CN110066835A - A kind of application of lipase in resolution of racemic 2- bromo ethyl isovalerate - Google Patents
A kind of application of lipase in resolution of racemic 2- bromo ethyl isovalerate Download PDFInfo
- Publication number
- CN110066835A CN110066835A CN201910217266.4A CN201910217266A CN110066835A CN 110066835 A CN110066835 A CN 110066835A CN 201910217266 A CN201910217266 A CN 201910217266A CN 110066835 A CN110066835 A CN 110066835A
- Authority
- CN
- China
- Prior art keywords
- lipase
- application
- ethyl isovalerate
- bromo ethyl
- reaction
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P41/00—Processes using enzymes or microorganisms to separate optical isomers from a racemic mixture
- C12P41/001—Processes using enzymes or microorganisms to separate optical isomers from a racemic mixture by metabolizing one of the enantiomers
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P7/00—Preparation of oxygen-containing organic compounds
- C12P7/62—Carboxylic acid esters
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Analytical Chemistry (AREA)
- Enzymes And Modification Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
The present invention provides a kind of lipase to split the application in 2- bromo ethyl isovalerate, and the amino acid sequence of the lipase is as shown in SEQ ID NO.1, and encoding gene is as shown in SEQ ID NO.2.Lipase gene of the present invention can connect building with expression vector and obtain the intracellular expression recombinant plasmid containing the gene, then convert into coli strain, obtain recombination bacillus coli;The recombination bacillus coli isolates and purifies acquisition recombinant lipase through clasmatosis;The recombinant lipase has the ability of catalysis resolution of racemic 2- bromo ethyl isovalerate, available product (R) -2- bromo ethyl isovalerate, enantiomeric excess value > 99% and conversion ratio reach 50.8%, the mass yield of product (R) -2- bromo ethyl isovalerate reaches 96.4%, and splits high-efficient.
Description
(1) technical field
The invention belongs to biocatalysis technology fields, are related to a kind of lipase stereoselectivity catalyzing hydrolysis fractionation 2- bromo
Ethyl isovalerate enantiomer synthesizes the application of (R) -2- bromo ethyl isovalerate enantiomer of single configuration.
(2) background technique
Taufluvalinate is the pyrethroid of non-cyclopropane shuttle acids, has structure similar with fenvalerate.It is total
There are four optical isomers.A pair of of active isomer that industrial goods are made of dextronic acid and racemization cyanalcohol, the desinsection with wide spectrum are living
Property tool tag and stomach poison function, there are also food refusals and repellent activity.Its virulence and fenvalerate can quite effectively prevent cotton, fruit
On the crops such as tree, vegetables, corn, tealeaves, tobacco including Lepidoptera, coleoptera, Homoptera and Diptera, including Main Harmful
Worm.In addition it can also prevent and treat for example blood red homalocephalus bee of livestock pest, sheep nose fly horn fly, stable fly, dog comb head flea etc..It is most in document to use
Raw material D-Val synthesizes to obtain taufluvalinate, although D-Val method can directly obtain chiral product, price ratio
Costly.And the raceme of taufluvalinate is synthesized from the more cheap 2- bromo ethyl isovalerate of price, then pass through chirality
It splits to obtain the active isomer of industrial goods application, production cost can be reduced, increased economic efficiency.However we provide one kind
Lipase carrys out catalyzing hydrolysis and splits 2- bromo ethyl isovalerate efficiently to produce the effective ways of (R) -2- bromo ethyl isovalerate,
Chiral product can be directly obtained, cost is thus greatly reduced.
Lipase (Lipase, EC 3.1.1.3) full name is Lipase (Triacylglycerol
It acylhydrolase), is current research a kind of hydrolase most with industrial applications.Lipase can be catalyzed ester hydrolysis, ester closes
At, alcoholysis, acidolysis, ester transesterification and ammonolysis reaction.Lipase is widely present in the various organisms of nature, especially micro-
In biology and animal vegetable tissue.Animal tallow enzyme is primarily present in the organ-tissues such as pancreas, such as Pig Liver Esterase and pig pancreas fat
Enzyme, but due to the factors such as animal tallow enzymatic activity is lower, enzyme extraction purification higher cost and raw material sources are limited, limit its
Application in industry.Microbial lipase abundance, it is many kinds of, it is not influenced by factors such as seasonal climates, microorganism is raw
The long producing enzyme period is shorter, and has that organic solvent-resistant, that Substratspezifitaet is strong, catalytic selectivity is high and catalytic activity is high etc. is special
Point, thus microbe-derived lipase has higher industrial application value.Most of commercial lipases currently on the market
All obtained by the fermentation of the microcultures such as bacterium, fungi and yeast.Novo Nordisk company, Denmark, Amano company, Japan
A variety of commercialization enzyme preparations is developed with Major Enzymes manufacturers such as Genencor companies, the U.S..These enzyme preparation companies, which utilize, to be divided
Sub- renovation technique is transformed microbial lipase, improves the zymologic properties such as enzyme activity, stability and stereoselectivity, with full
The demand of foot difference industrial circle application.Thus building lipase gene engineering bacteria is to which mass production recombinant lipase is with ten
Divide significance.
