CN107434195A - A kind of protection system for preventing safety door chain rupture - Google Patents
A kind of protection system for preventing safety door chain rupture Download PDFInfo
- Publication number
- CN107434195A CN107434195A CN201710585641.1A CN201710585641A CN107434195A CN 107434195 A CN107434195 A CN 107434195A CN 201710585641 A CN201710585641 A CN 201710585641A CN 107434195 A CN107434195 A CN 107434195A
- Authority
- CN
- China
- Prior art keywords
- cage
- chain
- parts
- pressing plate
- cross bar
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B66—HOISTING; LIFTING; HAULING
- B66B—ELEVATORS; ESCALATORS OR MOVING WALKWAYS
- B66B5/00—Applications of checking, fault-correcting, or safety devices in elevators
- B66B5/02—Applications of checking, fault-correcting, or safety devices in elevators responsive to abnormal operating conditions
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B66—HOISTING; LIFTING; HAULING
- B66B—ELEVATORS; ESCALATORS OR MOVING WALKWAYS
- B66B13/00—Doors, gates, or other apparatus controlling access to, or exit from, cages or lift well landings
- B66B13/02—Door or gate operation
- B66B13/06—Door or gate operation of sliding doors
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B66—HOISTING; LIFTING; HAULING
- B66B—ELEVATORS; ESCALATORS OR MOVING WALKWAYS
- B66B13/00—Doors, gates, or other apparatus controlling access to, or exit from, cages or lift well landings
- B66B13/02—Door or gate operation
- B66B13/14—Control systems or devices
- B66B13/143—Control systems or devices electrical
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B66—HOISTING; LIFTING; HAULING
- B66B—ELEVATORS; ESCALATORS OR MOVING WALKWAYS
- B66B13/00—Doors, gates, or other apparatus controlling access to, or exit from, cages or lift well landings
- B66B13/30—Constructional features of doors or gates
Landscapes
- Engineering & Computer Science (AREA)
- Automation & Control Theory (AREA)
- Power-Operated Mechanisms For Wings (AREA)
Abstract
The present invention discloses a kind of protection system for preventing safety door chain rupture, including cage, it is connected to the column of cage both sides, the cross bar being connected with column, cage lateral wall is provided with slide rail, gravity slide ball is set in slide rail, the top in mine where cage, bottom is provided with the pressing plate coordinated with gravity slide ball, pressing plate is connected by fagging with cylinder, gravity slide ball side is connected with chain, chain is penetrated in cage by the roller of cage side and is connected vertically downward with the rolling wheel in the middle part of rotating shaft with after the cooperation of the drive on cage top, rotating shaft is placed in cage inwall upper end by the bearing of cage both sides, chain is mounted with the rolling wheel of rotating shaft both sides, cross bar is evenly equipped with chain, cross bar both sides are connected with column, the present invention uses solenoid electric valve as main controlling element, rolling wheel motion is driven using cylinder, realize tank curtain automatic lifting；In chain surface spraying wear-resistant coating, the abrasion resistant effect and intensity on chain surface are improved, avoids the occurrence of the security incidents such as tank curtain fracture.
Description
Technical field
The present invention relates to cage security technology area, more particularly to a kind of protection system for preventing safety door chain rupture.
Background technology
In mine operation, through frequently with cage device as transporting equipment, wherein, the safety door in cage device is general
Including vertical rod and cross bar, cross bar can move along vertical rod, realize the closure or openness of safety door, be come in and gone out with facilitating.However, existing
Have in technology, the safety door in cage is typically all the problem of prior art is present using slide block type, scissor safety door
It is that, use is not convenient enough in cross bar moving process up and down not freely；In addition, complicated, dismounting is inconvenient, the difficulty of maintenance
Also it is bigger, and chain serves as key player in safety door, and if chain breakage, the security of safety door substantially reduces, tank
The security of personnel or article of the cage in lifting process to transport can not ensure, need the intensity and security of lifting chain.
