CN112794900A - cBIN1 antibody and application thereof - Google Patents
cBIN1 antibody and application thereof Download PDFInfo
- Publication number
- CN112794900A CN112794900A CN202011626540.2A CN202011626540A CN112794900A CN 112794900 A CN112794900 A CN 112794900A CN 202011626540 A CN202011626540 A CN 202011626540A CN 112794900 A CN112794900 A CN 112794900A
- Authority
- CN
- China
- Prior art keywords
- antibody
- cbin1
- seq
- thr
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/46—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
- G01N2333/47—Assays involving proteins of known structure or function as defined in the subgroups
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/32—Cardiovascular disorders
- G01N2800/325—Heart failure or cardiac arrest, e.g. cardiomyopathy, congestive heart failure
Abstract
The invention relates to the technical field of immunization, in particular to a cBIN1 antibody and application thereof. The three CDR regions of the heavy chain of the cBIN1 antibody provided by the invention have amino acid sequences shown as SEQ ID NO. 1, 2 and 3 respectively; the three CDR regions of the light chain have amino acid sequences shown in SEQ ID NO 4, 5 and 6, respectively. The antibody has good binding capacity with antigen, and the reagent prepared by the antibody can realize accurate detection of target antigen.
Description
Technical Field
The invention relates to the technical field of immunization, in particular to a cBIN1 antibody and application thereof.
Background
Heart failure is a complex group of clinical syndromes caused by abnormal changes in the structure and/or function of the heart due to a variety of causes that cause dysfunction in the systolic and/or diastolic function of the ventricles. Heart failure is a severe manifestation or late stage of various heart diseases, with high mortality and readmission rates. The data of all places in recent years show that the prevalence rate of heart failure in China has increased remarkably to 2% -3%, and about 1000 ten thousand of patients with current symptoms.
Heart failure the heart muscle has its core pathological changes that the calcium ion transport capacity is weakened, causing the contraction capacity of the heart muscle to be limited. The cause of calcium ion transport impairment characteristic of heart failure is excitation-contraction (E-C) decoupling and asynchronous calcium release. Under physiological conditions, membrane potential depolarization induces synchronous calcium release, which allows calcium ions to pass through the cell membrane and triggers more calcium release in the sarcoplasmic reticulum, i.e., calcium-induced-calcium-release (CICR) process. The CICR process, both healthy and ideal, relies on the binding muscles located between the cardiomyocytesClose cooperation between ryanodine receptors (RyRs) on the serosal membranes and L-type calcium channels (LTCCs) on the transverse-tube (T-tube) membranes. LTCCs in the transverse tubule form dimeric complexes with RyRs on the sarcoplasmic omentum of the junction, which affect the transport of extra-cytosolic calcium ions. In the pathological hypertrophy process caused by the increase of pressure load of cardiac muscle due to various reasons, a great amount of transverse tubular structures are disordered and reconstructed, and simultaneously, the dimeric structures are damaged, finally, the asynchronous CICR process is caused, and the hypertrophy compensation is gradually developed into heart failure. In addition to a series of reconstructive changes in the morphology of the cross tubes during heart failure, the process of the damaged LTCC migrating to the cross tubes and forming binary complexes with RyRs is also disturbed, Ga2+The metastatic capacity decreases, which in turn leads to E-C decoupling and decreased cardiac function.
BIN protein (Bar protein coding gene) can be divided into Amphihysini I, AmpII (also called Bin1), Bin2 and Bin 3. As a protein superfamily containing BAR domains, Bin1 contains an N-terminal BAR domain (N-BAR) characterized by being encoded by exons 1-9. Interestingly, the gene of Bin1 with 20 exons had different cellular functions by generating different Bin1 proteins according to different splicing schemes. The myocardial transverse tubular heart bridging integrator 1 (cBIN 1) is a BIN1 protein subtype with 13 and 17 exons.
Research shows that the transverse tubular micro-domain formed by the cBIN1 has the function of promoting and maintaining the formation of the LTCC-RyR binary complex. The results of the current studies indicate that a microdomain that possesses cBin1 can promote the formation of an efficient LTCC-RyR binary complex through the following 4 mechanisms: 1) promoting forward transport of LTCCs through the microdomains; 2) promoting aggregation of LTCCs that have been transferred to the cross tubes into clusters; 3) forming a protective slow dispersion area of extracellular calcium ions in the transverse tubular cavity to control the transfer power of the LTCCs; 4) and the RyRs in the cytoplasm are recalled to meet the sarcoplasmic reticulum of the junction area, so that a new binary complex can be formed with the LTCCs. Meanwhile, the cBin1 micro-domain plays a role in maintaining the steady state of the transverse tube of the cardiac muscle through the capability of continuous membrane turnover and rapid recombination under acute stress stimulation. At the same time, studies have found that the cBin1 microdomain is lost due to reduced transcription of cBin1 under stimulation associated with heart failure, with concomitant reduction in binary complex formation and impairment of myocardial contractility. That is, as cBin1 expression decreases, the horizontal tube microdomain structure becomes disorganized, thereby reducing cardiac contractility and response to the beta receptor.
