CN113912710B - Monoclonal antibody for resisting novel coronavirus N protein and application thereof - Google Patents
Monoclonal antibody for resisting novel coronavirus N protein and application thereof Download PDFInfo
- Publication number
- CN113912710B CN113912710B CN202111361909.6A CN202111361909A CN113912710B CN 113912710 B CN113912710 B CN 113912710B CN 202111361909 A CN202111361909 A CN 202111361909A CN 113912710 B CN113912710 B CN 113912710B
- Authority
- CN
- China
- Prior art keywords
- seq
- protein
- chain variable
- variable region
- monoclonal antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 108700002099 Coronavirus Nucleocapsid Proteins Proteins 0.000 title claims abstract description 30
- 238000001514 detection method Methods 0.000 claims abstract description 27
- 241000711573 Coronaviridae Species 0.000 claims abstract description 16
- 230000001900 immune effect Effects 0.000 claims abstract description 9
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 8
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 8
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 8
- 239000003153 chemical reaction reagent Substances 0.000 claims abstract description 7
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 8
- 239000002773 nucleotide Substances 0.000 claims description 12
- 125000003729 nucleotide group Chemical group 0.000 claims description 12
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 6
- 238000002360 preparation method Methods 0.000 claims description 6
- 230000035945 sensitivity Effects 0.000 abstract description 5
- 241000699666 Mus <mouse, genus> Species 0.000 description 28
- 101710141454 Nucleoprotein Proteins 0.000 description 28
- 150000001413 amino acids Chemical group 0.000 description 18
- 239000000427 antigen Substances 0.000 description 17
- 102000036639 antigens Human genes 0.000 description 17
- 108091007433 antigens Proteins 0.000 description 17
- 210000004027 cell Anatomy 0.000 description 17
- 241000699670 Mus sp. Species 0.000 description 15
- 201000003176 Severe Acute Respiratory Syndrome Diseases 0.000 description 15
- 230000003053 immunization Effects 0.000 description 13
- 239000002671 adjuvant Substances 0.000 description 11
- 108020004414 DNA Proteins 0.000 description 10
- 238000002649 immunization Methods 0.000 description 10
- 108090000623 proteins and genes Proteins 0.000 description 10
- 238000002965 ELISA Methods 0.000 description 9
- 238000002474 experimental method Methods 0.000 description 8
- 238000012216 screening Methods 0.000 description 8
- 206010003445 Ascites Diseases 0.000 description 7
- 241001678559 COVID-19 virus Species 0.000 description 7
- 238000000034 method Methods 0.000 description 7
- 238000005406 washing Methods 0.000 description 7
- 108090001074 Nucleocapsid Proteins Proteins 0.000 description 6
- 238000010790 dilution Methods 0.000 description 6
- 239000012895 dilution Substances 0.000 description 6
- 210000002966 serum Anatomy 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 5
- 210000004408 hybridoma Anatomy 0.000 description 5
- 230000002163 immunogen Effects 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- 102000004169 proteins and genes Human genes 0.000 description 5
- 239000002994 raw material Substances 0.000 description 5
- 241000700605 Viruses Species 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 238000011010 flushing procedure Methods 0.000 description 4
- 230000004927 fusion Effects 0.000 description 4
- 238000003119 immunoblot Methods 0.000 description 4
- 238000010166 immunofluorescence Methods 0.000 description 4
- 238000011068 loading method Methods 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 239000000523 sample Substances 0.000 description 4
- 238000012163 sequencing technique Methods 0.000 description 4
- 239000006228 supernatant Substances 0.000 description 4
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- 206010035226 Plasma cell myeloma Diseases 0.000 description 3
- 241000315672 SARS coronavirus Species 0.000 description 3
- 230000027455 binding Effects 0.000 description 3
- 239000011248 coating agent Substances 0.000 description 3
- 238000000576 coating method Methods 0.000 description 3
- 239000012634 fragment Substances 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 238000003317 immunochromatography Methods 0.000 description 3
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 201000000050 myeloid neoplasm Diseases 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 238000012795 verification Methods 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 108010065920 Insulin Lispro Proteins 0.000 description 2
- GILLQRYAWOMHED-DCAQKATOSA-N Lys-Val-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCCCN GILLQRYAWOMHED-DCAQKATOSA-N 0.000 description 2
- 208000025370 Middle East respiratory syndrome Diseases 0.000 description 2
- 241000127282 Middle East respiratory syndrome-related coronavirus Species 0.000 description 2
- 206010035664 Pneumonia Diseases 0.000 description 2
- VTFXTWDFPTWNJY-RHYQMDGZSA-N Pro-Leu-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O VTFXTWDFPTWNJY-RHYQMDGZSA-N 0.000 description 2
- FMDHKPRACUXATF-ACZMJKKPSA-N Ser-Gln-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O FMDHKPRACUXATF-ACZMJKKPSA-N 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- XFTYVCHLARBHBQ-FOHZUACHSA-N Thr-Gly-Asn Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O XFTYVCHLARBHBQ-FOHZUACHSA-N 0.000 description 2
- YUPVPKZBKCLFLT-QTKMDUPCSA-N Thr-His-Val Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](C(C)C)C(=O)O)N)O YUPVPKZBKCLFLT-QTKMDUPCSA-N 0.000 description 2
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 2
- 229910052782 aluminium Inorganic materials 0.000 description 2
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 2
- 238000011091 antibody purification Methods 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 239000007853 buffer solution Substances 0.000 description 2
- 210000005252 bulbus oculi Anatomy 0.000 description 2
- 230000007910 cell fusion Effects 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 108010054813 diprotin B Proteins 0.000 description 2
- 239000003480 eluent Substances 0.000 description 2
- 238000001976 enzyme digestion Methods 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 108010034529 leucyl-lysine Proteins 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 108010051242 phenylalanylserine Proteins 0.000 description 2
- 238000002331 protein detection Methods 0.000 description 2
- 210000004989 spleen cell Anatomy 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 108010033670 threonyl-aspartyl-tyrosine Proteins 0.000 description 2
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- YCRAFFCYWOUEOF-DLOVCJGASA-N Ala-Phe-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)C)CC1=CC=CC=C1 YCRAFFCYWOUEOF-DLOVCJGASA-N 0.000 description 1
- WQKAQKZRDIZYNV-VZFHVOOUSA-N Ala-Ser-Thr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O WQKAQKZRDIZYNV-VZFHVOOUSA-N 0.000 description 1
- GXXWTNKNFFKTJB-NAKRPEOUSA-N Arg-Ile-Ser Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O GXXWTNKNFFKTJB-NAKRPEOUSA-N 0.000 description 1
- HUZGPXBILPMCHM-IHRRRGAJSA-N Asn-Arg-Phe Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O HUZGPXBILPMCHM-IHRRRGAJSA-N 0.000 description 1
- HCAUEJAQCXVQQM-ACZMJKKPSA-N Asn-Glu-Asp Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O HCAUEJAQCXVQQM-ACZMJKKPSA-N 0.000 description 1
- YVXRYLVELQYAEQ-SRVKXCTJSA-N Asn-Leu-Lys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)N)N YVXRYLVELQYAEQ-SRVKXCTJSA-N 0.000 description 1
- MRQQMVZUHXUPEV-IHRRRGAJSA-N Asp-Arg-Phe Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O MRQQMVZUHXUPEV-IHRRRGAJSA-N 0.000 description 1
- SVFOIXMRMLROHO-SRVKXCTJSA-N Asp-Asp-Phe Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 SVFOIXMRMLROHO-SRVKXCTJSA-N 0.000 description 1
- NYQHSUGFEWDWPD-ACZMJKKPSA-N Asp-Gln-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CC(=O)O)N NYQHSUGFEWDWPD-ACZMJKKPSA-N 0.000 description 1
- AYFVRYXNDHBECD-YUMQZZPRSA-N Asp-Leu-Gly Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O AYFVRYXNDHBECD-YUMQZZPRSA-N 0.000 description 1
- CZIVKMOEXPILDK-SRVKXCTJSA-N Asp-Tyr-Ser Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(O)=O CZIVKMOEXPILDK-SRVKXCTJSA-N 0.000 description 1