(3) summary of the invention
It is an object of the present invention to provide a kind of stereoselectivity lipase to split in 2- bromo ethyl isovalerate in bioanalysis
Using can directly obtain chiral product, substantially reduce cost.
The technical solution adopted by the present invention is that:
The present invention provides a kind of lipase and is splitting the application (as shown in Figure 1) in 2- bromo ethyl isovalerate, the rouge
For the amino acid sequence of fat enzyme as shown in SEQ ID NO.1, coding gene sequence is lipase gene source shown in SEQ ID NO.2
From aspergillus oryzae WZ007 (Aspergillus oryzaeWZ007), which is preserved in China typical culture collection center, address:
Wuhan, China, Wuhan University, 430072, deposit number: CCTCC No:M 206105, preservation date: on October 8th, 2006,
Relevant bacteria species preservation information is had submitted in previously applying for a patent (Chinese patent CN 101186938) and discloses its heredity money
Source source.The present invention carries out the excavation of aimed aliphatic enzyme and gene on the basis of this patent application.Specific application method
Are as follows: from this aspergillus oryzae WZ007, mRNA is extracted through reverse transcription and obtains cDNA, the aspergillus oryzae genome checked according to NCBI
On the basis of GenBank:NWUI02000090.1 base sequence, design upstream primer is 5'-CCATGGGCATGAAGATTCAA
AAACTCATTCTGTACAGTCT-3' and downstream primer are 5'-CTCGAGTTAATATGCATACTTTGCAATGTCAGGC-3',
PCR is carried out, obtains base gene order SEQ ID NO.2 segment, sequence verification is correct, which is connected to carrier pET-
28b (+), conversion to Rosetta competence, the thick enzyme that the wet thallus that fermented culture obtains extracts is catalyst, with 2- bromo
Ethyl isovalerate is substrate, using 7.0 phosphate buffer of pH as reaction medium, under the conditions of 20-45 DEG C, 800-1000rpm into
After fully reacting, reaction solution is isolated and purified for row resolution reaction, obtains product (R) -2- bromo ethyl isovalerate.The catalysis
Agent dosage is calculated as 15-30g/L (preferably 30g/L) with buffer volume, and the Final substrate concentrations are calculated as 5- with buffer volume
10g/L (preferably 6g/L).
Further, preferred reaction time 3-7h, more preferable reaction condition is 35 DEG C, 1000rpm reacts 5h.
Further, the buffer is pH 7.0, the Na of 0.2mM2HPO4/NaH2PO4Buffer solution.
Further, the catalyst is prepared as follows: by engineering bacteria (the preferably large intestine bar of fatty enzyme coding gene
Bacterium Rosetta) it is seeded in LB culture medium, 37 DEG C of culture OD600To 0.4-0.6, add IPTG to final concentration 0.02mM, 30 DEG C of trainings
10-12h, bacterium solution 8000rpm, 4 DEG C of centrifugation 10min are supported, collects thallus, then with PBS buffer solution washing thalline 2 times, 8000rpm, 4
DEG C centrifugation 10min, collect thallus, freeze-drying, obtain the thick enzyme powder of lipase;LB culture medium composition: tryptone 10g/L, yeast powder
5g/L, NaCl 5g/L, solvent are deionized water, and pH value is natural.
Further, the method that reaction solution of the present invention isolates and purifies are as follows: after reaction, reaction solution is carried out with 4mMHCl
It is acidified to pH 2.0, is then extracted with isometric ethyl acetate, separatory funnel isolates organic phase, then twice through pure water,
Saturation NaCl is washed twice, dry, and revolving obtains product (R) -2- bromo ethyl isovalerate.
Fat enzyme amino acid sequence of the invention is as shown in SEQ ID NO.1:
MKIQKLILYKFANELTASGLIPSKALTCLNGYAIIDLNSIHRHNPSPENLSIYPYKAKSDAPYSIAENT
LRAGIHIPRSFSHKRDKKIPVLLVPGTAVPAAITFYFNFGKLRRALPESELVWIDLPQASLDDIQLSAEYVAYALNY
VSALTSSKIAVISWSQGALDIQWALKYWPSTRGVVNDFIAISPDFHGTIVKWLVCPLLNDLACTPSIWQQGWDANFI
QALRSQGGDSAYVPTTTIYSSFDKIVRPMSGENASARLLDYRGVGVSNNHLQTICANNAAGGLYTHEGVLYNPLAWA
LTVDALLHDGPSNITRIDTQKICEQVLPPYLELTDMLGTEALLLVALAKILTYSPKVSGEPDIAKYAY
Due to the particularity of amino acid sequence, the segment of any polypeptide containing amino acid sequence shown in SEQ ID NO.1
Or its variant, such as its examples of conservative variations, bioactive fragment or derivative, as long as the segment of the polypeptide or polypeptide variants with it is aforementioned
Amino acid sequence homology belongs to the column of the scope of the present invention 90% or more and enzymatic activity having the same.Specifically
, the change may include the missing of amino acid, insertion or replacement in amino acid sequence;Wherein, the conservative of variant is changed
Become, the amino acid replaced has structure similar with original acid or chemical property, such as replaces isoleucine with leucine, becomes
Body can also have non-conservation change, such as replace glycine with tryptophan.
