CN109970866A - A kind of two-way activation costimulatory molecules receptor of CD28 and application thereof - Google Patents

A kind of two-way activation costimulatory molecules receptor of CD28 and application thereof Download PDF

Info

Publication number
CN109970866A
CN109970866A CN201711466911.3A CN201711466911A CN109970866A CN 109970866 A CN109970866 A CN 109970866A CN 201711466911 A CN201711466911 A CN 201711466911A CN 109970866 A CN109970866 A CN 109970866A
Authority
CN
China
Prior art keywords
cell
gly
ser
thr
pro
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Granted
Application number
CN201711466911.3A
Other languages
Chinese (zh)
Other versions
CN109970866B (en
Inventor
钱其军
金华君
许慧敏
刘祥箴
李林芳
王超
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Shanghai Cell Therapy Research Institute
Shanghai Cell Therapy Group Co Ltd
Original Assignee
Shanghai Cell Therapy Research Institute
Shanghai Cell Therapy Group Co Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Shanghai Cell Therapy Research Institute, Shanghai Cell Therapy Group Co Ltd filed Critical Shanghai Cell Therapy Research Institute
Priority to CN201711466911.3A priority Critical patent/CN109970866B/en
Priority to PCT/CN2018/123988 priority patent/WO2019129090A1/en
Publication of CN109970866A publication Critical patent/CN109970866A/en
Application granted granted Critical
Publication of CN109970866B publication Critical patent/CN109970866B/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/7051—T-cell receptor (TcR)-CD3 complex
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/463—Cellular immunotherapy characterised by recombinant expression
    • A61K39/4631—Chimeric Antigen Receptors [CAR]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/461—Cellular immunotherapy characterised by the cell type used
    • A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643—Vertebrate antigens
    • A61K39/4644—Cancer antigens
    • A61K39/464469—Tumor associated carbohydrates
    • A61K39/46447—Mucins, e.g. MUC-1
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3076—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
    • C07K16/3092—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated mucins
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62—DNA sequences coding for fusion proteins
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/10—Cells modified by introduction of foreign genetic material
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
    • A61K2239/59—Reproductive system, e.g. uterus, ovaries, cervix or testes
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00—Genetically modified cells

Abstract

The invention belongs to cell biology and field of immunology field, it is related to a kind of two-way activation costimulatory molecules receptor of CD28 and application thereof.In particular it relates to which a kind of two-way activation costimulatory molecules receptor of CD28, successively includes following elements from N-terminal to C-terminal: optional signal peptide, CD28 activated form single-chain antibody, extracellular hinge area, transmembrane region and costimulatory signal molecule intracellular.When the two-way activation costimulatory molecules receptor of CD28 and the first generation CAR-T comprising the first signal modify T cell jointly, strong constellation effect, killing tumor cell can produce.Meanwhile the effect of this two-way activation is only confined between the T cell to contact with each other, will not be caused strong T cell as the activated form antibody of injection CD28 and is immunized, cause potentially serious toxic side effect.