- HTSSXFASOUSJQG-IHPCNDPISA-N Asp-Tyr-Trp Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O HTSSXFASOUSJQG-IHPCNDPISA-N 0.000 description 1
- ZUNMTUPRQMWMHX-LSJOCFKGSA-N Asp-Val-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(O)=O ZUNMTUPRQMWMHX-LSJOCFKGSA-N 0.000 description 1
- 208000025721 COVID-19 Diseases 0.000 description 1
- 101710132601 Capsid protein Proteins 0.000 description 1
- 102000010970 Connexin Human genes 0.000 description 1
- 108050001175 Connexin Proteins 0.000 description 1
- 102100031673 Corneodesmosin Human genes 0.000 description 1
- 101710139375 Corneodesmosin Proteins 0.000 description 1
- GEEXORWTBTUOHC-FXQIFTODSA-N Cys-Arg-Ser Chemical compound C(C[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CS)N)CN=C(N)N GEEXORWTBTUOHC-FXQIFTODSA-N 0.000 description 1
- OZHXXYOHPLLLMI-CIUDSAMLSA-N Cys-Lys-Ala Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O OZHXXYOHPLLLMI-CIUDSAMLSA-N 0.000 description 1
- ZGERHCJBLPQPGV-ACZMJKKPSA-N Cys-Ser-Gln Chemical compound C(CC(=O)N)[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CS)N ZGERHCJBLPQPGV-ACZMJKKPSA-N 0.000 description 1
- 101710091045 Envelope protein Proteins 0.000 description 1
- 101710204837 Envelope small membrane protein Proteins 0.000 description 1
- 241001198387 Escherichia coli BL21(DE3) Species 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- ZNZPKVQURDQFFS-FXQIFTODSA-N Gln-Glu-Ser Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O ZNZPKVQURDQFFS-FXQIFTODSA-N 0.000 description 1
- KHGGWBRVRPHFMH-PEFMBERDSA-N Gln-Ile-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)N)N KHGGWBRVRPHFMH-PEFMBERDSA-N 0.000 description 1
- LPIKVBWNNVFHCQ-GUBZILKMSA-N Gln-Ser-Leu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O LPIKVBWNNVFHCQ-GUBZILKMSA-N 0.000 description 1
- LKDIBBOKUAASNP-FXQIFTODSA-N Glu-Ala-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O LKDIBBOKUAASNP-FXQIFTODSA-N 0.000 description 1
- DLISPGXMKZTWQG-IFFSRLJSSA-N Glu-Thr-Val Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O DLISPGXMKZTWQG-IFFSRLJSSA-N 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- KRRMJKMGWWXWDW-STQMWFEESA-N Gly-Arg-Phe Chemical compound NC(=N)NCCC[C@H](NC(=O)CN)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 KRRMJKMGWWXWDW-STQMWFEESA-N 0.000 description 1
- BYYNJRSNDARRBX-YFKPBYRVSA-N Gly-Gln-Gly Chemical compound NCC(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O BYYNJRSNDARRBX-YFKPBYRVSA-N 0.000 description 1
- JJGBXTYGTKWGAT-YUMQZZPRSA-N Gly-Pro-Glu Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O JJGBXTYGTKWGAT-YUMQZZPRSA-N 0.000 description 1
- SOEGEPHNZOISMT-BYPYZUCNSA-N Gly-Ser-Gly Chemical compound NCC(=O)N[C@@H](CO)C(=O)NCC(O)=O SOEGEPHNZOISMT-BYPYZUCNSA-N 0.000 description 1
- DBUNZBWUWCIELX-JHEQGTHGSA-N Gly-Thr-Glu Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(O)=O DBUNZBWUWCIELX-JHEQGTHGSA-N 0.000 description 1
- XHVONGZZVUUORG-WEDXCCLWSA-N Gly-Thr-Lys Chemical compound NCC(=O)N[C@@H]([C@H](O)C)C(=O)N[C@H](C(O)=O)CCCCN XHVONGZZVUUORG-WEDXCCLWSA-N 0.000 description 1
- GBYYQVBXFVDJPJ-WLTAIBSBSA-N Gly-Tyr-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)CN)O GBYYQVBXFVDJPJ-WLTAIBSBSA-N 0.000 description 1
- FOCSWPCHUDVNLP-PMVMPFDFSA-N His-Trp-Tyr Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC3=CC=C(C=C3)O)C(=O)O)NC(=O)[C@H](CC4=CN=CN4)N FOCSWPCHUDVNLP-PMVMPFDFSA-N 0.000 description 1
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 1
- NCSIQAFSIPHVAN-IUKAMOBKSA-N Ile-Asn-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H]([C@@H](C)O)C(=O)O)N NCSIQAFSIPHVAN-IUKAMOBKSA-N 0.000 description 1
- GTSAALPQZASLPW-KJYZGMDISA-N Ile-His-Trp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](CC2=CNC3=CC=CC=C32)C(=O)O)N GTSAALPQZASLPW-KJYZGMDISA-N 0.000 description 1
- FADYJNXDPBKVCA-UHFFFAOYSA-N L-Phenylalanyl-L-lysin Natural products NCCCCC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FADYJNXDPBKVCA-UHFFFAOYSA-N 0.000 description 1
- UGTHTQWIQKEDEH-BQBZGAKWSA-N L-alanyl-L-prolylglycine zwitterion Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O UGTHTQWIQKEDEH-BQBZGAKWSA-N 0.000 description 1
- FQZPTCNSNPWHLJ-AVGNSLFASA-N Leu-Gln-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(O)=O FQZPTCNSNPWHLJ-AVGNSLFASA-N 0.000 description 1
- QVFGXCVIXXBFHO-AVGNSLFASA-N Leu-Glu-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O QVFGXCVIXXBFHO-AVGNSLFASA-N 0.000 description 1
- ZFNLIDNJUWNIJL-WDCWCFNPSA-N Leu-Glu-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O ZFNLIDNJUWNIJL-WDCWCFNPSA-N 0.000 description 1
- NRFGTHFONZYFNY-MGHWNKPDSA-N Leu-Ile-Tyr Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 NRFGTHFONZYFNY-MGHWNKPDSA-N 0.000 description 1
- KPYAOIVPJKPIOU-KKUMJFAQSA-N Leu-Lys-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(O)=O KPYAOIVPJKPIOU-KKUMJFAQSA-N 0.000 description 1
- ICYRCNICGBJLGM-HJGDQZAQSA-N Leu-Thr-Asp Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CC(O)=O ICYRCNICGBJLGM-HJGDQZAQSA-N 0.000 description 1
- LMDVGHQPPPLYAR-IHRRRGAJSA-N Leu-Val-His Chemical compound N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)O LMDVGHQPPPLYAR-IHRRRGAJSA-N 0.000 description 1
- GQFDWEDHOQRNLC-QWRGUYRKSA-N Lys-Gly-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN GQFDWEDHOQRNLC-QWRGUYRKSA-N 0.000 description 1
- KQAREVUPVXMNNP-WDSOQIARSA-N Lys-Trp-Met Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCSC)C(O)=O KQAREVUPVXMNNP-WDSOQIARSA-N 0.000 description 1
- 101710145006 Lysis protein Proteins 0.000 description 1
- 101710085938 Matrix protein Proteins 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 101710127721 Membrane protein Proteins 0.000 description 1
- SPSSJSICDYYTQN-HJGDQZAQSA-N Met-Thr-Gln Chemical compound CSCC[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CCC(N)=O SPSSJSICDYYTQN-HJGDQZAQSA-N 0.000 description 1
- 101900332836 Middle East respiratory syndrome-related coronavirus Nucleoprotein Proteins 0.000 description 1
- YBAFDPFAUTYYRW-UHFFFAOYSA-N N-L-alpha-glutamyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCC(O)=O YBAFDPFAUTYYRW-UHFFFAOYSA-N 0.000 description 1
- XMBSYZWANAQXEV-UHFFFAOYSA-N N-alpha-L-glutamyl-L-phenylalanine Natural products OC(=O)CCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 XMBSYZWANAQXEV-UHFFFAOYSA-N 0.000 description 1
- CUMXHKAOHNWRFQ-BZSNNMDCSA-N Phe-Asp-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=CC=C1 CUMXHKAOHNWRFQ-BZSNNMDCSA-N 0.000 description 1
- JJHVFCUWLSKADD-ONGXEEELSA-N Phe-Gly-Ala Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N[C@@H](C)C(O)=O JJHVFCUWLSKADD-ONGXEEELSA-N 0.000 description 1
- JMVQDLDPDBXAAX-YUMQZZPRSA-N Pro-Gly-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1 JMVQDLDPDBXAAX-YUMQZZPRSA-N 0.000 description 1
- VYWNORHENYEQDW-YUMQZZPRSA-N Pro-Gly-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1 VYWNORHENYEQDW-YUMQZZPRSA-N 0.000 description 1
- RMODQFBNDDENCP-IHRRRGAJSA-N Pro-Lys-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O RMODQFBNDDENCP-IHRRRGAJSA-N 0.000 description 1
- 229940096437 Protein S Drugs 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 101000933967 Pseudomonas phage KPP25 Major capsid protein Proteins 0.000 description 1
- 238000010802 RNA extraction kit Methods 0.000 description 1
- 101000702488 Rattus norvegicus High affinity cationic amino acid transporter 1 Proteins 0.000 description 1
- 206010057190 Respiratory tract infections Diseases 0.000 description 1
- 108091006197 SARS-CoV-2 Nucleocapsid Protein Proteins 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- YQHZVYJAGWMHES-ZLUOBGJFSA-N Ser-Ala-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YQHZVYJAGWMHES-ZLUOBGJFSA-N 0.000 description 1
- HBOABDXGTMMDSE-GUBZILKMSA-N Ser-Arg-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(O)=O HBOABDXGTMMDSE-GUBZILKMSA-N 0.000 description 1
- UIGMAMGZOJVTDN-WHFBIAKZSA-N Ser-Gly-Ser Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O UIGMAMGZOJVTDN-WHFBIAKZSA-N 0.000 description 1
- OQPNSDWGAMFJNU-QWRGUYRKSA-N Ser-Gly-Tyr Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 OQPNSDWGAMFJNU-QWRGUYRKSA-N 0.000 description 1
- XXXAXOWMBOKTRN-XPUUQOCRSA-N Ser-Gly-Val Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O XXXAXOWMBOKTRN-XPUUQOCRSA-N 0.000 description 1