Prior art, such as Chinese invention granted patent document, the B of Authorization Notice No. CN 105060086, the invention is related to one
Kind auxiliary shaft cage tank curtain automatic lifting controller.Existing tank curtain apparatus for controlling of lifting unlatching is slow, energy consumption is big, fragile, cost
It is high, dangerous.Therefore, the auxiliary shaft cage tank curtain automatic lifting controller includes cage and tank curtain, tank door, institute are provided with cage
State and spool is provided with cage, slide rail is additionally provided with the outside of cage, the slide rail is provided with a gravity slide ball, the auxiliary shaft top, bottom
Cylinder is respectively equipped with, cylinder includes cylinder body and piston rod, and the cylinder is inverted, fixed at the top of its cylinder body, and piston-rod lower end is provided with one
Lymphogranuloma inguinale, a lymphogranuloma inguinale pressing plate being hinged with the lymphogranuloma inguinale, the lymphogranuloma inguinale side is provided with fagging, and cylinder body lower end is provided with a steering channel-section steel,
Stretched under piston rod, lymphogranuloma inguinale pressing plate keep level, the long side pressure of lymphogranuloma inguinale pressing plate is moved tank curtain on gravity slide ball, by master file rope band and rolled up
Rise, when piston rod bounces back, the lymphogranuloma inguinale pressing plate switchs to straight down, does not influence cage lifting.It is adapted to various colliery auxiliary shafts to use,
But the tank curtain on the safety door of the device can not be fixed, tank curtain can not play protective action in cage lifting process, safety
Property it is not high, and folding and unfolding is carried out to tank door by serving, the wearability on serving surface is not high to be easily caused serving fracture, is unfavorable for tank
The security of door.
The content of the invention
It is an object of the invention to provide a kind of protection system for preventing safety door chain rupture, and safety is lifted by wear-resistant coating
The chain wearability and intensity of door, safety door are provided with retaining mechanism, and safety door protection effect is good, chain uniform force, not rapid wear
Bad or fracture.
The technical scheme taken to achieve the above object of the present invention is：A kind of protection system for preventing safety door chain rupture,
Including cage, the column of cage both sides is connected to, the cross bar being connected with column is provided with slide rail in the middle part of cage lateral wall, in slide rail
L-shaped gravity slide ball is mounted with, the top in mine, bottom where cage are provided with the pressing plate coordinated with gravity slide ball, and pressing plate leads to
Cross fagging to be connected with piston rod, piston rod is connected with inverted cylinder, and pressing plate is right-angled trapezium, and the inclined edge surfaces of pressing plate are provided with length
Plate, long slab can contact with gravity slide ball, and gravity slide ball side is connected with chain, and chain penetrates cage by the roller of cage side
The interior drive with the installation of cage top is connected with the rolling wheel in the middle part of rotating shaft vertically downward after coordinating, and rotating shaft is mounted with three volumes
Wheel, rotating shaft is placed in cage inwall upper end by the bearing of cage both sides, is mounted with chain on the rolling wheel of rotating shaft both sides, on chain
Cross bar is evenly equipped with, cross bar both sides are provided with annulus, and annulus upper and lower surface is provided with dust ring, and annulus and the column gap of cage both sides connect
Connect, column is provided with scrobicular ring with cage bottom junctions, and through hole is provided with scrobicular ring, telescopic block is mounted with through hole, telescopic block is with standing
Electromagnet in column bottom coordinates, and be hemispherical at the top of telescopic block, and leg surface is provided with the annulus with telescopic block cooperation, in annulus
Provided with spherical corresponding scrobicular ring at the top of telescopic block, spring is provided with below the connecting plate below drive that cage top is installed,
Spring is connected with first cross bar below rotating shaft.
The present invention, as main controlling element, is driven rolling wheel motion using cylinder, realizes tank using advanced solenoid electric valve
Curtain automatic lifting, fault rate is low, is easy to safeguard, failure easy-to-search, reduces the labor intensity of maintenance personal and cager.Realize
Cage in place after, the automatic lifting/lowering support of cage tank curtain, the automatic closure of tank curtain bottom blocking device.The arrangement achieves cage tank
The automatic lifting of curtain, tank curtain door are realized with cage stop position, safety door, cage chair, promotion signal and interlocked；Cage in place, is not pacified
Air cock can not be opened, and fail to lay down cage chair, and tank curtain can not automatic lifting.Pneumatic actuator cylinder improves safety fortune as power source
In the row cycle, economize on resources, column be set in cage both sides, realizes that cross bar moves up and down along column, and be provided with column lower end
Electromagnet and telescopic block realize the security of cage tank door in lifting process.