The segment of albumen of the present invention, derivative or the like, which refer to, is kept substantially protease phase of the present invention
Same biological function or active albumen, can be following state: (I) one or more amino acid residues are guarded or non-guarantor
Amino acid residue (preferably conservative amino acid residues) substitution is kept, and the amino acid replaced can be and may not be by losing
Pass codon coding;(II) some group on one or more amino acid residues is replaced by other groups;(III) at soft-boiled eggs
It is white to be merged with another compound (for example extending the compound of protein half-life, such as polyethylene glycol);(IV) additional amino
Acid sequence is integrated into mature albumen and the protein sequence (sequence or proprotein sequence as being used to purify this albumen) that is formed.
The albumen can be recombinant protein, native protein or synthetic proteins, can be the product of pure natural purifying, or
Chemically synthesized product, or using recombinant technique from protokaryon or eucaryon host (such as: bacterium, yeast, higher plant, insect and
Mammalian cell) in generate.According to host used in recombinant production scheme, albumen of the invention can be glycosylated.This
The albumen of invention can also include or not include the methionine residues originated.
The encoding gene nucleotide sequence of lipase of the present invention is as shown in SEQ ID NO.2:
ATGAAAATCCAGAAACTGATTTTATATAAATTTGCAAACGAGCTCACCGCATCAGGCCTGATACCTTCA
AAGGCACTGACATGCCTGAATGGCTACGCGATCATTGACCTCAATTCGATTCACCGTCACAACCCATCCCCAGAAAA
CTTGAGCATATACCCATACAAAGCAAAGAGCGATGCGCCTTACTCCATTGCGGAAAATACTCTCCGGGCTGGAATTC
ACATTCCTAGATCATTCTCACACAAACGGGACAAGAAAATACCGGTGCTCCTGGTACCAGGAACTGCTGTTCCTGCG
GCCATAACCTTTTATTTCAACTTTGGCAAGTTGAGGAGAGCCTTACCCGAAAGTGAGCTAGTTTGGATCGATCTCCC
TCAGGCCTCGTTGGATGACATTCAATTGAGCGCTGAATATGTCGCCTATGCGCTCAATTATGTTTCCGCTTTGACCT
CATCTAAGATTGCCGTGATTTCTTGGTCCCAAGGTGCACTGGATATTCAGTGGGCACTGAAGTACTGGCCATCTACC
CGGGGCGTCGTCAACGACTTCATTGCTATCAGCCCCGACTTCCATGGAACAATAGTCAAGTGGCTGGTATGCCCTCT
ATTAAATGATTTAGCCTGTACTCCTTCGATTTGGCAGCAAGGGTGGGATGCAAACTTTATACAGGCCTTGCGGAGCC
AAGGGGGAGACTCTGCCTATGTCCCCACGACCACCATTTACTCTTCATTCGACAAGATTGTGCGACCCATGAGTGGG
GAAAATGCTTCTGCTCGGCTACTGGACTACAGGGGGGTGGGCGTTTCCAATAACCATCTACAGACCATCTGCGCAAA
TAATGCCGCTGGTGGCCTCTATACGCATGAAGGCGTGTTGTACAACCCTCTTGCATGGGCCCTTACTGTTGACGCAC
TCCTTCACGATGGGCCTAGCAATATTACGCGAATCGATACCCAGAAGATCTGTGAACAAGTACTTCCGCCATATCTC
GAATTAACTGATATGCTGGGAACCGAAGCCCTCCTTTTAGTAGCCCTAGCAAAGATTCTTACATATTCCCCGAAAGT
CTCCGGTGAGCCTGACATTGCAAAGTATGCATATTAA
Due to the particularity of nucleotide sequence, the variant of polynucleotides shown in any SEQ ID NO.2, as long as it is more with this
Nucleotide has 70% or more homology and function having the same, belongs to the column of the scope of the present invention.The multicore glycosides
The variant of acid refers to a kind of polynucleotide sequence changed with one or more nucleotide.The variant of this polynucleotides can be
The variant that the allelic variant or non-natural naturally occurred occurs, including substitution variants, Deletion variants and insertion variation
Body.As known in the art, allelic variant is the alternative forms of a polynucleotides, it may be one or more nucleotide
Substitution, missing or insertion, but not from substantially change its encode amino acid function.
In addition, the polynucleotides that can hybridize with polynucleotide sequence shown in SEQ ID NO:2 are (at least homologous with 50%
Property, preferably there is 70% homology), it, especially under strict conditions can be with institute of the present invention also in the column of the scope of the present invention
State the polynucleotides of nucleotide sequence hybridization." stringent condition " refers to: (1) under compared with low ionic strength and higher temperature
Hybridization and elution, such as 0.2SSC, 0.1%SDS, 60 DEG C;Or (2) hybridize Shi Jiayong denaturant, such as 50% (v/v) formamide,
0.1% calf serum, 0.1%Ficoll, 42 DEG C;Or (3) only the homology between two sequences is at least 95% or more, more
Just hybridize when being well 97% or more.Also, egg shown in the albumen of interfertile polynucleotide encoding and SEQ ID NO:1
It is white to have identical biological function and activity.
The invention further relates to the recombinant vectors for containing the encoding gene, and converted using the recombinant vector
Recombination engineering bacteria.