- UIPXCLNLUUAMJU-JBDRJPRFSA-N Ser-Ile-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O UIPXCLNLUUAMJU-JBDRJPRFSA-N 0.000 description 1
- KCGIREHVWRXNDH-GARJFASQSA-N Ser-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CO)N KCGIREHVWRXNDH-GARJFASQSA-N 0.000 description 1
- PURRNJBBXDDWLX-ZDLURKLDSA-N Ser-Thr-Gly Chemical compound C[C@H]([C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](CO)N)O PURRNJBBXDDWLX-ZDLURKLDSA-N 0.000 description 1
- 101001024647 Severe acute respiratory syndrome coronavirus Nucleoprotein Proteins 0.000 description 1
- 101710198474 Spike protein Proteins 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- 102100021696 Syncytin-1 Human genes 0.000 description 1
- CAJFZCICSVBOJK-SHGPDSBTSA-N Thr-Ala-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CAJFZCICSVBOJK-SHGPDSBTSA-N 0.000 description 1
- DGDCHPCRMWEOJR-FQPOAREZSA-N Thr-Ala-Tyr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 DGDCHPCRMWEOJR-FQPOAREZSA-N 0.000 description 1
- KRPKYGOFYUNIGM-XVSYOHENSA-N Thr-Asp-Phe Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N)O KRPKYGOFYUNIGM-XVSYOHENSA-N 0.000 description 1
- OQCXTUQTKQFDCX-HTUGSXCWSA-N Thr-Glu-Phe Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N)O OQCXTUQTKQFDCX-HTUGSXCWSA-N 0.000 description 1
- XOTBWOCSLMBGMF-SUSMZKCASA-N Thr-Glu-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O XOTBWOCSLMBGMF-SUSMZKCASA-N 0.000 description 1
- MECLEFZMPPOEAC-VOAKCMCISA-N Thr-Leu-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)O)N)O MECLEFZMPPOEAC-VOAKCMCISA-N 0.000 description 1
- VRUFCJZQDACGLH-UVOCVTCTSA-N Thr-Leu-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O VRUFCJZQDACGLH-UVOCVTCTSA-N 0.000 description 1
- DEGCBBCMYWNJNA-RHYQMDGZSA-N Thr-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)[C@@H](C)O DEGCBBCMYWNJNA-RHYQMDGZSA-N 0.000 description 1
- BBPCSGKKPJUYRB-UVOCVTCTSA-N Thr-Thr-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O BBPCSGKKPJUYRB-UVOCVTCTSA-N 0.000 description 1
- JAWUQFCGNVEDRN-MEYUZBJRSA-N Thr-Tyr-Leu Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC(C)C)C(=O)O)N)O JAWUQFCGNVEDRN-MEYUZBJRSA-N 0.000 description 1
- LVRFMARKDGGZMX-IZPVPAKOSA-N Thr-Tyr-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)O)C(O)=O)CC1=CC=C(O)C=C1 LVRFMARKDGGZMX-IZPVPAKOSA-N 0.000 description 1
- AZBIIKDSDLVJAK-VHWLVUOQSA-N Trp-Ile-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)N AZBIIKDSDLVJAK-VHWLVUOQSA-N 0.000 description 1
- UPODKYBYUBTWSV-BZSNNMDCSA-N Tyr-Phe-Cys Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CS)C(O)=O)C1=CC=C(O)C=C1 UPODKYBYUBTWSV-BZSNNMDCSA-N 0.000 description 1
- WDIGUPHXPBMODF-UMNHJUIQSA-N Val-Glu-Pro Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N1CCC[C@@H]1C(=O)O)N WDIGUPHXPBMODF-UMNHJUIQSA-N 0.000 description 1
- DLMNFMXSNGTSNJ-PYJNHQTQSA-N Val-His-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](C(C)C)N DLMNFMXSNGTSNJ-PYJNHQTQSA-N 0.000 description 1
- WBAJDGWKRIHOAC-GVXVVHGQSA-N Val-Lys-Gln Chemical compound [H]N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(O)=O WBAJDGWKRIHOAC-GVXVVHGQSA-N 0.000 description 1
- ZRSZTKTVPNSUNA-IHRRRGAJSA-N Val-Lys-Leu Chemical compound CC(C)C[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)C(C)C)C(O)=O ZRSZTKTVPNSUNA-IHRRRGAJSA-N 0.000 description 1
- VHIZXDZMTDVFGX-DCAQKATOSA-N Val-Ser-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)N VHIZXDZMTDVFGX-DCAQKATOSA-N 0.000 description 1
- PZTZYZUTCPZWJH-FXQIFTODSA-N Val-Ser-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)O)N PZTZYZUTCPZWJH-FXQIFTODSA-N 0.000 description 1
- PGBMPFKFKXYROZ-UFYCRDLUSA-N Val-Tyr-Phe Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC2=CC=CC=C2)C(=O)O)N PGBMPFKFKXYROZ-UFYCRDLUSA-N 0.000 description 1
- 108020000999 Viral RNA Proteins 0.000 description 1
- 108010081404 acein-2 Proteins 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 108010069020 alanyl-prolyl-glycine Proteins 0.000 description 1
- 108010086434 alanyl-seryl-glycine Proteins 0.000 description 1
- 229940037003 alum Drugs 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 230000003698 anagen phase Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 244000309466 calf Species 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000013373 clone screening Methods 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- NKLPQNGYXWVELD-UHFFFAOYSA-M coomassie brilliant blue Chemical compound [Na+].C1=CC(OCC)=CC=C1NC1=CC=C(C(=C2C=CC(C=C2)=[N+](CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=2C=CC(=CC=2)N(CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=C1 NKLPQNGYXWVELD-UHFFFAOYSA-M 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 231100000517 death Toxicity 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 239000012470 diluted sample Substances 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 230000006806 disease prevention Effects 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 239000012149 elution buffer Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 239000006481 glucose medium Substances 0.000 description 1
- 108010057083 glutamyl-aspartyl-leucine Proteins 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 108010079413 glycyl-prolyl-glutamic acid Proteins 0.000 description 1
- 108010089804 glycyl-threonine Proteins 0.000 description 1
- 108010050848 glycylleucine Proteins 0.000 description 1
- 108010037850 glycylvaline Proteins 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 238000013537 high throughput screening Methods 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 108010005942 methionylglycine Proteins 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 108010024607 phenylalanylalanine Proteins 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000012113 quantitative test Methods 0.000 description 1
- 238000003753 real-time PCR Methods 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000007789 sealing Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 238000007447 staining method Methods 0.000 description 1
- 239000012089 stop solution Substances 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 229960003495 thiamine Drugs 0.000 description 1
- 239000011721 thiamine Substances 0.000 description 1
- 108010061238 threonyl-glycine Proteins 0.000 description 1
- 229940113082 thymine Drugs 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 108010038745 tryptophylglycine Proteins 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/577—Immunoassay; Biospecific binding assay; Materials therefor involving monoclonal antibodies binding reaction mechanisms characterised by the use of monoclonal antibodies; monoclonal antibodies per se are classified with their corresponding antigens
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/165—Coronaviridae, e.g. avian infectious bronchitis virus
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2469/00—Immunoassays for the detection of microorganisms
- G01N2469/10—Detection of antigens from microorganism in sample from host
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Virology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Analytical Chemistry (AREA)
- Organic Chemistry (AREA)
- Pathology (AREA)
- Biotechnology (AREA)
- Cell Biology (AREA)
- General Physics & Mathematics (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Tropical Medicine & Parasitology (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
The invention provides a monoclonal antibody for resisting novel coronavirus N protein and application thereof. The monoclonal antibodies include a heavy chain variable region and a light chain variable region. The heavy chain variable region comprises CDRH1 with an amino acid sequence shown as SEQ ID NO. 1, CDRH2 with an amino acid sequence shown as SEQ ID NO. 2 and CDRH3 with an amino acid sequence shown as SEQ ID NO. 3. The light chain variable region comprises a CDRL1 shown in SEQ ID NO. 4, a CDRL2 shown in SEQ ID NO. 5 and a CDRL3 shown in SEQ ID NO. 6. The invention also provides a nucleic acid molecule for encoding the monoclonal antibody, application of the monoclonal antibody in preparing a reagent for detecting the novel coronavirus N protein, and a kit for detecting the novel coronavirus comprising the monoclonal antibody. The monoclonal antibody has higher sensitivity and specificity, and can be applied to immunological detection.