Preferably, the becket abutting edge in chain is provided with fixed ring flat-plate, chain surface is provided with wear-resistant coating, wear-resisting painting
Layer is made up of following component and parts by weight：Firebrake ZB phenol-formaldehyde resin modified 17-38 parts, silicone modified polyester resin 16-21 parts,
Silicon dioxide gel 8-11 parts, sodium carboxymethylcellulose 2-5 parts, toluene 13-17 parts, ethylbenzene 5-20 parts, graphite powder 5-10 parts, ten
Trifluoro octyltri-ethoxysilane 0.7-0.8 parts, paraxylene 10-15 parts, trimethylhexamethylenediamine 0.1-0.35 parts, vinegar
Acetoacetic ester 7-12 parts, antiseptic 0.05-0.12 parts, 2- (2- ethyl-butoxies) ethanol 5-8 parts, isopropanol 3-7 parts, trimethyl six
The bending strength of methylene diamine is 1140-1160kg/cm2, and the weight ratio of silicone modified polyester resin and isopropanol is 3-
6：1.Becket abutting edge in chain sets fixed ring flat-plate to prevent becket from separating and then prevents chain breakage, by
After chain surface spraying wear-resistant coating and drying, the abrasion resistant effect and intensity on chain surface are remarkably improved, it is grown in cage
The abrasion of chain and cross bar is lacked during phase use, efficiency high, avoids the occurrence of the security incidents such as tank curtain fracture, organic by controlling
The weight of silicon-modified polyester resin and isopropanol with the bending strength of trimethylhexamethylenediamine than being remarkably improved wear-resisting painting
The bond effect and stability of layer, the effective time of coating is set to be up to more than 20 years, and coating is not easy to crack, impulse-durability effect
It is good, the abrasion resistant effect of coating can be improved by adding trimethylhexamethylenediamine and tridecafluoro-n-octyltriethoxysilane, is increased
The surface strength and hardness of strong coating, this wear-resistant coating also have excellent antifouling, antibacterial, water resistance.
Preferably, the antiseptic in wear-resistant coating formula is functional activity polypeptide, the amino acid sequence of functional activity polypeptide
QSGFCTSYYCSKFCGTGCSYGCYTPGKICYCLHCSS is classified as, the active peptides can form one layer in wear-resistant coating bottom surface and resist
Mycoderm, active peptides can obstructed cell membrane, directly act on DNA in kytoplasm, with DNA of bacteria double helix groove contact, pass through
To bacterium intracellular enzymatic structure, function and to bacterium intracellular signal transduction, the transcription of bacterial cell outer membrane protein is disturbed, suppresses bacterium
Growth, avoid the bacterium in mine from being attached to chain surface and cause corrosion to accelerate chain extent of corrosion to chain, can also lift chain
The health on bar surface.
Preferably, being provided with L-shaped balancing weight below pressing plate right angle end, balancing weight weight is the 1/5 ~ 2/5 of pressing plate weight, is led to
Crossing the balancing weight being provided with makes pressing plate be in poised state, when needing to be adjusted, starts the solenoid valve block that cylinder is connected with, presses
It is dynamic to release the button, the stretching, extension of solenoid valve block manipulating cylinder, stretch under piston rod, pressing plate short end is affected by gravity sinking, long end upwarp by
The fagging limitation, makes pressing plate keep level, piston rod be stretched under continuing, the long side pressure of pressing plate passes through chain on gravity slide ball
Cross bar is driven to roll tank curtain；Before cage declines, adapted safety door is first closed, normally opened proximity switch resets, and passes through solenoid valve block
Piston rod retraction is controlled, when piston rod bounces back, the short end of pressing plate is risen up into the steering channel-section steel, and its long end is turned by breach opposite
To compressing for channel-section steel wall, switch to straight down, do not influence cage lifting.
Preferably, circle diameter is the 1/4 ~ 1/3 of cross bar diameter in chain, by controlling circle diameter in chain to keep away
Exempt from that chain is meticulous or efficiency that slightly the tank curtain of safety door is rolled and put down excessively influences, and chain circle diameter determines safety
The security of door tank curtain.