Description

A kind of two-way activation costimulatory molecules receptor of CD28 and application thereof
Technical field
The invention belongs to cell biology and field of immunology field, be related to a kind of two-way activation costimulatory molecules of CD28 by Body, and its purposes of the T cell treatment malignant tumour after being modified with this receptor.
Background technique
Tumour adoptive cellular treatment (adoptive cell therapy, ACT) is by processed self or alloimmune Cell (mainly autogenous cell) is fed back to tumor patient, direct killing tumour cell, or by exciting the immune of body to answer Killing tumor cell is answered, therapeutic purposes are reached.The treatment of current cancer adoptive cellular is quickly grown, in the clinic of Several Kinds of Malignancy Extraordinary curative effect (Nature.2016 is achieved in treatment；Jun16；534(7607):396-401)；(Cell.2016 Oct 6；167(2):405-418.e13).Tumor vaccine cells treatment be considered as most it is promising treatment malignant tumour means it One.
T cell activation needs the stimulation of two signals, i.e. two kinds of T cell activation coherent signals.Wherein, T cell surface TCR-CD3 complex provides the first signal of T cell activation in conjunction with Antigenic Peptide-MHC molecule, determines that the killing of T cell is special Property；The costimulatory molecules (such as CD28) and respective ligand (such as B7) on T cell surface combine, and provide the second signal of T cell activation, Promote T cell activation, proliferation and survival.But the first signal stimulus of tumour cell source (such as MHC molecule) and second signal ligand are (such as ) etc. B7 lack or expression decline, can not effectively provide T cell activation relevant signal, so that T cell can not be activated immune anti- It answers.And the activation T cell costimulatory molecules of popularity, strong toxic side effect may be brought.
Chimeric antigen receptor CAR (chimeric antigen receptors, CAR) passes through extracellular specific recognition tumour The single chain antibody fragments (Single chain Variable Fragment, scFv) of antigen activate intracellular signal CD3 ζ or Fc ε ITAM (the immunoreceptor tyrosine-based activation motifs) signal of RI γ transmits.But first For the costimulatory signal of CAR receptor deficiency T cell, cause T cell that can only play moment effect, it is short, thin to there is the time in vivo Intracellular cytokine secretion is few.
The second generation is to be merged two signals needed for t cell activation with the CAR of the third generation, by second signal CD28 or/and 4-1BB Intracellular signals region is directly connected to CD3 ζ molecule, to bypass the usual second signal of tumour cell Such as B7 lacks the obstacle that caused T cell cannot activate.After first signal merges with second signal, substantially increase thin to T Born of the same parents' activation, proliferation and killing ability, are allowed to curative effect and increase considerably, based on the understanding at present to t cell activation mechanism, CD28, 4-1BB molecule is capable of providing second activation signal and further strengthens TCR/CD3 signal.
However, can only provide stimulus signal regardless of CAR-T cell to improved T cell, lack onlooker's function Can, peripheral T cells can not be activated, stronger cluster effect is generated, cause a series of cascade reaction of activation T cell functions.
Summary of the invention
The present inventor passes through in-depth study and creative labor, devises a kind of two-way costimulatory molecules activated receptor (Dual Costimulatory Activated Receptor, DCR) transmits T cell by the extracellular activated form antibody of CD28 Activate relevant second signal.T cell after modifying can not only activate itself by extracellular CD28 activated form antibody CD28 costimulatory molecules signal, moreover it is possible to after contacting with the T cell of unmodified activation around, activate the T cell contacted Costimulatory molecules signal intracellular promotes T cell activation, proliferation and survival.In particular, working as itself and first comprising the first signal When modifying T cell jointly for CAR-T, strong constellation effect, killing tumor cell can produce.In addition, this two-way activation Effect be only confined between the T cell to contact with each other, will not as injection CD28 activated form antibody, cause strong T Cellular immunity causes potentially serious toxic side effect.
Thus provide following inventions:
One aspect of the present invention is related to a kind of isolated polypeptide, successively includes following elements from N-terminal to C-terminal:
It is optional signal peptide, the polypeptide (such as ligand of CD28 activated form single-chain antibody or CD28) for activating CD28, extracellular Hinge area, transmembrane region and costimulatory signal molecule intracellular.
In one or more embodiments of the invention, the polypeptide, it is characterised in that following (1)-(5) item In any 1,2,3,4 or 5:
(1) signal peptide is memebrane protein signal peptide；Preferably, the signal peptide is selected from CD8 signal peptide, CD28 signal One of peptide and CD4 signal peptide are a variety of；Preferably, the signal peptide is CD8 signal peptide；Preferably, the ammonia of CD8 signal peptide Base acid sequence is as shown in SEQ ID NO:1；
(2) amino acid sequence of the CD28 activated form single-chain antibody is as shown in SEQ ID NO:2；The ligand of the CD28 It is CD80/CD86；
(3) the extracellular hinge area is one selected from IgG4Fc CH2CH3 hinge area, CD28 hinge area and CD8 hinge area Kind is a variety of；It preferably, is CD8 hinge area；Preferably, the amino acid sequence of the CD8 hinge area such as SEQ ID NO:3 institute Show；
(4) transmembrane region is selected from CD28 transmembrane region, CD8 transmembrane region, CD3 ζ transmembrane region, CD134 transmembrane region, CD137 One of transmembrane region, ICOS transmembrane region and DAP10 transmembrane region are a variety of；Preferably, the transmembrane region is CD28 transmembrane region；It is excellent Selection of land, the amino acid sequence of the CD28 transmembrane region is as shown in SEQ ID NO:4；
(5) the costimulatory signal molecule intracellular be selected from CD28 intracellular domain, CD134/OX40 intracellular domain, One of CD137/4-1BB intracellular domain, LCK intracellular domain, ICOS intracellular domain and DAP10 intracellular domain or It is a variety of；Preferably, the costimulatory signal molecule intracellular is CD28 intracellular domain and/or CD137 intracellular domain；It is preferred that Ground, the amino acid sequence of the CD28 intracellular domain is as shown in SEQ ID NO:5；Preferably, the CD137 intracellular domain Amino acid sequence as shown in SEQ ID NO:6.
In one or more embodiments of the invention, the polypeptide successively includes following members from N-terminal to C-terminal Part:
Optional CD8 signal peptide, CD28 activated form single-chain antibody, the extracellular hinge area of CD8, CD28 transmembrane region, CD28 are intracellular Structural domain and/or CD137 intracellular domain.
In one or more embodiments of the invention, the polypeptide, as shown in figures 1A-d.
In one or more embodiments of the invention, the polypeptide, amino acid sequence such as SEQ ID NO:7 is extremely In SEQ ID NO:14 shown in any sequence.
Another aspect of the present invention relates to a kind of isolated polynucleotides, encode separation described in any one of present invention Polypeptide；Preferably, any sequence in the sequence of the isolated polynucleotides such as SEQ ID NO:15 to SEQ ID NO:22 It is shown.
Another aspect of the invention is related to a kind of nucleic acid construct, includes polynucleotides of the invention.
Another aspect of the invention is related to a kind of recombinant vector, contains polynucleotides of the invention or core of the invention Acid con-struct；Preferably, the recombinant vector is recombinant cloning vector, eukaryotic expression recombinant plasmid or recombinant viral vector； Preferably, the recombinant expression carrier is the transposon vector of recombination；Preferably, the transposon vector, which contains, is selected from The transposable element of piggybac, sleeping beauty, frog prince, Tn5 or Ty；Preferably, the recombinant expression carries Body is polynucleotides and PS328b carrier of the invention through recombinating obtained recombinant vector.
Another aspect of the invention is related to a kind of recombinant vector combination, and it includes recombinant vectors 1 and recombinant vector 2, in which:
The recombinant vector 1 is recombinant vector of the invention,
The coded sequence of the recombinant vector 2 containing first generation Chimeric antigen receptor；Preferably, the first generation inosculating antibody Original receptor is the first generation Chimeric antigen receptor for targeting Muc1；Preferably, the amino acid sequence of the first generation Chimeric antigen receptor Column are as shown in SEQ ID NO:23；Preferably, the nucleic acid sequence of the first generation Chimeric antigen receptor such as SEQ ID NO:24 institute Show；
Preferably, the recombinant vector 2 is the PNB328B carrier of recombination.
Another aspect of the invention is related to a kind of recombinant host cell, wherein the cell contains multicore glycosides of the invention Nucleic acid construct, recombinant vector of the invention or recombinant vector of the invention combination sour, of the invention；Preferably, described heavy Group host cell is recombinant mammalian cells；Preferably, the recombinant host cell is recombination T cell；Preferably, described heavy Group T cell is the peripheral blood mononuclear cells of recombination.
Two-way activation costimulatory molecules receptor of the invention can also be combined with first generation Chimeric antigen receptor.
Another aspect of the invention is related to a kind of T cell, and expression has polypeptide described in any claim in the present invention, and First generation Chimeric antigen receptor；Preferably, the recombination T cell is the peripheral blood mononuclear cells of recombination；Preferably, described first It is to target the first generation Chimeric antigen receptor of Muc1 for Chimeric antigen receptor；Preferably, the first generation Chimeric antigen receptor Amino acid sequence is as shown in SEQ ID NO:23.
Another aspect of the invention is related to a kind of Pharmaceutical composition, and it includes the polypeptides described in any one of present invention, sheet The polynucleotides of invention, nucleic acid construct of the invention, recombinant vector of the invention, recombinant vector combination of the invention, this hair Bright recombinant host cell or T cell of the invention；It optionally, also include pharmaceutically acceptable auxiliary material.
Another aspect of the invention is related to polypeptide described in any one of present invention, polynucleotides of the invention, the present invention Nucleic acid construct, recombinant vector of the invention, recombinant vector of the invention combination, recombinant host cell of the invention or this Purposes of the T cell of invention in the drug of preparation treatment and/or pre- anti-cancer；Preferably, the cancer is its cancer cell table The cancer of face unconventionality expression Muc1；Preferably, the cancer is selected from: gland cancer, lung cancer, colon cancer, colorectal cancer, breast cancer, ovary Cancer, cervical carcinoma, gastric cancer, cholangiocarcinoma, gallbladder cancer, the cancer of the esophagus, cancer of pancreas or prostate cancer.
Another aspect of the invention is related to polypeptide described in any one of present invention, polynucleotides of the invention, the present invention Nucleic acid construct, recombinant vector of the invention, recombinant vector of the invention combination, recombinant host cell of the invention or this Purposes of the T cell of invention in the drug that preparation inhibits cancer cell；Preferably, the cancer cell is cell surface unconventionality expression The cancer cell of Muc1；Preferably, the cancer cell is selected from the cancer cell of following cancer: gland cancer, lung cancer, colon cancer, colorectal cancer, cream Gland cancer, oophoroma, cervical carcinoma, gastric cancer, cholangiocarcinoma, gallbladder cancer, the cancer of the esophagus, cancer of pancreas or prostate cancer.
Another aspect of the invention is related to a kind of method for inhibiting cancer cell in vivo or in vitro, including give cancer cell with It is polypeptide described in any one of a effective amount of present invention, polynucleotides of the invention, nucleic acid construct of the invention, of the invention The step of recombinant vector, recombinant vector combination of the invention, recombinant host cell of the invention or T cell of the invention；It is excellent Selection of land, the cancer cell are the cancer cell of cell surface unconventionality expression Muc1；Preferably, the cancer cell is selected from following cancer Cancer cell: gland cancer, lung cancer, colon cancer, colorectal cancer, breast cancer, oophoroma, cervical carcinoma, gastric cancer, cholangiocarcinoma, gallbladder cancer, oesophagus Cancer, cancer of pancreas or prostate cancer.
Another aspect of the invention is related to a kind of method for the treatment of and/or pre- anti-cancer, including giving the tested of demand Person is with polypeptide, polynucleotides of the invention described in any one of a effective amount of present invention, nucleic acid construct of the invention, this hair Bright recombinant vector, recombinant vector combination of the invention, recombinant host cell of the invention or T cell of the invention step Suddenly；Preferably, the cancer is the cancer of its cancer cell surfaces unconventionality expression Muc1；Preferably, the cancer is selected from: gland cancer, Lung cancer, colon cancer, colorectal cancer, breast cancer, oophoroma, cervical carcinoma, gastric cancer, cholangiocarcinoma, gallbladder cancer, the cancer of the esophagus, cancer of pancreas or preceding Column gland cancer.
Another aspect of the invention is related to polypeptide described in any one of present invention, polynucleotides of the invention, the present invention Nucleic acid construct, recombinant vector of the invention, recombinant vector of the invention combination, recombinant host cell of the invention or this Purposes of the T cell of invention in the drug that preparation promotes cytokine secretion, wherein the cell factor is selected from IL-2, IL- 4, one of IL-6, IL-10, TNF-α and IFN-γ or a variety of.
In the present invention, unless otherwise stated, Science and Technology noun used herein has art technology The normally understood meaning of personnel institute.Also, cell culture used herein, molecular genetics, nucleic acid chemistry, immunological experiment Room operating procedure is widely used conventional steps in corresponding field.Meanwhile for a better understanding of the present invention, it is provided below The definition and explanation of relational language.
In the present invention, term " separation " or " separation ", which refer to, to be obtained under native state through artificial means. If occurring the substance or ingredient of a certain " separation " in nature, it would be possible that being that natural surroundings locating for it are changed Become, or isolate the substance under natural surroundings, or both situation have generation.For example, naturally being deposited in a certain living animal body At certain not by isolated polynucleotide or polypeptide, and the high-purity separated under this native state is identical more Polynucleotide or polypeptide are to be referred to as separation.Term " separation " or " separation " are not excluded for being mixed with artificial or synthesis object Matter does not exclude the presence of not the other foreign bodys for influencing species activity yet.
In the present invention, term " carrier (vector) " refers to, a kind of nucleic acid delivery that can be inserted polynucleotide Tool.When carrier can make the albumen of the polynucleotide encoding of insertion obtain expression, carrier is known as expression vector.Carrier can lead to Conversion is crossed, transduction or transfection import host cell, and the inhereditary material element for carrying it is expressed in host cell.It carries Body is well known to those skilled in the art, including but not limited to: plasmid；Phasmid；Coemid；Artificial chromosome, such as ferment The artificial chromosome (PAC) of female artificial chromosome (YAC), bacterial artificial chromosome (BAC) or the source P1；Bacteriophage such as λ phagocytosis Body or M13 bacteriophage and animal virus etc..The animal virus that can be used as carrier includes but is not limited to, retrovirus (including Slow virus), adenovirus, adeno-associated virus, herpesviral (such as herpes simplex virus), poxvirus, baculoviral, papillomatosis Poison, papova viruses (such as SV40).A kind of element that carrier can be expressed containing various control, including but not limited to, Promoter sequence, transcriptional initiation sequence, enhancer sequence, selection element and reporter gene.It is replicated in addition, carrier can also contain Beginning site.
In the present invention, term " host cell " refers to, can be used for importing the cell of carrier comprising but be not limited to, it is such as big The prokaryotic cell of enterobacteria or withered grass bacterium etc., such as the fungal cell of yeast cells or Aspergillus, such as S2 drosophila cell or Sf9 Insect cell, or such as fibroblast, Chinese hamster ovary celI, COS cell, NSO cell, HeLa cell, bhk cell, HEK 293 The zooblast of cell or people's cell etc..
In the present invention, term " Chimeric antigen receptor " is artificial reconstructed receptor, can will identify the specificity of tumour antigen Molecule (such as antibody) is anchored in immunocyte (such as T cell), makes immunocyte identification tumour antigen or viral antigen and kill The cell of tumour cell or virus infection.
In the present invention, term " CD28 ", official's ID number of NCBI gene pool is 940, is expressed in T cell, it is thin to can promote T The proliferation and activation of born of the same parents.In the T cell therapy of second generation mosaic type antigen receptor modification, frequently as costimulatory signal intracellular, Enhance activation and the proliferative capacity of T cell.
In the present invention, term " CD137 ", official's ID number of NCBI gene pool is 3604, is expressed in T cell, can promote T The proliferation and activation of cell.In the T cell therapy of second generation mosaic type antigen receptor modification, believe frequently as costimulation intracellular Number, enhance activation and the proliferative capacity of T cell.
In the present invention, term " single-chain antibody " (single-chain antibody variable fragment, scFv) Refer to by antibody VLRegion amino acid sequence and VHRegion amino acid sequence is formed by connecting through Linker, has in conjunction with the anti-of antigenic capacity Body segment.Wherein VLAnd VHStructural domain matches to form monovalent molecule (ginseng by that can be produced as the connector of single polypeptide chain See, for example, Bird et al., Science 242:423-426 (1988) and Huston et al., Proc.Natl.Acad.Sci.USA 85:5879-5883(1988)).Such scFv molecule can have general structure: NH2-VLConnector-VH- COOH or NH2-VHIt connects Head-VL-COOH.Suitable prior art connector is made of duplicate GGGGS amino acid sequence or its variant.For example, can be used With amino acid sequence (GGGGS)4Connector, but can also be used its variant (Holliger et al. (1993), Proc.Natl.Acad.Sci.USA 90:6444-6448).Other connectors for use in the present invention are by Alfthan et al. (1995), Protein Eng.8:725-731, Choi et al. (2001), Eur.J.Immunol.31:94-106, Hu et al. (1996), Cancer Res.56:3055-3061, Kipriyanov et al. (1999), J.Mol.Biol.293:41-56 and Roovers et al. (2001), Cancer Immunol. description.
In the present invention, term " T cell activation coherent signal " refers to and two signals, i.e. T cell required for T cell activation Surface TCR-CD3 complex provides the first signal of T cell activation, determines the killing of T cell in conjunction with Antigenic Peptide-MHC molecule Specificity；The costimulatory molecules (such as CD28) and respective ligand (such as B7) on T cell surface combine, and provide the second of T cell activation Signal promotes T cell activation, proliferation and survival.
In the present invention, the immunoreceptor tyrosine activating motif is the tyrosine activation base of CD3 ζ and/or Fc ε RI γ Sequence；Preferably, the immunoreceptor tyrosine activating motif is CD3 ζ tyrosine activation motifs, amino acid sequence such as SEQ ID Shown in NO:25.
Term " costimulatory signal molecule " (Co-stimulating molecule) refers to immunocyte surface in the present invention Some adhesion molecules, such as CD28, CD134/OX40, CD137/4-1BB, CD40, by with its ligand binding, activation is immune The second signal of cell enhances the proliferative capacity of immunocyte and the secreting function of cell factor, extends activating immune cell Time-to-live.
In the present invention, term " PB " transposons, is the abbreviation of Piggybac.Transposons be one section of moveable heredity because Son.Section of DNA sequence above individually can be replicated or be broken from situ, another site is inserted into after cyclisation, and to base thereafter Because playing regulating and controlling effect, this process claims swivel base.Since the transposons on carrier functions, integrate Muc1 G1 CAR, 28DCR Enter T cell genome.
Antibody is divided into activated form and blocking-up type antibody.In the present invention, term " extracellular activated form antibody " is by antibody anchorage It is combined in the action site (i.e. ligand and receptor binding site) of cell membrane surface and cell surface molecule, promotes cell biological Learn function.The extracellular activated form antibody of CD28, since CD28 molecule is present in most of T cell surfaces, it is considered to be a kind of T cell Distinctive surface molecular, the extracellular activated form antibody of CD28 can effectively identify and activate CD28 molecular signal, generate second signal, The second signal of the alternative APC of CD28 acts on.
In the present invention, term " spectator functions " refer to when tumour cell, virus infection cell when, single CAR-T is thin Born of the same parents can only activate own cells second signal, can not further activate peripheral T cells function, cause peripheral T cells that cannot draw Play a series of activation T cell functions.
In the present invention, term " cluster effect " refers to that the T cell after single modification can be recruited constantly and activate surrounding not The T cell of activation, and peripheral T cells downstream signaling pathway is activated, cause the functions such as activation, the proliferation of multiple T cell grades.