Description
Technical Field
The invention relates to the technical field of biological medicines, in particular to a monoclonal antibody for resisting novel coronavirus N protein and application thereof.
Background
New coronavirus pneumonia caused by new coronaviruses is a public health problem of current global interest. On day 11 of 2 months 2020, this novel coronavirus was designated by the International Commission on the classification of viruses as SARS-CoV-2 (severe acute respiratory syndrome coronavirus 2, also known as 2019-nCoV (2019 novel coronavirus)), and on the same day, the world health organization designated the pneumonia infected with this virus as COVID-19.SARS-CoV-2 and Severe acute respiratory syndrome coronavirus (SARS-CoV), middle east respiratory syndrome coronavirus (MERS-CoV) are animal derived zoonotics. Although coronaviruses are often associated with acute respiratory infections in humans, their ability to infect a variety of host species makes them complex pathogens. The covd-19 pandemic caused by the novel coronavirus (SARS-CoV-2) is abused worldwide and causes millions of hospitalizations and deaths.
Thus, there is a need to establish a method for rapid screening and detection of novel coronaviruses for quarantine or treatment of infected individuals. Currently known detection methods include a real-time fluorescent quantitative PCR method, a serum antibody detection method, an antigen detection method, and the like. Wherein, the antigen detection method is to detect the corresponding antigen target of SARS-CoV-2 by monoclonal antibody, and is an accurate, rapid, simple and easy-to-use diagnosis method. Monoclonal antibodies, in turn, play an important role as core raw materials for antigen detection.
Disclosure of Invention
According to one aspect of the present application, there is provided a monoclonal antibody against a novel coronavirus N protein comprising a heavy chain variable region and a light chain variable region. The heavy chain variable region comprises CDRH1 with an amino acid sequence shown as SEQ ID NO. 1, CDRH2 with an amino acid sequence shown as SEQ ID NO. 2 and CDRH3 with an amino acid sequence shown as SEQ ID NO. 3. The light chain variable region comprises a CDRL1 shown in SEQ ID NO. 4, a CDRL2 shown in SEQ ID NO. 5 and a CDRL3 shown in SEQ ID NO. 6.
In some embodiments, the amino acid sequence of the heavy chain variable region is set forth in SEQ ID NO. 7 and the amino acid sequence of the light chain variable region is set forth in SEQ ID NO. 8.
According to another aspect of the present application, a nucleic acid molecule is provided. The nucleic acid molecule comprising a nucleotide sequence encoding a monoclonal antibody against a novel coronavirus N protein according to claim 1 or 2.
In some embodiments, the nucleotide sequences encoding CDRH1, CDRH2 and CDRH3 of the heavy chain variable region are shown as SEQ ID NO. 9, SEQ ID NO. 10 and SEQ ID NO. 11, respectively, and the nucleotide sequences encoding CDRL1, CDRL2 and CDRL3 of the light chain variable region are shown as SEQ ID NO. 12, SEQ ID NO. 13 and SEQ ID NO. 14, respectively.
In some embodiments, the nucleotide sequence encoding the heavy chain variable region is set forth in SEQ ID NO. 15 and the nucleotide sequence encoding the light chain variable region is set forth in SEQ ID NO. 16.
According to a further aspect of the present application there is provided the use of a monoclonal antibody as described above against a novel coronavirus N protein in the preparation of a reagent for detecting an anti-novel coronavirus N protein. The monoclonal antibody of the novel coronavirus N protein is used for immunological detection of novel coronaviruses.
According to yet another aspect of the present application, a kit for detecting a novel coronavirus is provided. The kit comprises the monoclonal antibody for resisting the novel coronavirus N protein.
Detailed Description
As used in this application and in the claims, the terms "a," "an," "the," and/or "the" are not specific to the singular, but may include the plural, unless the context clearly dictates otherwise. In general, the terms "comprises" and "comprising" merely indicate that the steps and elements are explicitly identified, and they do not constitute an exclusive list, as other steps or elements may be included in a method or apparatus.
2019-nCoV (SARS-CoV-2) has four major structural proteins: spike protein (also known as S protein), nucleocapsid protein (nucleocapsid protein, also known as N protein), membrane protein (also known as M protein) and envelope protein (also known as E protein).
The core protein of 2019-nCoV is the N protein. As one of the most important proteins within the viral nucleocapsid, the N protein is mainly responsible for the replicative function of RNA. N protein and viral genome RNA are intertwined to form a viral nucleocapsid, which plays an important role in the synthesis process of viral RNA. Meanwhile, N protein is relatively conserved, the proportion of the N protein in structural proteins of viruses is the largest, and the organism can generate high-level antibodies against the N protein in early infection.
Thus, the corresponding monoclonal antibody is prepared by using the N protein of 2019-nCoV as an antigen. Specifically, a prokaryotic expressed N protein is utilized to immunize a Balb/c mouse, spleen cells of the mouse are fused with myeloma cells, hybridoma cells with high specificity are obtained through specific high-throughput screening, a large amount of mouse ascites is obtained through culture and re-immunization, and then monoclonal antibodies with high titer, high purity, high sensitivity and high specificity, which are used for resisting novel coronavirus N proteins, are obtained through multi-step separation and purification. The anti-novel coronavirus monoclonal antibody can be used for immunological detection such as ELISA, immunochromatography, immunoblotting, immunofluorescence and the like, and provides a required raw material for immunological detection reagents (for example, an N protein detection immunoassay test strip). The detection kit developed by taking the antibody as a raw material has good application value.
The monoclonal antibody may include a heavy chain variable region and a light chain variable region. The heavy chain variable region comprises CDRH1 with an amino acid sequence shown as SEQ ID NO. 1, CDRH2 with an amino acid sequence shown as SEQ ID NO. 2 and CDRH3 with an amino acid sequence shown as SEQ ID NO. 3. The light chain variable region comprises a CDRL1 shown in SEQ ID NO. 4, a CDRL2 shown in SEQ ID NO. 5 and a CDRL3 shown in SEQ ID NO. 6.
The amino acid sequence of the heavy chain variable region is shown as SEQ ID NO. 7, and the amino acid sequence of the light chain variable region is shown as SEQ ID NO. 8.
The present application also provides a nucleic acid molecule. The nucleic acid molecule may comprise a nucleotide sequence encoding a monoclonal antibody against the novel coronavirus N protein described above. In some embodiments, the nucleotide sequences encoding CDRH1, CDRH2 and CDRH3 of the heavy chain variable region are set forth in SEQ ID NO. 9, SEQ ID NO. 10 and SEQ ID NO. 11, respectively. The nucleotide sequences of CDRL1, CDRL2 and CDRL3 which code for the light chain variable region are shown in SEQ ID NO. 12, SEQ ID NO. 13 and SEQ ID NO. 14 respectively. In some embodiments, the nucleotide sequence encoding the heavy chain variable region is set forth in SEQ ID NO. 15 and the nucleotide sequence encoding the heavy chain variable region is set forth in SEQ ID NO. 16.
The monoclonal antibody against the novel coronavirus N protein can be applied to a reagent for detecting the novel coronavirus N protein, for example, an N protein immune test strip. In some embodiments, monoclonal antibodies directed against novel coronavirus N proteins can be used for immunological detection of novel coronaviruses, e.g., ELISA, immunochromatography, immunoblotting, immunofluorescence, and the like.
The application also provides a kit for detecting the novel coronavirus. The kit can comprise the monoclonal antibody against the novel coronavirus N protein. The detection kit developed by taking the monoclonal antibody for resisting the novel coronavirus N protein as a raw material has good application value, high sensitivity and specificity, and can detect patients suffering from the novel coronavirus at an early stage.