Compared with prior art, beneficial effects of the present invention are：1）The present invention is using advanced solenoid electric valve as master
Control element, rolling wheel motion being driven using cylinder, realizes tank curtain automatic lifting, fault rate is low, is easy to safeguard, failure easy-to-search,
Reduce the labor intensity of maintenance personal and cager；2）Column is set in cage both sides, realizes that cross bar moves down along column
It is dynamic, and it is provided with electromagnet in column lower end and telescopic block realizes the security of cage tank door in lifting process；3）By
After chain surface spraying wear-resistant coating and drying, the abrasion resistant effect and intensity on chain surface are remarkably improved, it is grown in cage
The abrasion of chain and cross bar is lacked during phase use, efficiency high, avoids the occurrence of the security incidents such as tank curtain fracture；4）Cage tank is showed
The automatic lifting of curtain, tank curtain door are realized with cage stop position, safety door, cage chair, promotion signal and interlocked；Cage in place, is not pacified
Air cock can not be opened, and fail to lay down cage chair, and tank curtain can not automatic lifting.
Brief description of the drawings
Fig. 1 is a kind of protection system schematic for preventing safety door chain rupture of the present invention；
Fig. 2 is cylinder of the present invention, pressing plate, turns to channel-section steel in extended configuration structural representation；
Fig. 3 is cylinder of the present invention, pressing plate, turns to channel-section steel in contraction state structural representation；
Fig. 4 is column bottom of the present invention and telescopic block, the connection diagram of electromagnet；
Fig. 5 is the annulus schematic diagram coordinated with the telescopic block in Fig. 4；
Fig. 6 is the m portions partial enlarged drawing in Fig. 1；
Fig. 7 is the elementary diagram of the present invention.
Description of reference numerals：1 cage；2 springs；3 rotating shafts；4 rolling wheels；5 bearings；6 chains；7 columns；701 electromagnet；702
Telescopic block；8 annulus；801 dust rings；9 cylinders；901 cylinder bodies；902 turn to steel tank；10 piston rods；11 pressing plates；12 gravity slide balls；
13 slide rails；14 solenoid valve blocks；15 faggings；16 balancing weights；17 cross bars；18 drives.
Embodiment
It is described in further detail with reference to embodiments with accompanying drawing：
Embodiment 1：
As shown in figs. 1-7, a kind of protection system for preventing safety door chain rupture, including cage 1, it is connected to the column of the both sides of cage 1
7, the cross bar 17 being connected with column 7, the lateral wall of cage 1 middle part is provided with slide rail 13, and L-shaped gravity slide ball 12 is mounted with slide rail 13,
The top in mine, bottom where cage 1 are provided with the pressing plate 11 coordinated with gravity slide ball 12, and pressing plate 11 is by fagging 15 with living
Stopper rod 10 is connected, and piston rod 10 is connected with inverted cylinder 9, and pressing plate 11 is right-angled trapezium, and the inclined edge surfaces of pressing plate 11 are provided with long slab,
Long slab can be contacted with gravity slide ball 12, and the side of gravity slide ball 12 is connected with chain 6, and chain 6 is penetrated by the roller of the side of cage 1
Rolling wheel 4 after coordinating in cage 1 with the drive 18 of the top of cage 1 installation vertically downward with the middle part of rotating shaft 3 is connected, and rotating shaft 3 is pacified
It is equipped with three rolling wheels 4, rotating shaft 3 is placed in the inwall upper end of cage 1 by the bearing 5 of the both sides of cage 1, on the rolling wheel 4 of the both sides of rotating shaft 3
Chain 6 is mounted with, cross bar 3 is evenly equipped with chain 6, circle diameter is the 1/3 of the diameter of cross bar 17 in chain 6, and the both sides of cross bar 3 are provided with
Annulus 8, the upper and lower surface of annulus 8 are provided with dust ring 801, and annulus 8 is connected with the gap of column 7 of the both sides of cage 1, column 7 and cage 1
Bottom junctions are provided with scrobicular ring, and through hole is provided with scrobicular ring, and telescopic block 702, telescopic block 702 and the bottom of column 7 are mounted with through hole
Interior electromagnet 701 coordinates, and the top of telescopic block 702 is hemispherical, and the surface of column 7 is provided with the annulus 8 coordinated with telescopic block 702,
It is provided with annulus 8 and the spherical corresponding scrobicular ring in the top of telescopic block 702, the connecting plate of the lower section of drive 18 of the top of cage 1 installation
Lower section is provided with spring 2, and first cross bar 17 of spring 2 and the lower section of rotating shaft 3 is connected.L-shaped balancing weight is provided with below the right angle end of pressing plate 11
16, the weight of balancing weight 16 be the weight of pressing plate 11 1/5, by provided with balancing weight 16 pressing plate 11 be in poised state, when need
When being adjusted, start the solenoid valve block 14 that cylinder 9 is connected with, press and release the button, the manipulating cylinder 9 of solenoid valve block 14 is stretched
Open up, stretched under piston rod 10, the short end of pressing plate 11 is affected by gravity sinking, and long end upwarps to be limited by the fagging 15, protects 11 pressing plates
Water holding is put down, and piston rod 10 is stretched under continuing, and the long side pressure of pressing plate 11 drives cross bar 17 by tank on gravity slide ball 12, by chain 6
Curtain is rolled；Before cage 1 declines, adapted safety door is first closed, normally opened proximity switch is resetted, and piston rod is controlled by solenoid valve block 14
10 retractions, when piston rod 10 bounces back, the short end of the pressing plate 11 is risen up into the steering channel-section steel, and its long end is turned by breach opposite
To compressing for channel-section steel wall, switch to straight down, do not influence cage 1 and lift.