In the present invention, term " Muc1 " is also known as mucoprotein, mucins, and official's ID number of NCBI gene pool is 4582.Muc1 It is the I type transmembrane glycoprotein (being mostly connected with O-glycosides key with the Ser/Thr on polypeptide backbone) of a kind of high molecular weight (> 200kD), It is mainly expressed in Various Tissues under normal circumstances, the nearly lumen of epithelial cell or lumen of gland face in organ, is expressed in top, polarity point Cloth.When tumour occurs, Muc1 albumen can in tumor cell surface unconventionality expression, expression quantity up to it is normal when 100 times or more. Also, it loses in the polarity distribution of cell surface, can be uniformly distributed in entire cell surface.In addition, it is incomplete due to glycosylating, The structure of Muc1 albumen also changes, and new sugar chain and peptide epitopes occurs.
In the present invention, term " pharmaceutically acceptable carrier and/or excipient " refers in pharmacology and/or physiologically The carrier and/or excipient compatible with subject and active constituent is well known in the art (see, for example, Remington's Pharmaceutical Sciences.Edited by Gennaro AR,19th ed.Pennsylvania:Mack Publishing Company, 1995), and include but is not limited to: pH adjusting agent, surfactant, adjuvant, ionic strength increase Strong agent.For example, pH adjusting agent includes but is not limited to phosphate buffer；Surfactant include but is not limited to cation, yin from Son or nonionic surface active agent, such as Tween-80；Ionic strength reinforcing agent includes but is not limited to sodium chloride.
In the present invention, term " effective quantity " refers to the amount for being enough to obtain or at least partly obtaining desired effect.For example, pre- Anti- disease (such as tumour) effective quantity refers to, it is sufficient to prevent, prevent, or postpone the amount of the generation of disease (such as tumour)；Treatment Condition effective amount refers to, it is sufficient to cure or at least partly prevent suffer from disease patient disease and its complication amount.It surveys Fixed such effective quantity is completely within the limit of power of those skilled in the art.For example, therapeutical uses are effectively measured by Depending on the severity of disease to be treated, the overall status of the immune system of patient oneself, the ordinary circumstance of patient such as year Age, weight and gender, method of application of drug, and the other treatment being administered simultaneously etc..
Advantageous effect of the invention
When it modifies T cell jointly with the first generation CAR-T comprising the first signal, strong cluster effect can produce It answers, killing tumor cell.Meanwhile the effect of this two-way activation is only confined between the T cell to contact with each other, it will not be as note The activated form antibody for penetrating CD28 is the same, causes strong T cell and is immunized, causes potentially serious toxic side effect.It is provided by the invention The T cell of the Chimeric antigen receptor modification of the two-way costimulatory molecules activated receptor joint Muc1 of CD28, can be with specific killing The highly expressed tumor cell line of Muc1, and it is better than the Muc1 first generation, second generation CAR-T, while to the tumour cell that do not express Lethal effect is smaller or nothing for strain, have efficiently, high specific.The present invention can be on the basis for keeping the first generation, second generation CAR curative effect On, it is for tumour that the T cell of the two-way costimulatory molecules activated receptor activation of CD28, which can activate self T-cell second signal, Specific antigen is stronger, and the first signal CD3 ζ activation is also stronger, and correspondingly, the extracellular activated form antibody of CD28 transmits T cell activation Relevant second signal is also stronger, is gathered in around tumor by local, and constantly recruits and activate non-activated T cell around, And T cell downstream signaling pathway is activated, cause activation, proliferation and the survival of T cell tandem type.
Detailed description of the invention
The structural schematic diagram of Figure 1A: CD28 two-way activation costimulatory molecules receptor 28DCR1.
The structural schematic diagram of Figure 1B: CD28 two-way activation costimulatory molecules receptor 28DCR2.
The structural schematic diagram of the two-way activation costimulatory molecules receptor 28DCR3 of Fig. 1 C:CD28.
The structural schematic diagram of the two-way activation costimulatory molecules receptor 28DCR4 of Fig. 1 D:CD28.
Fig. 1 E:Muc1 G1 CAR structural schematic diagram.
Fig. 1 F:Muc1 G2 CAR structural schematic diagram.
Fig. 2A: the expression of CD3 ζ in two-way activation Chimeric antigen receptor Muc1 CAR-T cell.Internal reference is GADPH.
Fig. 2 B: the copy number of 28DCR1,28DCR2,28DCR3 in two-way activation Chimeric antigen receptor Muc1 CAR-T cell Expression.
Fig. 3: electricity turns 28DCR function, recombinant cell 28DCR1/2/3 Cells Cell Proliferation curve.Abscissa represents the time (h), ordinate represents cell number (a).
Fig. 4: two-way activation Chimeric antigen receptor Muc1 CAR-T cell, cell Proliferation curve.
Fig. 5 A: electricity turns 28DCR function, the CD28 phenotype of Mock T.Wherein, abscissa is that the cell of the single CD28 positive is glimmering Luminous intensity, ordinate are the cell number of different fluorescence intensities.
Fig. 5 B: electricity turns 28DCR1 function, the CD28 phenotype of recombinant cell 28DCR1.Wherein, abscissa is single CD28 sun Property cell fluorescence intensity, ordinate be different fluorescence intensities cell number.
Fig. 5 C: electricity turns 28DCR2 function, the CD28 phenotype of recombinant cell 28DCR2.Wherein, abscissa is single CD28 sun Property cell fluorescence intensity, ordinate be different fluorescence intensities cell number.
Fig. 5 D: electricity turns 28DCR3 function, the CD28 phenotype of recombinant cell 28DCR3.Wherein, abscissa is single CD28 sun Property cell fluorescence intensity, ordinate be different fluorescence intensities cell number.
Fig. 6 A: electricity turns the function of 28DCR2 joint Muc1 G1 CAR, the CD28 phenotype of Mock T.Wherein, abscissa is single The cell fluorescence intensity of a CD28 positive, ordinate are the cell number of different fluorescence intensities.
Fig. 6 B: electricity turns the function of 28DCR2 joint Muc1 G1 CAR, the CD28 phenotype of recombinant cell Muc1 G1 CAR.Its In, abscissa is the cell fluorescence intensity of the single CD28 positive, and ordinate is the cell number of different fluorescence intensities.
Fig. 6 C: electricity turns the function of 28DCR2 joint Muc1 G1 CAR, the CD28 phenotype of recombinant cell Muc1 G2 CAR.Its In, abscissa is the cell fluorescence intensity of the single CD28 positive, and ordinate is the cell number of different fluorescence intensities.
Fig. 6 D: electricity turns the function of 28DCR2 joint Muc1 G1 CAR, the CD28 of recombinant cell Muc1 G1 CAR-28DCR1 Phenotype.Wherein, abscissa is the cell fluorescence intensity of the single CD28 positive, and ordinate is the cell number of different fluorescence intensities.
Fig. 7 A: electricity turns the function of 28DCR2 joint Muc1 G1 CAR, the CD45RO phenotype of Mock T.Wherein, abscissa is The cell fluorescence intensity of the single CD45RO positive, ordinate are the cell number of different fluorescence intensities.
Fig. 7 B: electricity turns the function of 28DCR2 joint Muc1 G1 CAR, the CD45RO phenotype of recombinant cell Muc1 G1 CAR. Wherein, abscissa is the cell fluorescence intensity of the single CD45RO positive, and ordinate is the cell number of different fluorescence intensities.
Fig. 7 C: electricity turns the function of 28DCR2 joint Muc1 G1 CAR, the CD45RO phenotype of recombinant cell Muc1 G2 CAR. Wherein, abscissa is the cell fluorescence intensity of the single CD45RO positive, and ordinate is the cell number of different fluorescence intensities.
Fig. 7 D: electricity turns the function of 28DCR joint Muc1 G1 CAR, recombinant cell Muc1 G1 CAR-28DCR1's CD45RO phenotype.Wherein, abscissa is the cell fluorescence intensity of the single CD45RO positive, and ordinate is the thin of different fluorescence intensities Born of the same parents' number.
Fig. 8 A: electricity turns the function of 28DCR2 joint Muc1 G1 CAR, the memory T phenotype of Mock T.Wherein, abscissa is The cell fluorescence intensity of the single CD62L positive, ordinate are the cell fluorescence intensity of the not single CCR7 positive.
Fig. 8 B: electricity turns the function of 28DCR2 joint Muc1 G1 CAR, the memory T phenotype of recombinant cell Muc1G1 CAR.Its In, abscissa is the cell fluorescence intensity of the single CD62L positive, and ordinate is the cell fluorescence intensity of the not single CCR7 positive.
Fig. 8 C: electricity turns the function of 28DCR2 joint Muc1 G1 CAR, the memory T phenotype of recombinant cell Muc1 G2 CAR. Wherein, abscissa is the cell fluorescence intensity of the single CD62L positive, and ordinate is that the cell fluorescence of the not single CCR7 positive is strong Degree.
Fig. 8 D: electricity turns the function of 28DCR joint Muc1 G1 CAR, the memory T of recombinant cell Muc1 G1 CAR-28DCR1 Phenotype.Wherein, abscissa is the cell fluorescence intensity of the single CD62L positive, and ordinate is that the cell of the not single CCR7 positive is glimmering Luminous intensity.
Fig. 9 A: two-way activation Chimeric antigen receptor Muc1 CAR-T cell imitates target ratio to MCF7 tumor cell line in vitro and is The killing of 8:1.
Fig. 9 B: two-way activation Chimeric antigen receptor Muc1 CAR-T cell imitates target ratio to MCF7 tumor cell line in vitro and is The killing of 4:1.
Fig. 9 C: two-way activation Chimeric antigen receptor Muc1 CAR-T cell imitates target ratio to A549 tumor cell line in vitro and is The killing of 8:1.
Fig. 9 D: two-way activation Chimeric antigen receptor Muc1 CAR-T cell imitates target ratio to A549 tumor cell line in vitro and is The killing of 4:1.
Figure 10: two-way activation Chimeric antigen receptor Muc1 CAR-T cell IL-2, IL-4, IL- under Muc1 antigenic stimulus 6, IL-10, the variation of TNF-α and IFN-γ cell factor.
Figure 11: two-way activation Chimeric antigen receptor Muc1 CAR-T cell imitates the treatment of oophoroma mice-transplanted tumor model Fruit.
Partial sequence of the present invention is as follows:
1. the amino acid sequence (SEQ ID NO:1) of CD8 signal peptide
MGNSCYNIVATLLLVLNFERTRS
2. the amino acid sequence (SEQ ID NO:2) of the extracellular activated form single-chain antibody of CD28
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWIGCIYPGNVNTNYNEKFKDRAT LTVDTSISTAYMELSRLRSDDTAVYFCTRSHYGLDWNFDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL SASVGDRVTITCHASQNIYVWLNWYQQKPGKAPKLLIYKASNLHTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQGQTYPYTFGGGTKVEIKE
3. the amino acid sequence (SEQ ID NO:3) of CD8 α hinge area
SKYGPPCPPCPIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSK
4. the amino acid sequence (SEQ ID NO:4) of CD28 transmembrane region
PFWVLVVVGGVLACYSLLVTVAFIIFWV
5. the amino acid sequence (SEQ ID NO:5) of CD28 costimulatory signal intracellular domain intracellular
RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
6. the amino acid sequence (SEQ ID NO:6) of CD137 costimulatory signal intracellular domain intracellular
KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
7. the amino acid sequence (containing signal peptide) (SEQ ID NO:7) of 28DCR1
MGNSCYNIVATLLLVLNFERTRSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLE WIGCIYPGNVNTNYNEKFKDRATLTVDTSISTAYMELSRLRSDDTAVYFCTRSHYGLDWNFDVWGQGTTVTVSSGGG GSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCHASQNIYVWLNWYQQKPGKAPKLLIYKASNLHTGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCQQGQTYPYTFGGGTKVEIKESKYGPPCPPCPIEVMYPPPYLDNEKSNGTIIHVK GKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPR DFAAYRS
8. the amino acid sequence (containing signal peptide) (SEQ ID NO:8) of 28DCR2
MGNSCYNIVATLLLVLNFERTRSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLE WIGCIYPGNVNTNYNEKFKDRATLTVDTSISTAYMELSRLRSDDTAVYFCTRSHYGLDWNFDVWGQGTTVTVSSGGG GSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCHASQNIYVWLNWYQQKPGKAPKLLIYKASNLHTGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCQQGQTYPYTFGGGTKVEIKESKYGPPCPPCPIEVMYPPPYLDNEKSNGTIIHVK GKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPE EEEGGCEL
9. the amino acid sequence (containing signal peptide) (SEQ ID NO:9) of 28DCR3
MGNSCYNIVATLLLVLNFERTRSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLE WIGCIYPGNVNTNYNEKFKDRATLTVDTSISTAYMELSRLRSDDTAVYFCTRSHYGLDWNFDVWGQGTTVTVSSGGG GSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCHASQNIYVWLNWYQQKPGKAPKLLIYKASNLHTGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCQQGQTYPYTFGGGTKVEIKESKYGPPCPPCPIEVMYPPPYLDNEKSNGTIIHVK GKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPR DFAAYRSKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
10. the amino acid sequence (containing signal peptide) (SEQ ID NO:10) of 28DCR4
MGNSCYNIVATLLLVLNFERTRSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLE WIGCIYPGNVNTNYNEKFKDRATLTVDTSISTAYMELSRLRSDDTAVYFCTRSHYGLDWNFDVWGQGTTVTVSSGGG GSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCHASQNIYVWLNWYQQKPGKAPKLLIYKASNLHTGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCQQGQTYPYTFGGGTKVEIKESKYGPPCPPCPIEVMYPPPYLDNEKSNGTIIHVK GKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPE EEEGGCELRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
11. the amino acid sequence (being free of signal peptide) (SEQ ID NO:11) of 28DCR1
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWIGCIYPGNVNTNYNEKFKDRAT LTVDTSISTAYMELSRLRSDDTAVYFCTRSHYGLDWNFDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL SASVGDRVTITCHASQNIYVWLNWYQQKPGKAPKLLIYKASNLHTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQGQTYPYTFGGGTKVEIKESKYGPPCPPCPIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVV GGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
12. the amino acid sequence (being free of signal peptide) (SEQ ID NO:12) of 28DCR2
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWIGCIYPGNVNTNYNEKFKDRAT LTVDTSISTAYMELSRLRSDDTAVYFCTRSHYGLDWNFDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL SASVGDRVTITCHASQNIYVWLNWYQQKPGKAPKLLIYKASNLHTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQGQTYPYTFGGGTKVEIKESKYGPPCPPCPIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVV GGVLACYSLLVTVAFIIFWVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
13. the amino acid sequence (being free of signal peptide) (SEQ ID NO:13) of 28DCR3
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWIGCIYPGNVNTNYNEKFKDRAT LTVDTSISTAYMELSRLRSDDTAVYFCTRSHYGLDWNFDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL SASVGDRVTITCHASQNIYVWLNWYQQKPGKAPKLLIYKASNLHTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQGQTYPYTFGGGTKVEIKESKYGPPCPPCPIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVV GGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSKRGRKKLLYIFKQPFM RPVQTTQEEDGCSCRFPEEEEGGCEL
14. the amino acid sequence (being free of signal peptide) (SEQ ID NO:14) of 28DCR4
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWIGCIYPGNVNTNYNEKFKDRAT LTVDTSISTAYMELSRLRSDDTAVYFCTRSHYGLDWNFDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL SASVGDRVTITCHASQNIYVWLNWYQQKPGKAPKLLIYKASNLHTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQGQTYPYTFGGGTKVEIKESKYGPPCPPCPIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVV GGVLACYSLLVTVAFIIFWVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRSKRSRLLHSDYMNM TPRRPGPTRKHYQPYAPPRDFAAYRS
15. the nucleic acid sequence (containing signal peptide) (SEQ ID NO:15) of 28DCR1
ATGGGAAACAGCTGTTACAACATAGTAGCCACTCTGTTGCTGGTCCTCAACTTTGAGAGGACAAGATCA CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGG ATACACCTTCACCAGCTACTATATACACTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATTGGATGTATTT ATCCTGGAAATGTCAATACTAACTATAATGAGAAGTTCAAGGACAGGGCCACCCTGACCGTAGACACGTCCATCAGC ACAGCCTACATGGAGCTGAGCAGGCTGAGATCTGACGACACGGCCGTGTATTTCTGTACAAGATCACACTACGGCCT CGACTGGAACTTCGATGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCAGGTGGAGGCGGTTCAGGCGGAGGTG GCAGCGGCGGTGGCGGGTCGGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTC ACCATCACTTGCCATGCCAGTCAAAACATTTATGTTTGGTTAAACTGGTATCAGCAGAAACCAGGGAAAGCCCCTAA GCTCCTGATCTATAAGGCTTCCAACCTGCACACAGGGGTCCCATCAAGGTTCAGTGGCAGTGGATCTGGGACAGATT TCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCAACTTACTACTGTCAACAGGGTCAAACTTATCCGTAC ACGTTCGGCGGAGGGACCAAGGTGGAGATCAAAGAGTCCAAATATGGTCCCCCATGCCCACCATGCCCAATTGAAGT TATGTATCCTCCTCCTTACCTAGACAATGAGAAGAGCAATGGAACCATTATCCATGTGAAAGGGAAACACCTTTGTC CAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGC TTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAA CATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATC GCTCCTGATAA
16. the nucleic acid sequence (containing signal peptide) (SEQ ID NO:16) of 28DCR2
ATGGGAAACAGCTGTTACAACATAGTAGCCACTCTGTTGCTGGTCCTCAACTTTGAGAGGACAAGATCA CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGG ATACACCTTCACCAGCTACTATATACACTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATTGGATGTATTT ATCCTGGAAATGTCAATACTAACTATAATGAGAAGTTCAAGGACAGGGCCACCCTGACCGTAGACACGTCCATCAGC ACAGCCTACATGGAGCTGAGCAGGCTGAGATCTGACGACACGGCCGTGTATTTCTGTACAAGATCACACTACGGCCT CGACTGGAACTTCGATGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCAGGTGGAGGCGGTTCAGGCGGAGGTG GCAGCGGCGGTGGCGGGTCGGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTC ACCATCACTTGCCATGCCAGTCAAAACATTTATGTTTGGTTAAACTGGTATCAGCAGAAACCAGGGAAAGCCCCTAA GCTCCTGATCTATAAGGCTTCCAACCTGCACACAGGGGTCCCATCAAGGTTCAGTGGCAGTGGATCTGGGACAGATT TCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCAACTTACTACTGTCAACAGGGTCAAACTTATCCGTAC ACGTTCGGCGGAGGGACCAAGGTGGAGATCAAAGAGTCCAAATATGGTCCCCCATGCCCACCATGCCCAATTGAAGT TATGTATCCTCCTCCTTACCTAGACAATGAGAAGAGCAATGGAACCATTATCCATGTGAAAGGGAAACACCTTTGTC CAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGC TTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAAACGGGGCAGAAAGAAGCTCCTGTATATATTCAAACAACC ATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGAT GTGAACTGTGATAA
17. the nucleic acid sequence (containing signal peptide) (SEQ ID NO:17) of 28DCR3
ATGGGAAACAGCTGTTACAACATAGTAGCCACTCTGTTGCTGGTCCTCAACTTTGAGAGGACAAGATCA CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGG ATACACCTTCACCAGCTACTATATACACTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATTGGATGTATTT ATCCTGGAAATGTCAATACTAACTATAATGAGAAGTTCAAGGACAGGGCCACCCTGACCGTAGACACGTCCATCAGC ACAGCCTACATGGAGCTGAGCAGGCTGAGATCTGACGACACGGCCGTGTATTTCTGTACAAGATCACACTACGGCCT CGACTGGAACTTCGATGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCAGGTGGAGGCGGTTCAGGCGGAGGTG GCAGCGGCGGTGGCGGGTCGGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTC ACCATCACTTGCCATGCCAGTCAAAACATTTATGTTTGGTTAAACTGGTATCAGCAGAAACCAGGGAAAGCCCCTAA GCTCCTGATCTATAAGGCTTCCAACCTGCACACAGGGGTCCCATCAAGGTTCAGTGGCAGTGGATCTGGGACAGATT TCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCAACTTACTACTGTCAACAGGGTCAAACTTATCCGTAC ACGTTCGGCGGAGGGACCAAGGTGGAGATCAAAGAGTCCAAATATGGTCCCCCATGCCCACCATGCCCAATTGAAGT TATGTATCCTCCTCCTTACCTAGACAATGAGAAGAGCAATGGAACCATTATCCATGTGAAAGGGAAACACCTTTGTC CAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGC TTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAA CATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATC GCTCCAAACGGGGCAGAAAGAAGCTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAG GAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTGTGATAA
18. the nucleic acid sequence (containing signal peptide) (SEQ ID NO:18) of 28DCR4
ATGGGAAACAGCTGTTACAACATAGTAGCCACTCTGTTGCTGGTCCTCAACTTTGAGAGGACAAGATCA CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGG ATACACCTTCACCAGCTACTATATACACTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATTGGATGTATTT ATCCTGGAAATGTCAATACTAACTATAATGAGAAGTTCAAGGACAGGGCCACCCTGACCGTAGACACGTCCATCAGC ACAGCCTACATGGAGCTGAGCAGGCTGAGATCTGACGACACGGCCGTGTATTTCTGTACAAGATCACACTACGGCCT CGACTGGAACTTCGATGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCAGGTGGAGGCGGTTCAGGCGGAGGTG GCAGCGGCGGTGGCGGGTCGGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTC ACCATCACTTGCCATGCCAGTCAAAACATTTATGTTTGGTTAAACTGGTATCAGCAGAAACCAGGGAAAGCCCCTAA GCTCCTGATCTATAAGGCTTCCAACCTGCACACAGGGGTCCCATCAAGGTTCAGTGGCAGTGGATCTGGGACAGATT TCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCAACTTACTACTGTCAACAGGGTCAAACTTATCCGTAC ACGTTCGGCGGAGGGACCAAGGTGGAGATCAAAGAGTCCAAATATGGTCCCCCATGCCCACCATGCCCAATTGAAGT TATGTATCCTCCTCCTTACCTAGACAATGAGAAGAGCAATGGAACCATTATCCATGTGAAAGGGAAACACCTTTGTC CAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGC TTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAAACGGGGCAGAAAGAAGCTCCTGTATATATTCAAACAACC ATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGAT GTGAACTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACC CGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCCTGATAA
19. the nucleic acid sequence (being free of signal peptide) (SEQ ID NO:19) of 28DCR1
CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAG GCTTCTGGATACACCTTCACCAGCTACTATATACACTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATTGG ATGTATTTATCCTGGAAATGTCAATACTAACTATAATGAGAAGTTCAAGGACAGGGCCACCCTGACCGTAGACACGT CCATCAGCACAGCCTACATGGAGCTGAGCAGGCTGAGATCTGACGACACGGCCGTGTATTTCTGTACAAGATCACAC TACGGCCTCGACTGGAACTTCGATGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCAGGTGGAGGCGGTTCAGG CGGAGGTGGCAGCGGCGGTGGCGGGTCGGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAG ACAGAGTCACCATCACTTGCCATGCCAGTCAAAACATTTATGTTTGGTTAAACTGGTATCAGCAGAAACCAGGGAAA GCCCCTAAGCTCCTGATCTATAAGGCTTCCAACCTGCACACAGGGGTCCCATCAAGGTTCAGTGGCAGTGGATCTGG GACAGATTTCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCAACTTACTACTGTCAACAGGGTCAAACTT ATCCGTACACGTTCGGCGGAGGGACCAAGGTGGAGATCAAAGAGTCCAAATATGGTCCCCCATGCCCACCATGCCCA ATTGAAGTTATGTATCCTCCTCCTTACCTAGACAATGAGAAGAGCAATGGAACCATTATCCATGTGAAAGGGAAACA CCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTT GCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGAC TACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGC AGCCTATCGCTCCTGATAA
20. the nucleic acid sequence (being free of signal peptide) (SEQ ID NO:20) of 28DCR2
CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAG GCTTCTGGATACACCTTCACCAGCTACTATATACACTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATTGG ATGTATTTATCCTGGAAATGTCAATACTAACTATAATGAGAAGTTCAAGGACAGGGCCACCCTGACCGTAGACACGT CCATCAGCACAGCCTACATGGAGCTGAGCAGGCTGAGATCTGACGACACGGCCGTGTATTTCTGTACAAGATCACAC TACGGCCTCGACTGGAACTTCGATGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCAGGTGGAGGCGGTTCAGG CGGAGGTGGCAGCGGCGGTGGCGGGTCGGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAG ACAGAGTCACCATCACTTGCCATGCCAGTCAAAACATTTATGTTTGGTTAAACTGGTATCAGCAGAAACCAGGGAAA GCCCCTAAGCTCCTGATCTATAAGGCTTCCAACCTGCACACAGGGGTCCCATCAAGGTTCAGTGGCAGTGGATCTGG GACAGATTTCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCAACTTACTACTGTCAACAGGGTCAAACTT ATCCGTACACGTTCGGCGGAGGGACCAAGGTGGAGATCAAAGAGTCCAAATATGGTCCCCCATGCCCACCATGCCCA ATTGAAGTTATGTATCCTCCTCCTTACCTAGACAATGAGAAGAGCAATGGAACCATTATCCATGTGAAAGGGAAACA CCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTT GCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAAACGGGGCAGAAAGAAGCTCCTGTATATATTC AAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGA AGGAGGATGTGAACTGTGATAA