Examples
The experimental methods in the following examples are conventional methods unless otherwise specified. The test materials used in the examples described below, unless otherwise specified, were purchased from conventional Biochemical reagent companies. The quantitative tests in the following examples were all set up in triplicate and the results averaged.
Construction of recombinant plasmids
The inactivated SARS-CoV-2 strain (from the disease prevention and control center of Zhejiang province) was taken, RNA of the virus was extracted, reverse transcribed into cDNA template, and a fragment encoding N protein of 1257bp SARS-CoV-2 strain was PCR amplified using primers with BamH I and EcoR I restriction enzyme sites (forward primer: GGATCCATGTCTGATAATGGACCCCAAA (SEQ ID NO: 17) and reverse primer: GAATTCGGCCTGAGTTGAGTCAGCACTG (SEQ ID NO: 18)) according to the sequence of N protein of SARS-CoV-2 (Genebank accession number: 43740575). The PCR conditions were: pre-denatured at 94℃for 5 min, 94℃for 30 sec, 60℃for 30 sec, 72℃for 1 min, 35 cycles, 72℃for 10 min.
After obtaining the PCR product, the PCR product was ligated into pMD18T vector (purchased from TAKARA), and the ligation product was transformed into DH5a competent cells by hot-shock method, and clones were sequenced to complete correct nucleotide sequence of N protein. After the cleavage verification, the gene fragment of the N protein was cleaved with BamHI and EcoRI after the sequencing was correct, and ligated into pET28a vector (purchased from Novagen Co.) to obtain pET28a-NP recombinant plasmid. And performing enzyme digestion and sequencing verification again. The pET28a-NP plasmid with correct enzyme digestion and sequencing verification is transformed into escherichia coli BL21 (DE 3) strain to induce expression.
Preparation of N protein of SARS-CoV-2
BL21 (DE 3) containing pET28a-NP was cloned in 10mL of LB and 0.5% glucose medium containing 50. Mu.g/mL of ampicillin and chloramphenicol, cultured overnight at 37℃at 200rpm, and transferred 1:100 magnification to 500mL of the above medium the next day.
IPTG (Isopropyl. Beta. -D-Thiogalactoside, isopropyl Thiogalactoside) was added at a final concentration of 0.5mM when the cells were cultured at 37℃and 200rpm to an OD600 of about 0.6, and the cells were collected after induction at 16℃for 16 hours.
The cells were placed in 500mL fungus harvesting bottles, and after culturing at 4000rpm and 4℃for 10min, the supernatant was discarded.
15mL of a ligation buffer (20 mM sodium phosphate, 0.5M sodium chloride, 20mM imidazole, pH 7.4) was added, the cells were suspended by shaking, and the solution was sonicated (70 w, sonicated 90 times, 10s each time) at 4℃on ice (steps were performed on ice) and the pellet was removed by centrifugation after the solution was cleared.
The N protein was then collected by column chromatography with reference to GE company Glutathione Ni Sepharose, 6fast flow4b, as follows:
(1) Clarifying and filtering a sample: the prepared cell suspension supernatant was clarified using a 50ml syringe and a 0.22 μm filter;
(2) Adopting a protein chromatographic column to capture and purify on AKTA;
(3) Performing system flushing, flushing an A1 pump of AKTA by using balance liquid, and flushing a B1 pump by using eluent;
(4) Setting the flow rate of the system to be 0.1ml/min, selecting a corresponding column position No. 1 connexin chromatographic column, balancing AKTA and the column by using a balancing solution, and carrying out ultraviolet zeroing after balancing;
(5) Starting loading, and transferring the A1 pump into a loading centrifuge tube for loading;
(6) After the sample loading is finished, transferring the A1 pump into a balance buffer solution, flushing the balance buffer solution until the detection wavelength is stable, distributing and eluting, and collecting an eluent;
(7) Washing with balancing solution A, and finally washing with 20% ethanol, and preserving.
Finally, eluting the recombinant 6 XHis-tagged N protein from the column by using an elution buffer, analyzing and purifying the protein by using SDS-PAGE, and observing by using a Coomassie brilliant blue staining method to finally obtain the high-purity SARS-CoV-2 nucleocapsid protein N protein.
Preparation of monoclonal antibody Mouse anti-SARS-COV-2mAb4 (NP-Ab)
Female Balb/c mice 6-8 weeks old and healthy were selected for immunization according to a pre-specified immunization protocol. The N protein obtained in the above steps is used as an immunogen to immunize Balb/c mice, and spleen lymphocytes of the mice which are successfully immunized are extracted. Lymphocytes were fused with mouse myeloma cell SP2/0 by cell fusion techniques. After two rounds of subcloning and screening, hybridoma cell strains which stably secrete monoclonal antibodies against novel coronavirus N proteins are obtained, so that monoclonal antibodies against novel coronavirus N proteins are obtained.
Animal immunization experiments were performed using the expressed proteins described above.
The animal immunity experiment comprises the following specific steps:
1. Balb/C mice with consistent weight and age-averaged values were randomly divided into 3 groups (3 groups were divided according to the dose of the N protein of the immunizing antigen obtained in the above steps, respectively: 50 ug/mouse for the immunizing antigen contained in the group A mice, 100 ug/mouse for the immunizing antigen contained in the group B mice, 150 ug/mouse for the immunizing antigen contained in the group C mice, and a control group for each group of mice).
2. Before the start of the experiment, mice were each collected with preimmune serum, blood was taken through eyeballs, a proper amount of blood was taken to ensure the normal state of the mice), and the collected serum was stored at-80 ℃.
3. The preparation mode of the aluminum adjuvant (aluminum hydroxide adjuvant) group comprises the following steps: prior to immunization, each antigen was diluted to the corresponding dose (50 ug/mouse, 100 ug/mouse, 150 ug/mouse) in 75 μl PBS, respectively, and mixed with alum adjuvant (i.e., aluminum hydroxide adjuvant) (1 mg/mouse) at a volume antigen: adjuvant=3:1 (i.e., 25ul of adjuvant was added to 75ul of immunogen dilution); shaking the adjuvant evenly before using, and slowly dripping the injected adjuvant (25 ul) into the immunogen solution; after the adjuvant and the immunogen dilution were thoroughly mixed, the two were thoroughly mixed for 30 minutes. Allowing the adjuvant to effectively adsorb the antigen; the subsequent experiments were performed according to the experimental procedure of immunized animals.
4. Group without aluminum adjuvant: the antigen was diluted to the corresponding dose, i.e., 50 ug/mouse, 100 ug/mouse, 150 ug/mouse, respectively, in 100 μl of PBS, and the immunogen was 100 μl of the diluted antigen, followed by the following experimental procedure for immunized animals.
5. Subcutaneous injections at 2 week intervals: the experiment is designed into a 3-time immunization mode, but partial mouse supernatant is obtained by taking blood from eyeballs after 7 days of each immunization injection and centrifuging, serum antibody titer is detected first, the heart takes blood to obtain maximum blood after 7 days of the last immunization, and the supernatant is obtained by centrifuging and stored at-80 ℃. The test data after 2 immunizations are shown in table 1 below.
Table 12 serum antibody titer test data after immunization
The immune spleen cells are fused with myeloma cell line SP2/0 cells, the fused cells are screened by a HAT selection medium (the HAT selection medium contains hypoxanthine, aminopterin and thymine), and ELISA positive screening and subcloning are carried out on the fused cells; the positive monoclonal selected is taken, ascites antibody generated by hybridoma cells is purified by Protein A/G antibody purification columns, ELISA titer of the purified ascites antibody is more than 1:128,000, purity is more than 90%, and the result is determined by detecting the binding activity of the recognition N Protein by ELISA (enzyme-linked immunosorbent assay) described below.
ELISA detection of binding Activity of recognition N protein
1. IgG antibody titer detection mode
(1) And (3) coating a bottom plate: the antigen used was diluted to 3ug/ml with coating dilution, 100 ul of the prepared coating was added to each well, and the mixture was placed in a refrigerator at 4℃for 24 hours.
(2) After 24h, taking out from the refrigerator, balancing at 37 ℃ for 30min, and then discarding the liquid in the holes; washing the wells with washing liquid for 3 times and 3min each time.
(3) Closing the enzyme-labeled reaction hole: 200ul of 5% calf serum is added into each hole, the holes are sealed for 90min at 37 ℃, and after the sealing is finished, the holes are washed 3 times by washing liquid, and each time is 3min.
(4) Adding a sample to be detected: diluting the sample according to the required proportion, adding the diluted sample into enzyme-labeled reaction holes, placing 100 mu l of each hole at 37 ℃ for 90min; washing the wells with washing liquid for 3 times and 3min each time.
