CN111269324B - Fusion protein of Gauss luciferase and digoxin single-chain antibody and application thereof - Google Patents

Fusion protein of Gauss luciferase and digoxin single-chain antibody and application thereof Download PDF

Info

Publication number
CN111269324B
CN111269324B CN201811475418.2A CN201811475418A CN111269324B CN 111269324 B CN111269324 B CN 111269324B CN 201811475418 A CN201811475418 A CN 201811475418A CN 111269324 B CN111269324 B CN 111269324B
Authority
CN
China
Prior art keywords
gly
ser
fusion protein
ala
lys
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active
Application number
CN201811475418.2A
Other languages
Chinese (zh)
Other versions
CN111269324A (en
Inventor
董宇亮
王佑富
李静
马旭妍
郑越
章文蔚
徐崇钧
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Qingdao Huada Zhizao Technology Co ltd
Original Assignee
Qingdao Huada Zhizao Technology Co ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Qingdao Huada Zhizao Technology Co ltd filed Critical Qingdao Huada Zhizao Technology Co ltd
Priority to CN201811475418.2A priority Critical patent/CN111269324B/en
Publication of CN111269324A publication Critical patent/CN111269324A/en
Application granted granted Critical
Publication of CN111269324B publication Critical patent/CN111269324B/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/44Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/94Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving narcotics or drugs or pharmaceuticals, neurotransmitters or associated receptors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/20Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/21Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/61Fusion polypeptide containing an enzyme fusion for detection (lacZ, luciferase)

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Organic Chemistry (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Urology & Nephrology (AREA)
  • General Engineering & Computer Science (AREA)
  • Hematology (AREA)
  • Biophysics (AREA)
  • Medicinal Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Cell Biology (AREA)
  • Plant Pathology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Food Science & Technology (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

A fusion protein of a Gaussian luciferase and a digoxin single-chain antibody and application thereof. The fusion protein comprises a heavy chain variable region, a light chain variable region and a Gaussian luciferase or persistent luminescence mutant of a digoxin single-chain antibody, wherein the heavy chain variable region and the light chain variable region are connected through a first flexible peptide, and the Gaussian luciferase or the persistent luminescence mutant is connected with the heavy chain variable region or the light chain variable region through a second flexible peptide. The fusion protein disclosed by the invention retains the activity of two parts of proteins, can be specifically combined with digoxin on one hand, can play the self-luminescence advantage of luciferase on the other hand, realizes self-luminescence detection while specifically combining with target digoxin, and can be applied to clinical detection or related scientific research.