Compared with prior art, the beneficial effects are mainly reflected as follows: the present invention provides a kind of lipase genes
Nucleotide sequence;The lipase gene can connect building with expression vector and obtain the intracellular expression recombinant plasmid containing the gene, then
Conversion obtains recombination bacillus coli into coli strain, and recombination bacillus coli or recombinant lipase is recycled to urge for biology
Agent catalysis fractionation 2- bromo ethyl isovalerate, available product (R) -2- bromo ethyl isovalerate, enantiomeric excess value >
99% and conversion ratio reach 50.8%, the mass yield of product (R) -2- bromo ethyl isovalerate reaches 96.4%.The present invention is raw
The chiral synthetic reaction of object catalysis has mild condition, high-efficient, chemo-selective, regioselectivity and the enantiomer of height
The advantages that selective, and biocatalysis process has the characteristics that nontoxic, pollution-free and low energy consumption, is a kind of environmental-friendly conjunction
At method.
(4) Detailed description of the invention
Fig. 1 is the reaction schematic diagram that lipase enantioselective hydrolysis splits 2- bromo ethyl isovalerate;
Fig. 2 is racemic 2- bromo ethyl isovalerate standard specimen gas chromatogram;
Fig. 3 is the gas chromatogram of the lipase-catalyzed 2- bromo ethyl isovalerate hydrolysis 5h of embodiment 4.
(5) specific embodiment
The present invention is described further combined with specific embodiments below, but protection scope of the present invention is not limited in
This, the transformation in the method that those skilled in the art are made according to these embodiments is all contained in guarantor of the invention
It protects in range.
1 aspergillus oryzae WZ007 of embodiment fermentation, cDNA preparation, cloning lipase gene and engineering bacteria building
1, aspergillus oryzae WZ007 fermentation condition: slant medium (g/L): peeled potatoes 200, sucrose 20, agar 20 are molten
Agent is deionized water, and pH is natural.Fermentation medium (g/L): peptone 20, olive oil 1% (V/V), KH2PO41, MgSO4
0.5, NaCl 0.5, solvent is deionized water, pH 7.0.
Aspergillus oryzae WZ007 (Aspergillus oryzaeWZ007) is seeded to slant medium, 30 DEG C of culture 6-8d,
Obtain slant strains.Aspergillus oryzae WZ007 is preserved in China typical culture collection center, address: Wuhan, China, Wuhan University,
430072, deposit number: CCTCC No:M 206105, preservation date: on October 8th, 2006, in patent application CN
It is disclosed in 101186938A.
Slant strains are taken to be seeded in the 500mL shaking flask of the fermentation medium containing 100mL, at 30 DEG C of temperature, revolving speed 200rpm
Constant-temperature table culture 12h, seed liquor is made.The 30L fermentor that 1L seed liquor is poured into the fermentation medium containing 18L is sent out
Ferment culture, wherein temperature and revolving speed are controlled respectively in 30 DEG C and 200rpm, and fermented and cultured 48h collects wet thallus.
2, prepared by aspergillus oryzae WZ007 cDNA: taking the above-mentioned aspergillus oryzae wet thallus of 1g, uses the TransZol of Quan Shi King Company
Up Plus RNA Kit kit extracts mRNA, reuses the ReverTra Ace qPCR RT Kit of TOYOBO company, efficiently
Synthesize to rate the cDNA template suitable for Realtime PCR.
3, the clone of Aspergillus oryzae lipase gene: the aspergillus oryzae genome checked according to NCBI
On the basis of GenBank:NWUI02000090.1 base sequence, design upstream primer is
5'-CCATGGGCATGAAGATTCAAAAACTCATTCTGTACAGTCT-3' and downstream primer are 5'-CTCGAGT
TAATATGCATACTTTGCAATGTCAGGC-3' carries out PCR, obtains nucleotides sequence and be classified as SEQ ID using cDNA as template
Genetic fragment shown in NO.2, sequence verification are correct.The coding protein amino acid sequence of genetic fragment shown in SEQ ID NO.2 is
Shown in SEQ ID NO.1.
4, genetic fragment shown in the SEQ ID NO.2 building of colibacillus engineering: is connected to carrier pET-28b
(+) converts to Escherichia coli Rosetta competence, obtains the colibacillus engineering (being denoted as engineering bacteria M5) of fatty enzyme.
The fermented and cultured of the colibacillus engineering (M5) of the fatty enzyme of embodiment 2
The colibacillus engineering (M5) that embodiment 1 obtains is seeded in LB culture medium, 37 DEG C of culture OD600Most 0.5
(probably culture 2h), adds IPTG to final concentration 0.02mM, 30 DEG C of culture 10-12h.300mL bacterium solution 8000rpm, 4 DEG C of centrifugations
10min collects thallus, then with PBS buffer solution washing thalline 2 times, 8000rpm, 10min collect thallus.The thallus of collection is frozen
The thick enzyme powder of lipase is obtained after dry, is denoted as lipase M5,4 DEG C of refrigerators is put in and saves.LB culture medium composition: tryptone 10g/L,
Yeast powder 5g/L, NaCl 5g/L, solvent are deionized water, and pH is natural.