(5) Adding enzyme-labeled antibody: adding secondary antibody with proper concentration according to the specification; 100 μl of wash was applied to each well at 37deg.C for 90 min.
(6) Adding a substrate solution: the substrate is added in an amount of 100 mu l per hole, and the mixture is placed at 37 ℃ and protected from light for 15-30 min.
(7) Terminating the reaction: the reaction was stopped by adding 50. Mu.l of stop solution to each well, and the experimental results were measured within 20 min.
Detection of binding Activity of monoclonal antibody MOUSE ANTI-SARS-COV-2MAB4 (NP-AB) to recognize N protein
(1) Cell fusion and clone screening data
3 rounds of fusion are carried out, and the numbers of the mice are A1, B2 and C0 in sequence; selecting 26 positive clones for subcloning by fusion screening of the A1 mice, and finally completing 17 cell strains; and (3) performing fusion screening, namely selecting 160 positive clones with OD450 value more than 2.2, performing multiple ratio dilution detection titer, and performing secondary and tertiary subclone screening. 6 cell lines, designated A1-1 to A1-6, were obtained. And B2 mice are subjected to fusion screening, 76 positive holes are selected for subcloning, 120 positive holes with OD450 value more than 2.1 are selected for multiple ratio dilution detection titer, and then secondary and third subcloning screening is performed, so that 4 cell strains are finally completed, and the cell strains are respectively named as B2-1 to B2-4. The C0 mice were fused and positive wells were not screened.
(2) Ascites preparation and test data
A total of 10 hybridoma cell lines, 3F 1 mice per complete cell line, were prepared for a total of 10 ascites fluid, all of which were assayed for potency data as shown in table 2 below:
TABLE 2 ascites antibody assay potency data
(3) Investigation of antibody purification conditions and detection data
The above ascites was purified by 3.3% n-octanoic acid-thiamine precipitation to give 10 antibodies in total, and the potency detection data for all antibodies are shown in table 3 below:
TABLE 3 potency detection data for all antibodies
Dilution concentration of antibody | A1-1 | A1-2 | A1-3 | A1-4 | A1-5 | A1-6 | B2-1 | B2-2 | B2-3 | B2-4 |
20ug/ml | 3.153 | 3.391 | 3.163 | 3.288 | 2.887 | 3.058 | 3.116 | 3.25 | 3.183 | 3.082 |
4ug/ml | 3.204 | 3.204 | 3.028 | 3.107 | 3.153 | 3.153 | 3.238 | 3.238 | 3.183 | 3.014 |
800ug/ml | 3.375 | 3.074 | 2.709 | 3.484 | 2.914 | 3.05 | 3.066 | 3.007 | 3.09 | 2.591 |
160ng/ml | 2.364 | 3.028 | 2.798 | 3.426 | 2.413 | 2.576 | 3.344 | 2.48 | 3.074 | 2.765 |
32ng/ml | 1.561 | 2.047 | 1.978 | 2.197 | 1.682 | 1.569 | 2.648 | 1.528 | 2.412 | 2.129 |
6.4ng/ml | 1.309 | 1.151 | 0.633 | 1.785 | 0.581 | 0.496 | 1.865 | 1.744 | 1.603 | 0.797 |
1.28ng/ml | 0.606 | 0.461 | 0.194 | 1.3 | 0.249 | 0.23 | 1.252 | 0.616 | 0.775 | 0.392 |
PBS | 0.084 | 0.046 | 0.072 | 0.051 | 0.067 | 0.063 | 0.052 | 0.113 | 0.044 | 0.118 |
According to Table 3 above, antibody A1-1 was designated as Mouse anti-SARS-COV-2Mab4 (NP-Ab) antibody, which has high titer, high purity, high sensitivity and high specificity. The monoclonal antibody Mouse anti-SARS-COV-2Mab4 (NP-Ab) can be used for ELISA, immunochromatography, immunoblotting, immunofluorescence and other immunological detection.
To examine whether the Mouse anti-SARS-COV-2Mab4 (NP-Ab) antibody specifically binds to the nucleocapsid protein (nucleocapsid protein, also known as N protein) of the novel coronavirus 2019-nCoV (SARS-CoV-2), the N protein of SARS virus (SARS-CoV Nucleocapsid Protein (His Tag), cat# 40143-V08B) and the N protein of MERS virus (MERS-CoV Nucleocapsid Protein (His Tag), cat# 40068-V08B) were purchased from Beijing Yizhuzhushen corporation. Detection of whether the Mouse anti-SARS-COV-2Mab4 (NP-Ab) antibody bound to SARS-CoV-NP and MERS-CoV-NP by ELISA, the results of the cross-assay are shown in Table 4 below:
TABLE 4 Cross-test results data
The above data shows that monoclonal antibody Mouse anti-SARS-COV-2Mab4 (NP-Ab) has good specific binding capacity only to 2019-nCov-NP-2 antigen (i.e., novel coronavirus N protein), but does not bind SARS-CoV-NP and MERS-CoV-NP antigens, and is specific for detecting novel coronaviruses.
Sequence analysis of heavy chain variable region and light chain variable region of monoclonal antibody Mouse anti-SARS-COV-2Mab4 (NP-Ab)
Primers were designed to amplify the heavy chain variable region and light chain variable region genes of monoclonal antibody Mouse anti-SARS-COV-2Mab4 (NP-Ab).
Hybridoma cell strain (about 10) in logarithmic growth phase of monoclonal antibody Mouse anti-SARS-COV-2Mab4 (NP-Ab) 7 And (3) extracting total RNA of the cells according to the instruction of the Trizol RNA extraction kit, performing reverse transcription to synthesize a first cDNA chain by taking the total RNA as a template, and amplifying heavy chain variable region genes and light chain variable region genes of the antibody by taking the amplified product as the template through PCR.
Heavy chain variable region and light chain variable region gene fragments of monoclonal antibody Mouse anti-SARS-COV-2Mab4 (NP-Ab) were recovered and sequenced. Sequencing results were as follows:
the nucleotide sequence (345 bp) encoding the heavy chain variable region of the monoclonal antibody MOUSE ANTI-SARS-COV-2MAB4 (NP-AB) is as follows:
GTGAAGCTGCAGGAGTCTGGACCTGAGCTGAAGAAGCCTGGAGAGACAGTCAGGATC TCCTGCAAGGCTTCTGGTTATACCCTCACAGACTATTCAATACACTGGGTGAAGCAGGC TCCAGGAAAGGGTTTAAAGTGGATGGGCTGGATAAACACTGAGACTGTTGAGCCAACA TATACAGATGACTTCAAGGGACGGTTTGCCTTCTCTTTGGAAACCTCTGCCAGCACTGC CTATTTGCAAATCAACAACCTCAAAAATGAGGACACGGCTACATATTTCTGTGCCTCAA CTGGGACGGAATTTGACTACTGGGGCCAGGGCACCACTCTCACAGTCTCCTCA(SEQ ID NO:15)。
the sequence of CDRH1 encoding the heavy chain variable region is: GGTTATACCCTCACAGACTATTCA (SEQ ID NO: 9).
The sequence of CDRH2 encoding the heavy chain variable region is: ATAAACACTGAGACTGTTGAGCCA (SEQ ID NO: 10).
The sequence of CDRH3 encoding the heavy chain variable region is: GCCTCAACTGGGACGGAATTTGACTAC (SEQ ID NO: 11).
The amino acid sequence (115 aa) of the heavy chain variable region is shown below:
VKLQESGPELKKPGETVRISCKASGYTLTDYSIHWVKQAPGKGLKWMGWINTETVEPTYT DDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCASTGTEFDYWGQGTTLTVSS(SEQ ID NO:7)。
the amino acid sequence of CDRH1 of the heavy chain variable region is: GYTLTDYS (SEQ ID NO: 1).
The amino acid sequence of CDRH2 of the heavy chain variable region is: INTETYEP (SEQ ID NO: 2).
The amino acid sequence of CDRH3 of the heavy chain variable region is: ASTGTEFDY (SEQ ID NO: 3).
The nucleotide sequence (336 bp) encoding the light chain variable region of the monoclonal antibody MOUSE ANTI-SARS-COV-2MAB4 (NP-AB) is shown below:
GATGTTGTGATGACCCAAACTCCACTCTCCCTGCCTGTCAGTCTTGGAGATCAAGCCTC CATCTCTTGCAGATCTAGTCAGAGCCTTGTACACATTACTGGAAACACCTATTTACATT GGTACCTGCAGAAGCCAGGCCAGTCTCCAAAGCTCCTGATCTACAAAGTTTCCAACCG ATTTTCTGGGGTCCCAGACAGGTTCAGTGGCAGTGGATCAGGGACAGATTTCACACTC AAGATCAGCAGAGTGGAGGCTGAGGATCTGGGAGTTTATTTCTGCTCTCAAAGTACAC ATGTTCCGCTCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAAA(SEQ ID NO:16)。
the sequence of CDRL1 encoding the light chain variable region is: CAGAGCCTTGTACACATTACTGGAAACACCTATTTACATTGGTAC (SEQ ID NO: 12).