Description

Fusion protein of Gauss luciferase and digoxin single-chain antibody and application thereof
Technical Field
The invention relates to the technical field of antibodies, in particular to a fusion protein of a Gaussian luciferase and a digoxin single-chain antibody and application thereof.
Background
Luciferase (Luciferase) is a generic term for enzymes capable of producing bioluminescence in an organism. Are widely used as reporter genes due to their self-luminescent effect. Applications in detection and the like are also becoming more and more widespread. The classes of luciferases include: bacterial luciferases (Bacterial Luciferase, GLuc), firefly luciferases (Firefly Luciferase, FLuc), renilla luciferases (Renilla Luciferase, RLuc) and gaussian luciferases (Gaussia Luciferase, GLuc). Wherein the luminescence activity of the Gaussian luciferase is more than 100 times higher than that of other types of luciferases. Gauss luciferase is a luciferase derived from marine radial organisms (Gaussia princps) and has a size of 19.9kDa, and only 185 amino acids, which can be secreted by cells to the outside, and only coelenterazine and oxygen are needed for reaction. Currently, gaussian luciferase is widely used as a reporter gene. Through coexpression of Gaussian luciferase and target proteins, research such as positioning tracing and the like can be performed on the target proteins. Since it is found later than other luciferases, it has less development and application. Particularly in detection applications. Therefore, the method has wide application prospect for development and application.
Digoxin is widely used as a cardiac glycoside drug for clinically treating heart failure and arrhythmia. Meanwhile, digoxin is widely applied to detection research as a molecular target. Especially in clinical diagnosis and scientific research detection experiments, digoxin is used as a target or a marker, and further research and application in molecular diagnosis or molecular positioning are more and more performed by utilizing digoxin antibody specificity to recognize the target.
Currently, digoxin antibody is mostly used as a diagnosis or detection means, digoxin target is identified by the digoxin antibody, then the digoxin antibody is identified by a secondary antibody for amplification, and finally a color reaction is carried out by using a label carried on the secondary antibody. Such that the detection requires two or more steps to complete. Yet another way is to add a fluorescent tag to the digoxin antibody. The fluorescence label can emit fluorescence to be received by the detector after absorbing excitation light, and the detection process requires hardware facilities such as a fluorescence microscope, so that the application is limited. Currently, there is no product on the market with fluorescent labels on digoxin antibodies. But may have similar functions by combination. After modifying the digoxin antibody by Biotin (Biotin), the digoxin antibody can be specifically identified and self-luminous detection can be realized by amplifying by using an SA-GLU coupling product. However, this antibody combination method is cumbersome and time-consuming.
Disclosure of Invention
The invention provides a fusion protein of a Gaussian luciferase and a digoxin single-chain antibody and application thereof, and the fusion protein disclosed by the invention keeps the activities of two parts of proteins, can be specifically combined with digoxin on one hand, can exert the self-luminous advantage of the luciferase on the other hand, realizes self-luminous detection while specifically combining with a target digoxin, and can be applied to clinical detection or related scientific research.
According to a first aspect, in one embodiment there is provided a fusion protein of a gaussian luciferase and a digoxin single chain antibody, the fusion protein comprising a heavy chain variable region of a digoxin single chain antibody, a light chain variable region, and a gaussian luciferase or persistent luminescent mutant, the heavy chain variable region and the light chain variable region being linked by a first flexible peptide, the gaussian luciferase or persistent luminescent mutant and the heavy chain variable region or the light chain variable region being linked by a second flexible peptide.
In a preferred embodiment, the heavy chain variable region sequence is as set forth in SEQ ID NO: 1.
In a preferred embodiment, the light chain variable region sequence is as set forth in SEQ ID NO: 2.
In a preferred embodiment, the above gaussian luciferase has the sequence shown in SEQ ID NO: 3.
In a preferred embodiment, the sequence of the persistent luminescence mutant is as shown in SEQ ID NO: 4.
In a preferred embodiment, each of said first flexible peptide and said second flexible peptide is independently selected from the group consisting of SEQ ID NOs: 5 and SEQ ID NO: 6.
In a preferred embodiment, the first flexible peptide is SEQ ID NO:5, a sequence shown in seq id no; the second flexible peptide is seq id NO: 6.
In a preferred embodiment, the fusion protein further comprises: a signal peptide for directing the secretion of the above fusion protein from the inside of the expressing cell.
In a preferred embodiment, the signal peptide is located at the N-terminus of the fusion protein.
In a preferred embodiment, the signal peptide sequence is as set forth in SEQ ID NO: shown at 7.
In a preferred embodiment, the fusion protein further comprises: fusion tags for affinity purification of the fusion proteins.
In a preferred embodiment, the fusion tag is a 6×histidine tag.
In a preferred embodiment, the fusion tag is located at the C-terminus of the fusion protein.
In a preferred embodiment, the sequence of the fusion protein is as set forth in SEQ ID NO:8 or SEQ ID NO: shown at 9.
According to a second aspect, in one embodiment there is provided an isolated nucleic acid encoding the fusion protein of the first aspect.
In a preferred embodiment, the isolated nucleic acid comprises a heavy chain variable region coding sequence, a light chain variable region coding sequence, and a gaussian luciferase coding sequence or a persistent light emitting mutant coding sequence of a digoxin single chain antibody, wherein the heavy chain variable region coding sequence and the light chain variable region coding sequence are linked by a first linker sequence, and wherein the gaussian luciferase coding sequence or the persistent light emitting mutant coding sequence and the heavy chain variable region coding sequence or the light chain variable region coding sequence are linked by a second linker sequence.
In a preferred embodiment, the heavy chain variable region coding sequence is as set forth in SEQ ID NO: shown at 10.
In a preferred embodiment, the light chain variable region coding sequence is as set forth in SEQ ID NO: 11.
In a preferred embodiment, the coding sequence of the Gaussian luciferase is shown as SEQ ID NO: shown at 12.
In a preferred embodiment, the above-mentioned continuous luminescence mutant has a coding sequence as shown in SEQ ID NO: shown at 13.
In a preferred embodiment, each of said first and said second linker sequences is independently selected from the group consisting of SEQ ID NOs: 14 and SEQ ID NO: 15.
In a preferred embodiment, the first linking sequence is SEQ ID NO:14, a sequence shown in seq id no; the second connecting sequence is SEQ ID NO: 15.
In a preferred embodiment, the isolated nucleic acid further comprises: a signal peptide coding sequence encoding a signal peptide for directing secretion of the fusion protein from within the expressing cell.
In a preferred embodiment, the signal peptide coding sequence is located 5' to the isolated nucleic acid.
In a preferred embodiment, the signal peptide has a coding sequence as set forth in SEQ ID NO: shown at 16.
In a preferred embodiment, the isolated nucleic acid further comprises a fusion tag coding sequence for encoding a fusion tag for affinity purification of the fusion protein.
In a preferred embodiment, the fusion tag coding sequence is a sequence encoding a 6×histidine tag.
In a preferred embodiment, the fusion tag coding sequence is located at the 3' end of the isolated nucleic acid.
In a preferred embodiment, the isolated nucleic acid sequence is set forth in SEQ ID NO:17 or SEQ ID NO: shown at 18.
According to a third aspect, in one embodiment there is provided an expression vector comprising a nucleic acid sequence encoding the fusion protein of the first aspect, and a vector backbone sequence.
According to a fourth aspect, in one embodiment there is provided a recombinant host cell comprising the expression vector of the third aspect.
According to a fifth aspect, there is provided in an embodiment the use of the fusion protein of the first aspect, the isolated nucleic acid of the second aspect, the expression vector of the third aspect or the recombinant host cell of the fourth aspect in digoxin molecule detection.
The fusion protein of the Gaussian luciferase and the digoxin single-chain antibody can specifically identify digoxin on one hand and has a self-luminous function on the other hand, and is convenient to detect. Compared with the existing mode of detecting digoxin through coupling amplification, the fusion protein has the advantages of simple process, convenience in production, simplicity and convenience in use and shorter time consumption.
Drawings
FIG. 1 is a schematic flow chart of the construction principle of a Fusion Protein expression vector in the embodiment of the invention, wherein a heavy chain (H chain) variable region coding sequence of a digoxin single-chain antibody and a light chain (L chain) variable region coding sequence (comprising a Signal peptide coding sequence) are connected through a first connecting sequence (Linker 1), and the heavy chain (H chain) variable region coding sequence of the digoxin single-chain antibody and a Gaussian luciferase (Gluc) coding sequence are connected through a second connecting sequence (Linker 2) to obtain a Fusion Protein (Fusion Protein) coding sequence, and then the Fusion Protein coding sequence is integrally connected into a vector skeleton sequence pcDNA3.1 (+) to obtain a recombinant Fusion Protein expression vector.
FIG. 2 is a SDS-PAGE identification and Western blot identification chart of anti DIG scFv-GLuc fusion proteins in the embodiment of the invention, lane 1: anti DIG scFv-GLuc fusion protein, lane M: a marker.
FIG. 3 is a diagram showing experimental results of ELISA detection of digoxin binding force of an anti-DIG scFv-GLuc fusion protein antibody part in the embodiment of the invention, wherein anti-DIG scFv-GLuc represents a wild-type fusion protein, anti-DIG scFv-G2L represents a mutant fusion protein, anti-DIG scFv represents a digoxin single-chain antibody, GLuc represents a Gaussian luciferase, G2L represents a continuous luminescence mutant of the Gaussian luciferase, and the abscissa represents a Concentration (Concentration) value and the ordinate represents an OD450nm absorbance value.