The reaction of 3 enzymatic of embodiment fractionation 2- bromo ethyl isovalerate
The thick enzyme powder of lipase of 2 method of 0.03g embodiment preparation is weighed in 2mL EP pipe, addition 1mL PB (pH 7.0,
It 0.2mM) is used as reaction dissolvent, 0.006g substrate 2- bromo ethyl isovalerate is then added and is set so that thallus is not added as blank control
3h is reacted in 35 DEG C, 1000rpm constant temperature blending instrument.After reaction, reaction solution is acidified through 4mM HCl, adds 1mL acetic acid
Ethyl ester, turbula shaker vibrate 2min, sufficiently extract, be centrifuged (1200rpm, 3min), obtain organic phase.Take 700 μ L acetic acid second
Ester layer by the stereoselectivity of gas chromatographic detection thallus and enzymatic hydrolysis activity, obtain the enantiomeric excess value of substrate >
99% and conversion ratio reach 50.8%.
Specific gas phase analysis condition: Agilent6890 gas chromatograph, BGB-175 chiral capillary chromatographic column are used
(30.0m × 0.25mm × 0.25um), fid detector;Testing conditions are column temperature from 100 DEG C of initial temperature (constant temperature keeps 5min)
It is warming up to 120 DEG C, 2 DEG C/min of heating rate, 250 DEG C of injector temperature, 250 DEG C of detector temperature, air mass flow and hydrogen flowing quantity
Respectively 300mL/min and 30mL/min.Carrier gas is high-purity N2, stigma pressure 98.7Kpa;Make-up gas flow 30.0mLmin-1;
Split ratio 30:1, sampling volume 1uL.As shown in the result of GC, (R) -2- bromo ethyl isovalerate and (S) -2- bromo isoamyl
The retention time of acetoacetic ester is respectively 8.58min and 8.75min, sees Fig. 2.
The effect that the different lipase hydrolysis of embodiment 4 split 2- bromo ethyl isovalerate compares
In pH 7.0, the Na of 0.2mM2HPO4/NaH2PO4In buffer solution 1mL, the difference fat of final concentration 30g/L is added
Enzyme (the thick enzyme powder of lipase of the preparation of embodiment 2, Novozym 435, Lipozyme TL IM, Lipozyme RM IM, Amano
Lipase PS IM), 0.006g substrate 2- bromo ethyl isovalerate reacts under the conditions of 1000rpm in 35 DEG C of constant temperature blending instrument
5h extracts reaction solution enantiomeric excess value and conversion ratio by 1 method of embodiment detection (R) -2- bromo ethyl isovalerate, as a result sees
Shown in table 1.The results show that after 35 DEG C of reaction 5h, lipase Novozym 435, Lipozyme TL IM, Lipozyme RM
IM, PS IM are active without Hydrolysis Resolution to two kinds of configurations of substrate 2- bromo ethyl isovalerate, then above four kinds of commercial fat enzymes
To substrate 2- bromo ethyl isovalerate all without enantio-selectivity, and when the thick enzyme powder catalysis reaction of lipase, product (R)-
Ee value > 99% of 2- bromo ethyl isovalerate, conversion ratio 50.8%, shown in gas-chromatography Fig. 3.
The Hydrolysis Resolution effect of the different lipase-catalyzed 2- bromo ethyl isovalerates of table 1 compares
Influence of 5 reaction time of embodiment to enzyme kinetics Hydrolysis Resolution 2- bromo ethyl isovalerate
In pH 7.0, the Na of 0.2mM2HPO4/NaH2PO4In buffer solution 1mL, the embodiment 2 of final concentration 30g/L is added
The thick enzyme powder of lipase of method preparation, 0.006g2- bromo ethyl isovalerate, in 35 DEG C of constant temperature blending instrument, under the conditions of 1000rpm
It reacts different time (3~6h), extracts reaction solution the enantiomeric excess by 1 method of embodiment detection (R) -2- bromo ethyl isovalerate
Value and conversion ratio, the results are shown in Table shown in 2.
The result shows that the enantiomeric excess value of product (R) -2- bromo ethyl isovalerate has reached highest, right after reaction 5h
Reflect body excessive value > 99%, conversion ratio 50.8%, when reacted between be greater than 5h after, product (R) -2- bromo ethyl isovalerate
Enantiomeric excess value is gradually increasing, and conversion ratio is also increasing.
Influence of 2 reaction time of table to enzymic catalytic reaction
Influence of 6 reaction temperature of embodiment to enzyme kinetics Hydrolysis Resolution 2- bromo ethyl isovalerate
In pH 7.0, the Na of 0.2mM2HPO4/NaH2PO4In buffer solution 1mL, the embodiment 2 of final concentration 30g/L is added
The thick enzyme powder of the lipase of preparation, 0.006g 2- bromo ethyl isovalerate, in constant temperature blending instrument different temperatures (20-45 DEG C),
5h is reacted under the conditions of 1000rpm, extracts reaction solution the enantiomeric excess by 1 method of embodiment detection (R) -2- bromo ethyl isovalerate
Value and conversion ratio, the results are shown in Table shown in 3.