21. the nucleic acid sequence (being free of signal peptide) (SEQ ID NO:21) of 28DCR3
CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAG GCTTCTGGATACACCTTCACCAGCTACTATATACACTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATTGG ATGTATTTATCCTGGAAATGTCAATACTAACTATAATGAGAAGTTCAAGGACAGGGCCACCCTGACCGTAGACACGT CCATCAGCACAGCCTACATGGAGCTGAGCAGGCTGAGATCTGACGACACGGCCGTGTATTTCTGTACAAGATCACAC TACGGCCTCGACTGGAACTTCGATGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCAGGTGGAGGCGGTTCAGG CGGAGGTGGCAGCGGCGGTGGCGGGTCGGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAG ACAGAGTCACCATCACTTGCCATGCCAGTCAAAACATTTATGTTTGGTTAAACTGGTATCAGCAGAAACCAGGGAAA GCCCCTAAGCTCCTGATCTATAAGGCTTCCAACCTGCACACAGGGGTCCCATCAAGGTTCAGTGGCAGTGGATCTGG GACAGATTTCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCAACTTACTACTGTCAACAGGGTCAAACTT ATCCGTACACGTTCGGCGGAGGGACCAAGGTGGAGATCAAAGAGTCCAAATATGGTCCCCCATGCCCACCATGCCCA ATTGAAGTTATGTATCCTCCTCCTTACCTAGACAATGAGAAGAGCAATGGAACCATTATCCATGTGAAAGGGAAACA CCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTT GCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGAC TACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGC AGCCTATCGCTCCAAACGGGGCAGAAAGAAGCTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTA CTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTGTGATAA
22. the nucleic acid sequence (being free of signal peptide) (SEQ ID NO:22) of 28DCR4
CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAG GCTTCTGGATACACCTTCACCAGCTACTATATACACTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATTGG ATGTATTTATCCTGGAAATGTCAATACTAACTATAATGAGAAGTTCAAGGACAGGGCCACCCTGACCGTAGACACGT CCATCAGCACAGCCTACATGGAGCTGAGCAGGCTGAGATCTGACGACACGGCCGTGTATTTCTGTACAAGATCACAC TACGGCCTCGACTGGAACTTCGATGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCAGGTGGAGGCGGTTCAGG CGGAGGTGGCAGCGGCGGTGGCGGGTCGGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAG ACAGAGTCACCATCACTTGCCATGCCAGTCAAAACATTTATGTTTGGTTAAACTGGTATCAGCAGAAACCAGGGAAA GCCCCTAAGCTCCTGATCTATAAGGCTTCCAACCTGCACACAGGGGTCCCATCAAGGTTCAGTGGCAGTGGATCTGG GACAGATTTCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCAACTTACTACTGTCAACAGGGTCAAACTT ATCCGTACACGTTCGGCGGAGGGACCAAGGTGGAGATCAAAGAGTCCAAATATGGTCCCCCATGCCCACCATGCCCA ATTGAAGTTATGTATCCTCCTCCTTACCTAGACAATGAGAAGAGCAATGGAACCATTATCCATGTGAAAGGGAAACA CCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTT GCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAAACGGGGCAGAAAGAAGCTCCTGTATATATTC AAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGA AGGAGGATGTGAACTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCG GGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCCTGATAA
23. the amino acid sequence (SEQ ID NO:23) of Muc1 G1 CAR
MALPVTALLLPLALLLHAARPSEVQLQQSGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEW VAEIRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTFGNSFAYWGQGTTVTVSSGGSGSGG SGSGGSGSDIVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLI GDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLGSEESKYGPPCPPCPAPPVAGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEAC RPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFP EEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMA EAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
24. the nucleic acid sequence (SEQ ID NO:24) of Muc1 G1 CAR
CCATGCCCACCATGCCCAGCACCTCCCGTGGCCGGACCATCAGTCTTCCTGTTCCCCCCAAAACCCAAG GACACTCTCATGATCTCCCGGACCCCTGAGGTCACGTGCGTGGTGGTGGACGTGAGCCAGGAAGACCCCGAGGTCCA GTTCAACTGGTACGTGGATGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTTCCAGAGCACGT ACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAACGGCAAGGAGTACAAGTGCAAGGTCTCCAAC AAAGGCCTCCCGTCCTCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAGCCACAGGTGTACACCCT GCCCCCATCCCAGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACA TCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGC TCCTTCTTCCTCTACAGCAGGCTAACCGTGGACAAGAGCAGGTGGCAGGAGGGGAATGTCTTCTCATGCTCCGTGAT GCATGAGGCTCTGCACAACCACTACACACAGAAGAGCCTCTCCCTGTCTCTGGGTAAATTCGTGCCGGTCTTCCTGC CAGCGAAGCCCACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTG CGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGATATCTACAT CTGGGCGCCCCTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCACCCTTTACTGCAACCACAAACGGG GCAGAAAGAAGCTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGT AGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTGAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGC GTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGA GACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAG AAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCT TTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC
25. the tyrosine activation motifs (SEQ ID NO:25) of CD3 ζ
RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAE AYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
26. the nucleotide sequence (SEQ ID NO:26) of Muc1 G2 CAR
ATGGCCTTACCAGTGACCGCCTTGCTCCTGCCGCTGGCCTTGCTGCTCCACGCCGCCAGGCCGAGCGAG GTCCAGCTGCAGCAGTCAGGAGGAGGCTTGGTGCAACCTGGAGGATCCATGAAACTCTCCTGTGTTGCCTCTGGATT CACTTTCAGTAACTACTGGATGAACTGGGTCCGCCAGTCTCCAGAGAAGGGGCTTGAGTGGGTTGCTGAAATTAGAT TGAAATCTAATAATTATGCAACACATTATGCGGAGTCTGTGAAAGGGAGGTTCACCATCTCAAGAGATGATTCCAAA AGTAGTGTCTACCTGCAAATGAACAACTTAAGAGCTGAAGACACTGGCATTTATTACTGTACCTTTGGTAACTCCTT TGCTTACTGGGGCCAAGGGACCACGGTCACCGTCTCCTCAGGTGGTTCTGGTTCTGGCGGCTCCGGTTCCGGTGGAT CCGGCTCTGATATCGTTGTGACTCAGGAATCTGCACTCACCACATCACCTGGTGAAACAGTCACACTCACTTGTCGC TCAAGTACTGGGGCTGTTACAACTAGTAACTATGCCAACTGGGTCCAAGAAAAACCAGATCATTTATTCACTGGTCT AATAGGTGGTACCAACAACCGAGCACCAGGTGTTCCTGCCAGATTCTCAGGCTCCCTGATTGGAGACAAGGCTGCCC TCACCATCACAGGGGCACAGACTGAGGATGAGGCAATATATTTCTGTGCTCTATGGTACAGCAACCATTGGGTGTTC GGTGGAGGAACCAAACTGACTGTCCTAGGATCCGAGGAGTCCAAATATGGTCCCCCATGCCCACCATGCCCAGCACC TCCCGTGGCCGGACCATCAGTCTTCCTGTTCCCCCCAAAACCCAAGGACACTCTCATGATCTCCCGGACCCCTGAGG TCACGTGCGTGGTGGTGGACGTGAGCCAGGAAGACCCCGAGGTCCAGTTCAACTGGTACGTGGATGGCGTGGAGGTG CATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTTCCAGAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCA CCAGGACTGGCTGAACGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGGCCTCCCGTCCTCCATCGAGAAAACCA TCTCCAAAGCCAAAGGGCAGCCCCGAGAGCCACAGGTGTACACCCTGCCCCCATCCCAGGAGGAGATGACCAAGAAC CAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCC GGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAGGCTAACCGTGG ACAAGAGCAGGTGGCAGGAGGGGAATGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACACAG AAGAGCCTCTCCCTGTCTCTGGGTAAATTCGTGCCGGTCTTCCTGCCAGCGAAGCCCACCACGACGCCAGCGCCGCG ACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGG GCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGATATCTACATCTGGGCGCCCCTGGCCGGGACTTGTGGGGTC CTTCTCCTGTCACTGGTTATCACCCTTTACTGCAACCACAAACGGGGCAGAAAGAAGCTCCTGTATATATTCAAACA ACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAG GATGTGAACTGAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAAC GAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAA GCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGA TTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGAC ACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC
27. the nucleic acid sequence (SEQ ID NO:27) of PS328b carrier
GGCGCGCCTTAACCCTAGAAAGATAATCATATTGTGACGTACGTTAAAGATAATCATGCGTAAAATTGA CGCATGTCTAGAGGTGTGGAAAGTCCCCAGGCTCCCCAGCAGGCAGAAGTATGCAAAGCATGCATCTCAATTAGTCA GCAACCAGGTGTGGAAAGTCCCCAGGCTCCCCAGCAGGCAGAAGTATGCAAAGCATGCATCTCAATTAGTCAGCAAC CAAGGATCTGCGATCGCTCCGGTGCCCGTCAGTGGGCAGAGCGCACATCGCCCACAGTCCCCGAGAAGTTGGGGGGA GGGGTCGGCAATTGAACGGGTGCCTAGAGAAGGTGGCGCGGGGTAAACTGGGAAAGTGATGTCGTGTACTGGCTCCG CCTTTTTCCCGAGGGTGGGGGAGAACCGTATATAAGTGCAGTAGTCGCCGTGAACGTTCTTTTTCGCAACGGGTTTG CCGCCAGAACACAGCTGAAGCTTCGAGGGGCTCGCATCTCTCCTTCACGCGCCCGCCGCCCTACCTGAGGCCGCCAT CCACGCCGGTTGAGTCGCGTTCTGCCGCCTCCCGCCTGTGGTGCCTCCTGAACTGCGTCCGCCGTCTAGGTAAGTTT AAAGCTCAGGTCGAGACCGGGCCTTTGTCCGGCGCTCCCTTGGAGCCTACCTAGACTCAGCCGGCTCTCCACGCTTT GCCTGACCCTGCTTGCTCAACTCTACGTCTTTGTTTCGTTTTCTGTTCTGCGCCGTTACAGATCCAAGCTGTGACCG GCGCCTACGAATTCGGATCCTGCACTAGTGCTGTCGACCAGACATGATAAGATACATTGATGAGTTTGGACAAACCA CAACTAGAATGCAGTGAAAAAAATGCTTTATTTGTGAAATTTGTGATGCTATTGCTTTATTTGTAACCATTATAAGC TGCAATAAACAAGTTAACAACAACAATTGCATTCATTTTATGTTTCAGGTTCAGGGGGAGGTGTGGGAGGTTTTTTA AAGCAAGTAAAACCTCTACAAATGTGGTAGCATGCGTCAATTTTACGCAGACTATCTTTCTAGGGTTAAATCGATCC CGCTAGCCCCGATATCCCCTTAATTAAGAGGGGGAGACCAAAGGGCGAGACGTTAAGGCCTCACGTGACATGTGAGC AAAAGGCCAGCAAAAGGCCAGGAACCGTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACG AGCATCACAAAAATCGACGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCT GGAAGCTCCCTCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACGGGATACCTGTCCGCCTTTCTCCCTTCGGGAAG CGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTGGGCTGTGTGC ACGAACCCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGACACGAC TTATCGCCACTGGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTGAA GTGGTGGCCTAACTACGGCTACACTAGAAGAACAGTATTTGGTATCTGCGCTCTGCTGAAGCCAGTTACCTTCGGAA AAAGAGTTGGTAGCTCTTGATCCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGATT ACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTCAGTGGAACGAAAACTC ACGTTAAGGGATTTTGGTCATGCCGTCTCAGAAGAACTCGTCAAGAAGGCGATAGAAGGCGATGCGCTGCGAATCGG GAGCGGCGATACCGTAAAGCACGAGGAAGCGGTCAGCCCATTCGCCGCCAAGCTCTTCAGCAATATCACGGGTAGCC AACGCTATGTCCTGATAGCGGTCCGCCACACCCAGCCGGCCACAGTCGATGAATCCAGAAAAGCGGCCATTTTCCAC CATGATATTCGGCAAGCAGGCATCGCCATGGGTCACGACGAGATCCTCGCCGTCGGGCATGCTCGCCTTGAGCCTGG CGAACAGTTCGGCTGGCGCGAGCCCCTGATGCTCTTCGTCCAGATCATCCTGATCGACAAGACCGGCTTCCATCCGA GTACGTGCTCTCTCGATGCGATGTTTCGCTTGGTGGTCGAATGGGCAGGTAGCCGGATCAAGCGTATGCAGCCGCCG CATTGCATCAGCCATGATGGATACTTTCTCGGCAGGAGCAAGGTGAGATGACAGGAGATCCTGCCCCGGCACTTCGC CCAATAGCAGCCAGTCCCTTCCCGCTTCAGTGACAACGTCGAGTACAGCTGCGCAAGGAACGCCCGTCGTGGCCAGC CACGATAGCCGCGCTGCCTCGTCTTGCAGTTCATTCAGGGCACCGGACAGGTCGGTCTTGACAAAAAGAACCGGGCG CCCCTGCGCTGACAGCCGGAACACGGCGGCATCAGAGCAGCCGATTGTCTGTTGTGCCCAGTCATAGCCGAATAGCC TCTCCACCCAAGCGGCCGGAGAACCTGCGTGCAATCCATCTTGTTCAATCATAATATTATTGAAGCATTTATCAGGG TTCGTCTCGTCCCGGTCTCCTCCCATGCATG
28. the base sequence (SEQ ID NO:28) of primer CD28-F
GCTTCTGGATACACCTTC
29. the base sequence (SEQ ID NO:29) of primer CD28-R
CCTTGAACTTCTCATTATAGTTAG
30. the base sequence (SEQ ID NO:30) in probe Taqman
AATACATCCAATCCACTCAAGCC
Specific embodiment
Embodiment of the present invention is described in detail below in conjunction with embodiment.Those skilled in the art will manage Solution, the following examples are merely to illustrate the present invention, and should not be taken as limiting the scope of the invention.It is not specified in embodiment specific Technology or conditions person, described technology or conditions are (yellow such as with reference to the work such as J. Pehanorm Brooker according to the literature in the art " Molecular Cloning:A Laboratory guide " that training hall etc. is translated, the third edition, Science Press) or carry out according to product description.Examination used Production firm person is not specified in agent or instrument, is that can buy the conventional products obtained by market.
1:5 recombinant plasmid of embodiment, that is, recombinant plasmid pNB328-Muc1 G1 CAR, pNB328-Muc1 G2 CAR, PS328b 28DCR1, PS328b 28DCR2 and PS328b The building of 28DCR3
1. the gene (SEQ ID NO:16) of the gene (SEQ ID NO:15) of artificial synthesized 28DCR1,28DCR2, Gene (SEQ ID NO:17), Muc1 G1 CAR gene (SEQ ID NO:24) and the Muc1 G2 CAR gene of 28DCR3 (SEQ ID NO:26), structural schematic diagram is respectively as shown in Figure 1A, Figure 1B, Fig. 1 C, Fig. 1 E and Fig. 1 F.By 5 bases of synthesis Because being respectively charged into PNB328 carrier and PS328b carrier, between EcoRI and SalI restriction enzyme site,
It is referred in pNB328 carrier comprising original parts, the buildings of pNB328 carrier such as EF1 α promoter, PB transposons The embodiment 2 of WO2017054647A1.PS328b is artificial synthesized sequence, is synthesized by Shanghai Jierui Biology Engineering Co., Ltd, Sequence is as shown in SEQ ID NO:27.
The recombinant plasmid constructed is respectively designated as pNB328-Muc1 G1 CAR plasmid, pNB328-Muc1 G2 CAR matter Grain, PS328b 28DCR1 plasmid, PS328b 28DCR2 plasmid and PS328b 28DCR3 plasmid.The recombinant plasmid constructed point It can not be integrated into the genome of host cell with foreign gene-carrying.
Embodiment 2:9 kind mosaic type antigen receptor modifies T cell, that is, recombinant cell Muc1 G1 CAR、Muc1 G2 CAR、 Muc1 G1 CAR-28DCR1、Muc1 G1CAR-28DCR2、Muc1 G1 CAR-28DCR3、28DCR1、28DCR2、28DCR3 With the building and identification of Mock T
The building of (1) 9 kind of recombinant cell
By peripheral blood mononuclear cells (PBMCs) adhere-wall culture 2-4h, wherein not adherent suspension cell is initial T thin Born of the same parents.Suspension cell is collected into 15ml centrifuge tube, 1200rmp is centrifuged 3min, abandons supernatant；Be added physiological saline, 1200rmp from Heart 3min abandons physiological saline, and repeats the step 3 time of " physiological saline being added, 1200rmp is centrifuged 3min, abandons physiological saline ".
8 1.5ml centrifuge tubes are taken, 5 × 106 above-mentioned cells are added in every pipe, respectively a, b, c, d, e, f, g, h are numbered, 1200rmp is centrifuged 3min, abandons supernatant, and electricity is taken to turn kit (from Lonza company), and every pipe is proportionally added into electricity, and to turn reagent total 100 μ l, in which:
8 μ g of pNB328-Muc1 G1 CAR plasmid is added in a pipe,
8 μ g of pNB328-Muc1 G2 CAR plasmid is added in b pipe,
PS328b 28DCR1 plasmid and each 4 μ g of pNB328-Muc1 G1 CAR plasmid is added in c pipe,
PS328b 28DCR2 plasmid and each 4 μ g of pNB328-Muc1 G1 CAR plasmid is added in d pipe,
PS328b 28DCR3 plasmid and each 4 μ g of pNB328-Muc1 G1 CAR plasmid is added in e pipe,
8 μ g of PS328b 28DCR1 plasmid is added in f pipe,
8 μ g of PS328b 28DCR2 plasmid is added in g pipe,
8 μ g of PS328b 28DCR3 plasmid is added in h pipe,
Above-mentioned 8 pipe is respectively resuspended and is mixed, mixed liquor is respectively obtained.
Each mixed liquor is transferred to respectively in electric revolving cup, electroporation is put into, program needed for choosing shocks by electricity；Use examination The cell suspension that electricity takes a turn for the better is transferred in six orifice plates for adding training liquid the (training of AIM- V containing 2%FBS by the micropipet in agent box Liquid), it mixes, is placed in 37 DEG C, 5%CO2Incubator culture 6 hours, stimulating factor IL-2 and Muc1/anti-CD28 is then added, 37 DEG C, 5%CO2Culture 3-4 days, observes the growing state of T cell.Thus expression pNB328-Muc1 G1 is obtained respectively CAR、pNB328-Muc1 G2 CAR、pNB328-Muc1 G1 CAR-28DCR1、pNB328-Muc1 G1 CAR-28DCR2、 PNB328-Muc1 G1 CAR-28DCR3, PS328b 28DCR1, PS328b 28DCR2 and PS328b 28DCR3 gene weight Group T cell, is successively named as recombinant cell Muc1 G1 CAR, recombinant cell Muc1 G2 CAR, recombinant cell Muc1 G1 CAR-28DCR1, recombinant cell Muc1 G1 CAR-28DCR2 and recombinant cell Muc1 G1 CAR-28DCR3, recombinant cell 28DCR1, recombinant cell 28DCR2 and recombinant cell 28DCR3.
In addition, in another centrifuge tube, (number i) is added 5 × 106A cell, 1200rmp are centrifuged 3min, abandon supernatant, take electricity Turn kit (purchased from Lonza company), be proportionally added into electricity and turn reagent totally 100 μ l, and 8 μ g control plasmids (PNB328) are added, Method constructs to obtain control T cell as previously described, is named as Mock T.
(2) identification of positive restructuring cell
1. western blot method detects the expression of Muc1 G1 CAR or Muc1 G2 CAR gene
Above-mentioned recombinant cell Muc1 G1 CAR, Muc1 G2 CAR, Muc1 G1 CAR-28DCR1, Muc1 are collected respectively G1 CAR-28DCR2, Muc1 G1 CAR-28DCR3 and Mock-T cell, twice of brine,
160 μ l cell pyrolysis liquids are separately added into, place 10min on ice；After cell sufficiently cracks, 12000rmp, 4 DEG C, It is centrifuged 10min, collects supernatant.40 μ 5 × loading of l Buffer are added, 100 DEG C are boiled 10min, then place 5min on ice.
Use CD3 ζ antibody (being purchased from abcam company), GAPDH antibody (being purchased from Beyotime company), HRP sheep anti mouse secondary antibody (being purchased from Jackson company) detects the expression of the CD3 ζ in the recombinant cell that front constructs, knot by western blot etc. Fruit is as shown in Figure 2 A.
The results show that CD3 ζ is high expression in the recombination T cell that this is constructed.
2. RT-PCR detects 28DCR1-3 gene expression
Recombinant cell Muc1 G1 CAR, Muc1 G2 CAR, Muc1 G1 CAR-28DCR1, Muc1 G1 are extracted respectively The genomic DNA (RNA isolation kit) of CAR-28DCR2, Muc1 G1 CAR-28DCR3 and Mock-T, experimental procedure is referring to kit Interior subsidiary specification.
The concentration for measuring each recombinant cell DNA, using the expression of the method detection 28DCR gene of fluorescence real-time quantitative PCR Level, reaction are as follows: 95 DEG C, 15s；95 DEG C, 5s；60 DEG C, 15s.40 circulations.
PCR reaction system (20 μ l) is as follows:
Taqman:10 μ l
CD28-F:0.4μl
CD28-R:0.4μl
CD28-probe:0.2μl
Actin mix:1μl
H2O:7μl
Primer sequence is as follows:
CD28-F:GCTTCTGGATACACCTTC (SEQ ID NO:28)
CD28-R:CCTTGAACTTCTCATTATAGTTAG (SEQ ID NO:29)
Taqman:5'FAM-AATACATCCAATCCACTCAAGCC-Trama (SEQ ID NO:30)
As a result as shown in Figure 2 B.The results show that recombinant cell Muc1 G1 CAR-28DCR1, Muc1 G1 CAR- In 28DCR2, Muc1 G1 CAR-28DCR3 cell, the expression quantity of 28DCR1,28DCR2 or 28DCR3 gene is very high.
Embodiment 3: cell Proliferation vigor kit detects cell technology and detects cell Proliferation vigor1. laboratory sample and examination Agent
Recombinant cell Muc1 G1 CAR made from embodiment 2, Muc1 G2 CAR, Muc1 G1 CAR-28DCR2, 28DCR1,28DCR2,28DCR3 and Mock T.
Luminescent Cell Viability Assay, Promega, Cat.#G7570.
2. experimental method
(1) prepare 96 hole white boards, take above-mentioned each cell of culture the 8th day respectively, it is celliferous that 100 μ L are added in every hole AIM-V culture medium.
(2) prepare not celliferous blank control, to obtain background fluorescence activity.
(3) compound to be measured is added in the orifice plate, is incubated for 30min in the incubator.
(4) 100 μ L CellTiter-Glo reagents are added, mix 2min on earthquake instrument, and be incubated at room temperature 10min, reading.
(5) the 8th, 9,10 day of culture is all detected by above step daily.
3. experimental result
It is as shown in Figure 3 and Figure 4 respectively.
Fig. 3 shows that Mock T multiplication rate is most slow, and 28DCR multiplication rate is very fast.
Fig. 4 shows that Mock T multiplication rate is most slow, and Muc1 G1 CAR multiplication rate is slower, Muc1 G2 CAR proliferation speed Rate is very fast, and Muc1 G1 CAR-28DCR2 multiplication rate is most fast.
Embodiment 4: two-way costimulatory molecules activated receptor 28DCR combines Muc1 G1 under flow cytometer detection Muc1 antigenic stimulus CAR-T cell phenotype
1. laboratory sample
Recombinant cell Muc1 G1 CAR made from embodiment 2, Muc1 G2 CAR, Muc1 G1 CAR-28DCR3, 28DCR1,28DCR2,28DCR 3 and Mock T.
2. experimental method
Above-mentioned each cell is collected respectively, with 1 × 10 after counting6A cell/pipe is separately added into the EP pipe of 1.5ml, and PBS is washed Twice, 1200rpm is centrifuged 5min, is separately added into the isotype control Ab IgG1-PE of 2 μ l, fluorescence flow antibody anti-CD137, Isotype control (IgG1FITC+IgG1PC5+IgG1PE), (anti-CD45RO-PC5, anti-CD62L-FITC, anti-CCR7- PE), flicking precipitating is uniformly mixed it, and room temperature, which is protected from light, is incubated for 30min, and PBS is cleaned one time, and 400 μ lPBS is added to be transferred to cell In streaming pipe, upper machine testing.
3. experimental result
As shown in Fig. 5 A-5D, Fig. 6 A-6D, Fig. 7 A-7D and Fig. 8 A-8D.Wherein:
Fig. 5 A-5D is 3 kinds of single-turn cells of 3 kinds of 28DCR1,28DCR2,28DCR3, and CD137 phenotype is relative to Mock T It improves a lot.
Fig. 6 A-6D is the CD137 table of Mock T, Muc1 G1 CAR, Muc1 G2 CAR, Muc1 G1 CAR-28DCR2 Type, relative to other three groups, Muc1 G1 CAR-28DCR2 improves a lot.
Fig. 7 A-7D is the CD45RO table of Mock T, Muc1 G1 CAR, Muc1 G2 CAR, Muc1 G1 CAR-28DCR2 Type indicates cell activation degree, largely activates.
Fig. 8 A-8D is the memory T table of Mock T, Muc1 G1 CAR, Muc1 G2 CAR, Muc1 G1 CAR-28DCR2 Type, relative to other three groups, Muc1 G1 CAR-28DCR2 can promote the formation of memory T.
Embodiment 5: real-time n cell functional analysis instrument detects two-way costimulatory molecules activated receptor 28DCR joint The killing effect in vitro of Muc1 G1 CAR-T cells against tumor cells
1. laboratory sample
Effector cell: recombinant cell Muc1 G1 CAR, Muc1 G2 CAR, Muc1 G1 CAR- made from embodiment 2 28DCR1, Muc1 G1 CAR-28DCR3,28DCR1,28DCR2 and 28DCR3 and Mock T.
Target cell: (purchase is in American Type Culture Collecti by cervical cancer cell Hela, ovarian cancer cell SK-OV-3 ATCC)。
2. experimental method
The matched effector cell of MHC class I parting and target cell are chosen, using real-time n cell functional analysis Instrument (RTCA) detects the cytotoxicity of above-mentioned cell, the specific steps are as follows:
(1) return to zero: 50 μ l DMEM or 1640 culture medium is added in every hole, is put into instrument, selects step 1, zeroing；
(2) target cell bed board: cervical cancer cell Hela, ovarian cancer cell SK-OV-3 press every hole 10 respectively4A cell/50 μ L is layered in the plate containing detecting electrode, is placed several minutes, once to cytotostatic, is placed into instrument, and step 2, training are started Support cell；
(3) effector cell is added: after target cell culture for 24 hours, suspending step 2, effector cell is added, every 50 μ l of hole imitates target It is 10 than being respectively set to 8:1,4:(tumour cell4It is a) 1, using the Mock T cell of non-Pignus pignoris grain as control, start Step 3 continues after co-culturing for 24 hours, observes cell Proliferation curve.
2. experimental result
As shown in fig. s 9a through 9d.
The results show that Mock T is most weak to the lethal effect of tumour cell, Muc1 G1 CAR makees the killing of tumour cell With weaker, Muc1 G2 CAR is stronger to the lethal effect of tumour cell, Muc1 G1 CAR-28DCR1, Muc1 G1 CAR- 28DCR3 is most strong to the lethal effect of tumour cell.
Embodiment 6: Muc1 CAR-T cytokine secretion amount under flow cytometer detection Muc1 antigenic stimulus
1. laboratory sample
Recombinant cell Muc1 G1 CAR made from embodiment 2, Muc1 G2 CAR, Muc1 G1 CAR-28DCR1 and Mock T。
2. experimental method
1. overnight, PBS is cleaned 3 times 4 DEG C of coatings with 96 orifice plate of Muc1 antigen coat of 5 μ g/ml, it is separately added into 1 × 105 Each sample cell, culture collect cell conditioned medium afterwards for 24 hours.Use BDTMCBA Human Th1/Th2 Cytokine Kit II detection The secretion situation of Muc1 CAR-T cell cell factor after by Muc1 antigenic stimulus.
Specific step is as follows:
(1) IL-2, IL-4, IL-6, IL-10, TNF, the IFN-γ capture magnetic bead of people are mixed, vortex oscillation mixes capture magnetic The capture magnetic bead after 50 μ l are mixed is added in pearl, every pipe；
(2) be added 50 μ l people Th1/Th2 cytokine standards product (doubling dilution 5000pg/ml, 2500pg/ml, 1250pg/ml, 625pg/ml, 312.5pg/ml, 156pg/ml, 80pg/ml, 40pg/ml, 20pg/ml, 0pg/ml) and 50 μ l Sample to be tested (through 2 times of dilution dilute).