FIG. 4 is a diagram showing the results of bioluminescence assay of an anti DIG scFv-GLuc fusion protein in the example of the present invention, wherein anti DIG scFv-GLuc represents the fusion protein, anti DIG scFv-G2L represents the mutant fusion protein, anti DIG scFv represents the digoxin single chain antibody, GLuc represents the Gaussian luciferase, G2L represents the Gaussian luciferase continuous luminescence mutant, the abscissa represents Time (Time), and the ordinate represents luminescence intensity (CL values).
FIG. 5 is a diagram showing the results of an experiment for detecting the bifunctional activity of an anti DIG scFv-GLuc fusion protein in the embodiment of the invention, wherein anti DIG scFv-GLuc represents the fusion protein, anti DIG scFv-G2L represents the mutant fusion protein, anti DIG scFv represents the digoxin single-chain antibody, GLuc represents the Gaussian luciferase, G2L represents the continuous luminescence mutant of the Gaussian luciferase, the abscissa represents the Concentration (Concentration) value, and the ordinate represents the luminescence intensity (CL values).
Detailed Description
The invention will be described in further detail below with reference to the drawings by means of specific embodiments. In the following embodiments, numerous specific details are set forth in order to provide a better understanding of the present invention. However, one skilled in the art will readily recognize that some of the features may be omitted in various situations, or replaced by other materials, methods.
Furthermore, the described features, operations, or characteristics of the description may be combined in any suitable manner in various embodiments. Also, various steps or acts in the method descriptions may be interchanged or modified in a manner apparent to those of ordinary skill in the art. Thus, the various orders in the description and drawings are for clarity of description of only certain embodiments, and are not meant to be required orders unless otherwise indicated.
Herein, "first," "second," etc. are used merely to distinguish between the described objects, and do not have any sequential or technical meaning.
The invention provides a fusion protein of a single-chain antibody of gauss luciferase and digoxin, which is an antibody fusion protein of targeting digoxin, and is based on the single-chain antibody of digoxin and gauss luciferase or a continuous luminescence mutant, and the single-chain antibody of digoxin and the gauss luciferase or the continuous luminescence mutant are connected through a flexible peptide through gene reconstruction.
Specifically, the fusion protein comprises a heavy chain (H chain) variable region, a light chain (L chain) variable region and a Gaussian luciferase (Gluc) or persistent luminescence mutant of the digoxin single-chain antibody, wherein the heavy chain variable region and the light chain variable region are connected through a first flexible peptide, and the Gaussian luciferase or the persistent luminescence mutant is connected with the heavy chain variable region or the light chain variable region through a second flexible peptide.
In the fusion protein of the present invention, there are various connection modes of the heavy chain (H chain) variable region, the light chain (L chain) variable region and Gauss luciferase (Gluc) or a persistent luminescence mutant of the digoxin single-chain antibody, for example, four connection modes of H+L+gluc, L+H+gluc, gluc+L+H or gluc+H+L may be sequentially arranged from the N end to the C end of the protein. In a preferred embodiment, an H+L+gluc linkage is used.
In a preferred embodiment, the heavy chain variable region sequence is as set forth in SEQ ID NO:1 is shown as follows:
QVQLLQSAAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAVYYCARASPSGFDYWGQGTLVTVSS(SEQID NO:1)。
in a preferred embodiment, the light chain variable region sequence is as set forth in SEQ ID NO:2 is shown as follows:
QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLRAVVFGGGTKLTVLGG(SEQ ID NO:2)。
in a preferred embodiment, the gaussian luciferase sequence is as follows SEQ ID NO:3, shown in the following:
KPTENNEDFNIVAVASNFATTDLDADRGKLPGKKLPLEVLKEMEANARKAGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQGGIGEAIVDIPEIPGFKDLEPMEQFIAQVDLCVDCTTGCLKGLANVQCSDLLKKWLPQRCATFASKIQGQVDKIKGAGGD(SEQ ID NO:3)。
in a preferred embodiment, the persistent luminescent mutant sequence is as follows SEQ ID NO:4, as follows:
KPTENNEDFNIVAVASNFATTDLDADRGKLPGKKLPLEVLKELEANARKAGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQGGIGEAIVDIPEIPGFKDLEPLEQFIAQVDLCVDCTTGCLKGLANVQCSDLLKKWLPQRCATFASKIQGQVDKIKGAGGD(SEQ ID NO:4)。
it should be noted that, in addition to the fusion protein of the present invention using the above-mentioned SEQ ID NO: 1-3 or SEQ ID NO: 1-2 and SEQ ID NO:4, and a sequence form having the same function although the sequences are different from each other. For example, for the heavy chain variable region, it may be a sequence identical to SEQ ID NO:1 but also has the corresponding epitope properties, as in SEQ ID NO:1, adding or reducing a plurality of amino acids at two ends of the sequence but maintaining the same epitope characteristics; for the light chain variable region, it may be a sequence identical to SEQ ID NO:2 but also has the corresponding epitope properties, as in SEQ ID NO:2, adding or subtracting a plurality of amino acids at two ends of the sequence but maintaining the same epitope characteristic; for gaussian luciferase, it may be as defined in SEQ id no:3 but also has a sequence of gaussian luciferase activity as shown in SEQ ID NO:3, but maintains the same gaussian luciferase activity.
In the fusion protein of the present invention, the first flexible peptide and the second flexible peptide having a linking effect may be each independently selected from the following sequences:
GGGGSGGGGSGGS(SEQ ID NO:5);
GGGGSGGGGS(SEQ ID NO:6);
GQGQGQGQGQG(SEQ ID NO:19);
GSTSGSGKSSEKGKG(SEQ ID NO:20);
VPGVGVPGVG(SEQ ID NO:21);
SAPGTPSR(SEQ ID NO:22);
EGKSSGSGSESKEF(SEQ ID NO:23);
GSGGSG(SEQ ID NO:24)。
the first flexible peptide and the second flexible peptide may be any one of the above sequences, and may be the same sequence or different sequences.
In a preferred embodiment, the first flexible peptide and the second flexible peptide are each independently selected from the following sequences:
GGGGSGGGGSGGS(SEQ ID NO:5);GGGGSGGGGS(SEQ ID NO:6)。
the first flexible peptide and the second flexible peptide may be the same sequence or different sequences.
In a preferred embodiment, the first flexible peptide is SEQ ID NO:5, a sequence shown in seq id no; the second flexible peptide is SEQ ID NO: 6.
In a preferred embodiment, the fusion protein further comprises: a signal peptide for directing secretion of the fusion protein from within the expressing cell.
The signal peptide may be located at the N-terminus or the C-terminus of the fusion protein of the present invention, and in a preferred embodiment, the signal peptide is located at the N-terminus of the fusion protein without affecting the affinity activity and the luminescence activity in the fusion protein of the present invention.
In a preferred embodiment, the signal peptide sequence is as set forth in SEQ ID NO:7, as follows:
MGVKVLFALICIAVAEA(SEQ ID NO:7)。
in the present invention, methods useful for purifying fusion proteins include, but are not limited to: nickel column purification, ion exchange chromatography (Q column, P column), hydrophobic chromatography, heparin column chromatography, ammonium sulfate precipitation, etc.
In a preferred embodiment, the fusion protein of the invention further comprises: a fusion tag for affinity purification of the fusion protein. Specifically, the fusion tag is affinity-bound to a purification device (e.g., a purification column) used in various purification methods, and then the purified fusion protein is obtained by an appropriate method. The fusion tag may be located at the N-terminus or C-terminus, preferably at the C-terminus, of the fusion protein of the invention without affecting the antibody activity and the luminescent activity in the fusion protein of the invention.
The fusion tag can be a 6 XHis tag (6 XHis tag) or other fusion tags such as GST, MBP, SUMO, and the corresponding affinity purification method of the fusion tag is selected according to different fusion tags. In a preferred embodiment, the fusion tag is a 6 x histidine tag.
In a most preferred embodiment, the fusion protein of the invention has the following SEQ ID NO:8 or SEQ ID NO:9 is shown as follows:
MGVKVLFALICIAVAEAQVQLLQSAAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAVYYCARASPSGFDYWGQGTLVTVSSGGGGSGGGGS GGSQSVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLRAVVFGGGTKLTVLGGGGGGSGGGGSKPTENNEDFNIVAVASNFATTDLDADRGKLPGKKLPLEVLKEMEANARKAGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQGGIGEAIVDIPEIPGFKDLEPMEQFIAQVDLCVDCTTGCLKGLANVQCSDLLKKWLPQRCATFASKIQGQVDKIKGAGGDHHHHHH(SEQ ID NO:8)。
MGVKVLFALICIAVAEAQVQLLQSAAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAVYYCARASPSGFDYWGQGTLVTVSSGGGGSGGGGS GGSQSVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLRAVVFGGGTKLTVLGGGGGGSGGGGSKPTENNEDFNIVAVASNFATTDLDADRGKLPGKKLPLEVLKELEANARKAGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQGGIGEAIVDIPEIPGFKDLEPLEQFIAQVDLCVDCTTGCLKGLANVQCSDLLKKWLPQRCATFASKIQGQVDKIKGAGGDHHHHHH(SEQ ID NO:9)。
wherein the underlined sequence [ ]MGVKVLFALICIAVAEA) Representing a signal peptide; underlined sequence [ ]GGGGSGGGGSGGS) A first flexible peptide representing a heavy chain (H chain) variable region and a light chain (L chain) variable region of a digoxin single-chain antibody; underlined sequence [ ]GGGGSGGGGS) A second flexible peptide representing a linkage of a light chain (L chain) variable region and gaussian luciferase (Gluc); underlined sequence [ ]HHHHHH) Represents a 6 Xhistidine tag sequence.
The fusion protein of the invention can be obtained by the following method: cloning and recombining the screened Gaussian luciferase or continuous luminous mutant gene and the digoxin single-chain antibody gene by utilizing a PCR technology, constructing a digoxin single-chain antibody/Gaussian luciferase or continuous luminous mutant fusion protein recombinant vector, electrically transferring the recombinant vector into a host expression cell (such as a CHO cell), integrating the fusion protein gene into a chromosome, and screening a stable cell strain of the high-expression fusion antibody by utilizing neomycin G418; expanding culture of stable cell strain, centrifuging at low temperature to obtain supernatant, and separating and purifying the supernatant with nickel column; then Western Blot identification, separation and purification are carried out to obtain fusion protein; ELISA experiments identify the affinity activity of the fusion protein antibody portion; enzyme activity experiments identified the self-luminescent activity of the luciferase fraction. The fusion proteins all well retain the activity of both protein portions.
