CN107624639A - The planting unit of adjustable implantation hole size - Google Patents
The planting unit of adjustable implantation hole size Download PDFInfo
- Publication number
- CN107624639A CN107624639A CN201710773331.2A CN201710773331A CN107624639A CN 107624639 A CN107624639 A CN 107624639A CN 201710773331 A CN201710773331 A CN 201710773331A CN 107624639 A CN107624639 A CN 107624639A
- Authority
- CN
- China
- Prior art keywords
- implantation hole
- planting unit
- inner space
- moving block
- plant
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02P—CLIMATE CHANGE MITIGATION TECHNOLOGIES IN THE PRODUCTION OR PROCESSING OF GOODS
- Y02P60/00—Technologies relating to agriculture, livestock or agroalimentary industries
- Y02P60/20—Reduction of greenhouse gas [GHG] emissions in agriculture, e.g. CO2
- Y02P60/21—Dinitrogen oxide [N2O], e.g. using aquaponics, hydroponics or efficiency measures
Landscapes
- Cultivation Receptacles Or Flower-Pots, Or Pots For Seedlings (AREA)
Abstract
The invention belongs to planting technology field, disclose a kind of planting unit of adjustable implantation hole size, the inner space formed including shell and by shell, housing front plate upper end is transparent material, inner space upper end is provided with spraying mechanism, inner space rear is provided with control module, inner space lower end is provided with dividing plate, dividing plate lower end is provided with storage box, outer wall upper end is provided with hook at left and right sides of shell, lower end is provided with roll-over table, the planting unit of the present invention is wrapped to form integrative-structure by shell, not only save space, and totally it is hardly damaged, internal structure sets reasonable, be advantageous to plant growth, and grower can facilitate the upgrowth situation of observation of plant, not only improve planting survival rate, plantation enjoyment and aesthetics can also be increased.
Description
Technical field
The invention belongs to planting technology field, and in particular to a kind of planting unit of adjustable implantation hole size.
Background technology
As population increases, the mankind are more and more to appropriation of land, and vegetative coverage area diminishes in living area, old friend
Plant is taken home gradually, using the interior space carry out planting, so can not only increase life in plant contact, also
Indoor environment can be improved, improve quality of the life, therefore interior room planting technology is paid close attention to by more and more people.
Such as, Chinese invention patent mandate document, Authorization Notice No. is prior art：The B of CN 104186298, the invention relate to
And a kind of indoor planting equipment, it sets extension block due to setting slit to cause the implantation hole to have the elasticity outwards upheld
The indoor planting equipment is allowd to do corresponding regulation according to the characteristic or thin and weak situation of different plants, so as to be applicable difference
The demand of plant, and reduce the injury to plant, increase moves the survival rate for plucking plant, and extension block is in sector structure, so that with
The direct contact portion of root system of plant helps to reduce injury of the dividing plate to root system of plant without corner angle；In addition, by set handle with
Facilitate pull water storage case；The relevant information of plant, increase plantation enjoyment are recorded at any time by setting clipboard；Turned over further through this
Turntable is to increase the space availability ratio of the indoor planting equipment, but due to the thickness of dividing plate in the invention, therefore slit is to implantation hole
Outside extension elasticity may unobvious, plant may be influenceed and picked and placeed.
The content of the invention
The present invention provides one kind for solution above-mentioned technical problem and is applied to indoor plantation, multiple functional, planting plants survival
Rate is high, and baffle surface anticorrosion with painting coating, can effectively improve the plantation dress of the adjustable implantation hole size of dividing plate antiseptic property
Put.
The present invention is for the scheme taken of solution above-mentioned technical problem：The planting unit of adjustable implantation hole size, bag
Shell and the inner space formed by shell are included, housing front plate upper end is transparent material, and inner space upper end is provided with spraying mechanism,
Inner space rear is provided with control module, and inner space lower end is provided with dividing plate, and dividing plate lower end is provided with storage box, the shell left and right sides
Outer wall upper end is provided with hook, lower end is provided with roll-over table, and planting unit of the invention has shell to be wrapped to form integrative-structure, not only saved
Save space, and be totally hardly damaged, it is reasonable that internal structure is set, and is advantageous to plant growth, and inner space is plantation space, can be carried
For the planting environment of broadness, spraying mechanism effectively can spray water to plant, improve plant survival rate, housing front plate upper end is
Bright material, the upgrowth situation of observation of plant can be facilitated by being advantageous to grower, not only improved and prepared plantation survival rate, can also increase kind
Plant enjoyment and aesthetics.