Thus, cBIN1 is expected to be a novel marker of heart failure. If the expression level of cBIN1 in cardiac muscle or blood can be effectively detected, the structural integrity and the functional state of the heart can be objectively evaluated, an objective and reliable basis is provided for the evaluation and treatment of heart failure, and the treatment of the heart failure is guided. The development of sensitive antibodies for detecting cBIN1 can effectively facilitate the detection and evaluation of the marker, and provide a new reliable reference for clinical diagnosis and treatment of heart failure.
Disclosure of Invention
In view of the above, the technical problem to be solved by the present invention is to provide cBIN1 antibody and its application.
The invention provides a cBIN1 antibody, wherein the heavy chain comprises three CDR regions, wherein the amino acid sequence of at least one CDR region has the amino acid sequence shown as SEQ ID NO. 1, 2 or 3, or a sequence with at least 80% sequence homology; the light chain comprises three CDR regions, wherein the amino acid sequence of at least one CDR region has the amino acid sequence shown as SEQ ID NO. 4, 5 or 6, or a sequence with at least 80% of sequence homology with the CDR regions.
In the present invention, the three CDR regions of the heavy chain of the cBIN1 antibody have the amino acid sequences shown in SEQ ID NO 1, 2 and 3, respectively; the three CDR regions of the light chain have amino acid sequences shown in SEQ ID NO 4, 5 and 6, respectively.
In some embodiments of the invention, the amino acid sequences of the three CDR regions of the heavy chain of cBIN1 antibody are set forth in SEQ ID NOs 1, 2, and 3, respectively; the amino acid sequences of the three CDR regions of the light chain are shown in SEQ ID NO 4, 5 and 6 in sequence.
Wherein, the sequence shown in SEQ ID NO. 1 is GFNIKDS;
the sequence shown in SEQ ID NO. 2 is DPEDDD;
the sequence shown in SEQ ID NO. 3 is STLVATPWFFDV;
the sequence shown in SEQ ID NO. 4 is SASQDINNYLN;
the sequence shown in SEQ ID NO. 5 is YTSTLHS;
the sequence shown in SEQ ID NO. 6 is QQYTHNLPWT.
The cBIN1 antibody provided by the invention has a heavy chain comprising 4 FR regions, wherein the amino acid sequence of at least one FR region has the amino acid sequence shown as SEQ ID NO. 9, 10, 11 or 12, or a sequence with at least 80% sequence homology with the FR region; the light chain comprises 4 FR regions, wherein the amino acid sequence of at least one FR region has the amino acid sequence shown as SEQ ID NO 13, 14, 15 or 16, or a sequence with at least 80% of sequence homology with the FR region.
In the present invention, 4 FR regions of the heavy chain of the cBIN1 antibody respectively have amino acid sequences shown as SEQ ID NO. 9, 10, 11 or 12; the 4 FR regions of the light chain have amino acid sequences shown as SEQ ID NO 13, 14, 15 and 16 respectively.
In some embodiments of the invention, the amino acid sequences of the 4 FR regions of the heavy chain of the cBIN1 antibody are set forth in SEQ ID NOs 9, 10, 11, or 12, sequentially; the amino acid sequences of the 4 FR regions of the light chain are shown in SEQ ID NO 13, 14, 15 and 16.
Wherein the sequence shown in SEQ ID NO. 9 is EVQLQQSGAELVRPGASVKLSCTTS;
10 is YMHWVKQRPEQGLEWIGRI;
the sequence shown as SEQ ID NO. 11 is AVYAPKFQDRATMTADTSSNTAYLHLS SLTSDDTAVYYCTT;
the sequence shown as SEQ ID NO. 12 is WGTGTTVTVSS;
the sequence shown as SEQ ID NO. 13 is DIQMTQTTSSLSASLGDRVTISC;
the sequence shown in SEQ ID NO. 14 is WYQQKPDGTVKLLIY.
The sequence shown as SEQ ID NO. 15 is VPSRFSGSGSGTDYSLTITNLE PEDFATYYC;
the sequence shown in SEQ ID NO 16 is FGGGTKLEIK.