An embodiment of the invention provides an isolated nucleic acid encoding a fusion protein of the invention.
In a preferred embodiment, the isolated nucleic acid comprises a heavy chain variable region coding sequence, a light chain variable region coding sequence, and a gaussian luciferase coding sequence or a persistent luminescent mutant coding sequence of a digoxin single chain antibody, the heavy chain variable region coding sequence and the light chain variable region coding sequence being linked by a first linker sequence, and the gaussian luciferase coding sequence or the persistent luminescent mutant coding sequence and the heavy chain variable region coding sequence or the light chain variable region coding sequence being linked by a second linker sequence.
The nucleotide sequences encoding the same polypeptide or protein may be different due to the degeneracy of the codons, so long as the isolated nucleic acids of the invention are capable of encoding the fusion proteins of the invention. The sequence is not particularly limited.
In a preferred embodiment, the heavy chain variable region coding sequence is as set forth in SEQ ID NO:10, as shown in:
CAGGTGCAGCTGCTGCAGAGCGCCGCTGAGGTGAAGAAGCCAGGCGAGTCCCTGAAGATCAGCTGTAAGGGCTCCGGCTATAGCTTCACATCTTACTGGATCGGCTGGGTGAGACAGATGCCCGGCAAGGGCCTGGAGTGGATGGGCATCATCTATCCCGGCGACTCTGATACCCGCTACAGCCCTTCTTTTCAGGGCCAGGTGACCATCTCCGCTGATAAGTCCATCAGCACAGCCTATCTGCAGTGGTCCAGCCTGAAGGCTTCTGATACAGCCGTGTACTATTGCGCTAGGGCCTCTCCCTCCGGCTTTGACTACTGGGGCCAGGGCACCCTGGTGACAGTGTCTTCC(SEQ ID NO:10)。
in a preferred embodiment, the light chain variable region coding sequence is as set forth in SEQ ID NO:11, as shown in:
CAGTCTGTGCTGACCCAGCCACCTTCCGCTAGCGGAACCCCTGGACAGAGGGTGACAATCTCTTGTTCCGGCAGCTCTTCCAACATCGGCTCTAATTACGTGTATTGGTACCAGCAGCTGCCTGGCACAGCCCCAAAGCTGCTGATCTATAGGAACAATCAGAGGCCATCCGGAGTGCCTGATCGGTTCAGCGGATCTAAGTCCGGCACCTCCGCCTCCCTGGCTATCTCTGGCCTGAGGTCCGAGGATGAGGCTGACTACTATTGCGCTGCTTGGGACGATTCCCTGAGGGCTGTGGTGTTTGGAGGAGGAACCAAGCTGACAGTGCTGGGCGGA(SEQ ID NO:11)。
in a preferred embodiment, the gaussian luciferase coding sequence is as set forth in SEQ ID NO:12, as shown in:
AAGCCAACAGAGAACAATGAGGACTTCAACATCGTGGCTGTGGCCAGCAATTTTGCTACCACAGACCTGGATGCCGACAGAGGCAAGCTGCCAGGCAAGAAGCTGCCCCTGGAGGTGCTGAAGGAGATGGAGGCTAACGCCAGAAAGGCTGGCTGTACCCGCGGCTGCCTGATCTGTCTGTCCCACATCAAGTGCACACCTAAGATGAAGAAGTTCATCCCAGGCCGCTGTCATACCTACGAGGGCGATAAGGAGTCCGCCCAGGGAGGAATCGGAGAGGCCATCGTGGATATCCCAGAGATCCCCGGCTTCAAGGACCTGGAGCCTATGGAGCAGTTTATCGCTCAGGTGGATCTGTGCGTGGACTGTACCACAGGCTGCCTGAAGGGCCTGGCCAATGTGCAGTGTAGCGACCTGCTGAAGAAGTGGCTGCCACAGCGGTGCGCTACCTTTGCCTCTAAGATCCAGGGCCAGGTGGATAAGATCAAGGGAGCTGGAGGCGAC(SEQ ID NO:12)。
in a preferred embodiment, the bioluminescent mutant encodes the sequence set forth in SEQ ID NO:13, as shown in: AAGCCAACAGAGAACAATGAGGATTTCAACATCGTGGCTGTGGCCAGCAATTTTGCTACCACAGACCTGGATGCCGACAGAGGCAAGCTGCCAGGCAAGAAGCTGCCCCTGGAGGTGCTGAAGGAGCTCGAGGCTAACGCTAGGAAGGCTGGATGTACCAGGGGATGCCTGATCTGTCTGTCTCACATCAAGTGCACACCTAAGATGAAGAAGTTCATCCCAGGCCGCTGTCATACCTACGAGGGCGATAAGGAGTCCGCTCAGGGAGGAATCGGAGAGGCCATCGTGGATATCCCCGAGATCCCTGGCTTCAAGGACCTGGAGCCCCTCGAGCAGTTTATCGCTCAGGTGGATCTGTGCGTGGACTGTACCACAGGCTGCCTGAAGGGCCTGGCCAATGTGCAGTGTTCCGACCTGCTGAAGAAGTGGCTGCCTCAGAGGTGCGCTACCTTTGCCAGCAAGATCCAGGGCCAGGTGGATAAGATCAAGGGAGCTGGAGGCGAC(SEQ ID NO:13)。
In a preferred embodiment, the first and second linker sequences are each independently selected from the following sequences:
GGAGGAGGAGGAAGCGGAGGAGGAGGATCTGGAGGAAGC(SEQ ID NO:14);GGAGGAGGAGGATCCGGCGGAGGTGGAAGT(SEQ ID NO:15)。
the first and second linker sequences may be the same sequence or different sequences.
In a preferred embodiment, the first linking sequence is SEQ ID NO:14, a sequence shown in seq id no; the second linking sequence is SEQ id no: 15.
In a preferred embodiment, the isolated nucleic acid further comprises: a signal peptide coding sequence encoding a signal peptide for directing secretion of the fusion protein from within the expressing cell.
Since the signal peptide in the fusion protein of the present invention may be located at the N-terminus or the C-terminus of the fusion protein, the signal peptide coding sequence may be located at the 5 '-terminus or the 3' -terminus of the isolated nucleic acid. The signal peptide is located at the N-terminus of the fusion protein of the invention without affecting the affinity and luminescent activity of the fusion protein, and thus in a preferred embodiment, the signal peptide coding sequence is located at the 5' end of the isolated nucleic acid.
In a preferred embodiment, the signal peptide coding sequence is as set forth in SEQ ID NO:16, as shown in:
ATGGGCGTGAAGGTGCTGTTCGCCCTGATCTGCATCGCCGTGGCTGAGGCC(SEQ ID NO:16)。
in a preferred embodiment, the isolated nucleic acid further comprises a fusion tag coding sequence for encoding a fusion tag for affinity purification of the fusion protein described above.
In a preferred embodiment, the fusion tag coding sequence is a sequence encoding a 6 x histidine tag.
The fusion tag coding sequence may be located at the 3' end or the 5' end of the isolated nucleic acid, and in preferred embodiments, the fusion tag coding sequence is located at the 3' end of the isolated nucleic acid without affecting the antibody activity and expression of the light-emitting active moiety protein.
In a most preferred embodiment, the isolated nucleic acid sequence of the invention is as set forth in SEQ ID NO:17 or SEQ ID NO:18, as shown in:
ATGGGCGTGAAGGTGCTGTTCGCCCTGATCTGCATCGCCGTGGCTGAGGCCCAGGTGCAGCTGCTGCAGAGCGCCGCTGAGGTGAAGAAGCCAGGCGAGTCCCTGAAGATCAGCTGTAAGGGCTCCGGCTATAGCTTCACATCTTACTGGATCGGCTGGGTGAGACAGATGCCCGGCAAGGGCCTGGAGTGGATGGGCATCATCTATCCCGGCGACTCTGATACCCGCTACAGCCCTTCTTTTCAGGGCCAGGTGACCATCTCCGCTGATAAGTCCATCAGCACAGCCTATCTGCAGTGGTCCAGCCTGAAGGCTTCTGATACAGCCGTGTACTATTGCGCTAGGGCCTCTCCCTCCGGCTTTGACTACTGGGGCCAGGGCACCCTGGTGACAGTGTCTTCCGGAGGAGGAGGAAGCGGAGGAGGAGGATCTGGAGGAAGCCAGTCTGTGCTGACCCAGCCACCTTCCGCTAGCGGAACCCCTGGACAGAGGGTGACAATCTCTTGTTCCGGCAGCTCTTCCAACATCGGCTCTAATTACGTGTATTGGTACCAGCAGCTGCCTGGCACAGCCCCAAAGCTGCTGATCTATAGGAACAATCAGAGGCCATCCGGAGTGCCTGATCGGTTCAGCGGATCTAAGTCCGGCACCTCCGCCTCCCTGGCTATCTCTGGCCTGAGGTCCGAGGATGAGGCTGACTACTATTGCGCTGCTTGGGACGATTCCCTGAGGGCTGTGGTGTTTGGAGGAGGAACCAAGCTGACAGTGCTGGGCGGAGGAGGAGGAGGATCCGGCGGAGGTGGAAGTAAGCCAACAGAGAACAATGAGGACTTCAACATCGTGGCTGTGGCCAGCAATTTTGCTACCACAGACCTGGATGCCGACAGAGGCAAGCTGCCAGGCAAGAAGCTGCCCCTGGAGGTGCTGAAGGAGATGGAGGCTAACGCCAGAAAGGCTGGCTGTACCCGCGGCTGCCTGATCTGTCTGTCCCACATCAAGTGCACACCTAAGATGAAGAAGTTCATCCCAGGCCGCTGTCATACCTACGAGGGCGATAAGGAGTCCGCCCAGGGAGGAATCGGAGAGGCCATCGTGGATATCCCAGAGATCCCCGGCTTCAAGGACCTGGAGCCTATGGAGCAGTTTATCGCTCAGGTGGATCTGTGCGTGGACTGTACCACAGGCTGCCTGAAGGGCCTGGCCAATGTGCAGTGTAGCGACCTGCTGAAGAAGTGGCTGCCACAGCGGTGCGCTACCTTTGCCTCTAAGATCCAGGGCCAGGTGGATAAGATCAAGGGAGCTGGAGGCGACCACCATCACCATCACCAT(SEQ ID NO:17)。
ATGGGCGTGAAGGTGCTGTTCGCCCTGATCTGCATCGCCGTGGCTGAGGCCCAGGTGCAGCTGCTGCAGAGCGCCGCTGAGGTGAAGAAGCCAGGCGAGTCCCTGAAGATCAGCTGTAAGGGCTCCGGCTATAGCTTCACATCTTACTGGATCGGCTGGGTGAGACAGATGCCCGGCAAGGGCCTGGAGTGGATGGGCATCATCTATCCCGGCGACTCTGATACCCGCTACAGCCCTTCTTTTCAGGGCCAGGTGACCATCTCCGCTGATAAGTCCATCAGCACAGCCTATCTGCAGTGGTCCAGCCTGAAGGCTTCTGATACAGCCGTGTACTATTGCGCTAGGGCCTCTCCCTCCGGCTTTGACTACTGGGGCCAGGGCACCCTGGTGACAGTGTCTTCCGGAGGAGGAGGAAGCGGAGGAGGAGGATCTGGAGGAAGCCAGTCTGTGCTGACCCAGCCACCTTCCGCTAGCGGAACCCCTGGACAGAGGGTGACAATCTCTTGTTCCGGCAGCTCTTCCAACATCGGCTCTAATTACGTGTATTGGTACCAGCAGCTGCCTGGCACAGCCCCAAAGCTGCTGATCTATAGGAACAATCAGAGGCCATCCGGAGTGCCTGATCGGTTCAGCGGATCTAAGTCCGGCACCTCCGCCTCCCTGGCTATCTCTGGCCTGAGGTCCGAGGATGAGGCTGACTACTATTGCGCTGCTTGGGACGATTCCCTGAGGGCTGTGGTGTTTGGAGGAGGAACCAAGCTGACAGTGCTGGGCGGAGGAGGAGGAGGATCCGGCGGAGGTGGAAGTAAGCCAACAGAGAACAATGAGGATTTCAACATCGTGGCTGTGGCCAGCAATTTTGCTACCACAGACCTGGATGCCGACAGAGGCAAGCTGCCAGGCAAGAAGCTGCCCCTGGAGGTGCTGAAGGAGCTCGAGGCTAACGCTAGGAAGGCTGGATGTACCAGGGGATGCCTGATCTGTCTGTCTCACATCAAGTGCACACCTAAGATGAAGAAGTTCATCCCAGGCCGCTGTCATACCTACGAGGGCGATAAGGAGTCCGCTCAGGGAGGAATCGGAGAGGCCATCGTGGATATCCCCGAGATCCCTGGCTTCAAGGACCTGGAGCCCCTCGAGCAGTTTATCGCTCAGGTGGATCTGTGCGTGGACTGTACCACAGGCTGCCTGAAGGGCCTGGCCAATGTGCAGTGTTCCGACCTGCTGAAGAAGTGGCTGCCTCAGAGGTGCGCTACCTTTGCCAGCAAGATCCAGGGCCAGGTGGATAAGATCAAGGGAGCTGGAGGCGACCACCATCACCATCACCAT(SEQ ID NO:18)。
wherein, the underlined sequences from the 5 'end to the 3' end in the sequences are signal peptide coding sequences, respectively, a first linker sequence for linking the heavy chain variable region coding sequence and the light chain variable region coding sequence of the digoxin single-chain antibody, a second linker sequence for linking the light chain variable region coding sequence and the gaussian luciferase coding sequence, and a sequence for encoding a 6×histidine tag.
One embodiment of the invention provides an expression vector comprising a nucleic acid sequence encoding a fusion protein of the invention, and a vector backbone sequence. The vector backbone sequence may be any suitable expression vector sequence, for example, in one embodiment, the vector backbone sequence is pcDNA3.1 (+).
One embodiment of the present invention provides a recombinant host cell comprising an expression vector of the present invention. The host cell may be any host cell capable of expressing the fusion proteins of the invention, e.g., in one embodiment, CHO cells.
The invention also provides the use of fusion proteins, isolated nucleic acids, expression vectors or recombinant host cells in the detection of digoxin molecules.
The present invention is directed to the detection of digoxin molecules, which may be free digoxin molecules that are present independently, or may be in a form that binds to a suitable protein or the like, and the detection of such protein can be indirectly detected by detecting digoxin molecules that bind to such protein.
The fusion protein of the Gaussian luciferase and the digoxin single-chain antibody can specifically identify digoxin on one hand and has a self-luminous function on the other hand, and is convenient to detect. Compared with the existing mode of detecting digoxin through coupling amplification, the fusion protein has the advantages of simple process, convenience in production, simplicity and convenience in use and shorter time consumption.
The following detailed description of the present invention is provided by way of example only, and should not be construed as limiting the scope of the invention.
Example 1 construction of Fusion Protein (Fusion Protein) recombinant expression vector pcDNA3.1-anti DIG scFv-GLuc