Preferably, baffle surface is provided with implantation hole, implantation hole outward flange is equipped with four grooves, and implantation hole is by groove point
Moving block is equipped with every each region of formation, the splicing groove formed between moving block is corresponding with groove, and moving block rear is provided with
Support column, dividing plate are used for the fixation of plant, the setting of implantation hole so that plant has independent cultivated area, can effectively avoid
Cause the situation of Plant death because grower's plantation is overstocked, the setting of support column, can not only play support to more weak plant
Effect, can be also later stage plant result, when fruit weight is more than limb supported weight, provides support for limb and rely on, moving block
It may be reversed, be advantageous to adjust the relative aperture of implantation hole, avoid that plant roots and stems are not of uniform size and the feelings that can not fix or plant
Condition, improve the scope of application of planting unit.
Preferably, moving block is sector structure, moving block front end is connected with sponge, and sponge front end is provided with sponge projection,
Moving block is beveled structure, improves the contact area of moving block and plant roots and stems, so as to improve the fixed effect of moving block,
Moving block leading portion is connected with sponge, reduces injury of the moving block to plant roots and stems, and sponge front end is provided with sponge projection, increase
The space of plant fixed position, avoids moving block from being contacted with plant roots and stems overstocked, no moisture, air circulation and cause rhizome
The phenomenon festered, so as to be obviously improved the survival rate of plant.
Preferably, the width L1 of moving block is 1 with 5 radius r1 ratios of plantation:1.4 ~ 1.8, groove is triangular pyramids, is rotated
The width L1 of block and plantation pore radius r1 ratios not only cause implantation hole to have larger relative aperture adjustable range, make planting unit
With larger adaptability, it is triangle centrum to the preferable fixation of plant, groove that can also keep moving block, can not only make every
Moisture following current on plate is into storage box, or improves effect of the groove to implantation hole so that implantation hole has preferably outwards
The property of extension.
Preferably, baffle surface is coated with erosion shield, the composition and its parts by weight of erosion shield are：Modified boron
28 ~ 32 parts of novolac polymer, 0.11 ~ 0.18 part of nano combined liquid, 6 ~ 10 parts of carbon fiber of enhancing, rutile type titanium white 17 ~ 22
Part, 5 ~ 8 parts of silicon carbide ceramics powder, 3 ~ 6 parts of nickel-base alloy powder, anticorrosive coating are coated on baffle surface, shape after drying processing
Into corrosion-inhibiting coating, erosion shield can effectively improve the stability of dividing plate molecule, prevent the erosion of air, water body to dividing plate, from
And the intensity of dividing plate is improved, extend dividing plate service life, erosion shield can also improve the anti-adhesion performance of baffle surface, reduce water
Body, impurity baffle surface attachment, so as to improve the sanitary condition of planting environment.
Preferably, nano combined liquid contains 16 ~ 23% active peptides, the amino acid sequence of active peptides is：
HSHACASYYCSKSHACKTACKFCGTASCTHLSCTCRVLHPGKLCACVNCSR, it is more that activity is with the addition of in nano combined liquid
Peptide so that nano combined liquid can each group fractionated molecule be compatible in coating preparation process effectively facilitates coating, improves component degree of mixing,
So as to lift the mechanical property of coating and film forming, and then coating is securely attached to baffle surface, significantly increase coating to every
The Corrosion Protection of plate.