In the present invention, the sequence having at least 80% sequence homology is an amino acid sequence obtained by substituting, deleting or adding one or more amino acids from the original sequence, wherein the plurality is 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40 or 41.
In some embodiments, the heavy chain variable region of the cBIN1 antibody of the invention has the amino acid sequence shown in SEQ ID NO. 7; the light chain variable region has an amino acid sequence shown as SEQ ID NO. 8.
The invention also provides nucleotides encoding the antibodies.
The invention provides nucleotide sequences encoding the heavy chains of the antibodies.
The invention provides nucleotide sequences encoding the light chain of the antibody.
In the invention, the nucleotide for coding the heavy chain variable region of the antibody has a nucleotide sequence shown in SEQ ID NO. 17, or a nucleotide sequence which is obtained by substituting, deleting or adding one or more nucleotides and has the same or similar functions with the nucleotide sequence shown in SEQ ID NO. 17.
In some embodiments of the invention, the nucleotide sequence encoding the variable region of the antibody heavy chain is shown in SEQ ID NO. 17 or is the reverse complement of SEQ ID NO. 17.
In the invention, the nucleotide for coding the variable region of the antibody light chain has a nucleotide sequence shown in SEQ ID NO. 18, or a nucleotide sequence which is obtained by substituting, deleting or adding one or more nucleotides and has the same or similar functions with the nucleotide sequence shown in SEQ ID NO. 18.
In some embodiments of the invention, the nucleotide sequence encoding the variable region of the antibody light chain is as shown in SEQ ID NO. 18 or the reverse complement of SEQ ID NO. 18.
The invention also provides an expression vector comprising a nucleotide encoding the cBIN1 antibody of the invention.
The invention also provides a host cell transformed or transfected with the expression vector.
The preparation method of the cBIN1 antibody comprises the following steps: culturing the host cell of the invention and inducing the expression of the cBIN1 antibody.
The invention also provides said cBIN1 antibody, chemically or biologically labeled.
In the present invention, the chemical label is an isotope, an immunotoxin and/or a chemical drug; the biomarker is a biotin, avidin, or enzyme label. The enzyme label is preferably horseradish peroxidase or alkaline phosphatase. The immunotoxin is preferably aflatoxin, diphtheria toxin, pseudomonas aeruginosa exotoxin, ricin, abrin, mistletoe agglutinin, modeccin, PAP, nystatin, gelonin or luffa toxin.
The invention also provides a conjugate prepared by coupling the cBIN1 antibody with a solid medium or a semisolid medium. The solid medium or non-solid medium in the invention is selected from colloidal gold, polystyrene flat plate or bead.
The cBIN1 antibody or the conjugate is applied to preparation of products for detecting cBIN1 expression.
The invention also provides a kit comprising the cBIN1 antibody or the conjugate.
The kit also comprises an ELISA detection reagent or a Western Blot detection reagent.
The invention also provides a method for detecting the cBIN1, which adopts the kit provided by the invention to detect the cBIN1 in a sample by an ELISA method or a Western Blot method. The sample is a cardiac muscle sample or a blood sample.
The invention also provides a diagnostic method of heart failure, namely, the cBIN1 in the cardiac muscle or blood sample is detected by ELISA method or WesternBlot method by using the kit provided by the invention. The sample is a cardiac muscle sample or a blood sample.
The three CDR regions of the heavy chain of the cBIN1 antibody provided by the invention have amino acid sequences shown as SEQ ID NO. 1, 2 and 3 respectively; the three CDR regions of the light chain have amino acid sequences shown in SEQ ID NO 4, 5 and 6, respectively. The antibody has good binding capacity with antigen, and the reagent prepared by the antibody can realize accurate detection of target antigen.
Drawings
FIG. 1 shows ELISA binding curves of antibodies to cBIN1 Isoform II2 and cBIN1 Isoform II 3;
FIG. 2 shows the effect of antibody binding to protein in WB assay.
Detailed Description
The invention provides cBIN1 antibody and application thereof, and a person skilled in the art can realize the antibody by appropriately modifying process parameters according to the content in the specification. It is expressly intended that all such similar substitutes and modifications which would be obvious to one skilled in the art are deemed to be included in the invention. While the methods and applications of this invention have been described in terms of preferred embodiments, it will be apparent to those of ordinary skill in the art that variations and modifications in the methods and applications described herein, as well as other suitable variations and combinations, may be made to implement and use the techniques of this invention without departing from the spirit and scope of the invention.