As shown in FIG. 1, PCR amplification was performed by designing and synthesizing primers using heavy and light chain genes of digoxin antibody, gaussian luciferase gene and pCDNA3.1 plasmid as templates, respectively. The construction of the fusion protein anti DIG scFv-GLuc is based on a heavy chain gene (H chain) and a light chain gene (L chain) of a digoxin antibody, and the fusion protein anti DIG scFv-GLuc is connected by a first connecting sequence (Linker 1) (GGGGSGGGGSGGGGS) to carry out overlapping PCR extension amplification to obtain a complete scFv gene. The PCR product was detected by 1.0% agarose gel electrophoresis, and the target gene was recovered by agarose gel recovery kit. And based on the product and GLuc gene, connecting by using a second connecting sequence (Linker 2) (GGGGS), overlapping, performing PCR extension amplification to obtain a complete anti DIG scFv-GLuc gene (the sequence is shown as SEQ ID NO: 17), finally performing double enzyme digestion on a PCR amplification final product and a plasmid pCDNA3.1 by using restriction enzyme, and connecting overnight at 16 ℃ by using T4 ligase after the enzyme digestion product is recovered by using restriction enzyme. After ligation, E.coli HB2151 was transformed to be competent, plated, and the next day was picked up for double digestion and sequencing identification.
The mutant G2L fusion expression vector is based on a wild fusion protein expression vector which is successfully prepared, plasmid PCR is carried out by designing a primer containing a mutant gene (wherein the sequence of the anti DIG scFv-G2L gene is shown as SEQ ID NO: 18), and then the PCR product is treated by Dpn I enzyme and reacts for 2h at 37 ℃. The product was transformed into TOP10 competent cells and plated on LB plates containing 100 ng/. Mu.L ampicillin. The next day, the single clone was picked up on the plate, the plasmid was extracted after the expansion culture, and sequencing was performed to ensure the correct mutation site.
Example 2 transfection, expression and purification of fusion expression vectors
Mu.g of the constructed pcDNA3.1-anti DIG scFv-GLuc fusion protein expression plasmid was uniformly mixed with 1ml of cell culture medium. mu.L of the cell culture medium was mixed with 80. Mu.L of lipo2000 transfection reagent (Invitrogen). Mixing the diluted expression vector and the diluted transfection reagent, and standing at room temperature for 20 minutes. 25ml of a concentration of 2X 10 was prepared 6 Per ml of CHO cells, the mixed fusion protein expression plasmid and transfection reagent mixture was added to the cells and gently shaken. 37 ℃,8% CO 2 Culturing under the condition for 10 days.
Cell culture broth was collected and centrifuged at 8000rpm/min for 10min, and the supernatant was collected. The supernatant was filtered and applied to a nickel column, and washed with 10ml of PBS. 10ml were washed with buffer (20mM Tris,pH 8.0, 150mM NaCl,20mM imidazole) to remove the contaminating proteins and finally eluted with buffer (20mM Tris,pH 8.0, 150mM NaCl,500mM imidazole).
The eluted proteins were then detected by 10% SDS-PAGE. Western Blot identification was performed on the high purity protein samples. Constant current transfer at 250mA at 4℃for 1.5h, transfer proteins to PVDF membrane (from Millipore); after the transfer printing is finished, sealing the film in 5% skimmed milk for 2 hours at room temperature; washing 3 times with PBS, adding anti-H+ L, anti-Fc and anti-MICA antibody at a ratio of 1:2000, incubating at 37deg.C for 1H, washing 3 times with PBS (TPBS) containing 0.05% Tween, adding HRP-coupled goat anti-mouse IgG polyclonal antibody at a ratio of 1:5000, incubating at 37deg.C for 1H, washing with TBS for 3 times, dripping ECL luminescent color development liquid, and exposing and photographing with a gel imager. The final purified and identified samples were dialyzed or ultrafiltered into PBS, snap frozen in liquid nitrogen and stored at-70 ℃. FIG. 2 shows SDS-PAGE and Western Blot detection results, and shows that the eluted protein has clear bands and higher purity.
The pcDNA3.1-anti DIG scFv-G2L fusion protein expression plasmid was similarly constructed as described above.
Example 3 fusion protein antibody portion Elisa test affinity experiments
(1) Antigen 100. Mu.L BSA-DIG protein was coated on the enzyme strips at a concentration of 1. Mu.g/ml overnight. 200. Mu.L of PBST was added and washed with shaking for 10min, 3 times in total and 3 times in PBS.
(2) 200. Mu.L of 1% BSA-PBS was added thereto and the mixture was blocked at 37℃for 2 hours. PBST 200. Mu.L, washed 10min, washed 3 times, PBS 200. Mu.L, washed 10min, washed 3 times.
(3) 100 mu L of a protein solution to be detected with concentration gradient dilution is added, and the mixture is incubated for 2 hours at 37 ℃. PBST 200. Mu.L, washed 10min, washed 3 times, PBS 200. Mu.L, washed 10min, washed 3 times.
(4) Diluted commercial horseradish peroxidase-conjugated murine anti-6 x his antibody was added 100 μl and incubated for 1h at 37 ℃. PBST 200. Mu.L, washed 10min, washed 3 times, PBS 200. Mu.L, washed 10min, washed 3 times.
(5) The color development was performed for 10min using tetramethyl benzidine microporous peroxidase substrate (TMB) as a substrate.
(6) After the reaction was terminated by adding 50. Mu.L of sulfuric acid at a concentration of 0.1mol/L, the absorbance at 450nm was measured.
(7) The absorbance and concentration were analyzed, and the result of the effect analysis is shown in fig. 3.
The results show that: the binding force to digoxin of the fusion proteins anti DIG scFv-GLuc and anti DIG scFv-G2L is measured by an antibody part Elisa method, which shows that the fusion protein retains the affinity activity of the antibody to digoxin.
Example 4 detection of luciferase partial Activity of fusion proteins
The fusion protein was diluted to 3nM with substrate dilution (50 mM Tris, pH 8.0, 100mM NaCl) and 10. Mu.L was added to a 96-well ELISA plate. The substrate coelenterazine 90. Mu.L diluted to 10. Mu.M with the same solution was then added, and the luminescence intensity (CL values) was read from the luminescence module using a microplate reader, and the results are shown in FIG. 4.
The results show that: the luciferase parts of the fusion protein anti DIG scFv-GLuc and the anti DIG scFv-G2L both catalyze self-luminescence activity, and the fusion protein retains the activity of the luciferase for catalyzing the substrate to emit light.
Example 5 detection of bifunctional Activity of fusion proteins ELISA detection binding and bioluminescence experiments
(1) Antigen 100. Mu.L BSA-DIG protein was coated on the enzyme strips at a concentration of 1. Mu.g/ml overnight. 200. Mu.L of PBST was added and washed with shaking for 10min, 3 times, and 3 times with PBS.
(2) 200. Mu.L of 1% BSA-PBS was added thereto and the mixture was blocked at 37℃for 2 hours. PBST 200. Mu.L, washed 10min, washed 3 times, PBS 200. Mu.L, washed 10min, washed 3 times.
(3) 100 mu L of a protein solution to be detected with concentration gradient dilution is added, and the mixture is incubated for 2 hours at 37 ℃. PBST 200. Mu.L, washed 10min, washed 3 times, PBS 200. Mu.L, washed 10min, washed 3 times.
(4) The substrate coelenterazine 90. Mu.L diluted to 10. Mu.M with the solution was added and the luminescence intensity (CL values) read from the luminescence module using a microplate reader.
(5) The absorbance and concentration were analyzed, and the result of the effect analysis is shown in fig. 5.
The results show that: the fusion proteins anti DIG scFv-GLuc and anti DIG scFv-G2L have the dual-function activity of an antibody and luciferase, and can catalyze the substrate to bioluminescence after combining with target digoxin.
The foregoing description of the invention has been presented for purposes of illustration and description, and is not intended to be limiting. Several simple deductions, modifications or substitutions may also be made by a person skilled in the art to which the invention pertains, based on the idea of the invention.
SEQUENCE LISTING
<110> Shenzhen Hua institute of great life science
<120> fusion protein of Gauss luciferase and digoxin single-chain antibody and application thereof
<130> 18I27209
<160> 24
<170> PatentIn version 3.3
<210> 1
<211> 117
<212> PRT
<213> artificial sequence
<400> 1
Gln Val Gln Leu Leu Gln Ser Ala Ala Glu Val Lys Lys Pro Gly Glu
1 5 10 15
Ser Leu Lys Ile Ser Cys Lys Gly Ser Gly Tyr Ser Phe Thr Ser Tyr
20 25 30
Trp Ile Gly Trp Val Arg Gln Met Pro Gly Lys Gly Leu Glu Trp Met
35 40 45
Gly Ile Ile Tyr Pro Gly Asp Ser Asp Thr Arg Tyr Ser Pro Ser Phe
50 55 60
Gln Gly Gln Val Thr Ile Ser Ala Asp Lys Ser Ile Ser Thr Ala Tyr
65 70 75 80
Leu Gln Trp Ser Ser Leu Lys Ala Ser Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Arg Ala Ser Pro Ser Gly Phe Asp Tyr Trp Gly Gln Gly Thr Leu
100 105 110
Val Thr Val Ser Ser
115
<210> 2
<211> 112
<212> PRT
<213> artificial sequence
<400> 2
Gln Ser Val Leu Thr Gln Pro Pro Ser Ala Ser Gly Thr Pro Gly Gln
1 5 10 15
Arg Val Thr Ile Ser Cys Ser Gly Ser Ser Ser Asn Ile Gly Ser Asn
20 25 30
Tyr Val Tyr Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu
35 40 45
Ile Tyr Arg Asn Asn Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser
50 55 60
Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Ser Gly Leu Arg
65 70 75 80
Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Ala Ala Trp Asp Asp Ser Leu
85 90 95
Arg Ala Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Gly Gly
100 105 110
<210> 3
<211> 168
<212> PRT
<213> artificial sequence
<400> 3
Lys Pro Thr Glu Asn Asn Glu Asp Phe Asn Ile Val Ala Val Ala Ser
1 5 10 15
Asn Phe Ala Thr Thr Asp Leu Asp Ala Asp Arg Gly Lys Leu Pro Gly
20 25 30
Lys Lys Leu Pro Leu Glu Val Leu Lys Glu Met Glu Ala Asn Ala Arg
35 40 45
Lys Ala Gly Cys Thr Arg Gly Cys Leu Ile Cys Leu Ser His Ile Lys
50 55 60
Cys Thr Pro Lys Met Lys Lys Phe Ile Pro Gly Arg Cys His Thr Tyr
65 70 75 80
Glu Gly Asp Lys Glu Ser Ala Gln Gly Gly Ile Gly Glu Ala Ile Val
85 90 95
Asp Ile Pro Glu Ile Pro Gly Phe Lys Asp Leu Glu Pro Met Glu Gln
100 105 110
Phe Ile Ala Gln Val Asp Leu Cys Val Asp Cys Thr Thr Gly Cys Leu
115 120 125
Lys Gly Leu Ala Asn Val Gln Cys Ser Asp Leu Leu Lys Lys Trp Leu
130 135 140
Pro Gln Arg Cys Ala Thr Phe Ala Ser Lys Ile Gln Gly Gln Val Asp
145 150 155 160
Lys Ile Lys Gly Ala Gly Gly Asp
165
<210> 4
<211> 168
<212> PRT
<213> artificial sequence
<400> 4
Lys Pro Thr Glu Asn Asn Glu Asp Phe Asn Ile Val Ala Val Ala Ser
1 5 10 15
Asn Phe Ala Thr Thr Asp Leu Asp Ala Asp Arg Gly Lys Leu Pro Gly
20 25 30
Lys Lys Leu Pro Leu Glu Val Leu Lys Glu Leu Glu Ala Asn Ala Arg
35 40 45
Lys Ala Gly Cys Thr Arg Gly Cys Leu Ile Cys Leu Ser His Ile Lys
50 55 60
Cys Thr Pro Lys Met Lys Lys Phe Ile Pro Gly Arg Cys His Thr Tyr
65 70 75 80
Glu Gly Asp Lys Glu Ser Ala Gln Gly Gly Ile Gly Glu Ala Ile Val
85 90 95
Asp Ile Pro Glu Ile Pro Gly Phe Lys Asp Leu Glu Pro Leu Glu Gln
100 105 110
Phe Ile Ala Gln Val Asp Leu Cys Val Asp Cys Thr Thr Gly Cys Leu
115 120 125
Lys Gly Leu Ala Asn Val Gln Cys Ser Asp Leu Leu Lys Lys Trp Leu
130 135 140
Pro Gln Arg Cys Ala Thr Phe Ala Ser Lys Ile Gln Gly Gln Val Asp
145 150 155 160
Lys Ile Lys Gly Ala Gly Gly Asp
165
<210> 5
<211> 13
<212> PRT
<213> artificial sequence
<400> 5
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Ser
1 5 10
<210> 6
<211> 10
<212> PRT
<213> artificial sequence
<400> 6
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
1 5 10