Preferably, outer wall both sides are provided with handle before storage box, outer wall middle part is provided with observation window before storage box, and storage box leads to
Cross aqueduct and be connected with storage tank, storage tank is arranged at outdoor, and storage box volume is the 1/4 ~ 1/3 of inner space volume, water storage
Box can provide the supply of moisture and nutrition for plant, and handle is easy to the side of taking of storage box, and storage tank is by aqueduct to storage box
Moisturizing, storage tank are arranged at outdoor, substantially reduce the volume of this planting unit, improve the freedom of indoor placement, water storage
Box body accumulates the volume ratio with inner space, can effectively build the natural environment of class, both volume ratios are suitable, are advantageous to plant roots
Stem and the growth of limb, improve plant survival rate.
Mechanism and recording mechanism are played preferably, being provided with the left of inner space, mechanism is played and can play various natures
Sound, the setting for playing mechanism improves the simulation nature performance of planting unit, builds good environment for plant growth, can have
Effect promotes the growth of plant.
Preferably, control module electrical connection spraying mechanism, broadcasting mechanism and recording mechanism, and control entering for aqueduct
Water, by control of the control module to modules, the automation performance of planting unit is improved, reduces the artificial treatment time,
Accurate control program, also improve the survival rate of plant.
Compared with prior art, beneficial effects of the present invention are:1）This planting unit is integral type structure, not only saves and puts
Between being empty, the utilization rate of device can be also improved；2）Using the implantation hole of adjustable aperture, damage when plant picks and places is not only reduced
Wound, it can also improve the plant scope of planting unit suitable planting；3）Baffle surface is coated with erosion shield, can not only improve
The antiseptic property of dividing plate, increases the service life, and can also improve its antistick characteristic, improves the sanitary condition in planting environment.
Present invention employs the planting unit that above-mentioned technical proposal provides adjustable implantation hole size, prior art compensate for
Deficiency, it is reasonable in design, it is easy to operate.
Brief description of the drawings
Fig. 1 is the structural representation of the planting unit of the adjustable implantation hole size of the present invention；
Fig. 2 is the diaphragm structure schematic diagram of the planting unit of the adjustable implantation hole size of the present invention；
Fig. 3 is the moving block structural representation of the planting unit of the adjustable implantation hole size of the present invention；
Fig. 4 is the dividing plate sectional view of the planting unit of the adjustable implantation hole size of the present invention.
Description of reference numerals：1 shell；2 spraying mechanisms；3 control modules；4 hooks；5 play mechanism；6 recording mechanisms；In 7
Portion space；8 dividing plates；9 storage boxes；10 handles；11 observation windows；12 roll-over tables；13 aqueducts；14 storage tanks；15 implantation holes；16 turns
Motion block；17 splicing grooves；18 support columns；19 grooves；20 sponges；21 sponge projections.
Embodiment
It is described in further detail below in conjunction with drawings and examples：
Embodiment 1：
As shown in Fig. 1 ~ 4, the planting unit of implantation hole size can adjust, including shell 1 and the inner space 7 that is formed by shell 1,
The antetheca upper end of shell 1 is transparent material, and the upper end of inner space 7 is provided with spraying mechanism 2, and the rear of inner space 7 is provided with control module
3, the lower end of inner space 7 is provided with dividing plate 8, and the lower end of dividing plate 8 is provided with storage box 9, the left and right sides outer wall upper end of shell 1 be provided with hook 4,
Lower end is provided with roll-over table 12, and planting unit of the invention has shell 1 to be wrapped to form integrative-structure, not only saves space, and totally
It is hardly damaged, it is reasonable that internal structure is set, and is advantageous to plant growth, and inner space 7 is plantation space, it is possible to provide broad plantation
Environment, spraying mechanism 2 effectively can spray water to plant, improve plant survival rate, the antetheca upper end of shell 1 is transparent material, is had
The upgrowth situation of observation of plant can be facilitated beneficial to grower, not only improve prepare plantation survival rate, can also increase plantation enjoyment with
And aesthetics.