As a result illustrate, when reaction temperature is 35 DEG C, the enantiomeric excess value highest of (R) -2- bromo ethyl isovalerate,
Ee value > 99%.When reaction temperature is higher than 35 DEG C or is lower than 35 DEG C, the conversion ratio of (R) -2- bromo ethyl isovalerate and mapping
Body excessive value can all decline, and illustrate that temperature has a very big impact the optical selective of lipase M5.
Influence of 3 reaction temperature of table to reaction
The separation and Extraction of 7 product of embodiment (R) -2- bromo ethyl isovalerate
20mLpH 7.0,0.2mM Na are added in 50mL round-bottomed flask2HPO4/NaH2PO4Buffer solution weighs 0.3g
The thick enzyme powder of lipase prepared by embodiment 2, adds the 2- bromo ethyl isovalerate of final concentration 5g/L, is carried out with 50mM NaOH
Stream plus drop reaction, control reaction pH maintain 7.0, at 35 DEG C of magnetic stirring apparatus, 6h are reacted under the conditions of 600rpm.Reaction terminates
The reaction solution obtained afterwards is carried out being acidified to pH 2.0 with 4mM HCl, is then extracted with isometric ethyl acetate, separatory funnel
Organic phase being isolated, then twice through pure water, saturation NaCl is washed twice, and dry, revolving obtains final product, and weigh,
The mass yield of product (R) -2- bromo ethyl isovalerate reaches 96.4%.
Sequence table
<110>Zhejiang Polytechnical University
<120>application of a kind of lipase in resolution of racemic 2- bromo ethyl isovalerate
<160> 2
<170> SIPOSequenceListing 1.0
<210> 1
<211> 368
<212> PRT
<213>aspergillus oryzae (Aspergillus oryzae)
<400> 1
Met Lys Ile Gln Lys Leu Ile Leu Tyr Lys Phe Ala Asn Glu Leu Thr
1 5 10 15
Ala Ser Gly Leu Ile Pro Ser Lys Ala Leu Thr Cys Leu Asn Gly Tyr
20 25 30
Ala Ile Ile Asp Leu Asn Ser Ile His Arg His Asn Pro Ser Pro Glu
35 40 45
Asn Leu Ser Ile Tyr Pro Tyr Lys Ala Lys Ser Asp Ala Pro Tyr Ser
50 55 60
Ile Ala Glu Asn Thr Leu Arg Ala Gly Ile His Ile Pro Arg Ser Phe
65 70 75 80
Ser His Lys Arg Asp Lys Lys Ile Pro Val Leu Leu Val Pro Gly Thr
85 90 95
Ala Val Pro Ala Ala Ile Thr Phe Tyr Phe Asn Phe Gly Lys Leu Arg
100 105 110
Arg Ala Leu Pro Glu Ser Glu Leu Val Trp Ile Asp Leu Pro Gln Ala
115 120 125
Ser Leu Asp Asp Ile Gln Leu Ser Ala Glu Tyr Val Ala Tyr Ala Leu
130 135 140
Asn Tyr Val Ser Ala Leu Thr Ser Ser Lys Ile Ala Val Ile Ser Trp
145 150 155 160
Ser Gln Gly Ala Leu Asp Ile Gln Trp Ala Leu Lys Tyr Trp Pro Ser
165 170 175
Thr Arg Gly Val Val Asn Asp Phe Ile Ala Ile Ser Pro Asp Phe His
180 185 190
Gly Thr Ile Val Lys Trp Leu Val Cys Pro Leu Leu Asn Asp Leu Ala
195 200 205
Cys Thr Pro Ser Ile Trp Gln Gln Gly Trp Asp Ala Asn Phe Ile Gln
210 215 220
Ala Leu Arg Ser Gln Gly Gly Asp Ser Ala Tyr Val Pro Thr Thr Thr
225 230 235 240
Ile Tyr Ser Ser Phe Asp Lys Ile Val Arg Pro Met Ser Gly Glu Asn
245 250 255
Ala Ser Ala Arg Leu Leu Asp Tyr Arg Gly Val Gly Val Ser Asn Asn
260 265 270
His Leu Gln Thr Ile Cys Ala Asn Asn Ala Ala Gly Gly Leu Tyr Thr
275 280 285
His Glu Gly Val Leu Tyr Asn Pro Leu Ala Trp Ala Leu Thr Val Asp
290 295 300
Ala Leu Leu His Asp Gly Pro Ser Asn Ile Thr Arg Ile Asp Thr Gln
305 310 315 320
Lys Ile Cys Glu Gln Val Leu Pro Pro Tyr Leu Glu Leu Thr Asp Met
325 330 335
Leu Gly Thr Glu Ala Leu Leu Leu Val Ala Leu Ala Lys Ile Leu Thr
340 345 350
Tyr Ser Pro Lys Val Ser Gly Glu Pro Asp Ile Ala Lys Tyr Ala Tyr
355 360 365
<210> 2
<211> 1107