The sequence of CDRL2 encoding the light chain variable region is: AAAGTTTCC (SEQ ID NO: 13).
The sequence of CDRL3 encoding the light chain variable region is: TCTCAAAGTACACATGTTCCGCTCACG (SEQ ID NO: 14).
The amino acid sequence of the light chain variable region (112 aa) is shown below:
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHITGNTYLHWYLQKPGQSPKLLIYKVSNRFSG VPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPLTFGAGTKLELK(SEQ ID NO:8)。
the amino acid sequence of CDRL1 of the light chain variable region is: QSLVHITGNTY (SEQ ID NO: 4).
The amino acid sequence of CDRL2 of the light chain variable region is: KVS (SEQ ID NO: 5).
The amino acid sequence of CDRL3 of the light chain variable region is: SQSTHVPLT (SEQ ID NO: 6).
One of the benefits of the present disclosure includes, but is not limited to: (1) The monoclonal antibody of the novel coronavirus N protein has high titer, high purity, high sensitivity and high specificity; (2) The monoclonal antibody of the novel coronavirus N protein can be used for immunoblotting, immunofluorescence and other immunological detection, and provides a required raw material for immunological detection reagents (for example, an N protein detection immunoassay test strip). It should be noted that, the advantages that may be generated by different embodiments may be different, and in different embodiments, the advantages that may be generated may be any one or a combination of several of the above, or any other possible advantages that may be obtained.
It will be appreciated by those skilled in the art that the above examples are illustrative of the invention and are not to be construed as limiting the invention. Any modifications, equivalent substitutions and variations, etc., which are within the spirit and principles of the present invention, are intended to be included within the scope of the present invention.
Sequence listing
<110> Xuezuke biotechnology Co., ltd
<120> monoclonal antibody against novel coronavirus N protein and use thereof
<160> 18
<170> SIPOSequenceListing 1.0
<210> 1
<211> 8
<212> PRT
<213> Artificial sequence (Artificial Sequence)
<400> 1
Gly Tyr Thr Leu Thr Asp Tyr Ser
1 5
<210> 2
<211> 8
<212> PRT
<213> Artificial sequence (Artificial Sequence)
<400> 2
Ile Asn Thr Glu Thr Val Glu Pro
1 5
<210> 3
<211> 9
<212> PRT
<213> Artificial sequence (Artificial Sequence)
<400> 3
Ala Ser Thr Gly Thr Glu Phe Asp Tyr
1 5
<210> 4
<211> 11
<212> PRT
<213> Artificial sequence (Artificial Sequence)
<400> 4
Gln Ser Leu Val His Ile Thr Gly Asn Thr Tyr
1 5 10
<210> 5
<211> 3
<212> PRT
<213> Artificial sequence (Artificial Sequence)
<400> 5
Lys Val Ser
1
<210> 6
<211> 9
<212> PRT
<213> Artificial sequence (Artificial Sequence)
<400> 6
Ser Gln Ser Thr His Val Pro Leu Thr
1 5
<210> 7
<211> 115
<212> PRT
<213> Artificial sequence (Artificial Sequence)
<400> 7
Val Lys Leu Gln Glu Ser Gly Pro Glu Leu Lys Lys Pro Gly Glu Thr
1 5 10 15
Val Arg Ile Ser Cys Lys Ala Ser Gly Tyr Thr Leu Thr Asp Tyr Ser
20 25 30
Ile His Trp Val Lys Gln Ala Pro Gly Lys Gly Leu Lys Trp Met Gly
35 40 45
Trp Ile Asn Thr Glu Thr Val Glu Pro Thr Tyr Thr Asp Asp Phe Lys
50 55 60
Gly Arg Phe Ala Phe Ser Leu Glu Thr Ser Ala Ser Thr Ala Tyr Leu
65 70 75 80
Gln Ile Asn Asn Leu Lys Asn Glu Asp Thr Ala Thr Tyr Phe Cys Ala
85 90 95
Ser Thr Gly Thr Glu Phe Asp Tyr Trp Gly Gln Gly Thr Thr Leu Thr
100 105 110
Val Ser Ser
115
<210> 8
<211> 112
<212> PRT
<213> Artificial sequence (Artificial Sequence)
<400> 8
Asp Val Val Met Thr Gln Thr Pro Leu Ser Leu Pro Val Ser Leu Gly
1 5 10 15
Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Leu Val His Ile
20 25 30
Thr Gly Asn Thr Tyr Leu His Trp Tyr Leu Gln Lys Pro Gly Gln Ser
35 40 45
Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro
50 55 60
Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile
65 70 75 80
Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Phe Cys Ser Gln Ser
85 90 95
Thr His Val Pro Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys
100 105 110
<210> 9
<211> 24
<212> DNA
<213> Artificial sequence (Artificial Sequence)
<400> 9
ggttataccc tcacagacta ttca 24
<210> 10
<211> 24
<212> DNA
<213> Artificial sequence (Artificial Sequence)
<400> 10
ataaacactg agactgttga gcca 24
<210> 11
<211> 27
<212> DNA
<213> Artificial sequence (Artificial Sequence)
<400> 11
gcctcaactg ggacggaatt tgactac 27
<210> 12
<211> 45
<212> DNA
<213> Artificial sequence (Artificial Sequence)
<400> 12
cagagccttg tacacattac tggaaacacc tatttacatt ggtac 45
<210> 13
<211> 9
<212> DNA
<213> Artificial sequence (Artificial Sequence)
<400> 13
aaagtttcc 9
<210> 14
<211> 27
<212> DNA
<213> Artificial sequence (Artificial Sequence)
<400> 14
tctcaaagta cacatgttcc gctcacg 27
<210> 15
<211> 345
<212> DNA
<213> Artificial sequence (Artificial Sequence)
<400> 15
gtgaagctgc aggagtctgg acctgagctg aagaagcctg gagagacagt caggatctcc 60
tgcaaggctt ctggttatac cctcacagac tattcaatac actgggtgaa gcaggctcca 120
ggaaagggtt taaagtggat gggctggata aacactgaga ctgttgagcc aacatataca 180
gatgacttca agggacggtt tgccttctct ttggaaacct ctgccagcac tgcctatttg 240
caaatcaaca acctcaaaaa tgaggacacg gctacatatt tctgtgcctc aactgggacg 300
gaatttgact actggggcca gggcaccact ctcacagtct cctca 345
<210> 16
<211> 336
<212> DNA
<213> Artificial sequence (Artificial Sequence)
<400> 16
gatgttgtga tgacccaaac tccactctcc ctgcctgtca gtcttggaga tcaagcctcc 60
atctcttgca gatctagtca gagccttgta cacattactg gaaacaccta tttacattgg 120
tacctgcaga agccaggcca gtctccaaag ctcctgatct acaaagtttc caaccgattt 180
tctggggtcc cagacaggtt cagtggcagt ggatcaggga cagatttcac actcaagatc 240
agcagagtgg aggctgagga tctgggagtt tatttctgct ctcaaagtac acatgttccg 300
ctcacgttcg gtgctgggac caagctggag ctgaaa 336
<210> 17
<211> 28
<212> DNA
<213> Artificial sequence (Artificial Sequence)
<400> 17
ggatccatgt ctgataatgg accccaaa 28
<210> 18
<211> 28
<212> DNA
<213> Artificial sequence (Artificial Sequence)
<400> 18
gaattcggcc tgagttgagt cagcactg 28
Claims (8)
1. A monoclonal antibody against novel coronavirus N protein, which is characterized by comprising a heavy chain variable region and a light chain variable region, wherein,
the heavy chain variable region comprises CDRH1 with an amino acid sequence shown as SEQ ID NO. 1, CDRH2 with an amino acid sequence shown as SEQ ID NO. 2 and CDRH3 with an amino acid sequence shown as SEQ ID NO. 3; and
the light chain variable region comprises a CDRL1 shown in SEQ ID NO. 4, a CDRL2 shown in SEQ ID NO. 5 and a CDRL3 shown in SEQ ID NO. 6.
2. The monoclonal antibody of claim 1, wherein the amino acid sequence of the heavy chain variable region is shown in SEQ ID No. 7 and the amino acid sequence of the light chain variable region is shown in SEQ ID No. 8.