The surface of dividing plate 8 is provided with implantation hole 15, and the outward flange of implantation hole 15 is equipped with four grooves 19, and implantation hole 15 is by groove 19
The each region being separated to form is equipped with moving block 16, and the splicing groove 17 formed between moving block 16 is corresponding with groove 19, rotates
The rear of block 16 is provided with support column 18, and dividing plate 8 is used for the fixation of plant, the setting of implantation hole 15 so that plant has independent kind
Area is planted, can effectively avoid causing the situation of Plant death because grower's plantation is overstocked, the setting of support column 18 not only can be right
More weak plant plays a supportive role, and can be also later stage plant result, when fruit weight is more than limb supported weight, be carried for limb
Relied on for support, moving block 16 may be reversed, and is advantageous to adjust the relative aperture of implantation hole 15, it is not of uniform size to avoid plant roots and stems
And the situation that can not be fixed or plant, improve the scope of application of planting unit.
Moving block 16 is sector structure, and the front end of moving block 16 is connected with sponge 20, and the front end of sponge 20 is provided with sponge projection 21,
Moving block 16 is beveled structure, improves the contact area of moving block 16 and plant roots and stems, so as to improve consolidating for moving block 16
Determine effect, the leading portion of moving block 16 is connected with sponge 20, reduces injury of the moving block 16 to plant roots and stems, and the front end of sponge 20 is set
There is sponge projection 21, add the space of plant fixed position, avoid moving block 16 from being contacted with plant roots and stems overstocked, no moisture,
Air circulation and the phenomenon for causing rhizome to fester, so as to be obviously improved the survival rate of plant.
The width L1 of moving block 16 is 1 with the radius r1 ratios of implantation hole 15:1.6, groove 19 is triangular pyramids, moving block 16
Width L1 not only causes implantation hole 15 to have larger relative aperture adjustable range with the radius r1 ratios of implantation hole 15, makes planting unit
With larger adaptability, it is triangle centrum to the preferable fixation of plant, groove 19 that can also keep moving block 16, not only may be used
Make the moisture following current on dividing plate 8 into storage box 9, or improve effect of the groove 19 to implantation hole 15 so that implantation hole 15 has
There is the property preferably to stretch out.
The surface spraying of dividing plate 8 has erosion shield, and the composition and its parts by weight of erosion shield are：Modified boron phenolic polymerization
It is 29 parts of thing, 0.16 part of nano combined liquid, 7 parts of carbon fiber of enhancing, 18 parts of rutile type titanium white, 7 parts of silicon carbide ceramics powder, Ni-based
4 parts of alloyed powder, anticorrosive coating are coated on the surface of dividing plate 8, form corrosion-inhibiting coating after drying processing, erosion shield can be effective
The stability of the molecule of dividing plate 8 is improved, prevents the erosion of air, water body to dividing plate 8, so as to improve the intensity of dividing plate, extends dividing plate 8
Service life, erosion shield can also improve the anti-adhesion performance on the surface of dividing plate 8, and it is attached the surface of dividing plate 8 to reduce water body, impurity
, so as to improve the sanitary condition of planting environment.
Nano combined liquid contains 18% active peptides, and the amino acid sequence of active peptides is：
HSHACASYYCSKSHACKTACKFCGTASCTHLSCTCRVLHPGKLCACVNCSR, it is more that activity is with the addition of in nano combined liquid
Peptide so that nano combined liquid can each group fractionated molecule be compatible in coating preparation process effectively facilitates coating, improves component degree of mixing,
So as to lift the mechanical property of coating and film forming, and then coating is securely attached to the surface of dividing plate 8, significantly increase coating to every
The Corrosion Protection of plate 8.
Outer wall both sides are provided with handle 10 before storage box 9, and outer wall middle part is provided with observation window 11 before storage box 9, and storage box 9 passes through
Aqueduct 13 is connected with storage tank 14, and storage tank 14 is arranged at outdoor, and the volume of storage box 9 is the 1/4 of the volume of inner space 7, is stored
Water box 9 can provide the supply of moisture and nutrition for plant, and handle 10 is easy to the side of taking of storage box 9, and storage tank 14 passes through aqueduct
13 give the moisturizing of storage box 9, and storage tank 14 is arranged at outdoor, substantially reduces the volume of this planting unit, improves indoor placement
Freedom, the volume ratio of the volume of storage box 9 and inner space 7, can effectively build the natural environment of class, both fit at volume ratio
Preferably, be advantageous to the growth of plant roots and stems and limb, improve plant survival rate.