<210> 7
<211> 17
<212> PRT
<213> artificial sequence
<400> 7
Met Gly Val Lys Val Leu Phe Ala Leu Ile Cys Ile Ala Val Ala Glu
1 5 10 15
Ala
<210> 8
<211> 443
<212> PRT
<213> artificial sequence
<400> 8
Met Gly Val Lys Val Leu Phe Ala Leu Ile Cys Ile Ala Val Ala Glu
1 5 10 15
Ala Gln Val Gln Leu Leu Gln Ser Ala Ala Glu Val Lys Lys Pro Gly
20 25 30
Glu Ser Leu Lys Ile Ser Cys Lys Gly Ser Gly Tyr Ser Phe Thr Ser
35 40 45
Tyr Trp Ile Gly Trp Val Arg Gln Met Pro Gly Lys Gly Leu Glu Trp
50 55 60
Met Gly Ile Ile Tyr Pro Gly Asp Ser Asp Thr Arg Tyr Ser Pro Ser
65 70 75 80
Phe Gln Gly Gln Val Thr Ile Ser Ala Asp Lys Ser Ile Ser Thr Ala
85 90 95
Tyr Leu Gln Trp Ser Ser Leu Lys Ala Ser Asp Thr Ala Val Tyr Tyr
100 105 110
Cys Ala Arg Ala Ser Pro Ser Gly Phe Asp Tyr Trp Gly Gln Gly Thr
115 120 125
Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
130 135 140
Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro Ser Ala Ser Gly Thr
145 150 155 160
Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly Ser Ser Ser Asn Ile
165 170 175
Gly Ser Asn Tyr Val Tyr Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro
180 185 190
Lys Leu Leu Ile Tyr Arg Asn Asn Gln Arg Pro Ser Gly Val Pro Asp
195 200 205
Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Ser
210 215 220
Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Ala Ala Trp Asp
225 230 235 240
Asp Ser Leu Arg Ala Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val
245 250 255
Leu Gly Gly Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Lys Pro Thr
260 265 270
Glu Asn Asn Glu Asp Phe Asn Ile Val Ala Val Ala Ser Asn Phe Ala
275 280 285
Thr Thr Asp Leu Asp Ala Asp Arg Gly Lys Leu Pro Gly Lys Lys Leu
290 295 300
Pro Leu Glu Val Leu Lys Glu Met Glu Ala Asn Ala Arg Lys Ala Gly
305 310 315 320
Cys Thr Arg Gly Cys Leu Ile Cys Leu Ser His Ile Lys Cys Thr Pro
325 330 335
Lys Met Lys Lys Phe Ile Pro Gly Arg Cys His Thr Tyr Glu Gly Asp
340 345 350
Lys Glu Ser Ala Gln Gly Gly Ile Gly Glu Ala Ile Val Asp Ile Pro
355 360 365
Glu Ile Pro Gly Phe Lys Asp Leu Glu Pro Met Glu Gln Phe Ile Ala
370 375 380
Gln Val Asp Leu Cys Val Asp Cys Thr Thr Gly Cys Leu Lys Gly Leu
385 390 395 400
Ala Asn Val Gln Cys Ser Asp Leu Leu Lys Lys Trp Leu Pro Gln Arg
405 410 415
Cys Ala Thr Phe Ala Ser Lys Ile Gln Gly Gln Val Asp Lys Ile Lys
420 425 430
Gly Ala Gly Gly Asp His His His His His His
435 440
<210> 9
<211> 443
<212> PRT
<213> artificial sequence
<400> 9
Met Gly Val Lys Val Leu Phe Ala Leu Ile Cys Ile Ala Val Ala Glu
1 5 10 15
Ala Gln Val Gln Leu Leu Gln Ser Ala Ala Glu Val Lys Lys Pro Gly
20 25 30
Glu Ser Leu Lys Ile Ser Cys Lys Gly Ser Gly Tyr Ser Phe Thr Ser
35 40 45
Tyr Trp Ile Gly Trp Val Arg Gln Met Pro Gly Lys Gly Leu Glu Trp
50 55 60
Met Gly Ile Ile Tyr Pro Gly Asp Ser Asp Thr Arg Tyr Ser Pro Ser
65 70 75 80
Phe Gln Gly Gln Val Thr Ile Ser Ala Asp Lys Ser Ile Ser Thr Ala
85 90 95
Tyr Leu Gln Trp Ser Ser Leu Lys Ala Ser Asp Thr Ala Val Tyr Tyr
100 105 110
Cys Ala Arg Ala Ser Pro Ser Gly Phe Asp Tyr Trp Gly Gln Gly Thr
115 120 125
Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
130 135 140
Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro Ser Ala Ser Gly Thr
145 150 155 160
Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly Ser Ser Ser Asn Ile
165 170 175
Gly Ser Asn Tyr Val Tyr Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro
180 185 190
Lys Leu Leu Ile Tyr Arg Asn Asn Gln Arg Pro Ser Gly Val Pro Asp
195 200 205
Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Ser
210 215 220
Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Ala Ala Trp Asp
225 230 235 240
Asp Ser Leu Arg Ala Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val
245 250 255
Leu Gly Gly Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Lys Pro Thr
260 265 270
Glu Asn Asn Glu Asp Phe Asn Ile Val Ala Val Ala Ser Asn Phe Ala
275 280 285
Thr Thr Asp Leu Asp Ala Asp Arg Gly Lys Leu Pro Gly Lys Lys Leu
290 295 300
Pro Leu Glu Val Leu Lys Glu Leu Glu Ala Asn Ala Arg Lys Ala Gly
305 310 315 320
Cys Thr Arg Gly Cys Leu Ile Cys Leu Ser His Ile Lys Cys Thr Pro
325 330 335
Lys Met Lys Lys Phe Ile Pro Gly Arg Cys His Thr Tyr Glu Gly Asp
340 345 350
Lys Glu Ser Ala Gln Gly Gly Ile Gly Glu Ala Ile Val Asp Ile Pro
355 360 365
Glu Ile Pro Gly Phe Lys Asp Leu Glu Pro Leu Glu Gln Phe Ile Ala
370 375 380
Gln Val Asp Leu Cys Val Asp Cys Thr Thr Gly Cys Leu Lys Gly Leu
385 390 395 400
Ala Asn Val Gln Cys Ser Asp Leu Leu Lys Lys Trp Leu Pro Gln Arg
405 410 415
Cys Ala Thr Phe Ala Ser Lys Ile Gln Gly Gln Val Asp Lys Ile Lys
420 425 430
Gly Ala Gly Gly Asp His His His His His His
435 440
<210> 10
<211> 351
<212> DNA
<213> artificial sequence
<400> 10
caggtgcagc tgctgcagag cgccgctgag gtgaagaagc caggcgagtc cctgaagatc 60
agctgtaagg gctccggcta tagcttcaca tcttactgga tcggctgggt gagacagatg 120
cccggcaagg gcctggagtg gatgggcatc atctatcccg gcgactctga tacccgctac 180
agcccttctt ttcagggcca ggtgaccatc tccgctgata agtccatcag cacagcctat 240
ctgcagtggt ccagcctgaa ggcttctgat acagccgtgt actattgcgc tagggcctct 300
ccctccggct ttgactactg gggccagggc accctggtga cagtgtcttc c 351
<210> 11
<211> 336
<212> DNA
<213> artificial sequence
<400> 11
cagtctgtgc tgacccagcc accttccgct agcggaaccc ctggacagag ggtgacaatc 60
tcttgttccg gcagctcttc caacatcggc tctaattacg tgtattggta ccagcagctg 120
cctggcacag ccccaaagct gctgatctat aggaacaatc agaggccatc cggagtgcct 180
gatcggttca gcggatctaa gtccggcacc tccgcctccc tggctatctc tggcctgagg 240
tccgaggatg aggctgacta ctattgcgct gcttgggacg attccctgag ggctgtggtg 300
tttggaggag gaaccaagct gacagtgctg ggcgga 336
<210> 12
<211> 504
<212> DNA
<213> artificial sequence
<400> 12
aagccaacag agaacaatga ggacttcaac atcgtggctg tggccagcaa ttttgctacc 60
acagacctgg atgccgacag aggcaagctg ccaggcaaga agctgcccct ggaggtgctg 120
aaggagatgg aggctaacgc cagaaaggct ggctgtaccc gcggctgcct gatctgtctg 180
tcccacatca agtgcacacc taagatgaag aagttcatcc caggccgctg tcatacctac 240
gagggcgata aggagtccgc ccagggagga atcggagagg ccatcgtgga tatcccagag 300
atccccggct tcaaggacct ggagcctatg gagcagttta tcgctcaggt ggatctgtgc 360
gtggactgta ccacaggctg cctgaagggc ctggccaatg tgcagtgtag cgacctgctg 420
aagaagtggc tgccacagcg gtgcgctacc tttgcctcta agatccaggg ccaggtggat 480
aagatcaagg gagctggagg cgac 504
<210> 13
<211> 504
<212> DNA
<213> artificial sequence
<400> 13
aagccaacag agaacaatga ggatttcaac atcgtggctg tggccagcaa ttttgctacc 60
acagacctgg atgccgacag aggcaagctg ccaggcaaga agctgcccct ggaggtgctg 120
aaggagctcg aggctaacgc taggaaggct ggatgtacca ggggatgcct gatctgtctg 180
tctcacatca agtgcacacc taagatgaag aagttcatcc caggccgctg tcatacctac 240
gagggcgata aggagtccgc tcagggagga atcggagagg ccatcgtgga tatccccgag 300
atccctggct tcaaggacct ggagcccctc gagcagttta tcgctcaggt ggatctgtgc 360
gtggactgta ccacaggctg cctgaagggc ctggccaatg tgcagtgttc cgacctgctg 420
aagaagtggc tgcctcagag gtgcgctacc tttgccagca agatccaggg ccaggtggat 480
aagatcaagg gagctggagg cgac 504
<210> 14
<211> 39
<212> DNA
<213> artificial sequence
<400> 14
ggaggaggag gaagcggagg aggaggatct ggaggaagc 39
<210> 15
<211> 30
<212> DNA
<213> artificial sequence
<400> 15
ggaggaggag gatccggcgg aggtggaagt 30
<210> 16
<211> 51
<212> DNA
<213> artificial sequence
<400> 16
atgggcgtga aggtgctgtt cgccctgatc tgcatcgccg tggctgaggc c 51
<210> 17
<211> 1329
<212> DNA
<213> artificial sequence
<400> 17
atgggcgtga aggtgctgtt cgccctgatc tgcatcgccg tggctgaggc ccaggtgcag 60
ctgctgcaga gcgccgctga ggtgaagaag ccaggcgagt ccctgaagat cagctgtaag 120
ggctccggct atagcttcac atcttactgg atcggctggg tgagacagat gcccggcaag 180
ggcctggagt ggatgggcat catctatccc ggcgactctg atacccgcta cagcccttct 240
tttcagggcc aggtgaccat ctccgctgat aagtccatca gcacagccta tctgcagtgg 300
tccagcctga aggcttctga tacagccgtg tactattgcg ctagggcctc tccctccggc 360
tttgactact ggggccaggg caccctggtg acagtgtctt ccggaggagg aggaagcgga 420
ggaggaggat ctggaggaag ccagtctgtg ctgacccagc caccttccgc tagcggaacc 480
cctggacaga gggtgacaat ctcttgttcc ggcagctctt ccaacatcgg ctctaattac 540
gtgtattggt accagcagct gcctggcaca gccccaaagc tgctgatcta taggaacaat 600
cagaggccat ccggagtgcc tgatcggttc agcggatcta agtccggcac ctccgcctcc 660
ctggctatct ctggcctgag gtccgaggat gaggctgact actattgcgc tgcttgggac 720
gattccctga gggctgtggt gtttggagga ggaaccaagc tgacagtgct gggcggagga 780
ggaggaggat ccggcggagg tggaagtaag ccaacagaga acaatgagga cttcaacatc 840
gtggctgtgg ccagcaattt tgctaccaca gacctggatg ccgacagagg caagctgcca 900
ggcaagaagc tgcccctgga ggtgctgaag gagatggagg ctaacgccag aaaggctggc 960
tgtacccgcg gctgcctgat ctgtctgtcc cacatcaagt gcacacctaa gatgaagaag 1020
ttcatcccag gccgctgtca tacctacgag ggcgataagg agtccgccca gggaggaatc 1080
ggagaggcca tcgtggatat cccagagatc cccggcttca aggacctgga gcctatggag 1140
cagtttatcg ctcaggtgga tctgtgcgtg gactgtacca caggctgcct gaagggcctg 1200
gccaatgtgc agtgtagcga cctgctgaag aagtggctgc cacagcggtg cgctaccttt 1260
gcctctaaga tccagggcca ggtggataag atcaagggag ctggaggcga ccaccatcac 1320
catcaccat 1329
<210> 18
<211> 1329
<212> DNA
<213> artificial sequence
<400> 18
atgggcgtga aggtgctgtt cgccctgatc tgcatcgccg tggctgaggc ccaggtgcag 60
ctgctgcaga gcgccgctga ggtgaagaag ccaggcgagt ccctgaagat cagctgtaag 120
ggctccggct atagcttcac atcttactgg atcggctggg tgagacagat gcccggcaag 180
ggcctggagt ggatgggcat catctatccc ggcgactctg atacccgcta cagcccttct 240
tttcagggcc aggtgaccat ctccgctgat aagtccatca gcacagccta tctgcagtgg 300
tccagcctga aggcttctga tacagccgtg tactattgcg ctagggcctc tccctccggc 360
tttgactact ggggccaggg caccctggtg acagtgtctt ccggaggagg aggaagcgga 420
ggaggaggat ctggaggaag ccagtctgtg ctgacccagc caccttccgc tagcggaacc 480
cctggacaga gggtgacaat ctcttgttcc ggcagctctt ccaacatcgg ctctaattac 540
gtgtattggt accagcagct gcctggcaca gccccaaagc tgctgatcta taggaacaat 600
cagaggccat ccggagtgcc tgatcggttc agcggatcta agtccggcac ctccgcctcc 660
ctggctatct ctggcctgag gtccgaggat gaggctgact actattgcgc tgcttgggac 720
gattccctga gggctgtggt gtttggagga ggaaccaagc tgacagtgct gggcggagga 780
ggaggaggat ccggcggagg tggaagtaag ccaacagaga acaatgagga tttcaacatc 840
gtggctgtgg ccagcaattt tgctaccaca gacctggatg ccgacagagg caagctgcca 900
ggcaagaagc tgcccctgga ggtgctgaag gagctcgagg ctaacgctag gaaggctgga 960
tgtaccaggg gatgcctgat ctgtctgtct cacatcaagt gcacacctaa gatgaagaag 1020
ttcatcccag gccgctgtca tacctacgag ggcgataagg agtccgctca gggaggaatc 1080
ggagaggcca tcgtggatat ccccgagatc cctggcttca aggacctgga gcccctcgag 1140
cagtttatcg ctcaggtgga tctgtgcgtg gactgtacca caggctgcct gaagggcctg 1200
gccaatgtgc agtgttccga cctgctgaag aagtggctgc ctcagaggtg cgctaccttt 1260
gccagcaaga tccagggcca ggtggataag atcaagggag ctggaggcga ccaccatcac 1320
catcaccat 1329
<210> 19
<211> 11
<212> PRT
<213> artificial sequence
<400> 19
Gly Gln Gly Gln Gly Gln Gly Gln Gly Gln Gly
1 5 10
<210> 20
<211> 15
<212> PRT
<213> artificial sequence
<400> 20
Gly Ser Thr Ser Gly Ser Gly Lys Ser Ser Glu Lys Gly Lys Gly
1 5 10 15
<210> 21
<211> 10
<212> PRT
<213> artificial sequence
<400> 21
Val Pro Gly Val Gly Val Pro Gly Val Gly
1 5 10
<210> 22
<211> 8
<212> PRT
<213> artificial sequence
<400> 22
Ser Ala Pro Gly Thr Pro Ser Arg
1 5
<210> 23
<211> 14
<212> PRT
<213> artificial sequence
<400> 23
Glu Gly Lys Ser Ser Gly Ser Gly Ser Glu Ser Lys Glu Phe
1 5 10
<210> 24
<211> 6
<212> PRT
<213> artificial sequence
<400> 24
Gly Ser Gly Gly Ser Gly
1 5