Unless otherwise indicated, the molecular biological experimental methods and immunoassay methods used in the present invention are essentially described by reference to j.sambrook et al, molecular cloning: a laboratory manual, 2 nd edition, cold spring harbor laboratory Press, 1989, and F.M. Ausubel et al, eds. molecular biology laboratory Manual, 3 rd edition, John Wiley & Sons, Inc., 1995; the use of restriction enzymes follows the conditions recommended by the product manufacturer. The examples are given by way of illustration and are not intended to limit the scope of the invention as claimed.
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. With regard to the definitions and terminology in this field, the expert can refer in particular to Current Protocols in Molecular Biology (Ausubel). The abbreviations for amino acid residues are standard 3-letter and/or 1-letter codes used in the art to refer to one of the 20 commonly used L-amino acids.
The term "antibody" refers to a protein composed of one or more polypeptides capable of specifically binding to an antigen. One form of antibody constitutes the basic building block of an antibody. This form is a tetramer, which is composed of two identical pairs of antibody chains, each pair having a light chain and a heavy chain. In each pair of antibody chains, the variable regions of the light and heavy chains are joined together and are responsible for binding to antigen, while the constant regions are responsible for the effector functions of the antibody.
The "variable region" of the heavy or light chain of the antibody is the N-terminal mature region of the chain. The types of antibodies currently known include kappa and lambda light chains, as well as alpha, gamma (IgG1, IgG2, IgG3, IgG4), delta, epsilon and mu heavy chains or other type equivalents thereof. Full-length immunoglobulin "light chains" (about 25kDa or about 214 amino acids) comprise a single NH domain2A variable region of approximately 110 amino acids at the end, and a kappa or lambda constant region at the COOH-terminus. The full-length immunoglobulin "heavy chain" (about 50kDa or about 446 amino acids) likewise comprises a variable region (about 116 amino acids), and one of the heavy chain constant regions, e.g., gamma (about 330 amino acids).
"antibody" includes any isotype of antibody or immunoglobulin, or antibody fragments that retain specific binding to an antigen, including but not limited to Fab, Fv, scFv, and Fd fragments, chimeric antibodies, humanized antibodies, single chain antibodies, and fusion proteins comprising an antigen-binding portion of an antibody and a non-antibody protein. The antibody may be labeled and detected, for example, by a radioisotope, an enzyme capable of producing a detectable substance, a fluorescent protein, biotin, or the like. The antibodies can also be bound to a solid support, including but not limited to polystyrene plates or beads, and the like.
As used herein, "CDR region" or "CDR" refers to the hypervariable regions of the heavy and light chains of an immunoglobulin, as defined by Kabat et al (Kabat et al, Sequences of proteins of immunological interest,5th Ed., U.S. department of Health and Human Services, NIH,1991, and later). There are three heavy chain CDRs and three light chain CDRs. As used herein, the term CDR or CDRs is intended to indicate one of these regions, or several or even all of these regions, which comprise the majority of the amino acid residues responsible for binding by the affinity of the antibody for the antigen or its recognition epitope, as the case may be.
The test materials adopted by the invention are all common commercial products and can be purchased in the market. The invention is further illustrated by the following examples:
example 1: synthesis of antigens for immunization
The antigen is a protein sequence LRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQ corresponding to exon13 (cBIN1 exon13) of a humanized Cardiac recognition integrator 1, a polypeptide Gill biochemistry company for immunization is synthesized by a Guo chemical method, and in order to improve the immunogenicity of the antigen, the C end of the polypeptide is coupled with Keyhole Limpet Hemocyanin (KLH) through distearate (PEG 4).
Example 2: production of anti-human cBIN1 exon13 antibody
To obtain murine anti-human cBIN1 exon13 antibodies, different strains of mice (Balb/c, shanghai chang bio; SJL, beijing vinifera) were immunized using the immunization strategy in table 1.1 (table 1). The antigen used was as described in example 1; adjuvants include: complete Freund's adjuvant CFA (InvivoGen, cat # vac-CFA-60), IFA (InvivoGen, cat # vac-IFA-60). Splenocytes from immunized mice were fused with mouse myeloma cells SP2/0 using the polyethylene glycol method 3 days after the final immunization to obtain B-cells that both express antibodies and proliferate indefinitely in vitro, and were cultured in HAT selective medium. The fused hybridoma cells were plated in 96-well cell culture plates and positive clones were selected by primary screening for 2 rounds of subcloning.