The left side of inner space 7, which is provided with, plays mechanism 5 and recording mechanism 6, plays the sound that mechanism 5 can play various natures
Sound, the setting for playing mechanism 5 improve the simulation nature performance of planting unit, and good environment is built for plant growth, can be effective
Promote the growth of plant.
Control module 3 electrically connects spraying mechanism 2, plays mechanism 5 and recording mechanism 6, and controls the water inlet of aqueduct 13, leads to
Control of the control module 3 to modules is crossed, improves the automation performance of planting unit, reduces the artificial treatment time, accurately
Control program, also improve the survival rate of plant.
The prior art of routine techniques dawn known to those skilled in the art in the present embodiment, is not chatted in detail herein
State.
Embodiment 2：
As shown in Fig. 1 ~ 4, the planting unit of implantation hole size is can adjust, in actual use, by the kind in addition to storage tank 14
Planting apparatus body is installed indoors, and storage tank 14 is installed outdoors, is connected between the two by aqueduct 13, and plantling is passed through into kind
Plant hole 15 to be fixed on dividing plate 8, switching on power makes control module 3 work, and control module 3 can control spraying mechanism 2, play mechanism
5 regular workings, and control storage box 9 to be drawn water from storage tank 14 to keep plant to have moisture and the nutrition of abundance, during which, plantation
Personnel can observe the upgrowth situation of plant in inner space 7 by transparent material, can not only adjust planting situation in time, also
Plantation enjoyment can be improved, plant personnel can observe water body situation in storage box 9 by observation window 11, if there is water body after long-term use
Debris, you can storage box 9 is extracted out by handle 10 and cleaned, the hook 4 in the side wall of shell 1 can be used for suspension plantation correlative
Product, plant growth minute book is such as hung, not only increase plantation enjoyment, can also improve plant research convenience, the lower section of hook 4 is turned over
Turntable 12 adds the space of planting unit, improves space availability ratio, and this planting unit automaticity is high, and device is totally whole
It is clean, account for that the interior space is small, and plant personnel can be allowed to experience larger plantation enjoyment.
The width L1 of moving block 16 is not limited only to 1 with the radius r1 ratios of implantation hole 15:1.4 ~ 1.8, it should also include 1:1.4 or 1:
1.41 or 1:1.42 or 1:1.43 or 1:1.44 ... or 1:1.79 or 1:1.8.
The ratio of the volume of storage box 9 and the volume of inner space 7 is not limited only to 1/4 ~ 1/3, should also include 60/240 or 61/240
Or 62/240 or 63/240 or 64/240 ... or 79/240 or 80/240.
The prior art of routine techniques dawn known to those skilled in the art in the present embodiment, is not chatted in detail herein
State.
Embodiment of above is merely to illustrate the present invention, and not limitation of the present invention, the ordinary skill people of this area
Member, without departing from the spirit and scope of the present invention, it can also make a variety of changes and modification.Therefore, it is all equivalent
Technical scheme fall within scope of the invention, scope of patent protection of the invention should be defined by the claims.
Sequence table
<110>Lanxi City Bai Ruike science services Co., Ltd
<120>The planting unit of adjustable implantation hole size
<160> 1
<170> SIPOSequenceListing 1.0
<210> 1
<211> 51
<212> PRT
<213>Trachyostracous mussel (Mytilus coruscus)
<400> 1
His Ser His Ala Cys Ala Ser Tyr Tyr Cys Ser Lys Ser His Ala Cys
1 5 10 15
Lys Thr Ala Cys Lys Phe Cys Gly Thr Ala Ser Cys Thr His Leu Ser
20 25 30
Cys Thr Cys Arg Val Leu His Pro Gly Lys Leu Cys Ala Cys Val Asn
35 40 45
Cys Ser Arg
50
Claims (7)
1. the planting unit of adjustable implantation hole size, including shell（1）With by shell（1）The inner space of formation（7）, it is special
Sign is, the shell（1）Antetheca upper end is transparent material, the inner space（7）Upper end is provided with spraying mechanism（2）, it is described
Inner space（7）Rear is provided with control module（3）, the inner space（7）Lower end is provided with dividing plate（8）, the dividing plate（8）Lower end
Provided with storage box（9）, the shell（1）Left and right sides outer wall upper end is provided with hook（4）, lower end be provided with roll-over table（12）.