3. A nucleic acid molecule comprising a nucleotide sequence encoding the monoclonal antibody against the novel coronavirus N protein of claim 1 or 2.
4. The nucleic acid molecule of claim 3, wherein the nucleotide sequences encoding CDRH1, CDRH2 and CDRH3 of the heavy chain variable region are shown as SEQ ID NO. 9, SEQ ID NO. 10 and SEQ ID NO. 11, respectively, and the nucleotide sequences encoding CDRL1, CDRL2 and CDRL3 of the light chain variable region are shown as SEQ ID NO. 12, SEQ ID NO. 13 and SEQ ID NO. 14, respectively.
5. The nucleic acid molecule of claim 4, wherein the nucleotide sequence encoding the heavy chain variable region is set forth in SEQ ID NO. 15 and the nucleotide sequence encoding the light chain variable region is set forth in SEQ ID NO. 16.
6. Use of a monoclonal antibody against a novel coronavirus N protein according to claim 1 or 2 for the preparation of a reagent for detecting an anti-novel coronavirus N protein.
7. The use according to claim 6, wherein said monoclonal antibody against the novel coronavirus N protein is used for immunological detection of novel coronaviruses.
8. A kit for detecting a novel coronavirus, comprising the monoclonal antibody against the novel coronavirus N protein of claim 1 or 2.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202111361909.6A CN113912710B (en) | 2021-11-17 | 2021-11-17 | Monoclonal antibody for resisting novel coronavirus N protein and application thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202111361909.6A CN113912710B (en) | 2021-11-17 | 2021-11-17 | Monoclonal antibody for resisting novel coronavirus N protein and application thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CN113912710A CN113912710A (en) | 2022-01-11 |
CN113912710B true CN113912710B (en) | 2023-05-26 |
Family
ID=79247302
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202111361909.6A Active CN113912710B (en) | 2021-11-17 | 2021-11-17 | Monoclonal antibody for resisting novel coronavirus N protein and application thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN113912710B (en) |
Families Citing this family (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN114560929B (en) * | 2022-03-21 | 2023-07-04 | 深圳国家感染性疾病临床医学研究中心 | Monoclonal antibody aiming at coronavirus NP protein and application thereof |
CN114805564B (en) * | 2022-06-10 | 2023-06-06 | 郑州大学 | Monoclonal antibody for specifically recognizing SARS-CoV-2S protein NTD region and application thereof |
CN117659180A (en) * | 2022-09-06 | 2024-03-08 | 东莞市朋志生物科技有限公司 | Anti-novel coronavirus antibody or functional fragment thereof, reagent for detecting novel coronavirus and kit |
CN115850459B (en) * | 2022-11-14 | 2023-07-14 | 杭州华葵金配生物科技有限公司 | Antibody targeting novel coronavirus N protein and application thereof |
CN115894675B (en) * | 2023-02-03 | 2023-11-14 | 康复大学(筹) | New coronavirus SARS-CoV-2 nucleocapsid protein monoclonal antibody and its application |
CN116675765B (en) * | 2023-06-02 | 2023-11-24 | 保定国兰生物技术有限公司 | Coronavirus N protein monoclonal antibody and application thereof |
Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN106977602A (en) * | 2016-08-23 | 2017-07-25 | 中山康方生物医药有限公司 | A kind of anti-PD1 monoclonal antibodies, its medical composition and its use |
CN111269313A (en) * | 2020-03-07 | 2020-06-12 | 北京岳昊科技发展有限公司 | Monoclonal antibody for detecting novel coronavirus and application of monoclonal antibody in preparation of kit |
CN112812178A (en) * | 2021-02-04 | 2021-05-18 | 河南中泽生物工程有限公司 | PCV3Cap protein epitope peptide, monoclonal antibody for resisting PCV3Cap protein, preparation method and application thereof |
CN112940110A (en) * | 2021-04-14 | 2021-06-11 | 中山大学 | Anti-novel coronavirus N protein monoclonal antibody and application thereof |
CN113150136A (en) * | 2021-04-30 | 2021-07-23 | 杭州贤至生物科技有限公司 | Preparation of novel coronavirus N protein monoclonal antibody |
CN113249337A (en) * | 2021-07-15 | 2021-08-13 | 天津一瑞生物科技股份有限公司 | Mouse-resistant novel coronavirus N protein hybridoma cell strain, monoclonal antibody and application |
-
2021
- 2021-11-17 CN CN202111361909.6A patent/CN113912710B/en active Active
Patent Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN106977602A (en) * | 2016-08-23 | 2017-07-25 | 中山康方生物医药有限公司 | A kind of anti-PD1 monoclonal antibodies, its medical composition and its use |
CN111269313A (en) * | 2020-03-07 | 2020-06-12 | 北京岳昊科技发展有限公司 | Monoclonal antibody for detecting novel coronavirus and application of monoclonal antibody in preparation of kit |
CN112812178A (en) * | 2021-02-04 | 2021-05-18 | 河南中泽生物工程有限公司 | PCV3Cap protein epitope peptide, monoclonal antibody for resisting PCV3Cap protein, preparation method and application thereof |
CN112940110A (en) * | 2021-04-14 | 2021-06-11 | 中山大学 | Anti-novel coronavirus N protein monoclonal antibody and application thereof |
CN113150136A (en) * | 2021-04-30 | 2021-07-23 | 杭州贤至生物科技有限公司 | Preparation of novel coronavirus N protein monoclonal antibody |
CN113249337A (en) * | 2021-07-15 | 2021-08-13 | 天津一瑞生物科技股份有限公司 | Mouse-resistant novel coronavirus N protein hybridoma cell strain, monoclonal antibody and application |
Also Published As
Publication number | Publication date |
---|---|
CN113912710A (en) | 2022-01-11 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN113912710B (en) | Monoclonal antibody for resisting novel coronavirus N protein and application thereof | |
CN111269313B (en) | Monoclonal antibody for detecting novel coronavirus and application of monoclonal antibody in preparation of kit | |
CN112225797B (en) | Monoclonal antibody for resisting SARS-CoV-2 nucleocapsid protein and application thereof | |
CN111153991A (en) | Human SARS-CoV-2 monoclonal antibody and its preparation method and use | |
CN113336844B (en) | Shark single domain antibody targeting novel coronavirus N protein, and preparation method and application thereof | |
CN114106164B (en) | Monoclonal antibody for resisting novel coronavirus S protein and application thereof | |
CN112851804B (en) | Neutralizing active monoclonal antibody of human source for resisting novel coronavirus (SARS-CoV-2) | |
CN111748032B (en) | Antibody against novel coronavirus and immunoassay using the same | |
CN110684740B (en) | Monoclonal antibody of anti-human ubiquitin carboxyl terminal hydrolase-1 (UCH-L1) and application thereof | |
WO2023130770A1 (en) | Fully human broadly neutralizing antibody zw2g10 against novel coronavirus and application thereof | |
EP3239176B1 (en) | Anti-active gip antibody | |
EP4265717A1 (en) | Mouse anti-mcr-1/mcr-2 protein hybridoma cell strain, monoclonal antibody and use | |
CN116082498A (en) | Monoclonal antibody of monkey pox virus protein and application thereof | |
CN106866820B (en) | Monoclonal antibody for capturing tumor cells and resisting human keratin 18 and application thereof | |
CN114349853B (en) | Anti-H1N 1 influenza virus hemagglutinin protein neutralizing monoclonal antibody ZJU11-01 and application thereof | |
CN113527474B (en) | Monoclonal antibody of anti-novel coronavirus N protein and application thereof | |
CN112094346B (en) | Monoclonal antibody of mouse anti-cell single-chain transmembrane glycoprotein CD142 capable of being applied to tumor cell capture | |
KR100905066B1 (en) | The recombinant proteins for the diagnosis of diseases infected from Mycoplasma pneumoniae and the diagnostic kits comprising the same | |
CN114805579B (en) | Anti-human ACE2 protein monoclonal antibody, nucleic acid molecule and application | |
CN114935649B (en) | HPV virus detection kit | |
CN115087667B (en) | Antigen binding proteins that specifically bind SARS-CoV-2 | |
WO2019165019A1 (en) | Antibodies to human respiratory syncytial virus protein f pre-fusion conformation and methods of use therefor | |
CN111763255B (en) | Genetically modified VEGFA protein, monoclonal antibody thereof and application | |
TWI775422B (en) | Recombinant antibodies, kits comprising the same, and uses thereof | |
KR20220055423A (en) | Detection method of SARS-CoV-2 using novel SARS-CoV-2 specific antibody |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 40066790 Country of ref document: HK |
|
GR01 | Patent grant | ||
GR01 | Patent grant |