<212> DNA
<213>aspergillus oryzae (Aspergillus oryzae)
<400> 2
atgaaaatcc agaaactgat tttatataaa tttgcaaacg agctcaccgc atcaggcctg 60
ataccttcaa aggcactgac atgcctgaat ggctacgcga tcattgacct caattcgatt 120
caccgtcaca acccatcccc agaaaacttg agcatatacc catacaaagc aaagagcgat 180
gcgccttact ccattgcgga aaatactctc cgggctggaa ttcacattcc tagatcattc 240
tcacacaaac gggacaagaa aataccggtg ctcctggtac caggaactgc tgttcctgcg 300
gccataacct tttatttcaa ctttggcaag ttgaggagag ccttacccga aagtgagcta 360
gtttggatcg atctccctca ggcctcgttg gatgacattc aattgagcgc tgaatatgtc 420
gcctatgcgc tcaattatgt ttccgctttg acctcatcta agattgccgt gatttcttgg 480
tcccaaggtg cactggatat tcagtgggca ctgaagtact ggccatctac ccggggcgtc 540
gtcaacgact tcattgctat cagccccgac ttccatggaa caatagtcaa gtggctggta 600
tgccctctat taaatgattt agcctgtact ccttcgattt ggcagcaagg gtgggatgca 660
aactttatac aggccttgcg gagccaaggg ggagactctg cctatgtccc cacgaccacc 720
atttactctt cattcgacaa gattgtgcga cccatgagtg gggaaaatgc ttctgctcgg 780
ctactggact acaggggggt gggcgtttcc aataaccatc tacagaccat ctgcgcaaat 840
aatgccgctg gtggcctcta tacgcatgaa ggcgtgttgt acaaccctct tgcatgggcc 900
cttactgttg acgcactcct tcacgatggg cctagcaata ttacgcgaat cgatacccag 960
aagatctgtg aacaagtact tccgccatat ctcgaattaa ctgatatgct gggaaccgaa 1020
gccctccttt tagtagccct agcaaagatt cttacatatt ccccgaaagt ctccggtgag 1080
cctgacattg caaagtatgc atattaa 1107
Claims (9)
1. a kind of application of lipase in resolution of racemic 2- bromo ethyl isovalerate, it is characterised in that the ammonia of the lipase
Base acid sequence is as shown in SEQ ID NO.1.
2. application as described in claim 1, it is characterised in that the nucleotide sequence of the encoding gene of the lipase such as SEQ
Shown in ID NO.2.
3. application as described in claim 1, it is characterised in that the method for the application are as follows: with the work of fatty enzyme coding gene
The thick enzyme powder of lipase after the wet thallus freeze-drying that the fermented culture of journey bacterium obtains is biocatalyst, with racemic 2- bromo isoamyl
Acetoacetic ester is substrate, using pH7.0 buffer as reaction medium, carries out resolution reaction under the conditions of 20-45 DEG C, 800-1000rpm,
After fully reacting, reaction solution is isolated and purified, obtains (R) -2- bromo ethyl isovalerate.
4. application as claimed in claim 3, it is characterised in that the catalyst amount is calculated as 15-30g/L with buffer volume,
The Final substrate concentrations are calculated as 5-10g/L with buffer volume.
5. application as claimed in claim 3, it is characterised in that reaction time 3-7h.
6. application as claimed in claim 3, it is characterised in that the reaction condition is 35 DEG C, 1000rpm reacts 5h.
7. application as claimed in claim 3, it is characterised in that the buffer is pH7.0, the Na of 0.2mM2HPO4/NaH2PO4
Buffer solution.
8. application as claimed in claim 3, it is characterised in that the catalyst is prepared as follows: fatty enzyme is encoded
The engineering bacteria of gene is seeded in LB culture medium, 37 DEG C of culture OD600To 0.4-0.6, add IPTG to final concentration 0.02mM, 30 DEG C
10-12h, bacterium solution 8000rpm, 4 DEG C of centrifugation 10min are cultivated, collects thallus, then with PBS buffer solution washing thalline 2 times,
8000rpm, 4 DEG C of centrifugation 10min, collect thallus, and freeze-drying obtains the thick enzyme powder of lipase.