2. the planting unit of adjustable implantation hole size according to claim 1, it is characterised in that the dividing plate（8）Table
Face is provided with implantation hole（15）, the implantation hole（15）Outward flange is equipped with four grooves（19）, the implantation hole（15）By groove
（19）The each region being separated to form is equipped with moving block（16）, the moving block（16）Between the splicing groove that is formed（17）With it is recessed
Groove（19）It is corresponding, the moving block（16）Rear is provided with support column（18）.
3. the planting unit of adjustable implantation hole size according to claim 2, it is characterised in that the moving block（16）
For sector structure, the moving block（16）Front end is connected with sponge（20）, the sponge（20）Front end is provided with sponge projection（21）.
4. the planting unit of adjustable implantation hole size according to claim 2, it is characterised in that the moving block（16）
Width L1 and implantation hole（15）Radius r1 ratios are 1:1.4 ~ 1.8, the groove（19）For triangular pyramids.
5. the planting unit of adjustable implantation hole size according to claim 1, it is characterised in that the dividing plate（8）Table
Face is coated with erosion shield, and the composition and its parts by weight of the erosion shield are：Modified 28 ~ 32 parts of boron phenolic polymer,
Nano combined 0.11 ~ 0.18 part of liquid, 6 ~ 10 parts of carbon fiber of enhancing, 17 ~ 22 parts of rutile type titanium white, silicon carbide ceramics powder 5 ~ 8
Part, 3 ~ 6 parts of nickel-base alloy powder.
6. the planting unit of adjustable implantation hole size according to claim 1, it is characterised in that the storage box（9）
Preceding outer wall both sides are provided with handle（10）, the storage box（9）Observation window is provided with the middle part of preceding outer wall（11）, the storage box（9）It is logical
Cross aqueduct（13）It is connected with storage tank（14）, the storage tank（14）It is arranged at outdoor, the storage box（9）Volume is inside
Space（7）The 1/4 ~ 1/3 of volume.
7. the planting unit of adjustable implantation hole size according to claim 1, it is characterised in that the inner space
（7）Left side, which is provided with, plays mechanism（5）With recording mechanism（6）.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710773331.2A CN107624639A (en) | 2017-08-31 | 2017-08-31 | The planting unit of adjustable implantation hole size |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710773331.2A CN107624639A (en) | 2017-08-31 | 2017-08-31 | The planting unit of adjustable implantation hole size |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107624639A true CN107624639A (en) | 2018-01-26 |
Family
ID=61101779
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710773331.2A Pending CN107624639A (en) | 2017-08-31 | 2017-08-31 | The planting unit of adjustable implantation hole size |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107624639A (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114830939A (en) * | 2022-04-07 | 2022-08-02 | 安徽水利生态环境建设有限公司 | Emergent aquatic plant planting utensil made of degradable material |
Citations (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JPS63269919A (en) * | 1987-04-28 | 1988-11-08 | Kubota Ltd | Working machine for paddy field |
| CN2444414Y (en) * | 2000-10-01 | 2001-08-29 | 深圳市威瑞达商贸有限公司 | No-soil sponge cultivation device for plant |
| JP2004344143A (en) * | 2003-05-26 | 2004-12-09 | Muramoto Shisan Kanri:Kk | Roof tree-planting device |
| CN101805554A (en) * | 2009-02-16 | 2010-08-18 | 中国科学院金属研究所 | Boron phenolics-titanium nano composite temperature and pressure resistant heavy anti-corrosive coating and preparation method thereof |
| CN201995418U (en) * | 2010-12-22 | 2011-10-05 | 王俊芹 | Soilless culture device |
| CN203613030U (en) * | 2013-11-08 | 2014-05-28 | 江苏美尚生态景观股份有限公司 | Wet type ecological floating bed unit body for hydro-fluctuation belt ecological revetment |