The present invention, as main controlling element, is driven rolling wheel motion using cylinder, realizes tank using advanced solenoid electric valve
Curtain automatic lifting, fault rate is low, is easy to safeguard, failure easy-to-search, reduces the labor intensity of maintenance personal and cager.Realize
Cage in place after, the automatic lifting/lowering support of cage tank curtain, the automatic closure of tank curtain bottom blocking device.The arrangement achieves cage tank
The automatic lifting of curtain, tank curtain door are realized with cage stop position, safety door, cage chair, promotion signal and interlocked；Cage in place, is not pacified
Air cock can not be opened, and fail to lay down cage chair, and tank curtain can not automatic lifting.Pneumatic actuator cylinder improves safety fortune as power source
In the row cycle, economize on resources, column 7 be set in the both sides of cage 1, realizes that cross bar 3 moves up and down along column 7, and under column 7
The security of the tank door in lifting process of cage 1 is realized provided with electromagnet 701 and telescopic block 702 in end.
Becket abutting edge in chain 6 is provided with fixed ring flat-plate, and the surface of chain 6 is provided with wear-resistant coating, wear-resistant coating by with
Lower composition and preferred weight part composition：23 parts of Firebrake ZB phenol-formaldehyde resin modified, 18 parts of silicone modified polyester resin, silica
9 parts of colloidal sol, 4 parts of sodium carboxymethylcellulose, 15 parts of toluene, 14 parts of ethylbenzene, 8 parts of graphite powder, tridecafluoro-n-octyltriethoxysilane
0.75 part, 12 parts of paraxylene, 0.2 part of trimethylhexamethylenediamine, 10 parts of ethyl acetate, 0.07 part of antiseptic, 2- (2- second
Base butoxy) 7 parts of ethanol, 3 parts of isopropanol, the bending strength of trimethylhexamethylenediamine is 1150kg/cm2, and organosilicon changes
Property polyester resin and isopropanol weight ratio be 6：1.Antiseptic in wear-resistant coating formula is functional activity polypeptide, functional activity
The amino acid sequence of polypeptide is QSGFCTSYYCSKFCGTGCSYGCYTPGKICYCLHCSS, and the active peptides can be in wear-resistant coating
Bottom surface forms one layer of antibacterial film, active peptides can obstructed cell membrane, DNA in kytoplasm is directly acted on, with the double spiral shells of DNA of bacteria
Groove contact is revolved, by bacterium intracellular enzymatic structure, function and to bacterium intracellular signal transduction, disturbing bacterial cell outer membrane protein
Transcription, bacteria growing inhibiting, avoid the bacterium in mine be attached to the surface of chain 6 to chain cause corrosion accelerate chain corrosion
Degree, can also the surface of lifting chain 6 health.Becket abutting edge in chain 6 sets fixed ring flat-plate to prevent becket
Separate and then prevent chain 6 to be broken, by after the surface spraying wear-resistant coating of chain 6 and drying, being remarkably improved the surface of chain 6
Abrasion resistant effect and intensity, lack the abrasion of its chain 6 and cross bar 17 during the long-term use of cage 1, efficiency high, avoid out
The security incidents such as existing tank curtain fracture, by the weight ratio and the methylene of trimethyl six that control silicone modified polyester resin and isopropanol
The bending strength of base diamines is remarkably improved the bond effect and stability of wear-resistant coating, the effective time of coating is up to 20 years
More than, and coating is not easy to crack, and impulse-durability effect is good, by adding trimethylhexamethylenediamine and the second of ten trifluoro octyl group three
TMOS can improve the abrasion resistant effect of coating, strengthen the surface strength and hardness of coating, and this wear-resistant coating also has excellent
Antifouling, antibacterial, water resistance.