Claims (6)

1. A fusion protein of a gauss luciferase and a digoxin single-chain antibody, characterized in that the fusion protein comprises a heavy chain variable region, a light chain variable region and a gauss luciferase or a continuously-emitting mutant of the digoxin single-chain antibody, wherein the heavy chain variable region and the light chain variable region are connected through a first flexible peptide, and the gauss luciferase or the continuously-emitting mutant is connected with the heavy chain variable region or the light chain variable region through a second flexible peptide;
the sequence of the fusion protein is shown as SEQ ID NO:8 or SEQ ID NO: shown at 9.
2. An isolated nucleic acid encoding the fusion protein of claim 1.
3. The isolated nucleic acid of claim 2, wherein the isolated nucleic acid sequence is set forth in SEQ ID NO:17 or SEQ ID NO: shown at 18.
4. An expression vector comprising a nucleic acid sequence encoding the fusion protein of claim 1, and a vector backbone sequence.
5. A recombinant host cell comprising the expression vector of claim 4.
6. Use of the fusion protein of claim 1, the isolated nucleic acid of claim 2 or 3, the expression vector of claim 4 or the recombinant host cell of claim 5 in the detection of digoxin molecules for non-diagnostic and therapeutic purposes.
CN201811475418.2A 2018-12-04 2018-12-04 Fusion protein of Gauss luciferase and digoxin single-chain antibody and application thereof Active CN111269324B (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN201811475418.2A CN111269324B (en) 2018-12-04 2018-12-04 Fusion protein of Gauss luciferase and digoxin single-chain antibody and application thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN201811475418.2A CN111269324B (en) 2018-12-04 2018-12-04 Fusion protein of Gauss luciferase and digoxin single-chain antibody and application thereof