9. application as described in claim 1, it is characterised in that the method that the reaction solution isolates and purifies are as follows: after reaction,
Reaction solution is acidified to pH2.0 with 4mM HCl, is then extracted with isometric ethyl acetate, separatory funnel isolates organic phase, then passes through
Twice, saturation NaCl is washed twice pure water, and dry, revolving obtains final product (R) -2- bromo ethyl isovalerate.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201910217266.4A CN110066835B (en) | 2019-03-21 | 2019-03-21 | Application of lipase in resolution of racemic ethyl 2-bromoisovalerate |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201910217266.4A CN110066835B (en) | 2019-03-21 | 2019-03-21 | Application of lipase in resolution of racemic ethyl 2-bromoisovalerate |
Publications (2)
Publication Number | Publication Date |
---|---|
CN110066835A true CN110066835A (en) | 2019-07-30 |
CN110066835B CN110066835B (en) | 2020-12-25 |
Family
ID=67366548
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201910217266.4A Active CN110066835B (en) | 2019-03-21 | 2019-03-21 | Application of lipase in resolution of racemic ethyl 2-bromoisovalerate |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN110066835B (en) |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2002040438A1 (en) * | 2000-11-14 | 2002-05-23 | Ciba Specialty Chemicals Holding Inc. | Preparation of enantiomerically pure hydroxy esters and acids |
CN101063156A (en) * | 2007-04-30 | 2007-10-31 | 江南大学 | Method for preparing (R)-6-hydroxy-8-chlorine octanoic acid ethyl by enzyme resolution |
CN103351300A (en) * | 2013-06-30 | 2013-10-16 | 北京万全德众医药生物技术有限公司 | Preparation method of aliskiren intermediate side chain ((s)-methyl-2-bromoisovalerate) |
CN106191004A (en) * | 2016-07-01 | 2016-12-07 | 浙江工业大学 | A kind of Aspergillus oryzae lipase, encoding gene, carrier, engineering bacteria and application thereof |
-
2019
- 2019-03-21 CN CN201910217266.4A patent/CN110066835B/en active Active
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2002040438A1 (en) * | 2000-11-14 | 2002-05-23 | Ciba Specialty Chemicals Holding Inc. | Preparation of enantiomerically pure hydroxy esters and acids |
CN101063156A (en) * | 2007-04-30 | 2007-10-31 | 江南大学 | Method for preparing (R)-6-hydroxy-8-chlorine octanoic acid ethyl by enzyme resolution |
CN103351300A (en) * | 2013-06-30 | 2013-10-16 | 北京万全德众医药生物技术有限公司 | Preparation method of aliskiren intermediate side chain ((s)-methyl-2-bromoisovalerate) |
CN106191004A (en) * | 2016-07-01 | 2016-12-07 | 浙江工业大学 | A kind of Aspergillus oryzae lipase, encoding gene, carrier, engineering bacteria and application thereof |
Non-Patent Citations (3)
Title |
---|
ACCESSION NO.:RMZ48115.1: "lipase [Aspergillus flavus]", 《GENBANK DATABASE》 * |
FABIANO JARES CONTESINI: "Aspergillus sp. lipase: Potential biocatalyst for industrial use", 《JOURNAL OF MOLECULAR CATALYSIS B: ENZYMATIC》 * |
JIAN-YONG ZHENG等: "High-level expression and characterization of a stereoselective lipase from Aspergillus oryzae in Pichia pastoris", 《PROTEIN EXPRESSION AND PURIFICATION》 * |
Also Published As
Publication number | Publication date |
---|---|
CN110066835B (en) | 2020-12-25 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN106191004A (en) | A kind of Aspergillus oryzae lipase, encoding gene, carrier, engineering bacteria and application thereof | |
CN109628544A (en) | A kind of lipase is splitting the application in N- acetyl-DL- methionine methyl ester | |
CN110055297B (en) | Application of esterase in splitting (R, S) -5-caprolactone | |
CN111893126A (en) | Alkaline protease gene, alkaline protease, preparation method and application thereof | |
CN105779409B (en) | A kind of stereoselectivity esterase, encoding gene, carrier, engineering bacteria and its application | |
CN110358752A (en) | A kind of Aspergillus oryzae lipase and preparing the application in Bu Waxitan chiral intermediate | |
CN111996205A (en) | Chitinase gene, chitinase and preparation method and application thereof | |
CN108251400B (en) | Lipase and application thereof | |
CN113462678B (en) | Glutamic acid decarboxylase mutant | |
CN109929822A (en) | A kind of Aspergillus oryzae lipase mutant and its application | |
CN101085984A (en) | Low-temperature lipase and its gene sequence | |
CN109652470A (en) | A kind of application of lipase in fractionation (R, S)-methyl mandelate | |
CN103131659B (en) | Organic solvent-resistant lipase, as well as encoding gene, producing strain and application thereof | |
CN108251401A (en) | Lipase and its application | |
CN1958797B (en) | Method for preparing lipase of antarctic candida | |
CN110066835A (en) | A kind of application of lipase in resolution of racemic 2- bromo ethyl isovalerate | |
CN109943618B (en) | Application of recombinant lipase in resolution of (R, S) -alpha-ethyl-2-oxo-1-pyrrolidine methyl acetate | |
US20240052380A1 (en) | Biosynthesis of vanillin from isoeugenol | |
CN110438194B (en) | Application of lipase in preparation of D-tropine methyl ester | |
CN101962633B (en) | Alpha-amylase, encoding gene and expression thereof | |
CN110195088A (en) | A kind of new arginine hydrolase and its encoding gene and application | |
CN110628743A (en) | Stereoselective esterase, coding gene, vector, engineering bacterium and application | |
CN111057735B (en) | Application of bacillus amyloliquefaciens esterase in splitting N-BOC-DL-alpha-methyl aminobutyric acid | |
CN111057736B (en) | Application of lipase in splitting BOC-DL-proline methyl ester | |
Stefanov et al. | Isolation and Purification of Proteolytic Enzymes, Produced by Strains of Genus Bacillus. |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant | ||
TR01 | Transfer of patent right |
Effective date of registration: 20210524 Address after: Room 101-01, 1st floor, building 6, No. 1366, Hongfeng Road, Kangshan street, Huzhou City, Zhejiang Province, 313001 Patentee after: Zhejiang yingwodi Biotechnology Co.,Ltd. Address before: 310014 No. 18 Chao Wang Road, Xiacheng District, Zhejiang, Hangzhou Patentee before: ZHEJIANG University OF TECHNOLOGY |
|
TR01 | Transfer of patent right |