(3) the detection antibody of the Th1/Th2-II-PE of the people of 50 μ l is added in every pipe；
(4) room temperature, which is protected from light, is incubated for 3h；
(5) the Wash Buffer, 200 centrifugation 5min that 1ml is added in every pipe abandon supernatant；
(6) cell is resuspended in the Wash Buffer that 300 μ l are added in every pipe, and is transferred in streaming pipe, is examined with flow cytometer Survey fluorescent value.
3. experimental result
As shown in Figure 10.
The results show that compared to Mock T cell, the various cell factors of remaining cell (IL-2, IL-4, IL-6, IL-10, TNF-α and IFN-γ) secretory volume all improve a lot.The secretory volume of the various cell factors of Mock T is most weak, Muc1 G1 The secretory volume of the various cell factors of CAR is weaker, and the secretory volume of the various cell factors of Muc1 G2 CAR is stronger, Muc1 G1 CAR- The secretory volume of the various cell factors of 28DCR1 is most strong.
Embodiment 7: two-way costimulatory molecules activated receptor 28DCR combines Muc1 G1 The in vivo functionality of CAR-T cell is real It tests
1. laboratory sample and experimental animal
The complete immunodeficient mouse of 4-6 week old NSG 20, average weight 22-27g, tieing up sensible biotechnology by Beijing has Limit company provides, SPF grades of Animal Lab. raisings.
Recombinant cell Muc1 G1 CAR made from embodiment 2, Muc1 G2 CAR, Muc1 G1 CAR-28DCR3 and Mock T。
Ovarian cancer cell SK-OV-3-luc (is purchased from Shanghai Hui Ying Biotechnology Co., Ltd).
2. experimental method
(1) extracorporeal culture Proliferation of Human Ovarian Cell SK-OV-3-luc, logarithmic growth phase adherent growth cell, 0.25% pancreas Enzymic digestion is centrifuged, uses PBS liquid to be resuspended after collection cell, and 1000rmp room temperature is centrifuged 2 minutes, abandoning supernatant, then with after the resuspension of PBS liquid Cell, adjustment concentration of cell suspension to 5 × 10 is collected by centrifugation7A/ml.
(2) SK-OV-3-luc cell is inoculated in the right ribbed back portion of mouse, 0.1ml/ is only.After inoculation 10 days, work can be passed through Body imager observes tumor size.
(3) NSG immunodeficient mouse is randomly divided into 4 groups, every group 5.Administration route be direct tail vein injection, every 0.1ml/, i.e., 5 × 106A positive cell, solvent PBS.Only it is administered once.
(4) animation of mouse is observed daily and passed through living imaging instrument every 10 days observes mouse tumor variation.
3. experimental result
As shown in figure 11.
The results show that Mock T is control group, tumour cell fluorescence intensity is strong, and Muc1 G1 CAR is target Muc1 one For CAR, tumour cell fluorescence intensity weakens, and shows the therapeutic effect for having certain, Muc1 G2 CAR tumour cell fluorescence intensity is more It is weak, show the therapeutic effect for having further good, Muc1 G1 CAR-28DCR3 tumour cell fluorescence intensity is most weak, shows have most Good therapeutic effect.
Although a specific embodiment of the invention has obtained detailed description, it will be understood to those of skill in the art that.Root According to all introductions having disclosed, those details can be carry out various modifications and be replaced, these change in guarantor of the invention Within the scope of shield.Full scope of the invention is given by the appended claims and any equivalents thereof.
SEQUENCE LISTING
<110>Shanghai cell therapy research institute
Shanghai cell therapy Engineering Technical Research Centre Group Co., Ltd
<120>two-way activation costimulatory molecules receptor of a kind of CD28 and application thereof
<130> IDC170226
<160> 30
<170> PatentIn version 3.5
<210> 1
<211> 23
<212> PRT
<213> Artificial Sequence
<220>
<223>amino acid sequence of CD8 signal peptide
<400> 1
Met Gly Asn Ser Cys Tyr Asn Ile Val Ala Thr Leu Leu Leu Val Leu
1 5 10 15
Asn Phe Glu Arg Thr Arg Ser
20
<210> 2
<211> 243
<212> PRT
<213> Artificial Sequence
<220>
<223>amino acid sequence of the extracellular activated form single-chain antibody of CD28
<400> 2
Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala
1 5 10 15
Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr
20 25 30
Tyr Ile His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Ile
35 40 45
Gly Cys Ile Tyr Pro Gly Asn Val Asn Thr Asn Tyr Asn Glu Lys Phe
50 55 60
Lys Asp Arg Ala Thr Leu Thr Val Asp Thr Ser Ile Ser Thr Ala Tyr
65 70 75 80
Met Glu Leu Ser Arg Leu Arg Ser Asp Asp Thr Ala Val Tyr Phe Cys
85 90 95
Thr Arg Ser His Tyr Gly Leu Asp Trp Asn Phe Asp Val Trp Gly Gln
100 105 110
Gly Thr Thr Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125
Gly Ser Gly Gly Gly Gly Ser Asp Ile Gln Met Thr Gln Ser Pro Ser
130 135 140
Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys His Ala
145 150 155 160
Ser Gln Asn Ile Tyr Val Trp Leu Asn Trp Tyr Gln Gln Lys Pro Gly
165 170 175
Lys Ala Pro Lys Leu Leu Ile Tyr Lys Ala Ser Asn Leu His Thr Gly
180 185 190
Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
195 200 205
Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln
210 215 220
Gln Gly Gln Thr Tyr Pro Tyr Thr Phe Gly Gly Gly Thr Lys Val Glu
225 230 235 240
Ile Lys Glu
<210> 3
<211> 49
<212> PRT
<213> Artificial Sequence
<220>
<223>amino acid sequence of CD8 α hinge area
<400> 3
Ser Lys Tyr Gly Pro Pro Cys Pro Pro Cys Pro Ile Glu Val Met Tyr
1 5 10 15
Pro Pro Pro Tyr Leu Asp Asn Glu Lys Ser Asn Gly Thr Ile Ile His
20 25 30
Val Lys Gly Lys His Leu Cys Pro Ser Pro Leu Phe Pro Gly Pro Ser
35 40 45
Lys
<210> 4
<211> 28
<212> PRT
<213> Artificial Sequence
<220>
<223>amino acid sequence of CD28 transmembrane region
<400> 4
Pro Phe Trp Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser
1 5 10 15
Leu Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val
20 25
<210> 5
<211> 41
<212> PRT
<213> Artificial Sequence
<220>
<223>amino acid sequence of CD28 costimulatory signal intracellular domain intracellular
<400> 5
Arg Ser Lys Arg Ser Arg Leu Leu His Ser Asp Tyr Met Asn Met Thr
1 5 10 15
Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro
20 25 30
Pro Arg Asp Phe Ala Ala Tyr Arg Ser
35 40
<210> 6
<211> 42
<212> PRT
<213> Artificial Sequence
<220>
<223>amino acid sequence of CD137 costimulatory signal intracellular domain intracellular
<400> 6
Lys Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe Lys Gln Pro Phe Met
1 5 10 15
Arg Pro Val Gln Thr Thr Gln Glu Glu Asp Gly Cys Ser Cys Arg Phe
20 25 30
Pro Glu Glu Glu Glu Gly Gly Cys Glu Leu
35 40
<210> 7
<211> 384
<212> PRT
<213> Artificial Sequence
<220>
<223>amino acid sequence (containing signal peptide) of 28DCR1
<400> 7
Met Gly Asn Ser Cys Tyr Asn Ile Val Ala Thr Leu Leu Leu Val Leu
1 5 10 15
Asn Phe Glu Arg Thr Arg Ser Gln Val Gln Leu Val Gln Ser Gly Ala
20 25 30
Glu Val Lys Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser
35 40 45
Gly Tyr Thr Phe Thr Ser Tyr Tyr Ile His Trp Val Arg Gln Ala Pro
50 55 60
Gly Gln Gly Leu Glu Trp Ile Gly Cys Ile Tyr Pro Gly Asn Val Asn
65 70 75 80
Thr Asn Tyr Asn Glu Lys Phe Lys Asp Arg Ala Thr Leu Thr Val Asp
85 90 95
Thr Ser Ile Ser Thr Ala Tyr Met Glu Leu Ser Arg Leu Arg Ser Asp
100 105 110
Asp Thr Ala Val Tyr Phe Cys Thr Arg Ser His Tyr Gly Leu Asp Trp
115 120 125
Asn Phe Asp Val Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser Gly
130 135 140
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Ile
145 150 155 160
Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg
165 170 175
Val Thr Ile Thr Cys His Ala Ser Gln Asn Ile Tyr Val Trp Leu Asn
180 185 190
Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Lys
195 200 205
Ala Ser Asn Leu His Thr Gly Val Pro Ser Arg Phe Ser Gly Ser Gly
210 215 220
Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp
225 230 235 240
Phe Ala Thr Tyr Tyr Cys Gln Gln Gly Gln Thr Tyr Pro Tyr Thr Phe
245 250 255
Gly Gly Gly Thr Lys Val Glu Ile Lys Glu Ser Lys Tyr Gly Pro Pro
260 265 270
Cys Pro Pro Cys Pro Ile Glu Val Met Tyr Pro Pro Pro Tyr Leu Asp
275 280 285
Asn Glu Lys Ser Asn Gly Thr Ile Ile His Val Lys Gly Lys His Leu
290 295 300
Cys Pro Ser Pro Leu Phe Pro Gly Pro Ser Lys Pro Phe Trp Val Leu
305 310 315 320
Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu Leu Val Thr Val
325 330 335
Ala Phe Ile Ile Phe Trp Val Arg Ser Lys Arg Ser Arg Leu Leu His
340 345 350
Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro Gly Pro Thr Arg Lys
355 360 365
His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe Ala Ala Tyr Arg Ser
370 375 380
<210> 8
<211> 385
<212> PRT
<213> Artificial Sequence
<220>
<223>amino acid sequence (containing signal peptide) of 28DCR2
<400> 8
Met Gly Asn Ser Cys Tyr Asn Ile Val Ala Thr Leu Leu Leu Val Leu
1 5 10 15
Asn Phe Glu Arg Thr Arg Ser Gln Val Gln Leu Val Gln Ser Gly Ala
20 25 30
Glu Val Lys Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser
35 40 45
Gly Tyr Thr Phe Thr Ser Tyr Tyr Ile His Trp Val Arg Gln Ala Pro
50 55 60
Gly Gln Gly Leu Glu Trp Ile Gly Cys Ile Tyr Pro Gly Asn Val Asn
65 70 75 80
Thr Asn Tyr Asn Glu Lys Phe Lys Asp Arg Ala Thr Leu Thr Val Asp
85 90 95
Thr Ser Ile Ser Thr Ala Tyr Met Glu Leu Ser Arg Leu Arg Ser Asp
100 105 110
Asp Thr Ala Val Tyr Phe Cys Thr Arg Ser His Tyr Gly Leu Asp Trp
115 120 125
Asn Phe Asp Val Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser Gly
130 135 140
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Ile
145 150 155 160
Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg
165 170 175
Val Thr Ile Thr Cys His Ala Ser Gln Asn Ile Tyr Val Trp Leu Asn
180 185 190
Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Lys
195 200 205
Ala Ser Asn Leu His Thr Gly Val Pro Ser Arg Phe Ser Gly Ser Gly
210 215 220
Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp
225 230 235 240
Phe Ala Thr Tyr Tyr Cys Gln Gln Gly Gln Thr Tyr Pro Tyr Thr Phe
245 250 255
Gly Gly Gly Thr Lys Val Glu Ile Lys Glu Ser Lys Tyr Gly Pro Pro
260 265 270
Cys Pro Pro Cys Pro Ile Glu Val Met Tyr Pro Pro Pro Tyr Leu Asp
275 280 285
Asn Glu Lys Ser Asn Gly Thr Ile Ile His Val Lys Gly Lys His Leu
290 295 300
Cys Pro Ser Pro Leu Phe Pro Gly Pro Ser Lys Pro Phe Trp Val Leu
305 310 315 320
Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu Leu Val Thr Val
325 330 335
Ala Phe Ile Ile Phe Trp Val Lys Arg Gly Arg Lys Lys Leu Leu Tyr
340 345 350
Ile Phe Lys Gln Pro Phe Met Arg Pro Val Gln Thr Thr Gln Glu Glu
355 360 365
Asp Gly Cys Ser Cys Arg Phe Pro Glu Glu Glu Glu Gly Gly Cys Glu
370 375 380
Leu
385
<210> 9
<211> 426
<212> PRT
<213> Artificial Sequence
<220>
<223>amino acid sequence (containing signal peptide) of 28DCR3
<400> 9
Met Gly Asn Ser Cys Tyr Asn Ile Val Ala Thr Leu Leu Leu Val Leu
1 5 10 15
Asn Phe Glu Arg Thr Arg Ser Gln Val Gln Leu Val Gln Ser Gly Ala
20 25 30
Glu Val Lys Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser
35 40 45
Gly Tyr Thr Phe Thr Ser Tyr Tyr Ile His Trp Val Arg Gln Ala Pro
50 55 60
Gly Gln Gly Leu Glu Trp Ile Gly Cys Ile Tyr Pro Gly Asn Val Asn
65 70 75 80
Thr Asn Tyr Asn Glu Lys Phe Lys Asp Arg Ala Thr Leu Thr Val Asp
85 90 95
Thr Ser Ile Ser Thr Ala Tyr Met Glu Leu Ser Arg Leu Arg Ser Asp
100 105 110
Asp Thr Ala Val Tyr Phe Cys Thr Arg Ser His Tyr Gly Leu Asp Trp
115 120 125
Asn Phe Asp Val Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser Gly
130 135 140
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Ile
145 150 155 160
Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg
165 170 175
Val Thr Ile Thr Cys His Ala Ser Gln Asn Ile Tyr Val Trp Leu Asn
180 185 190
Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Lys
195 200 205
Ala Ser Asn Leu His Thr Gly Val Pro Ser Arg Phe Ser Gly Ser Gly
210 215 220
Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp
225 230 235 240
Phe Ala Thr Tyr Tyr Cys Gln Gln Gly Gln Thr Tyr Pro Tyr Thr Phe
245 250 255
Gly Gly Gly Thr Lys Val Glu Ile Lys Glu Ser Lys Tyr Gly Pro Pro
260 265 270
Cys Pro Pro Cys Pro Ile Glu Val Met Tyr Pro Pro Pro Tyr Leu Asp
275 280 285
Asn Glu Lys Ser Asn Gly Thr Ile Ile His Val Lys Gly Lys His Leu
290 295 300
Cys Pro Ser Pro Leu Phe Pro Gly Pro Ser Lys Pro Phe Trp Val Leu
305 310 315 320
Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu Leu Val Thr Val
325 330 335
Ala Phe Ile Ile Phe Trp Val Arg Ser Lys Arg Ser Arg Leu Leu His
340 345 350
Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro Gly Pro Thr Arg Lys
355 360 365
His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe Ala Ala Tyr Arg Ser
370 375 380
Lys Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe Lys Gln Pro Phe Met
385 390 395 400
Arg Pro Val Gln Thr Thr Gln Glu Glu Asp Gly Cys Ser Cys Arg Phe
405 410 415
Pro Glu Glu Glu Glu Gly Gly Cys Glu Leu
420 425
<210> 10
<211> 426
<212> PRT
<213> Artificial Sequence
<220>
<223>amino acid sequence (containing signal peptide) of 28DCR4
<400> 10
Met Gly Asn Ser Cys Tyr Asn Ile Val Ala Thr Leu Leu Leu Val Leu
1 5 10 15
Asn Phe Glu Arg Thr Arg Ser Gln Val Gln Leu Val Gln Ser Gly Ala
20 25 30
Glu Val Lys Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser
35 40 45
Gly Tyr Thr Phe Thr Ser Tyr Tyr Ile His Trp Val Arg Gln Ala Pro
50 55 60
Gly Gln Gly Leu Glu Trp Ile Gly Cys Ile Tyr Pro Gly Asn Val Asn
65 70 75 80
Thr Asn Tyr Asn Glu Lys Phe Lys Asp Arg Ala Thr Leu Thr Val Asp
85 90 95
Thr Ser Ile Ser Thr Ala Tyr Met Glu Leu Ser Arg Leu Arg Ser Asp
100 105 110
Asp Thr Ala Val Tyr Phe Cys Thr Arg Ser His Tyr Gly Leu Asp Trp
115 120 125
Asn Phe Asp Val Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser Gly
130 135 140
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Ile
145 150 155 160
Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg
165 170 175
Val Thr Ile Thr Cys His Ala Ser Gln Asn Ile Tyr Val Trp Leu Asn
180 185 190
Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Lys
195 200 205
Ala Ser Asn Leu His Thr Gly Val Pro Ser Arg Phe Ser Gly Ser Gly
210 215 220
Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp
225 230 235 240
Phe Ala Thr Tyr Tyr Cys Gln Gln Gly Gln Thr Tyr Pro Tyr Thr Phe
245 250 255
Gly Gly Gly Thr Lys Val Glu Ile Lys Glu Ser Lys Tyr Gly Pro Pro
260 265 270
Cys Pro Pro Cys Pro Ile Glu Val Met Tyr Pro Pro Pro Tyr Leu Asp
275 280 285
Asn Glu Lys Ser Asn Gly Thr Ile Ile His Val Lys Gly Lys His Leu
290 295 300
Cys Pro Ser Pro Leu Phe Pro Gly Pro Ser Lys Pro Phe Trp Val Leu
305 310 315 320
Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu Leu Val Thr Val
325 330 335
Ala Phe Ile Ile Phe Trp Val Lys Arg Gly Arg Lys Lys Leu Leu Tyr
340 345 350
Ile Phe Lys Gln Pro Phe Met Arg Pro Val Gln Thr Thr Gln Glu Glu
355 360 365
Asp Gly Cys Ser Cys Arg Phe Pro Glu Glu Glu Glu Gly Gly Cys Glu
370 375 380
Leu Arg Ser Lys Arg Ser Arg Leu Leu His Ser Asp Tyr Met Asn Met
385 390 395 400
Thr Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln Pro Tyr Ala
405 410 415
Pro Pro Arg Asp Phe Ala Ala Tyr Arg Ser
420 425
<210> 11
<211> 361
<212> PRT
<213> Artificial Sequence
<220>
<223>amino acid sequence (being free of signal peptide) of 28DCR1
<400> 11
Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala
1 5 10 15
Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr
20 25 30
Tyr Ile His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Ile
35 40 45
Gly Cys Ile Tyr Pro Gly Asn Val Asn Thr Asn Tyr Asn Glu Lys Phe
50 55 60
Lys Asp Arg Ala Thr Leu Thr Val Asp Thr Ser Ile Ser Thr Ala Tyr
65 70 75 80
Met Glu Leu Ser Arg Leu Arg Ser Asp Asp Thr Ala Val Tyr Phe Cys
85 90 95
Thr Arg Ser His Tyr Gly Leu Asp Trp Asn Phe Asp Val Trp Gly Gln
100 105 110
Gly Thr Thr Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125
Gly Ser Gly Gly Gly Gly Ser Asp Ile Gln Met Thr Gln Ser Pro Ser
130 135 140
Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys His Ala
145 150 155 160
Ser Gln Asn Ile Tyr Val Trp Leu Asn Trp Tyr Gln Gln Lys Pro Gly
165 170 175
Lys Ala Pro Lys Leu Leu Ile Tyr Lys Ala Ser Asn Leu His Thr Gly
180 185 190
Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
195 200 205
Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln
210 215 220
Gln Gly Gln Thr Tyr Pro Tyr Thr Phe Gly Gly Gly Thr Lys Val Glu
225 230 235 240
Ile Lys Glu Ser Lys Tyr Gly Pro Pro Cys Pro Pro Cys Pro Ile Glu
245 250 255
Val Met Tyr Pro Pro Pro Tyr Leu Asp Asn Glu Lys Ser Asn Gly Thr
260 265 270
Ile Ile His Val Lys Gly Lys His Leu Cys Pro Ser Pro Leu Phe Pro
275 280 285
Gly Pro Ser Lys Pro Phe Trp Val Leu Val Val Val Gly Gly Val Leu
290 295 300
Ala Cys Tyr Ser Leu Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val
305 310 315 320
Arg Ser Lys Arg Ser Arg Leu Leu His Ser Asp Tyr Met Asn Met Thr
325 330 335
Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro
340 345 350
Pro Arg Asp Phe Ala Ala Tyr Arg Ser
355 360
<210> 12
<211> 362
<212> PRT
<213> Artificial Sequence
<220>
<223>amino acid sequence (being free of signal peptide) of 28DCR2
<400> 12
Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala
1 5 10 15
Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr
20 25 30
Tyr Ile His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Ile
35 40 45
Gly Cys Ile Tyr Pro Gly Asn Val Asn Thr Asn Tyr Asn Glu Lys Phe
50 55 60
Lys Asp Arg Ala Thr Leu Thr Val Asp Thr Ser Ile Ser Thr Ala Tyr
65 70 75 80
Met Glu Leu Ser Arg Leu Arg Ser Asp Asp Thr Ala Val Tyr Phe Cys
85 90 95
Thr Arg Ser His Tyr Gly Leu Asp Trp Asn Phe Asp Val Trp Gly Gln
100 105 110
Gly Thr Thr Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125
Gly Ser Gly Gly Gly Gly Ser Asp Ile Gln Met Thr Gln Ser Pro Ser
130 135 140
Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys His Ala
145 150 155 160
Ser Gln Asn Ile Tyr Val Trp Leu Asn Trp Tyr Gln Gln Lys Pro Gly
165 170 175
Lys Ala Pro Lys Leu Leu Ile Tyr Lys Ala Ser Asn Leu His Thr Gly
180 185 190
Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
195 200 205
Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln
210 215 220
Gln Gly Gln Thr Tyr Pro Tyr Thr Phe Gly Gly Gly Thr Lys Val Glu
225 230 235 240
Ile Lys Glu Ser Lys Tyr Gly Pro Pro Cys Pro Pro Cys Pro Ile Glu
245 250 255
Val Met Tyr Pro Pro Pro Tyr Leu Asp Asn Glu Lys Ser Asn Gly Thr
260 265 270
Ile Ile His Val Lys Gly Lys His Leu Cys Pro Ser Pro Leu Phe Pro
275 280 285
Gly Pro Ser Lys Pro Phe Trp Val Leu Val Val Val Gly Gly Val Leu
290 295 300
Ala Cys Tyr Ser Leu Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val
305 310 315 320
Lys Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe Lys Gln Pro Phe Met
325 330 335
Arg Pro Val Gln Thr Thr Gln Glu Glu Asp Gly Cys Ser Cys Arg Phe
340 345 350
Pro Glu Glu Glu Glu Gly Gly Cys Glu Leu
355 360
<210> 13
<211> 403
<212> PRT
<213> Artificial Sequence
<220>
<223>amino acid sequence (being free of signal peptide) of 28DCR3
<400> 13
Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala
1 5 10 15
Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr
20 25 30
Tyr Ile His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Ile
35 40 45
Gly Cys Ile Tyr Pro Gly Asn Val Asn Thr Asn Tyr Asn Glu Lys Phe
50 55 60
Lys Asp Arg Ala Thr Leu Thr Val Asp Thr Ser Ile Ser Thr Ala Tyr
65 70 75 80
Met Glu Leu Ser Arg Leu Arg Ser Asp Asp Thr Ala Val Tyr Phe Cys
85 90 95
Thr Arg Ser His Tyr Gly Leu Asp Trp Asn Phe Asp Val Trp Gly Gln
100 105 110
Gly Thr Thr Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125
Gly Ser Gly Gly Gly Gly Ser Asp Ile Gln Met Thr Gln Ser Pro Ser
130 135 140
Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys His Ala
145 150 155 160
Ser Gln Asn Ile Tyr Val Trp Leu Asn Trp Tyr Gln Gln Lys Pro Gly
165 170 175
Lys Ala Pro Lys Leu Leu Ile Tyr Lys Ala Ser Asn Leu His Thr Gly
180 185 190
Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
195 200 205
Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln
210 215 220
Gln Gly Gln Thr Tyr Pro Tyr Thr Phe Gly Gly Gly Thr Lys Val Glu
225 230 235 240
Ile Lys Glu Ser Lys Tyr Gly Pro Pro Cys Pro Pro Cys Pro Ile Glu
245 250 255
Val Met Tyr Pro Pro Pro Tyr Leu Asp Asn Glu Lys Ser Asn Gly Thr
260 265 270
Ile Ile His Val Lys Gly Lys His Leu Cys Pro Ser Pro Leu Phe Pro
275 280 285
Gly Pro Ser Lys Pro Phe Trp Val Leu Val Val Val Gly Gly Val Leu
290 295 300
Ala Cys Tyr Ser Leu Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val
305 310 315 320
Arg Ser Lys Arg Ser Arg Leu Leu His Ser Asp Tyr Met Asn Met Thr
325 330 335
Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro
340 345 350
Pro Arg Asp Phe Ala Ala Tyr Arg Ser Lys Arg Gly Arg Lys Lys Leu
355 360 365
Leu Tyr Ile Phe Lys Gln Pro Phe Met Arg Pro Val Gln Thr Thr Gln
370 375 380
Glu Glu Asp Gly Cys Ser Cys Arg Phe Pro Glu Glu Glu Glu Gly Gly
385 390 395 400
Cys Glu Leu
<210> 14
<211> 403
<212> PRT
<213> Artificial Sequence
<220>
<223>amino acid sequence (being free of signal peptide) of 28DCR4
<400> 14
Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala
1 5 10 15
Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr
20 25 30
Tyr Ile His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Ile
35 40 45
Gly Cys Ile Tyr Pro Gly Asn Val Asn Thr Asn Tyr Asn Glu Lys Phe
50 55 60
Lys Asp Arg Ala Thr Leu Thr Val Asp Thr Ser Ile Ser Thr Ala Tyr
65 70 75 80
Met Glu Leu Ser Arg Leu Arg Ser Asp Asp Thr Ala Val Tyr Phe Cys
85 90 95
Thr Arg Ser His Tyr Gly Leu Asp Trp Asn Phe Asp Val Trp Gly Gln
100 105 110
Gly Thr Thr Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125
Gly Ser Gly Gly Gly Gly Ser Asp Ile Gln Met Thr Gln Ser Pro Ser
130 135 140
Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys His Ala
145 150 155 160
Ser Gln Asn Ile Tyr Val Trp Leu Asn Trp Tyr Gln Gln Lys Pro Gly
165 170 175
Lys Ala Pro Lys Leu Leu Ile Tyr Lys Ala Ser Asn Leu His Thr Gly
180 185 190
Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
195 200 205
Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln
210 215 220
Gln Gly Gln Thr Tyr Pro Tyr Thr Phe Gly Gly Gly Thr Lys Val Glu
225 230 235 240
Ile Lys Glu Ser Lys Tyr Gly Pro Pro Cys Pro Pro Cys Pro Ile Glu
245 250 255
Val Met Tyr Pro Pro Pro Tyr Leu Asp Asn Glu Lys Ser Asn Gly Thr
260 265 270
Ile Ile His Val Lys Gly Lys His Leu Cys Pro Ser Pro Leu Phe Pro
275 280 285
Gly Pro Ser Lys Pro Phe Trp Val Leu Val Val Val Gly Gly Val Leu
290 295 300
Ala Cys Tyr Ser Leu Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val
305 310 315 320
Lys Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe Lys Gln Pro Phe Met
325 330 335
Arg Pro Val Gln Thr Thr Gln Glu Glu Asp Gly Cys Ser Cys Arg Phe
340 345 350
Pro Glu Glu Glu Glu Gly Gly Cys Glu Leu Arg Ser Lys Arg Ser Arg
355 360 365
Leu Leu His Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro Gly Pro
370 375 380
Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe Ala Ala
385 390 395 400
Tyr Arg Ser
<210> 15
<211> 1158
<212> DNA
<213> Artificial Sequence
<220>
<223>nucleic acid sequence (containing signal peptide) of 28DCR1
<400> 15
atgggaaaca gctgttacaa catagtagcc actctgttgc tggtcctcaa ctttgagagg 60
acaagatcac aggtgcagct ggtgcagtct ggggctgagg tgaagaagcc tggggcctca 120
gtgaaggtct cctgcaaggc ttctggatac accttcacca gctactatat acactgggtg 180
cgacaggccc ctggacaagg gcttgagtgg attggatgta tttatcctgg aaatgtcaat 240
actaactata atgagaagtt caaggacagg gccaccctga ccgtagacac gtccatcagc 300
acagcctaca tggagctgag caggctgaga tctgacgaca cggccgtgta tttctgtaca 360
agatcacact acggcctcga ctggaacttc gatgtctggg gccaagggac cacggtcacc 420
gtctcctcag gtggaggcgg ttcaggcgga ggtggcagcg gcggtggcgg gtcggacatc 480
cagatgaccc agtctccatc ctccctgtct gcatctgtag gagacagagt caccatcact 540
tgccatgcca gtcaaaacat ttatgtttgg ttaaactggt atcagcagaa accagggaaa 600
gcccctaagc tcctgatcta taaggcttcc aacctgcaca caggggtccc atcaaggttc 660
agtggcagtg gatctgggac agatttcact ctcaccatca gcagtctgca acctgaagat 720