Publications (2)

Publication Number Publication Date
CN111269324A CN111269324A (en) 2020-06-12
CN111269324B true CN111269324B (en) 2023-10-20

Family

ID=70993207

Family Applications (1)

Application Number Title Priority Date Filing Date
CN201811475418.2A Active CN111269324B (en) 2018-12-04 2018-12-04 Fusion protein of Gauss luciferase and digoxin single-chain antibody and application thereof

Country Status (1)

Country Link
CN (1) CN111269324B (en)

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN116396392B (en) * 2023-01-17 2023-10-27 珠海重链生物科技有限公司 Antibody specific to digoxigenin and related application thereof
WO2023109981A2 (en) * 2023-04-11 2023-06-22 深圳华大智造科技股份有限公司 Novel copepod luciferase mutant and application thereof
CN117362447B (en) * 2023-08-25 2024-04-09 广东省农业科学院农业生物基因研究中心 Bioluminescence enzyme-linked immunoassay method based on protein coupled polymer

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN1375505A (en) * 2001-03-19 2002-10-23 中国人民解放军总医院 Genetically engineering monoclonal anti-digoxin single-stranded antibody and its use
CN105779472A (en) * 2016-02-23 2016-07-20 重庆医科大学 Gaussia luciferase genetic mutant and fusion protein thereof
CN106282229A (en) * 2016-08-26 2017-01-04 广州市皮肤病防治所 For screening the recombiant plasmid of Nrf2 activator and construction method thereof and purposes

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN1375505A (en) * 2001-03-19 2002-10-23 中国人民解放军总医院 Genetically engineering monoclonal anti-digoxin single-stranded antibody and its use
CN105779472A (en) * 2016-02-23 2016-07-20 重庆医科大学 Gaussia luciferase genetic mutant and fusion protein thereof
CN106282229A (en) * 2016-08-26 2017-01-04 广州市皮肤病防治所 For screening the recombiant plasmid of Nrf2 activator and construction method thereof and purposes

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
Gaussia Luciferase as a Genetic Fusion Partner with Antibody Fragments for Sensitive Immunoassay Monitoring of Clinical Biomarkers;Hiroyuki Oyama等;《American Chemical Society》;第87卷;摘要,第12394页结论部分 *
信号肽对O型口蹄疫病毒重组表位蛋白在CHO中表达及分泌的影响;孙振文等;《中国兽医科学》(第03期);全文 *

Also Published As

Publication number Publication date
CN111269324A (en) 2020-06-12

Similar Documents

Publication Publication Date Title
US20220315628A1 (en) Amino acid-specific binder and selectively identifying an amino acid
CA2583009C (en) Ubiquitin or gamma-crystalline conjugates for use in therapy, diagnosis and chromatography
CA2267068C (en) Renilla luciferase and green fluorescent protein fusion genes
Kerschbaumer et al. Single-chain Fv fusion proteins suitable as coating and detecting reagents in a double antibody sandwich enzyme-linked immunosorbent assay
CN111269324B (en) Fusion protein of Gauss luciferase and digoxin single-chain antibody and application thereof
EP1728866B1 (en) Luciferase expression cassettes and methods of use
US20240027344A1 (en) Fluorescent Probe for Branched Chain Amino Acids and Use Thereof
CN108484764B (en) Nano antibody for green fluorescent protein and its coding sequence
CN111269322B (en) Fusion protein of streptavidin and Gaussian luciferase and application thereof
CN111269323B (en) Fusion protein of monomer streptavidin and gauss luciferase and application thereof
CN114057861B (en) bio-PROTAC artificial protein targeting UBE2C
KR101247374B1 (en) Novel peptides with specific binding to Fc domain of IgG and their preparation methods
CN110078832B (en) ZZ domain-based secondary antibody and preparation method and application thereof
CN109880840B (en) In vivo biotinylation labeling system for recombinant protein escherichia coli
US7241864B2 (en) Recombinant photoproteins and their conjugates
KR102607655B1 (en) Method for producing refolded recombinant humanized ranibizumab
US20160319287A1 (en) Atypical inteins
WO2024000408A1 (en) Luciferase mutant and use thereof
US7879578B2 (en) Self-assembled proteins and related methods and protein structures
CN113087807B (en) Shiga toxin B subunit recombinant protein-based probe for detecting carbohydrate antigen and preparation method thereof
CN115703843A (en) Fusion protein, related nucleic acid molecule thereof and application thereof in high-throughput sequencing
CN109096394B (en) Nano antibody of B subunit of anti-staphylococcal protein A, nucleic acid molecule and application
RU2565545C1 (en) RECOMBINANT PLASMID DNA pFLAG-sc14D5a-Rm7 ENSURING SYNTHESIS OF HYBRID PROTEIN sc14D5a-Rm7, BACTERIA STRAIN Escherichia coli - PRODUCER OF HYBRID PROTEIN sc14D5a-Rm7, AND HYBRID PROTEIN sc14D5a-Rm7, COMBINING PROTEIN E OF TICK-BORNE ENCEPHALITIS MICE AND HAVING BIO-LUMINESCENCE ACTIVITY
US11214791B2 (en) Engineered FHA domains
KR20120049206A (en) Gfp-specific single domain antibody

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
TA01 Transfer of patent application right

Effective date of registration: 20230912

Address after: 266400 building 4, No. 2, hengyunshan Road, Qingdao area, China (Shandong) pilot Free Trade Zone, Huangdao District, Qingdao City, Shandong Province

Applicant after: Qingdao Huada Zhizao Technology Co.,Ltd.

Address before: 518083 7th floor, building 11, Beishan Industrial Zone, 146 Beishan Road, Yangang community, Yantian street, Yantian District, Shenzhen City, Guangdong Province

Applicant before: Shenzhen Huada zhizaojichuang Technology Co.,Ltd.

TA01 Transfer of patent application right
GR01 Patent grant
GR01 Patent grant