Embodiment 2：
As shown in figs. 1-7, during cage real work of the invention：When safety door is opened, normally opened proximity switch SB1 triggerings closure,
The QA1 that releases the button now is pressed, the manipulating cylinder 9 of solenoid valve block 14 stretches, stretched under piston rod 10, the short end of pressing plate 11 is by balancing weight 16
Gravity influence sink, long end upwarps to be limited by fagging 15, makes the keep level of pressing plate 11, and piston rod 10 is stretched under continuing, pressing plate 11
Long side pressure on gravity slide ball 12, by chain 6 drive rolling wheel 4 cross bar 17 is scrolled up along column 7, cross bar 17 and column
7 junctions are provided with annulus 8, and the upper and lower surface of annulus 8 is provided with dust ring 801, can prevent dust or slag from falling into influence tank in annulus
The folding and unfolding of curtain, the spring 2 being provided with below the connecting plate of the lower section of drive 18 of the top of cage 1 installation, spring 2 and the lower section of rotating shaft 3
First cross bar 17 connects, and rolls cross bar 17 to chain 6 and plays certain booster action, avoids chain 6 from being broken, and completes the receipts of tank curtain
Hold together, before cage 1 declines, first close adapted safety door, normally opened proximity switch SB1 is resetted, and piston rod is controlled by solenoid valve block 14
10 retractions, when piston rod 10 bounces back, the short end of pressing plate 11, which rises up into, to be turned in channel-section steel 902, steering groove of its long end by breach opposite
The wall of steel 902 compresses, and switchs to straight down, does not influence cage 1 and lifts, between normally opened proximity switch SB1 and the QA1 that releases the button also
A buzzer siren or phonetic alarm can be concatenated, tank curtain lifting process sends language alarm signal, added on personnel
Reliability, the security of lower cage, after tank curtain is put down, the lowermost end of column 17 is provided with having scrobicular ring at annulus cooperation in scrobicular ring
Through hole, telescopic block 702 is mounted with through hole, telescopic block 702 coordinates with the electromagnet 701 in the bottom of column 7, and telescopic block 702 is pushed up
Portion is hemispherical, and the surface of column 7 is provided with the annulus 8 coordinated with telescopic block 702, is provided with annulus 8 spherical with the top of telescopic block 702
Corresponding scrobicular ring, control telescopic block 802 to coordinate realization to fix tank curtain with the scrobicular ring in annulus by electromagnet 701, ensure tank
Cage 1 in well lifting process to personnel or the safety of article.
The weight of balancing weight 16 is not limited only to the 1/5 ~ 2/5 of the weight of pressing plate 11, can also be 20/100 or 21/100 or 22/
100 or 23/100 ... 39/100 or 40/100；Circle diameter is not limited only to the 1/4 ~ 1/3 of the diameter of cross bar 17 in chain 6, may be used also
39/120 or 40/120 to be 30/120 or 31/120 or 32/120 or 33/120 ....
The prior art of routine techniques dawn known to those skilled in the art in above-described embodiment, such as the peace of cylinder 9
The prior arts such as dress, the installation of cage 1, therefore in this not go into detail.
Embodiment of above is merely to illustrate the present invention, and not limitation of the present invention, the ordinary skill people of this area
Member, without departing from the spirit and scope of the present invention, it can also make a variety of changes and modification.Therefore, it is all equivalent
Technical scheme fall within scope of the invention, scope of patent protection of the invention should be defined by the claims.
SEQUENCE LISTING
<110>Sea salt sends Mortopl Science and Technology Ltd.