TABLE 1 immunization strategy
Example 3: determination of sequence of variable region of anti-human cBIN1 exon13 antibody
Hybridoma cells were collected by centrifugation at 5X 106~10×106Adding 1ml of TRIzol and 0.2ml of chloroform into the cells, vigorously shaking for 15 seconds, standing at room temperature for 3 minutes, centrifuging, adding 0.5ml of isopropanol into the water phase, standing at room temperature for 10 minutes, collecting the precipitate, washing with ethanol, and drying to obtain RNA. Adding template RNA and primers into an ice bath centrifuge tube, correctly matching the primers and the template, performing reverse transcription, and performing PCR amplification. dNTP/ddNTP mixtures 2.5. mu.l are added into 4 microcentrifuge tubes respectively, and the mixtures are subjected to warm bath at 37 ℃ for 5min for standby. 1pmol of PCR amplified double-stranded DNA,10pmol of sequencing primer, 2. mu.l of 5 Xsequencing buffer were added to an empty microcentrifuge tube, double distilled water was added to a total volume of 10. mu.l, heating was carried out at 96 ℃ for 8min, cooling was carried out in ice bath for 1min, and centrifugation was carried out at 4 ℃ for 10s at 10000 g. Mu.l of a pre-cooled labeling mix (dCTP, dGTP, dTTP 0.75. mu. mol/L each), alpha-32P-dATP 5. mu. Ci, 1. mu.l of 0.1mol/L DDT, sequencer enzyme 2U, water to 15. mu.l, mixed well and placed on ice for 2min to label the newly synthesized DNA strand. Mu.l of the labeled reaction mixture was added to 4 prepared microcentrifuge tubes and incubated at 37 ℃ for 5min, 4. mu.l of stop buffer was added to each tube. Samples were heat denatured in a water bath at 80 ℃ for 5min, 2. mu.l of each lane was applied to the sequencing gel, the fragments were electrophoretically separated, and sequence information was collected.
The VH and VL sequences of the murine antibody (8G1-D7-F5) were obtained as shown in the table below. Further, the CDR Sequences of murine mAb were determined using the method described by Kabat et al (Kabat et al, Sequences of Proteins of Immunological Interest, fifth edition, Public Health Service, national institutes of Health, Besseda, Maryland (1991), p.647-669).
TABLE 2 sequence information of murine antibodies
TABLE 3 antibody sequences
4: evaluation of binding Activity of anti-human cBIN1 exon13 antibody
4.1 binding Activity of antibody (8G1-D7-F5) in enzyme-linked immunosorbent (ELISA)
The antibody was diluted at 11 spots in a three-fold dilution at the starting concentration of 10. mu.g/ml. Proteins cBIN1 Isoform II2(cBIN1 exon1-13&18-20) and cBIN1 Isoform II3(cBIN1 exon 1-12&18-20) which are recombinantly expressed by GyKa Genencor Chemie GmbH were used as coating antigens, respectively, and the coating plates were coated at 0.1. mu.g/well. Diluted antibodies were added to an Elisa plate at 100ul per well. Incubate for 1h at room temperature and wash the plate. Diluting the secondary antibody according to the ratio of 1:10000, adding 100ul of secondary antibody into each hole, incubating for 1h at room temperature, and washing the plate. Mixing TMBA solution and B solution at a ratio of 1:1, incubating at room temperature for 5min per well at 100ul for color development. After the color development was complete, 50ul of 2% H2SO4 was added to each well to stop the reaction and the OD450 was read. GraphPadPrism 6 analyzes the data and calculates EC50 values for antibody binding to cBIN1 Isoform II2 and cBIN1 Isoform II 3. The antibody binding curves are shown in figure 1, and the binding EC50 for the antibody and both proteins is shown in table 3.
TABLE 3 ESLIA binding of antibody to antigen EC50(μ g/ml)
Antibodies | cBIN1IsoformII2 | cBIN1IsoformII3 |
8G1-D7-F5 | 0.058 | Is not combined with |
Positive control antibody | 0.614 |
Antibody 8G1-D7-F5 bound with high affinity to cBIN1 Isoform II2 protein containing exon13 and did not bind to cBIN1 Isoform II3 protein lacking exon13, indicating that antibody 8G1-D7-F5 binds cBIN in the region corresponding to its exon 13. The binding activity of the antibody 8G1-D7-F5 in ELISA was 11-12 times higher than that of the positive control antibody (Novus, NBP 2-21689).
4.2 antibody binding Activity in immunoblotting experiments (WB)
Proteins were electrophoresed on 12% SDS-PAGE for 1 hour at 120mA current using cBIN1 Isoform II2(cBIN1 exon1-13&18-20) which is a protein recombinantly expressed by GmbH GeneChemie, Inc. After the electrophoresis is finished, the protein is transferred to the PVDF membrane by using a transfer electrophoresis device and electrotransfer for 150min under the constant current condition of 300mA at 4 ℃. Primary antibody incubation was performed at a concentration of 10. mu.g/ml using antibodies 1F3-D11-B and positive control antibody (Novus, NBP2-21689), respectively, with the blocked PVDF membrane at room temperature for 2 hours, after washing, with secondary antibody, with PVDF membrane at room temperature for 1.5 hours, after thorough washing, and development. The results are shown in FIG. 2. As shown in fig. 2, antibody 8G1-D7-F5 binds cBIN1 Isoform II2 protein containing exon13 with high affinity in WB, and the amount of binding of antibody 8G1-D7-F5 is significantly higher than that of the positive control antibody (Novus, NBP 2-21689).