tttgcaactt actactgtca acagggtcaa acttatccgt acacgttcgg cggagggacc 780
aaggtggaga tcaaagagtc caaatatggt cccccatgcc caccatgccc aattgaagtt 840
atgtatcctc ctccttacct agacaatgag aagagcaatg gaaccattat ccatgtgaaa 900
gggaaacacc tttgtccaag tcccctattt cccggacctt ctaagccctt ttgggtgctg 960
gtggtggttg gtggagtcct ggcttgctat agcttgctag taacagtggc ctttattatt 1020
ttctgggtga ggagtaagag gagcaggctc ctgcacagtg actacatgaa catgactccc 1080
cgccgccccg ggcccacccg caagcattac cagccctatg ccccaccacg cgacttcgca 1140
gcctatcgct cctgataa 1158
<210> 16
<211> 1161
<212> DNA
<213> Artificial Sequence
<220>
<223>nucleic acid sequence (containing signal peptide) of 28DCR2
<400> 16
atgggaaaca gctgttacaa catagtagcc actctgttgc tggtcctcaa ctttgagagg 60
acaagatcac aggtgcagct ggtgcagtct ggggctgagg tgaagaagcc tggggcctca 120
gtgaaggtct cctgcaaggc ttctggatac accttcacca gctactatat acactgggtg 180
cgacaggccc ctggacaagg gcttgagtgg attggatgta tttatcctgg aaatgtcaat 240
actaactata atgagaagtt caaggacagg gccaccctga ccgtagacac gtccatcagc 300
acagcctaca tggagctgag caggctgaga tctgacgaca cggccgtgta tttctgtaca 360
agatcacact acggcctcga ctggaacttc gatgtctggg gccaagggac cacggtcacc 420
gtctcctcag gtggaggcgg ttcaggcgga ggtggcagcg gcggtggcgg gtcggacatc 480
cagatgaccc agtctccatc ctccctgtct gcatctgtag gagacagagt caccatcact 540
tgccatgcca gtcaaaacat ttatgtttgg ttaaactggt atcagcagaa accagggaaa 600
gcccctaagc tcctgatcta taaggcttcc aacctgcaca caggggtccc atcaaggttc 660
agtggcagtg gatctgggac agatttcact ctcaccatca gcagtctgca acctgaagat 720
tttgcaactt actactgtca acagggtcaa acttatccgt acacgttcgg cggagggacc 780
aaggtggaga tcaaagagtc caaatatggt cccccatgcc caccatgccc aattgaagtt 840
atgtatcctc ctccttacct agacaatgag aagagcaatg gaaccattat ccatgtgaaa 900
gggaaacacc tttgtccaag tcccctattt cccggacctt ctaagccctt ttgggtgctg 960
gtggtggttg gtggagtcct ggcttgctat agcttgctag taacagtggc ctttattatt 1020
ttctgggtga aacggggcag aaagaagctc ctgtatatat tcaaacaacc atttatgaga 1080
ccagtacaaa ctactcaaga ggaagatggc tgtagctgcc gatttccaga agaagaagaa 1140
ggaggatgtg aactgtgata a 1161
<210> 17
<211> 1284
<212> DNA
<213> Artificial Sequence
<220>
<223>nucleic acid sequence (containing signal peptide) of 28DCR3
<400> 17
atgggaaaca gctgttacaa catagtagcc actctgttgc tggtcctcaa ctttgagagg 60
acaagatcac aggtgcagct ggtgcagtct ggggctgagg tgaagaagcc tggggcctca 120
gtgaaggtct cctgcaaggc ttctggatac accttcacca gctactatat acactgggtg 180
cgacaggccc ctggacaagg gcttgagtgg attggatgta tttatcctgg aaatgtcaat 240
actaactata atgagaagtt caaggacagg gccaccctga ccgtagacac gtccatcagc 300
acagcctaca tggagctgag caggctgaga tctgacgaca cggccgtgta tttctgtaca 360
agatcacact acggcctcga ctggaacttc gatgtctggg gccaagggac cacggtcacc 420
gtctcctcag gtggaggcgg ttcaggcgga ggtggcagcg gcggtggcgg gtcggacatc 480
cagatgaccc agtctccatc ctccctgtct gcatctgtag gagacagagt caccatcact 540
tgccatgcca gtcaaaacat ttatgtttgg ttaaactggt atcagcagaa accagggaaa 600
gcccctaagc tcctgatcta taaggcttcc aacctgcaca caggggtccc atcaaggttc 660
agtggcagtg gatctgggac agatttcact ctcaccatca gcagtctgca acctgaagat 720
tttgcaactt actactgtca acagggtcaa acttatccgt acacgttcgg cggagggacc 780
aaggtggaga tcaaagagtc caaatatggt cccccatgcc caccatgccc aattgaagtt 840
atgtatcctc ctccttacct agacaatgag aagagcaatg gaaccattat ccatgtgaaa 900
gggaaacacc tttgtccaag tcccctattt cccggacctt ctaagccctt ttgggtgctg 960
gtggtggttg gtggagtcct ggcttgctat agcttgctag taacagtggc ctttattatt 1020
ttctgggtga ggagtaagag gagcaggctc ctgcacagtg actacatgaa catgactccc 1080
cgccgccccg ggcccacccg caagcattac cagccctatg ccccaccacg cgacttcgca 1140
gcctatcgct ccaaacgggg cagaaagaag ctcctgtata tattcaaaca accatttatg 1200
agaccagtac aaactactca agaggaagat ggctgtagct gccgatttcc agaagaagaa 1260
gaaggaggat gtgaactgtg ataa 1284
<210> 18
<211> 1284
<212> DNA
<213> Artificial Sequence
<220>
<223>nucleic acid sequence (containing signal peptide) of 28DCR4
<400> 18
atgggaaaca gctgttacaa catagtagcc actctgttgc tggtcctcaa ctttgagagg 60
acaagatcac aggtgcagct ggtgcagtct ggggctgagg tgaagaagcc tggggcctca 120
gtgaaggtct cctgcaaggc ttctggatac accttcacca gctactatat acactgggtg 180
cgacaggccc ctggacaagg gcttgagtgg attggatgta tttatcctgg aaatgtcaat 240
actaactata atgagaagtt caaggacagg gccaccctga ccgtagacac gtccatcagc 300
acagcctaca tggagctgag caggctgaga tctgacgaca cggccgtgta tttctgtaca 360
agatcacact acggcctcga ctggaacttc gatgtctggg gccaagggac cacggtcacc 420
gtctcctcag gtggaggcgg ttcaggcgga ggtggcagcg gcggtggcgg gtcggacatc 480
cagatgaccc agtctccatc ctccctgtct gcatctgtag gagacagagt caccatcact 540
tgccatgcca gtcaaaacat ttatgtttgg ttaaactggt atcagcagaa accagggaaa 600
gcccctaagc tcctgatcta taaggcttcc aacctgcaca caggggtccc atcaaggttc 660
agtggcagtg gatctgggac agatttcact ctcaccatca gcagtctgca acctgaagat 720
tttgcaactt actactgtca acagggtcaa acttatccgt acacgttcgg cggagggacc 780
aaggtggaga tcaaagagtc caaatatggt cccccatgcc caccatgccc aattgaagtt 840
atgtatcctc ctccttacct agacaatgag aagagcaatg gaaccattat ccatgtgaaa 900
gggaaacacc tttgtccaag tcccctattt cccggacctt ctaagccctt ttgggtgctg 960
gtggtggttg gtggagtcct ggcttgctat agcttgctag taacagtggc ctttattatt 1020
ttctgggtga aacggggcag aaagaagctc ctgtatatat tcaaacaacc atttatgaga 1080
ccagtacaaa ctactcaaga ggaagatggc tgtagctgcc gatttccaga agaagaagaa 1140
ggaggatgtg aactgaggag taagaggagc aggctcctgc acagtgacta catgaacatg 1200
actccccgcc gccccgggcc cacccgcaag cattaccagc cctatgcccc accacgcgac 1260
ttcgcagcct atcgctcctg ataa 1284
<210> 19
<211> 1089
<212> DNA
<213> Artificial Sequence
<220>
<223>nucleic acid sequence (being free of signal peptide) of 28DCR1
<400> 19
caggtgcagc tggtgcagtc tggggctgag gtgaagaagc ctggggcctc agtgaaggtc 60
tcctgcaagg cttctggata caccttcacc agctactata tacactgggt gcgacaggcc 120
cctggacaag ggcttgagtg gattggatgt atttatcctg gaaatgtcaa tactaactat 180
aatgagaagt tcaaggacag ggccaccctg accgtagaca cgtccatcag cacagcctac 240
atggagctga gcaggctgag atctgacgac acggccgtgt atttctgtac aagatcacac 300
tacggcctcg actggaactt cgatgtctgg ggccaaggga ccacggtcac cgtctcctca 360
ggtggaggcg gttcaggcgg aggtggcagc ggcggtggcg ggtcggacat ccagatgacc 420
cagtctccat cctccctgtc tgcatctgta ggagacagag tcaccatcac ttgccatgcc 480
agtcaaaaca tttatgtttg gttaaactgg tatcagcaga aaccagggaa agcccctaag 540
ctcctgatct ataaggcttc caacctgcac acaggggtcc catcaaggtt cagtggcagt 600
ggatctggga cagatttcac tctcaccatc agcagtctgc aacctgaaga ttttgcaact 660
tactactgtc aacagggtca aacttatccg tacacgttcg gcggagggac caaggtggag 720
atcaaagagt ccaaatatgg tcccccatgc ccaccatgcc caattgaagt tatgtatcct 780
cctccttacc tagacaatga gaagagcaat ggaaccatta tccatgtgaa agggaaacac 840
ctttgtccaa gtcccctatt tcccggacct tctaagccct tttgggtgct ggtggtggtt 900
ggtggagtcc tggcttgcta tagcttgcta gtaacagtgg cctttattat tttctgggtg 960
aggagtaaga ggagcaggct cctgcacagt gactacatga acatgactcc ccgccgcccc 1020
gggcccaccc gcaagcatta ccagccctat gccccaccac gcgacttcgc agcctatcgc 1080
tcctgataa 1089
<210> 20
<211> 1092
<212> DNA
<213> Artificial Sequence
<220>
<223>nucleic acid sequence (being free of signal peptide) of 28DCR2
<400> 20
caggtgcagc tggtgcagtc tggggctgag gtgaagaagc ctggggcctc agtgaaggtc 60
tcctgcaagg cttctggata caccttcacc agctactata tacactgggt gcgacaggcc 120
cctggacaag ggcttgagtg gattggatgt atttatcctg gaaatgtcaa tactaactat 180
aatgagaagt tcaaggacag ggccaccctg accgtagaca cgtccatcag cacagcctac 240
atggagctga gcaggctgag atctgacgac acggccgtgt atttctgtac aagatcacac 300
tacggcctcg actggaactt cgatgtctgg ggccaaggga ccacggtcac cgtctcctca 360
ggtggaggcg gttcaggcgg aggtggcagc ggcggtggcg ggtcggacat ccagatgacc 420
cagtctccat cctccctgtc tgcatctgta ggagacagag tcaccatcac ttgccatgcc 480
agtcaaaaca tttatgtttg gttaaactgg tatcagcaga aaccagggaa agcccctaag 540
ctcctgatct ataaggcttc caacctgcac acaggggtcc catcaaggtt cagtggcagt 600
ggatctggga cagatttcac tctcaccatc agcagtctgc aacctgaaga ttttgcaact 660
tactactgtc aacagggtca aacttatccg tacacgttcg gcggagggac caaggtggag 720
atcaaagagt ccaaatatgg tcccccatgc ccaccatgcc caattgaagt tatgtatcct 780
cctccttacc tagacaatga gaagagcaat ggaaccatta tccatgtgaa agggaaacac 840
ctttgtccaa gtcccctatt tcccggacct tctaagccct tttgggtgct ggtggtggtt 900
ggtggagtcc tggcttgcta tagcttgcta gtaacagtgg cctttattat tttctgggtg 960
aaacggggca gaaagaagct cctgtatata ttcaaacaac catttatgag accagtacaa 1020
actactcaag aggaagatgg ctgtagctgc cgatttccag aagaagaaga aggaggatgt 1080
gaactgtgat aa 1092
<210> 21
<211> 1215
<212> DNA
<213> Artificial Sequence
<220>
<223>nucleic acid sequence (being free of signal peptide) of 28DCR3
<400> 21
caggtgcagc tggtgcagtc tggggctgag gtgaagaagc ctggggcctc agtgaaggtc 60
tcctgcaagg cttctggata caccttcacc agctactata tacactgggt gcgacaggcc 120
cctggacaag ggcttgagtg gattggatgt atttatcctg gaaatgtcaa tactaactat 180
aatgagaagt tcaaggacag ggccaccctg accgtagaca cgtccatcag cacagcctac 240
atggagctga gcaggctgag atctgacgac acggccgtgt atttctgtac aagatcacac 300
tacggcctcg actggaactt cgatgtctgg ggccaaggga ccacggtcac cgtctcctca 360
ggtggaggcg gttcaggcgg aggtggcagc ggcggtggcg ggtcggacat ccagatgacc 420
cagtctccat cctccctgtc tgcatctgta ggagacagag tcaccatcac ttgccatgcc 480
agtcaaaaca tttatgtttg gttaaactgg tatcagcaga aaccagggaa agcccctaag 540
ctcctgatct ataaggcttc caacctgcac acaggggtcc catcaaggtt cagtggcagt 600
ggatctggga cagatttcac tctcaccatc agcagtctgc aacctgaaga ttttgcaact 660
tactactgtc aacagggtca aacttatccg tacacgttcg gcggagggac caaggtggag 720
atcaaagagt ccaaatatgg tcccccatgc ccaccatgcc caattgaagt tatgtatcct 780
cctccttacc tagacaatga gaagagcaat ggaaccatta tccatgtgaa agggaaacac 840
ctttgtccaa gtcccctatt tcccggacct tctaagccct tttgggtgct ggtggtggtt 900
ggtggagtcc tggcttgcta tagcttgcta gtaacagtgg cctttattat tttctgggtg 960
aggagtaaga ggagcaggct cctgcacagt gactacatga acatgactcc ccgccgcccc 1020
gggcccaccc gcaagcatta ccagccctat gccccaccac gcgacttcgc agcctatcgc 1080
tccaaacggg gcagaaagaa gctcctgtat atattcaaac aaccatttat gagaccagta 1140
caaactactc aagaggaaga tggctgtagc tgccgatttc cagaagaaga agaaggagga 1200
tgtgaactgt gataa 1215
<210> 22
<211> 1215
<212> DNA
<213> Artificial Sequence
<220>
<223>nucleic acid sequence (being free of signal peptide) of 28DCR4
<400> 22
caggtgcagc tggtgcagtc tggggctgag gtgaagaagc ctggggcctc agtgaaggtc 60
tcctgcaagg cttctggata caccttcacc agctactata tacactgggt gcgacaggcc 120
cctggacaag ggcttgagtg gattggatgt atttatcctg gaaatgtcaa tactaactat 180
aatgagaagt tcaaggacag ggccaccctg accgtagaca cgtccatcag cacagcctac 240
atggagctga gcaggctgag atctgacgac acggccgtgt atttctgtac aagatcacac 300
tacggcctcg actggaactt cgatgtctgg ggccaaggga ccacggtcac cgtctcctca 360
ggtggaggcg gttcaggcgg aggtggcagc ggcggtggcg ggtcggacat ccagatgacc 420
cagtctccat cctccctgtc tgcatctgta ggagacagag tcaccatcac ttgccatgcc 480
agtcaaaaca tttatgtttg gttaaactgg tatcagcaga aaccagggaa agcccctaag 540
ctcctgatct ataaggcttc caacctgcac acaggggtcc catcaaggtt cagtggcagt 600
ggatctggga cagatttcac tctcaccatc agcagtctgc aacctgaaga ttttgcaact 660
tactactgtc aacagggtca aacttatccg tacacgttcg gcggagggac caaggtggag 720
atcaaagagt ccaaatatgg tcccccatgc ccaccatgcc caattgaagt tatgtatcct 780
cctccttacc tagacaatga gaagagcaat ggaaccatta tccatgtgaa agggaaacac 840
ctttgtccaa gtcccctatt tcccggacct tctaagccct tttgggtgct ggtggtggtt 900
ggtggagtcc tggcttgcta tagcttgcta gtaacagtgg cctttattat tttctgggtg 960
aaacggggca gaaagaagct cctgtatata ttcaaacaac catttatgag accagtacaa 1020
actactcaag aggaagatgg ctgtagctgc cgatttccag aagaagaaga aggaggatgt 1080
gaactgagga gtaagaggag caggctcctg cacagtgact acatgaacat gactccccgc 1140
cgccccgggc ccacccgcaa gcattaccag ccctatgccc caccacgcga cttcgcagcc 1200
tatcgctcct gataa 1215
<210> 23
<211> 729
<212> PRT
<213> Artificial Sequence
<220>
<223>amino acid sequence of Muc1 G1 CAR
<400> 23
Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu
1 5 10 15
His Ala Ala Arg Pro Ser Glu Val Gln Leu Gln Gln Ser Gly Gly Gly
20 25 30
Leu Val Gln Pro Gly Gly Ser Met Lys Leu Ser Cys Val Ala Ser Gly
35 40 45
Phe Thr Phe Ser Asn Tyr Trp Met Asn Trp Val Arg Gln Ser Pro Glu
50 55 60
Lys Gly Leu Glu Trp Val Ala Glu Ile Arg Leu Lys Ser Asn Asn Tyr
65 70 75 80
Ala Thr His Tyr Ala Glu Ser Val Lys Gly Arg Phe Thr Ile Ser Arg
85 90 95
Asp Asp Ser Lys Ser Ser Val Tyr Leu Gln Met Asn Asn Leu Arg Ala
100 105 110
Glu Asp Thr Gly Ile Tyr Tyr Cys Thr Phe Gly Asn Ser Phe Ala Tyr
115 120 125
Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser Gly Gly Ser Gly Ser
130 135 140
Gly Gly Ser Gly Ser Gly Gly Ser Gly Ser Asp Ile Val Val Thr Gln
145 150 155 160
Glu Ser Ala Leu Thr Thr Ser Pro Gly Glu Thr Val Thr Leu Thr Cys
165 170 175
Arg Ser Ser Thr Gly Ala Val Thr Thr Ser Asn Tyr Ala Asn Trp Val
180 185 190
Gln Glu Lys Pro Asp His Leu Phe Thr Gly Leu Ile Gly Gly Thr Asn
195 200 205
Asn Arg Ala Pro Gly Val Pro Ala Arg Phe Ser Gly Ser Leu Ile Gly
210 215 220
Asp Lys Ala Ala Leu Thr Ile Thr Gly Ala Gln Thr Glu Asp Glu Ala
225 230 235 240
Ile Tyr Phe Cys Ala Leu Trp Tyr Ser Asn His Trp Val Phe Gly Gly
245 250 255
Gly Thr Lys Leu Thr Val Leu Gly Ser Glu Glu Ser Lys Tyr Gly Pro
260 265 270
Pro Cys Pro Pro Cys Pro Ala Pro Pro Val Ala Gly Pro Ser Val Phe
275 280 285
Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro
290 295 300
Glu Val Thr Cys Val Val Val Asp Val Ser Gln Glu Asp Pro Glu Val
305 310 315 320
Gln Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr
325 330 335
Lys Pro Arg Glu Glu Gln Phe Gln Ser Thr Tyr Arg Val Val Ser Val
340 345 350
Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys
355 360 365
Lys Val Ser Asn Lys Gly Leu Pro Ser Ser Ile Glu Lys Thr Ile Ser
370 375 380
Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro
385 390 395 400
Ser Gln Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val
405 410 415
Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly
420 425 430
Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp
435 440 445
Gly Ser Phe Phe Leu Tyr Ser Arg Leu Thr Val Asp Lys Ser Arg Trp
450 455 460
Gln Glu Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His
465 470 475 480
Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Leu Gly Lys Phe Val
485 490 495
Pro Val Phe Leu Pro Ala Lys Pro Thr Thr Thr Pro Ala Pro Arg Pro
500 505 510
Pro Thr Pro Ala Pro Thr Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro
515 520 525
Glu Ala Cys Arg Pro Ala Ala Gly Gly Ala Val His Thr Arg Gly Leu
530 535 540
Asp Phe Ala Cys Asp Ile Tyr Ile Trp Ala Pro Leu Ala Gly Thr Cys
545 550 555 560
Gly Val Leu Leu Leu Ser Leu Val Ile Thr Leu Tyr Cys Asn His Lys
565 570 575
Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe Lys Gln Pro Phe Met Arg
580 585 590
Pro Val Gln Thr Thr Gln Glu Glu Asp Gly Cys Ser Cys Arg Phe Pro
595 600 605
Glu Glu Glu Glu Gly Gly Cys Glu Leu Arg Val Lys Phe Ser Arg Ser
610 615 620
Ala Asp Ala Pro Ala Tyr Gln Gln Gly Gln Asn Gln Leu Tyr Asn Glu
625 630 635 640
Leu Asn Leu Gly Arg Arg Glu Glu Tyr Asp Val Leu Asp Lys Arg Arg
645 650 655
Gly Arg Asp Pro Glu Met Gly Gly Lys Pro Arg Arg Lys Asn Pro Gln
660 665 670
Glu Gly Leu Tyr Asn Glu Leu Gln Lys Asp Lys Met Ala Glu Ala Tyr
675 680 685
Ser Glu Ile Gly Met Lys Gly Glu Arg Arg Arg Gly Lys Gly His Asp
690 695 700
Gly Leu Tyr Gln Gly Leu Ser Thr Ala Thr Lys Asp Thr Tyr Asp Ala
705 710 715 720
Leu His Met Gln Ala Leu Pro Pro Arg
725
<210> 24
<211> 1371
<212> DNA
<213> Artificial Sequence
<220>
<223>nucleic acid sequence of Muc1 G1 CAR
<400> 24
ccatgcccac catgcccagc acctcccgtg gccggaccat cagtcttcct gttcccccca 60
aaacccaagg acactctcat gatctcccgg acccctgagg tcacgtgcgt ggtggtggac 120
gtgagccagg aagaccccga ggtccagttc aactggtacg tggatggcgt ggaggtgcat 180
aatgccaaga caaagccgcg ggaggagcag ttccagagca cgtaccgtgt ggtcagcgtc 240
ctcaccgtcc tgcaccagga ctggctgaac ggcaaggagt acaagtgcaa ggtctccaac 300
aaaggcctcc cgtcctccat cgagaaaacc atctccaaag ccaaagggca gccccgagag 360
ccacaggtgt acaccctgcc cccatcccag gaggagatga ccaagaacca ggtcagcctg 420
acctgcctgg tcaaaggctt ctaccccagc gacatcgccg tggagtggga gagcaatggg 480
cagccggaga acaactacaa gaccacgcct cccgtgctgg actccgacgg ctccttcttc 540
ctctacagca ggctaaccgt ggacaagagc aggtggcagg aggggaatgt cttctcatgc 600
tccgtgatgc atgaggctct gcacaaccac tacacacaga agagcctctc cctgtctctg 660
ggtaaattcg tgccggtctt cctgccagcg aagcccacca cgacgccagc gccgcgacca 720
ccaacaccgg cgcccaccat cgcgtcgcag cccctgtccc tgcgcccaga ggcgtgccgg 780
ccagcggcgg ggggcgcagt gcacacgagg gggctggact tcgcctgtga tatctacatc 840
tgggcgcccc tggccgggac ttgtggggtc cttctcctgt cactggttat caccctttac 900
tgcaaccaca aacggggcag aaagaagctc ctgtatatat tcaaacaacc atttatgaga 960
ccagtacaaa ctactcaaga ggaagatggc tgtagctgcc gatttccaga agaagaagaa 1020
ggaggatgtg aactgagagt gaagttcagc aggagcgcag acgcccccgc gtaccagcag 1080
ggccagaacc agctctataa cgagctcaat ctaggacgaa gagaggagta cgatgttttg 1140
gacaagagac gtggccggga ccctgagatg gggggaaagc cgagaaggaa gaaccctcag 1200
gaaggcctgt acaatgaact gcagaaagat aagatggcgg aggcctacag tgagattggg 1260
atgaaaggcg agcgccggag gggcaagggg cacgatggcc tttaccaggg tctcagtaca 1320
gccaccaagg acacctacga cgcccttcac atgcaggccc tgccccctcg c 1371
<210> 25
<211> 112
<212> PRT
<213> Artificial Sequence
<220>
<223>tyrosine activation motifs of CD3 ζ
<400> 25
Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly
1 5 10 15
Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr
20 25 30
Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys
35 40 45
Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys
50 55 60
Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg
65 70 75 80
Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr Ala
85 90 95
Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg
100 105 110
<210> 26
<211> 2187
<212> DNA
<213> Artificial Sequence
<220>
<223>nucleotide sequence of Muc1 G2 CAR
<400> 26
atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60
ccgagcgagg tccagctgca gcagtcagga ggaggcttgg tgcaacctgg aggatccatg 120
aaactctcct gtgttgcctc tggattcact ttcagtaact actggatgaa ctgggtccgc 180
cagtctccag agaaggggct tgagtgggtt gctgaaatta gattgaaatc taataattat 240
gcaacacatt atgcggagtc tgtgaaaggg aggttcacca tctcaagaga tgattccaaa 300
agtagtgtct acctgcaaat gaacaactta agagctgaag acactggcat ttattactgt 360
acctttggta actcctttgc ttactggggc caagggacca cggtcaccgt ctcctcaggt 420
ggttctggtt ctggcggctc cggttccggt ggatccggct ctgatatcgt tgtgactcag 480
gaatctgcac tcaccacatc acctggtgaa acagtcacac tcacttgtcg ctcaagtact 540
ggggctgtta caactagtaa ctatgccaac tgggtccaag aaaaaccaga tcatttattc 600
actggtctaa taggtggtac caacaaccga gcaccaggtg ttcctgccag attctcaggc 660
tccctgattg gagacaaggc tgccctcacc atcacagggg cacagactga ggatgaggca 720
atatatttct gtgctctatg gtacagcaac cattgggtgt tcggtggagg aaccaaactg 780
actgtcctag gatccgagga gtccaaatat ggtcccccat gcccaccatg cccagcacct 840
cccgtggccg gaccatcagt cttcctgttc cccccaaaac ccaaggacac tctcatgatc 900
tcccggaccc ctgaggtcac gtgcgtggtg gtggacgtga gccaggaaga ccccgaggtc 960
cagttcaact ggtacgtgga tggcgtggag gtgcataatg ccaagacaaa gccgcgggag 1020
gagcagttcc agagcacgta ccgtgtggtc agcgtcctca ccgtcctgca ccaggactgg 1080
ctgaacggca aggagtacaa gtgcaaggtc tccaacaaag gcctcccgtc ctccatcgag 1140
aaaaccatct ccaaagccaa agggcagccc cgagagccac aggtgtacac cctgccccca 1200
tcccaggagg agatgaccaa gaaccaggtc agcctgacct gcctggtcaa aggcttctac 1260
cccagcgaca tcgccgtgga gtgggagagc aatgggcagc cggagaacaa ctacaagacc 1320
acgcctcccg tgctggactc cgacggctcc ttcttcctct acagcaggct aaccgtggac 1380
aagagcaggt ggcaggaggg gaatgtcttc tcatgctccg tgatgcatga ggctctgcac 1440
aaccactaca cacagaagag cctctccctg tctctgggta aattcgtgcc ggtcttcctg 1500
ccagcgaagc ccaccacgac gccagcgccg cgaccaccaa caccggcgcc caccatcgcg 1560
tcgcagcccc tgtccctgcg cccagaggcg tgccggccag cggcgggggg cgcagtgcac 1620
acgagggggc tggacttcgc ctgtgatatc tacatctggg cgcccctggc cgggacttgt 1680
ggggtccttc tcctgtcact ggttatcacc ctttactgca accacaaacg gggcagaaag 1740
aagctcctgt atatattcaa acaaccattt atgagaccag tacaaactac tcaagaggaa 1800
gatggctgta gctgccgatt tccagaagaa gaagaaggag gatgtgaact gagagtgaag 1860
ttcagcagga gcgcagacgc ccccgcgtac cagcagggcc agaaccagct ctataacgag 1920
ctcaatctag gacgaagaga ggagtacgat gttttggaca agagacgtgg ccgggaccct 1980
gagatggggg gaaagccgag aaggaagaac cctcaggaag gcctgtacaa tgaactgcag 2040
aaagataaga tggcggaggc ctacagtgag attgggatga aaggcgagcg ccggaggggc 2100
aaggggcacg atggccttta ccagggtctc agtacagcca ccaaggacac ctacgacgcc 2160
cttcacatgc aggccctgcc ccctcgc 2187
<210> 27
<211> 2718
<212> DNA
<213> Artificial Sequence
<220>
<223>nucleic acid sequence of PS328b carrier
<400> 27
ggcgcgcctt aaccctagaa agataatcat attgtgacgt acgttaaaga taatcatgcg 60
taaaattgac gcatgtctag aggtgtggaa agtccccagg ctccccagca ggcagaagta 120
tgcaaagcat gcatctcaat tagtcagcaa ccaggtgtgg aaagtcccca ggctccccag 180
caggcagaag tatgcaaagc atgcatctca attagtcagc aaccaaggat ctgcgatcgc 240
tccggtgccc gtcagtgggc agagcgcaca tcgcccacag tccccgagaa gttgggggga 300
ggggtcggca attgaacggg tgcctagaga aggtggcgcg gggtaaactg ggaaagtgat 360
gtcgtgtact ggctccgcct ttttcccgag ggtgggggag aaccgtatat aagtgcagta 420
gtcgccgtga acgttctttt tcgcaacggg tttgccgcca gaacacagct gaagcttcga 480
ggggctcgca tctctccttc acgcgcccgc cgccctacct gaggccgcca tccacgccgg 540
ttgagtcgcg ttctgccgcc tcccgcctgt ggtgcctcct gaactgcgtc cgccgtctag 600
gtaagtttaa agctcaggtc gagaccgggc ctttgtccgg cgctcccttg gagcctacct 660
agactcagcc ggctctccac gctttgcctg accctgcttg ctcaactcta cgtctttgtt 720
tcgttttctg ttctgcgccg ttacagatcc aagctgtgac cggcgcctac gaattcggat 780
cctgcactag tgctgtcgac cagacatgat aagatacatt gatgagtttg gacaaaccac 840
aactagaatg cagtgaaaaa aatgctttat ttgtgaaatt tgtgatgcta ttgctttatt 900
tgtaaccatt ataagctgca ataaacaagt taacaacaac aattgcattc attttatgtt 960
tcaggttcag ggggaggtgt gggaggtttt ttaaagcaag taaaacctct acaaatgtgg 1020
tagcatgcgt caattttacg cagactatct ttctagggtt aaatcgatcc cgctagcccc 1080
gatatcccct taattaagag ggggagacca aagggcgaga cgttaaggcc tcacgtgaca 1140
tgtgagcaaa aggccagcaa aaggccagga accgtaaaaa ggccgcgttg ctggcgtttt 1200
tccataggct ccgcccccct gacgagcatc acaaaaatcg acgctcaagt cagaggtggc 1260
gaaacccgac aggactataa agataccagg cgtttccccc tggaagctcc ctcgtgcgct 1320
ctcctgttcc gaccctgccg cttacgggat acctgtccgc ctttctccct tcgggaagcg 1380
tggcgctttc tcatagctca cgctgtaggt atctcagttc ggtgtaggtc gttcgctcca 1440
agctgggctg tgtgcacgaa ccccccgttc agcccgaccg ctgcgcctta tccggtaact 1500
atcgtcttga gtccaacccg gtaagacacg acttatcgcc actggcagca gccactggta 1560
acaggattag cagagcgagg tatgtaggcg gtgctacaga gttcttgaag tggtggccta 1620
actacggcta cactagaaga acagtatttg gtatctgcgc tctgctgaag ccagttacct 1680
tcggaaaaag agttggtagc tcttgatccg gcaaacaaac caccgctggt agcggtggtt 1740
tttttgtttg caagcagcag attacgcgca gaaaaaaagg atctcaagaa gatcctttga 1800
tcttttctac ggggtctgac gctcagtgga acgaaaactc acgttaaggg attttggtca 1860
tgccgtctca gaagaactcg tcaagaaggc gatagaaggc gatgcgctgc gaatcgggag 1920
cggcgatacc gtaaagcacg aggaagcggt cagcccattc gccgccaagc tcttcagcaa 1980
tatcacgggt agccaacgct atgtcctgat agcggtccgc cacacccagc cggccacagt 2040
cgatgaatcc agaaaagcgg ccattttcca ccatgatatt cggcaagcag gcatcgccat 2100
gggtcacgac gagatcctcg ccgtcgggca tgctcgcctt gagcctggcg aacagttcgg 2160
ctggcgcgag cccctgatgc tcttcgtcca gatcatcctg atcgacaaga ccggcttcca 2220
tccgagtacg tgctctctcg atgcgatgtt tcgcttggtg gtcgaatggg caggtagccg 2280
gatcaagcgt atgcagccgc cgcattgcat cagccatgat ggatactttc tcggcaggag 2340
caaggtgaga tgacaggaga tcctgccccg gcacttcgcc caatagcagc cagtcccttc 2400
ccgcttcagt gacaacgtcg agtacagctg cgcaaggaac gcccgtcgtg gccagccacg 2460
atagccgcgc tgcctcgtct tgcagttcat tcagggcacc ggacaggtcg gtcttgacaa 2520
aaagaaccgg gcgcccctgc gctgacagcc ggaacacggc ggcatcagag cagccgattg 2580
tctgttgtgc ccagtcatag ccgaatagcc tctccaccca agcggccgga gaacctgcgt 2640
gcaatccatc ttgttcaatc ataatattat tgaagcattt atcagggttc gtctcgtccc 2700
ggtctcctcc catgcatg 2718
<210> 28
<211> 18
<212> DNA
<213> Artificial Sequence
<220>
<223>base sequence of primer CD28-F
<400> 28
gcttctggat acaccttc 18
<210> 29
<211> 24
<212> DNA
<213> Artificial Sequence
<220>
<223>base sequence of primer CD28-R
<400> 29
ccttgaactt ctcattatag ttag 24
<210> 30
<211> 23
<212> DNA
<213> Artificial Sequence
<220>
<223>base sequence in probe Taqman
<400> 30
aatacatcca atccactcaa gcc 23