<120>A kind of protection system for preventing safety door chain rupture
<130> 1
<160> 1
<170> PatentIn version 3.5
<210> 1
<211> 36
<212> PRT
<213>It is artificial synthesized
<400> 1
Gln Ser Gly Phe Cys Thr Ser Tyr Tyr Cys Ser Lys Phe Cys Gly Thr
1 5 10 15
Gly Cys Ser Tyr Gly Cys Tyr Thr Pro Gly Lys Ile Cys Tyr Cys Leu
20 25 30
His Cys Ser Ser
35
Claims (4)
1. a kind of protection system for preventing safety door chain rupture, including cage（1）, it is connected to cage（1）The column of both sides（7）, with
Column（7）The cross bar of connection（17）, it is characterised in that：The cage（1）Slide rail is provided with the middle part of lateral wall（13）, the slide rail
（13）Inside it is mounted with L-shaped gravity slide ball（12）, the cage（1）Top, bottom in the mine at place are provided with and gravity slide ball
（12）The pressing plate of cooperation（11）, the pressing plate（11）Pass through fagging（15）With piston rod（10）Connection, the piston rod（10）With
Inverted cylinder（9）Connection, the pressing plate（11）For right-angled trapezium, pressing plate（11）Inclined edge surfaces be provided with long slab, the long slab can
With gravity slide ball（12）Contact, the gravity slide ball（12）Side is connected with chain（6）, the chain（6）Pass through cage（1）Side
The roller in face penetrates cage（1）Interior and cage（1）The drive of top installation（18）After cooperation vertically downward with rotating shaft（3）Middle part
Rolling wheel（4）Connection, the rotating shaft（3）It is mounted with three rolling wheels（4）, the rotating shaft（3）Pass through cage（1）The bearing of both sides
（5）It is placed in cage（1）Inwall upper end, the rotating shaft（3）The rolling wheel of both sides（4）On be mounted with chain（6）, the chain（6）
On be evenly equipped with cross bar（3）, the cross bar（3）Both sides are provided with annulus（8）, the annulus（8）Upper and lower surface is provided with dust ring
（801）, the annulus（8）With cage（1）The column of both sides（7）Gap connects, the column（7）With cage（1）Bottom connects
Place is provided with scrobicular ring, is provided with through hole in the scrobicular ring, telescopic block is mounted with the through hole（702）, the telescopic block（702）With standing
Post（7）Electromagnet in bottom（701）Coordinate, the telescopic block（702）Top is hemispherical, the column（7）Surface is provided with
With telescopic block（702）The annulus of cooperation（8）, annulus（8）Inside it is provided with and telescopic block（702）Scrobicular ring corresponding to top is spherical, it is described
Cage（1）The drive of top installation（18）Spring is provided with below the connecting plate of lower section（2）, the spring（2）With rotating shaft（3）Under
First cross bar in side（17）Connection.
A kind of 2. protection system for preventing safety door chain rupture according to claim 1, it is characterised in that：The chain（6）
In becket abutting edge be provided with fixed ring flat-plate, the chain（6）Surface is provided with wear-resistant coating, the wear-resistant coating by below into
Divide and parts by weight form：Firebrake ZB phenol-formaldehyde resin modified 17-38 parts, silicone modified polyester resin 16-21 parts, silica are molten
Glue 8-11 parts, sodium carboxymethylcellulose 2-5 parts, toluene 13-17 parts, ethylbenzene 5-20 parts, graphite powder 5-10 parts, ten trifluoro octyl groups three
Ethoxysilane 0.7-0.8 parts, paraxylene 10-15 parts, trimethylhexamethylenediamine 0.1-0.35 parts, ethyl acetate 7-12
Part, antiseptic 0.05-0.12 parts, 2- (2- ethyl-butoxies) ethanol 5-8 parts, isopropanol 3-7 parts, the tri-methyl hexamethylene
The bending strength of diamines is 1140-1160kg/cm2, and the weight ratio of silicone modified polyester resin and isopropanol is 3-6：1.
A kind of 3. protection system for preventing safety door chain rupture according to claim 1, it is characterised in that：The pressing plate（11）
L-shaped balancing weight is provided with below right angle end（16）, the balancing weight（16）Weight is pressing plate（11）The 1/5 ~ 2/5 of weight.