The foregoing is only a preferred embodiment of the present invention, and it should be noted that it is obvious to those skilled in the art that various modifications and improvements can be made without departing from the principle of the present invention, and these modifications and improvements should also be considered as the protection scope of the present invention.
Sequence listing
<110> Xiangya II Hospital of Zhongnan university
<120> cBIN1 antibody and application thereof
<130> MP2037306
<160> 18
<170> SIPOSequenceListing 1.0
<210> 1
<211> 7
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 1
Gly Phe Asn Ile Lys Asp Ser
1 5
<210> 2
<211> 6
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 2
Asp Pro Glu Asp Asp Asp
1 5
<210> 3
<211> 12
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 3
Ser Thr Leu Val Ala Thr Pro Trp Phe Phe Asp Val
1 5 10
<210> 4
<211> 11
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 4
Ser Ala Ser Gln Asp Ile Asn Asn Tyr Leu Asn
1 5 10
<210> 5
<211> 7
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 5
Tyr Thr Ser Thr Leu His Ser
1 5
<210> 6
<211> 10
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 6
Gln Gln Tyr Thr His Asn Leu Pro Trp Thr
1 5 10
<210> 7
<211> 121
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 7
Glu Val Gln Leu Gln Gln Ser Gly Ala Glu Leu Val Arg Pro Gly Ala
1 5 10 15
Ser Val Lys Leu Ser Cys Thr Thr Ser Gly Phe Asn Ile Lys Asp Ser
20 25 30
Tyr Met His Trp Val Lys Gln Arg Pro Glu Gln Gly Leu Glu Trp Ile
35 40 45
Gly Arg Ile Asp Pro Glu Asp Asp Asp Ala Val Tyr Ala Pro Lys Phe
50 55 60
Gln Asp Arg Ala Thr Met Thr Ala Asp Thr Ser Ser Asn Thr Ala Tyr
65 70 75 80
Leu His Leu Ser Ser Leu Thr Ser Asp Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Thr Thr Ser Thr Leu Val Ala Thr Pro Trp Phe Phe Asp Val Trp Gly
100 105 110
Thr Gly Thr Thr Val Thr Val Ser Ser
115 120
<210> 8
<211> 108
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 8
Asp Ile Gln Met Thr Gln Thr Thr Ser Ser Leu Ser Ala Ser Leu Gly
1 5 10 15
Asp Arg Val Thr Ile Ser Cys Ser Ala Ser Gln Asp Ile Asn Asn Tyr
20 25 30
Leu Asn Trp Tyr Gln Gln Lys Pro Asp Gly Thr Val Lys Leu Leu Ile
35 40 45
Tyr Tyr Thr Ser Thr Leu His Ser Gly Val Pro Ser Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Asp Tyr Ser Leu Thr Ile Thr Asn Leu Glu Pro
65 70 75 80
Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Thr His Asn Leu Pro
85 90 95
Trp Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys
100 105
<210> 9
<211> 25
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 9
Glu Val Gln Leu Gln Gln Ser Gly Ala Glu Leu Val Arg Pro Gly Ala
1 5 10 15
Ser Val Lys Leu Ser Cys Thr Thr Ser
20 25
<210> 10
<211> 19
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 10
Tyr Met His Trp Val Lys Gln Arg Pro Glu Gln Gly Leu Glu Trp Ile
1 5 10 15
Gly Arg Ile
<210> 11
<211> 41
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 11
Ala Val Tyr Ala Pro Lys Phe Gln Asp Arg Ala Thr Met Thr Ala Asp
1 5 10 15
Thr Ser Ser Asn Thr Ala Tyr Leu His Leu Ser Ser Leu Thr Ser Asp
20 25 30
Asp Thr Ala Val Tyr Tyr Cys Thr Thr
35 40
<210> 12
<211> 11
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 12
Trp Gly Thr Gly Thr Thr Val Thr Val Ser Ser
1 5 10
<210> 13
<211> 23
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 13
Asp Ile Gln Met Thr Gln Thr Thr Ser Ser Leu Ser Ala Ser Leu Gly
1 5 10 15
Asp Arg Val Thr Ile Ser Cys
20
<210> 14
<211> 15
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 14
Trp Tyr Gln Gln Lys Pro Asp Gly Thr Val Lys Leu Leu Ile Tyr
1 5 10 15
<210> 15
<211> 32
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 15
Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Tyr Ser
1 5 10 15
Leu Thr Ile Thr Asn Leu Glu Pro Glu Asp Phe Ala Thr Tyr Tyr Cys
20 25 30
<210> 16
<211> 10
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 16
Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys
1 5 10
<210> 17