Claims (14)

1. a kind of isolated polypeptide, successively includes following elements from N-terminal to C-terminal:
Optional signal peptide, polypeptide (such as ligand of CD28 activated form single-chain antibody or CD28), the extracellular hinge for activating CD28 Area, transmembrane region and costimulatory signal molecule intracellular.
2. polypeptide according to claim 1, it is characterised in that any 1,2,3,4 in following (1)-(5) item Or 5:
(1) signal peptide is memebrane protein signal peptide；Preferably, the signal peptide be selected from CD8 signal peptide, CD28 signal peptide and One of CD4 signal peptide is a variety of；Preferably, the signal peptide is CD8 signal peptide；Preferably, the amino acid of CD8 signal peptide Sequence is as shown in SEQ ID NO:1；
(2) amino acid sequence of the CD28 activated form single-chain antibody is as shown in SEQ ID NO:2；The ligand of the CD28 is CD80/CD86；
(3) the extracellular hinge area be one kind selected from IgG4Fc CH2CH3 hinge area, CD28 hinge area and CD8 hinge area or It is a variety of；It preferably, is CD8 hinge area；Preferably, the amino acid sequence of the CD8 hinge area is as shown in SEQ ID NO:3；
(4) transmembrane region is selected from CD28 transmembrane region, CD8 transmembrane region, CD3 ζ transmembrane region, CD134 transmembrane region, CD137 cross-film One of area, ICOS transmembrane region and DAP10 transmembrane region are a variety of；Preferably, the transmembrane region is CD28 transmembrane region；It is preferred that Ground, the amino acid sequence of the CD28 transmembrane region is as shown in SEQ ID NO:4；
(5) the costimulatory signal molecule intracellular is selected from CD28 intracellular domain, CD134/OX40 intracellular domain, CD137/4- One of 1BB intracellular domain, LCK intracellular domain, ICOS intracellular domain and DAP10 intracellular domain are a variety of；It is excellent Selection of land, the costimulatory signal molecule intracellular are CD28 intracellular domain and/or CD137 intracellular domain；Preferably, described The amino acid sequence of CD28 intracellular domain is as shown in SEQ ID NO:5；Preferably, the amino of the CD137 intracellular domain Acid sequence is as shown in SEQ ID NO:6.
3. polypeptide according to claim 1 or 2 successively includes following elements from N-terminal to C-terminal:
Optional CD8 signal peptide, CD28 activated form single-chain antibody, the extracellular hinge area of CD8, CD28 transmembrane region, CD28 structure intracellular Domain and/or CD137 intracellular domain.
4. according to claim 1 to polypeptide described in any claim in 3, amino acid sequence such as SEQ ID NO:7 to SEQ In ID NO:14 shown in any sequence.
5. a kind of isolated polynucleotides encode polypeptide isolated described in any claim in Claims 1-4；It is excellent Selection of land, the sequence of the isolated polynucleotides is as shown in any sequence in SEQ ID NO:15 to SEQ ID NO:22.
6. a kind of nucleic acid construct includes the polynucleotides described in claim 5.
7. a kind of recombinant vector contains the polynucleotides or nucleic acid construct as claimed in claim 6 described in claim 5 Body；Preferably, the recombinant vector is recombinant cloning vector, eukaryotic expression recombinant plasmid or recombinant viral vector；Preferably, The recombinant expression carrier is the transposon vector of recombination；Preferably, the transposon vector contain selected from piggybac, The transposable element of sleeping beauty, frog prince, Tn5 or Ty；Preferably, the recombinant expression carrier is wanted for right Polynucleotides described in asking 5 and PS328b carrier are through recombinating obtained recombinant vector.
8. a kind of recombinant vector combination, it includes recombinant vectors 1 and recombinant vector 2, in which:
The recombinant vector 1 is recombinant vector as claimed in claim 7,
The coded sequence of the recombinant vector 2 containing first generation Chimeric antigen receptor；Preferably, the first generation chimeric antigen by Body is the first generation Chimeric antigen receptor for targeting Muc1；Preferably, the amino acid sequence of the first generation Chimeric antigen receptor is such as Shown in SEQ ID NO:23；Preferably, the nucleic acid sequence of the first generation Chimeric antigen receptor is as shown in SEQ ID NO:24；
Preferably, the recombinant vector 2 is the PNB328B carrier of recombination.
9. a kind of recombinant host cell, wherein the cell contains polynucleotides described in claim 5, described in claim 6 Nucleic acid construct, recombinant vector as claimed in claim 7 or recombinant vector according to any one of claims 8 combination；Preferably, institute Stating recombinant host cell is recombinant mammalian cells；Preferably, the recombinant host cell is recombination T cell；Preferably, institute State the peripheral blood mononuclear cells that recombination T cell is recombination.
10. a kind of T cell, expression has the right to require polypeptide described in any claim and the first generation in 1 to 4 chimeric Antigen receptor；Preferably, the recombination T cell is the peripheral blood mononuclear cells of recombination；Preferably, the first generation chimeric antigen Receptor is the first generation Chimeric antigen receptor for targeting Muc1；Preferably, the amino acid sequence of the first generation Chimeric antigen receptor As shown in SEQ ID NO:23.
11. a kind of Pharmaceutical composition, it includes polypeptides described in any claim in Claims 1-4, claim 5 institute The polynucleotides stated, nucleic acid construct as claimed in claim 6, recombinant vector as claimed in claim 7, described in claim 8 Recombinant vector combination, recombinant host cell as claimed in claim 9 or T cell described in any one of claim 10；Optionally, also Include pharmaceutically acceptable auxiliary material.
12. polypeptide described in any claim, polynucleotides, claim 6 described in claim 5 in Claims 1-4 The nucleic acid construct, recombinant vector as claimed in claim 7, recombinant vector according to any one of claims 8 combination, claim Recombinant host cell described in 9 or T cell described in any one of claim 10 are in the drug of preparation treatment and/or pre- anti-cancer Purposes；Preferably, the cancer is the cancer of its cancer cell surfaces unconventionality expression Muc1；Preferably, the cancer is selected from: gland Cancer, lung cancer, colon cancer, colorectal cancer, breast cancer, oophoroma, cervical carcinoma, gastric cancer, cholangiocarcinoma, gallbladder cancer, the cancer of the esophagus, cancer of pancreas or Prostate cancer.
13. polypeptide described in any claim, polynucleotides, claim 6 described in claim 5 in Claims 1-4 The nucleic acid construct, recombinant vector as claimed in claim 7, recombinant vector according to any one of claims 8 combination, claim The purposes of recombinant host cell described in 9 or T cell described in any one of claim 10 in the drug that preparation inhibits cancer cell；It is excellent Selection of land, the cancer cell are the cancer cell of cell surface unconventionality expression Muc1；Preferably, the cancer cell is selected from following cancer Cancer cell: gland cancer, lung cancer, colon cancer, colorectal cancer, breast cancer, oophoroma, cervical carcinoma, gastric cancer, cholangiocarcinoma, gallbladder cancer, oesophagus Cancer, cancer of pancreas or prostate cancer.
14. polypeptide described in any claim, polynucleotides, claim 6 described in claim 5 in Claims 1-4 The nucleic acid construct, recombinant vector as claimed in claim 7, recombinant vector according to any one of claims 8 combination, claim Recombinant host cell described in 9 or T cell described in any one of claim 10 are in the drug that preparation promotes cytokine secretion Purposes, wherein the cell factor is selected from one of IL-2, IL-4, IL-6, IL-10, TNF-α and IFN-γ or a variety of.
CN201711466911.3A 2017-12-28 2017-12-28 CD28 bidirectional activation co-stimulatory molecule receptor and application thereof Active CN109970866B (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
CN201711466911.3A CN109970866B (en) 2017-12-28 2017-12-28 CD28 bidirectional activation co-stimulatory molecule receptor and application thereof
PCT/CN2018/123988 WO2019129090A1 (en) 2017-12-28 2018-12-26 Cd28 bidirectionally activated costimulatory molecule/receptor, and uses thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN201711466911.3A CN109970866B (en) 2017-12-28 2017-12-28 CD28 bidirectional activation co-stimulatory molecule receptor and application thereof