A kind of 4. protection system for preventing safety door chain rupture according to claim 1, it is characterised in that：The chain（6）
Middle circle diameter is cross bar（17）The 1/4 ~ 1/3 of diameter.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710585641.1A CN107434195A (en) | 2017-07-18 | 2017-07-18 | A kind of protection system for preventing safety door chain rupture |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710585641.1A CN107434195A (en) | 2017-07-18 | 2017-07-18 | A kind of protection system for preventing safety door chain rupture |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107434195A true CN107434195A (en) | 2017-12-05 |
Family
ID=60460855
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710585641.1A Pending CN107434195A (en) | 2017-07-18 | 2017-07-18 | A kind of protection system for preventing safety door chain rupture |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107434195A (en) |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB190816400A (en) * | 1908-08-04 | 1909-07-08 | John Botterill | Improvements in and connected with Gates for Pit Cages, Lifts and Lift Openings. |
| CN2119504U (en) * | 1992-03-30 | 1992-10-21 | 淮南矿务局谢家集一矿 | Cage |
| CN2250937Y (en) * | 1996-02-17 | 1997-04-02 | 沙新民 | Safety curtain linkage device for safety door cage of mine well head |
| CN201305395Y (en) * | 2008-12-17 | 2009-09-09 | 安阳大众煤业有限责任公司 | Anti-collision magnet switch of a cage door |
| CN105060086A (en) * | 2015-08-13 | 2015-11-18 | 兖州煤业股份有限公司 | Automatic lifting control device for cage curtain of auxiliary shaft cage |
| CN105400372A (en) * | 2015-12-16 | 2016-03-16 | 襄阳市百盾防护涂层材料有限公司 | Wear-resistant coating material |
| CN105523454A (en) * | 2014-10-27 | 2016-04-27 | 山东华联矿业股份有限公司 | Cage curtain door protecting device |
-
2017
- 2017-07-18 CN CN201710585641.1A patent/CN107434195A/en active Pending
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB190816400A (en) * | 1908-08-04 | 1909-07-08 | John Botterill | Improvements in and connected with Gates for Pit Cages, Lifts and Lift Openings. |
| CN2119504U (en) * | 1992-03-30 | 1992-10-21 | 淮南矿务局谢家集一矿 | Cage |
| CN2250937Y (en) * | 1996-02-17 | 1997-04-02 | 沙新民 | Safety curtain linkage device for safety door cage of mine well head |
| CN201305395Y (en) * | 2008-12-17 | 2009-09-09 | 安阳大众煤业有限责任公司 | Anti-collision magnet switch of a cage door |
| CN105523454A (en) * | 2014-10-27 | 2016-04-27 | 山东华联矿业股份有限公司 | Cage curtain door protecting device |
| CN105060086A (en) * | 2015-08-13 | 2015-11-18 | 兖州煤业股份有限公司 | Automatic lifting control device for cage curtain of auxiliary shaft cage |
| CN105400372A (en) * | 2015-12-16 | 2016-03-16 | 襄阳市百盾防护涂层材料有限公司 | Wear-resistant coating material |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN205998100U (en) | A kind of automatic mooring gear of ship | |
| CN203806941U (en) | Hoisting overturning device of direct-drive wind power generator | |
| CN201890731U (en) | Crane | |
| CN107539888A (en) | Fluid pressure type low pressure shore connection cable lifting conveying long-distance monitorng device and its method of work | |
| CN107572350A (en) | A kind of inside has the lift car of buffer | |
| CN107434195A (en) | A kind of protection system for preventing safety door chain rupture | |
| CN204848017U (en) | Swing crane; derrick | |
| CN107673274B (en) | A kind of warehouse piler elevating mechanism | |
| CN207129823U (en) | A kind of horizontal two level telescopic spreader of cement pipe pile | |
| CN205675805U (en) | A kind of novel material stocking device | |
| CN110092315B (en) | Cargo lifting device with safety alarm function | |
| CN105060086B (en) | Auxiliary shaft cage tank curtain automatic lifting controller | |
| CN206857903U (en) | A kind of elevator pit overhauls protection device | |
| CN203676617U (en) | Inductive earthquake safety bed | |
| CN106081972A (en) | Electric block alarm device | |
| CN107575067A (en) | A kind of stereo garage elevator structure of wire rope pulley combination traction | |
| CN207393835U (en) | A kind of damping shock proof device for electric block | |
| CN107128799B (en) | One kind, which rises, reuses Automatic-clamping suspender | |
| CN206352032U (en) | A kind of goods lift | |
| CN206395778U (en) | A kind of three oil cylinder elevators | |
| CN202704841U (en) | Lifting tackle | |
| CN207046626U (en) | A kind of safety device of construction elevator | |
| CN209023975U (en) | Elevator spring damper | |
| CN207775997U (en) | A kind of antitheft improved structure of outdoor fire hydrant | |
| CN205823565U (en) | A kind of motor with star-like air valve |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| RJ01 | Rejection of invention patent application after publication |
Application publication date: 20171205 |
|
| RJ01 | Rejection of invention patent application after publication |