<211> 363
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<400> 17
gaggttcagc tgcagcagtc tggggcagag cttgtgaggc caggggcctc agtcaagttg 60
tcctgcacaa cttctggctt caacattaaa gactcctata tgcactgggt gaagcagagg 120
cctgaacagg gcctggagtg gattggaagg attgatcctg aggatgatga tgctgtatac 180
gccccgaagt tccaggacag ggccactatg actgcagaca catcctccaa cacagcctat 240
ctgcacctca gcagcctgac atctgacgac actgccgtct attactgtac tacatctacg 300
ctagtagcca cgccctggtt cttcgatgtc tggggcacag ggaccacggt caccgtctcc 360
tca 363
<210> 18
<211> 324
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<400> 18
gatatccaga tgacacagac tacatcctcc ctgtctgcct ctctgggaga cagagtcacc 60
atcagttgca gtgcaagtca ggacattaac aattacttaa actggtatca gcagaaacca 120
gatggcactg ttaaactcct gatttattac acatcaactt tacactcagg agtcccgtca 180
aggttcagtg gcagtgggtc tgggacagat tattctctca ccatcaccaa cctggagcct 240
gaagattttg ccacttacta ttgtcaacag tatactcata accttccgtg gacgttcggt 300
ggaggcacca agctggaaat caaa 324
Claims (10)
- A cBIN1 antibody characterized in that,the three CDR regions of the heavy chain have amino acid sequences shown as SEQ ID NO 1, 2 and 3 respectively;the three CDR regions of the light chain have amino acid sequences shown in SEQ ID NO 4, 5 and 6 respectively.
- 2. The cBIN1 antibody of claim 1,the heavy chain variable region has an amino acid sequence shown as SEQ ID NO. 7;the light chain variable region has an amino acid sequence shown as SEQ ID NO. 8.
- 3. A nucleotide encoding the antibody of claim 1 or 2.
- 4. An expression vector comprising the nucleotide of claim 3.
- 5. A host cell transformed or transfected with the expression vector of claim 4.
- 6. A method of producing the cBIN1 antibody of claim 1 or 2, comprising: culturing the host cell of claim 5 to induce expression of cBIN1 antibody.
- 7. The cBIN1 antibody of claim 1 or 2 that is chemically or biologically labeled.
- 8. A conjugate prepared by conjugating the cBIN1 antibody of claim 1, 2 or 7 to a solid or semi-solid medium.
- 9. Use of the cBIN1 antibody of claim 1, 2 or 7 or the conjugate of claim 8 in the preparation of a product for detecting the expression of cBIN 1.
- 10. A kit comprising the cBIN1 antibody of claim 1, 2 or 7 or the conjugate of claim 8.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202011626540.2A CN112794900B (en) | 2020-12-31 | 2020-12-31 | cBIN1 antibodies and uses thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202011626540.2A CN112794900B (en) | 2020-12-31 | 2020-12-31 | cBIN1 antibodies and uses thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CN112794900A true CN112794900A (en) | 2021-05-14 |
CN112794900B CN112794900B (en) | 2022-10-25 |
Family
ID=75807856
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202011626540.2A Active CN112794900B (en) | 2020-12-31 | 2020-12-31 | cBIN1 antibodies and uses thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN112794900B (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN112592403A (en) * | 2020-12-31 | 2021-04-02 | 中南大学湘雅二医院 | cBIN1 antibody and application thereof |
Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6162601A (en) * | 1997-08-08 | 2000-12-19 | Incyte Pharmaceuticals, Inc. | Human pinin splice variant |
CN1878795A (en) * | 2002-12-02 | 2006-12-13 | 阿布格尼克斯公司 | Antibodies directed to phospholipase A2 and uses thereof |
WO2012087437A2 (en) * | 2010-11-09 | 2012-06-28 | Sarcotein Diagnostics Llc | Bin1 expression as a marker of skeletal muscle mass and neurological conditions |
WO2013049666A1 (en) * | 2011-09-30 | 2013-04-04 | Sarcotein Diagnostics, Llc | Bin1 expression as a marker of cancer |
WO2013053741A1 (en) * | 2011-10-14 | 2013-04-18 | Centre National De La Recherche Scientifique (Cnrs) | Anti-spla2-v antibodies and uses thereof |
WO2018035710A1 (en) * | 2016-08-23 | 2018-03-01 | Akeso Biopharma, Inc. | Anti-ctla4 antibodies |
-
2020
- 2020-12-31 CN CN202011626540.2A patent/CN112794900B/en active Active