Publications (2)

Publication Number Publication Date
CN109970866A true CN109970866A (en) 2019-07-05
CN109970866B CN109970866B (en) 2022-10-04

Family

ID=67063220

Family Applications (1)

Application Number Title Priority Date Filing Date
CN201711466911.3A Active CN109970866B (en) 2017-12-28 2017-12-28 CD28 bidirectional activation co-stimulatory molecule receptor and application thereof

Country Status (2)

Country Link
CN (1) CN109970866B (en)
WO (1) WO2019129090A1 (en)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110240658A (en) * 2019-06-20 2019-09-17 徐州医科大学 Target CAR-T and its application of HBV treatment liver cancer
CN113493526A (en) * 2021-07-07 2021-10-12 星汉德生物医药(大连)有限公司 Multiple co-stimulation signal chimeric antigen receptor and application thereof
CN116497065A (en) * 2022-01-25 2023-07-28 广东东阳光药业股份有限公司 Viral vectors and uses thereof

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN109970864A (en) * 2017-12-28 2019-07-05 上海细胞治疗研究院 A kind of two-way activation costimulatory molecules receptor and application thereof

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1996023814A1 (en) * 1995-02-03 1996-08-08 Cell Genesys, Inc. Chimeric receptor molecules for delivery of co-stimulatory signals
CN105331586A (en) * 2015-11-20 2016-02-17 上海细胞治疗研究院 Tumor precision T cell containing efficient killing starting mechanism and application of tumor precision T cell
CN106220739A (en) * 2010-12-09 2016-12-14 宾夕法尼亚大学董事会 The purposes of the T cell treatment cancer that Chimeric antigen receptor is modified
WO2017027291A1 (en) * 2015-08-07 2017-02-16 Seattle Children's Hospital (dba Seattle Children's Research Institute) Bispecific car t-cells for solid tumor targeting

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1996023814A1 (en) * 1995-02-03 1996-08-08 Cell Genesys, Inc. Chimeric receptor molecules for delivery of co-stimulatory signals
CN106220739A (en) * 2010-12-09 2016-12-14 宾夕法尼亚大学董事会 The purposes of the T cell treatment cancer that Chimeric antigen receptor is modified
WO2017027291A1 (en) * 2015-08-07 2017-02-16 Seattle Children's Hospital (dba Seattle Children's Research Institute) Bispecific car t-cells for solid tumor targeting
CN105331586A (en) * 2015-11-20 2016-02-17 上海细胞治疗研究院 Tumor precision T cell containing efficient killing starting mechanism and application of tumor precision T cell

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110240658A (en) * 2019-06-20 2019-09-17 徐州医科大学 Target CAR-T and its application of HBV treatment liver cancer
CN113493526A (en) * 2021-07-07 2021-10-12 星汉德生物医药(大连)有限公司 Multiple co-stimulation signal chimeric antigen receptor and application thereof
CN116497065A (en) * 2022-01-25 2023-07-28 广东东阳光药业股份有限公司 Viral vectors and uses thereof

Also Published As

Publication number Publication date
CN109970866B (en) 2022-10-04
WO2019129090A1 (en) 2019-07-04

Similar Documents

Publication Publication Date Title
KR20230018488A (en) Novel Coronavirus Spike Protein Binding Molecules and Their Applications
CN104507968B (en) People&#39;s CD30 ligand antigen binding protein
CN106755107B (en) A kind of CAR recruit and its application in oncotherapy
CN109970866B (en) CD28 bidirectional activation co-stimulatory molecule receptor and application thereof
WO2018233574A1 (en) Anti-pd-l1 humanized nanobody and use thereof
CN107683289A (en) The bonding agents of IL13RA α 2 and its purposes in treatment of cancer
JP2001523973A (en) Human monoclonal antibody against epidermal growth factor receptor
KR20150030706A (en) Dual receptor antagonistic antigen-binding proteins and uses thereof
CN111432831A (en) I L-2 mutant protein and application thereof
CN114292326B (en) Novel coronavirus (SARS-COV-2) spike protein binding molecule and application thereof
CN113788894B (en) Monoclonal antibody targeting human Claudin18.2 protein and application thereof
WO2021052307A1 (en) Anti-b7-h3 antibody and application thereof
WO2019128994A1 (en) Muc1-specific car-t cell stably expressing pd-1 antibody and use thereof
CN109575143A (en) Bispecific CD20-CD19-CAR and its application
CN108219004A (en) The T cell of double distinctive embedment antigen receptor modifications, preparation method and the usage
WO2019129124A1 (en) T cell containing cd40 antibody and muc1 specific chimeric antigen receptor gene and use thereof
CN109970867A (en) A kind of two-way activation costimulatory molecules receptor of CD40 and application thereof
CA2257861A1 (en) Hexameric fusion proteins and uses therefor
CN109970864A (en) A kind of two-way activation costimulatory molecules receptor and application thereof
CN109970865B (en) CD137 bidirectional activation costimulatory molecule receptor and application thereof
WO2019129142A1 (en) Car-t cells that automatically secrete cd40 antibodies and target erbb receptor family and use thereof
CN111574630B (en) CD 19-resistant nano antibody, encoding gene, recombinant nano antibody, recombinant vector, recombinant strain and application
KR20220129015A (en) Engineered T cells, their preparation and applications
CN110016074B (en) MAGE-A3 humanized T cell receptor
CN114805581B (en) Antibodies targeting IL13RA2, chimeric antigen receptors and uses thereof

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
GR01 Patent grant
GR01 Patent grant
CP03 Change of name, title or address

Address after: No. 1585 Yuanguo Road, Jiading District, Shanghai, 201805

Patentee after: SHANGHAI CELL THERAPY Research Institute

Country or region after: China

Patentee after: Shanghai Cell Therapy Group Co.,Ltd.

Address before: No. 1585 Yuanguo Road, Jiading District, Shanghai, 201805

Patentee before: SHANGHAI CELL THERAPY Research Institute

Country or region before: China

Patentee before: SHANGHAI CELL THERAPY GROUP Co.,Ltd.