| CN104186298A (en) * | 2014-08-26 | 2014-12-10 | 江苏仓海工业设计有限公司 | Indoor planting device |
| CN204733719U (en) * | 2015-07-10 | 2015-11-04 | 中国农业科学院兰州畜牧与兽药研究所 | Vegetation board |
-
2017
- 2017-08-31 CN CN201710773331.2A patent/CN107624639A/en active Pending
Patent Citations (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JPS63269919A (en) * | 1987-04-28 | 1988-11-08 | Kubota Ltd | Working machine for paddy field |
| CN2444414Y (en) * | 2000-10-01 | 2001-08-29 | 深圳市威瑞达商贸有限公司 | No-soil sponge cultivation device for plant |
| JP2004344143A (en) * | 2003-05-26 | 2004-12-09 | Muramoto Shisan Kanri:Kk | Roof tree-planting device |
| CN101805554A (en) * | 2009-02-16 | 2010-08-18 | 中国科学院金属研究所 | Boron phenolics-titanium nano composite temperature and pressure resistant heavy anti-corrosive coating and preparation method thereof |
| CN201995418U (en) * | 2010-12-22 | 2011-10-05 | 王俊芹 | Soilless culture device |
| CN203613030U (en) * | 2013-11-08 | 2014-05-28 | 江苏美尚生态景观股份有限公司 | Wet type ecological floating bed unit body for hydro-fluctuation belt ecological revetment |
| CN104186298A (en) * | 2014-08-26 | 2014-12-10 | 江苏仓海工业设计有限公司 | Indoor planting device |
| CN204733719U (en) * | 2015-07-10 | 2015-11-04 | 中国农业科学院兰州畜牧与兽药研究所 | Vegetation board |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114830939A (en) * | 2022-04-07 | 2022-08-02 | 安徽水利生态环境建设有限公司 | Emergent aquatic plant planting utensil made of degradable material |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN106142268B (en) | A kind of method that utilization Leaves of Dendrocalamus Latiflorus processes rice-pudding leaf | |
| CN205648795U (en) | All -round pesticide sprinkler in gardens | |
| CN108668658A (en) | A kind of Damask Rose cuttage and seedling culture method | |
| CN101829025A (en) | Bioactive facial mask and preparation method therefore | |
| CN109169231A (en) | A kind of aeroponic method of romaine lettuce | |
| CN108411326A (en) | A kind of nano bubble electrolyzed water machine | |
| CN107624639A (en) | The planting unit of adjustable implantation hole size | |
| CN207692526U (en) | A kind of gardens device for raising seedlings | |
| CN108901492B (en) | Nursery stock artificial containers with temperature regulation function | |
| CN107517779A (en) | Indoor planting equipment based on water circulation system | |
| CN108633725A (en) | A kind of water planting field planting basket and the three-dimensional water planting field planting equipment using it | |
| CN107624638A (en) | Multifunctional room implants planting unit | |
| CN110352737A (en) | A kind of breeding apparatus of High aititude gold and silver grass | |
| CN104221678B (en) | A kind of method improving Hua Shallot seed seedling-raising survival rate | |
| CN217608627U (en) | Adjustable farming frame for farming | |
| CN201917029U (en) | Ultrasonic wave humidifier | |
| CN107567885A (en) | Planting equipment with water storage case | |
| CN107581068B (en) | A kind of method removing single-shaft orchid endophyte and the application in vanilla tissue-culturing quick-propagation | |
| CN107114222A (en) | A kind of maintenance process of ecology water-culture flowers | |
| CN208972185U (en) | A kind of mushroom classification inoculation apparatus | |
| CN103816569B (en) | The method of the implant medical material of a kind of gas phase Ag nano particle processing | |
| CN209824570U (en) | Three-dimensional cultivation device of dendrobii officmalis caulis | |
| CN207948460U (en) | A kind of Multifunction mist training humidification integrated device | |
| CN108935038A (en) | A kind of maintenance process of hydroponic flowers | |
| CN214126315U (en) | Three-dimensional cultivation room for mushroom cultivation |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| RJ01 | Rejection of invention patent application after publication | ||
| RJ01 | Rejection of invention patent application after publication |
Application publication date: 20180126 |