Patent Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6162601A (en) * | 1997-08-08 | 2000-12-19 | Incyte Pharmaceuticals, Inc. | Human pinin splice variant |
CN1878795A (en) * | 2002-12-02 | 2006-12-13 | 阿布格尼克斯公司 | Antibodies directed to phospholipase A2 and uses thereof |
WO2012087437A2 (en) * | 2010-11-09 | 2012-06-28 | Sarcotein Diagnostics Llc | Bin1 expression as a marker of skeletal muscle mass and neurological conditions |
WO2013049666A1 (en) * | 2011-09-30 | 2013-04-04 | Sarcotein Diagnostics, Llc | Bin1 expression as a marker of cancer |
WO2013053741A1 (en) * | 2011-10-14 | 2013-04-18 | Centre National De La Recherche Scientifique (Cnrs) | Anti-spla2-v antibodies and uses thereof |
WO2018035710A1 (en) * | 2016-08-23 | 2018-03-01 | Akeso Biopharma, Inc. | Anti-ctla4 antibodies |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN112592403A (en) * | 2020-12-31 | 2021-04-02 | 中南大学湘雅二医院 | cBIN1 antibody and application thereof |
CN112592403B (en) * | 2020-12-31 | 2022-04-15 | 中南大学湘雅二医院 | cBIN1 antibody and application thereof |
Also Published As
Publication number | Publication date |
---|---|
CN112794900B (en) | 2022-10-25 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP1165616B1 (en) | Monoclonal antibodies, antigens and diagnosis and therapy of malignant diseases | |
US5891996A (en) | Humanized and chimeric monoclonal antibodies that recognize epidermal growth factor receptor (EGF-R); diagnostic and therapeutic use | |
TW201837056A (en) | B7-h3 antibody, antigen-binding fragment thereof and medical application thereof | |
CN113912710B (en) | Monoclonal antibody for resisting novel coronavirus N protein and application thereof | |
CN114437213B (en) | Monoclonal antibody of resisting fluogesterone acetate and application thereof | |
WO2016104439A1 (en) | Anti-active gip antibody | |
KR20200022479A (en) | Chimeric Antibodies for the Treatment of Amyloid Deposition Disease | |
CN112794900B (en) | cBIN1 antibodies and uses thereof | |
CN112592403B (en) | cBIN1 antibody and application thereof | |
CN109535255B (en) | Anti-human CD26 antibody and application thereof in detection kit | |
CN112778414B (en) | cBIN1 antibody and application thereof | |
CN111763255B (en) | Genetically modified VEGFA protein, monoclonal antibody thereof and application | |
CN114560940B (en) | SIRP alpha resisting rabbit recombinant monoclonal antibody, and preparation method and application thereof | |
JP4059404B2 (en) | Antibodies with activity to stimulate thyroid function | |
JP3920556B2 (en) | Abbreviated midkine (tMK) protein-specific monoclonal antibody and use thereof | |
CN114456265B (en) | anti-HFABP monoclonal antibody and application thereof | |
CN111349157B (en) | Monoclonal antibody of cadherin 6 and application thereof | |
CN110483641B (en) | Monoclonal antibody of interferon inducible GTPase and application thereof | |
CN111349169B (en) | Monoclonal antibody of Werner syndrome ATP dependent helicase and application thereof | |
RU2499000C1 (en) | VARIABLE DOMAINS OF LIGHT AND HEAVY CHAIN OF MURINE MONOCLONAL ANTIBODY AGAINST TUMOUR NECROSIS FACTOR ALPHA (TNF-α) OF HUMAN BEING (VERSIONS); ANTIGEN-BINDING FRAGMENT (Fab) AGAINST TNF-α OF HUMAN BEING, WHICH CONTAINS ABOVE SAID DOMAINS (VERSIONS) | |
WO2024067151A1 (en) | Anti-respiratory syncytial virus antibody and related use thereof | |
CN109709337B (en) | Immunohistochemical detection kit for human CD26 and clinical application thereof | |
CN109776679B (en) | Antibody of serine protease inhibitor SPINK1, and preparation method and application thereof | |
CN117700534A (en) | Antibody for resisting monkey poxvirus A35R protein and application thereof | |
Stillman et al. | Specific immunoglobulin cDNA clones produced from hybridoma cell lines and murine spleen fragment cultures by 3SR amplification. |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |