CN107211772A - Intelligent greenhouse external sunshade control device - Google Patents
Intelligent greenhouse external sunshade control device Download PDFInfo
- Publication number
- CN107211772A CN107211772A CN201710391860.6A CN201710391860A CN107211772A CN 107211772 A CN107211772 A CN 107211772A CN 201710391860 A CN201710391860 A CN 201710391860A CN 107211772 A CN107211772 A CN 107211772A
- Authority
- CN
- China
- Prior art keywords
- parts
- sunshading
- thermal insulating
- control device
- sunshade
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01G—HORTICULTURE; CULTIVATION OF VEGETABLES, FLOWERS, RICE, FRUIT, VINES, HOPS OR SEAWEED; FORESTRY; WATERING
- A01G9/00—Cultivation in receptacles, forcing-frames or greenhouses; Edging for beds, lawn or the like
- A01G9/22—Shades or blinds for greenhouses, or the like
- A01G9/227—Shades or blinds for greenhouses, or the like rolled up during non-use
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A40/00—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production
- Y02A40/10—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production in agriculture
- Y02A40/25—Greenhouse technology, e.g. cooling systems therefor
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Environmental Sciences (AREA)
- Greenhouses (AREA)
Abstract
The present invention provides intelligent greenhouse external sunshade control device, including supporting mechanism, sunshading and thermal insulating mechanism, transmission mechanism, supporting mechanism is by some support metope compositions and is built into greenhouse periphery, sunshading and thermal insulating mechanism is fixed on supporting mechanism, sunshading and thermal insulating mechanism is connected with the transmission mechanism of control sunshading and thermal insulating mechanism, in transmission mechanism fixation and supporting mechanism, this intelligent greenhouse external sunshade control device that the present invention is provided, daytime draws curtain at thing gable in, the illumination in greenhouse is not influenceed, night deploys curtain, curtain reflecting properties are good, heat radiation in greenhouse is reflected back, reduce greenhouse cooling speed, play excellent heat insulation effect.
Description
Technical field
The present invention relates to environment conditioning technical field, especially intelligent greenhouse external sunshade control device.
Background technology
The construction features of heliogreenhouse determine the transparent surface that the most position of its heat loss is roofing, account for whole greenhouse heat
More than the 75% of loss.It is due to choosing although greenhouses all at present is all additionally arranged insulation covering in the outer surface of transparent surface
Price is considered during material（Economy）, weight（Influence to structure）Etc. factor, the external thermal insulation covering only one in most of greenhouses
Layer, even the good material of heat-insulating property, its insulating power is also limited.Often there is summer in the insulation quilt used for many years in addition
Improper storage, easily cause insulation be aging, the phenomenon such as breakage, and then cause insulation quilt itself heat-insulating property to decline, overlap joint
The problems such as place's sealing declines, this can have a strong impact on the winter nocturnal temperature environment of heliogreenhouse, or even influence production.Therefore
Someone begins attempt to use heat preservation system inside, but the technical scheme taken is mostly insulation quilt（Curtain）Done from top to bottom along front roof
Camber line or linear motion, need to overcome gravity when system motion and stopping, and this make it that operation tractive force is big, is not easy to artificial behaviour
Make；Its support system is generally truss or double-deck skeleton, occupies the upper space in a part of greenhouse.
On the other hand, heliogreenhouse is mostly without sun-shading equipment, whenever solar radiation is too strong, only aeration-cooling measure
When can not meet regulation and control and requiring, cultivation production can only be just abandoned.Minority has the heliogreenhouse of solar protection devices, uses external sunshade more
Mode, although sunshade and suppress high temp effect preferably, but the input cost of support system is higher, thus applied in production compared with
It is few.
Prior art such as Authorization Notice No. is CN103858706B Chinese invention patent, discloses one kind and is installed on daylight
Inside greenhouse, the difunctional environment conditioning equipment to improve greenhouse heat-insulating performance and light shielding ability.A kind of heliogreenhouse auxiliary
Inside holding/shading system, including transmission mechanism（12）, support system, insulation/shading system and sealing device.The screening of the device
The radioactivity of positive curtain is less desirable, and heat preservation energy-saving rate is not high, and curtain ageing resistace is undesirable, and service life is short.
The content of the invention
The technical problems to be solved by the invention are to provide a kind of reflecting properties good, high insulating effect, and fractional energy savings is high, can
Needed to adjust the intelligent greenhouse external sunshade control device of sunshade area according to cultivation..
To solve above-mentioned existing technical problem, the present invention uses following scheme：Intelligent greenhouse external sunshade control device,
Including supporting mechanism, sunshading and thermal insulating mechanism, transmission mechanism, the supporting mechanism is by some support metope compositions and is built into temperature
Outdoor is enclosed, and sunshading and thermal insulating mechanism is fixed on supporting mechanism, the transmission mechanism of sunshading and thermal insulating mechanism and control sunshading and thermal insulating mechanism
In connection, transmission mechanism fixation and supporting mechanism.
Preferably, sunshading and thermal insulating mechanism includes：Heat-insulation unit, sunshade unit, and be connected heat-insulation unit and screening
The skeleton of positive unit, heat-insulation unit can control greenhouse temperature, and biological required temperature is controlled in the hot-house culture biochron, temperature is prevented
Degree diffusion is too fast to make greenhouse temperature not reach necessary requirement, and sunshade unit can reduce the intensity of illumination of plant, and slow down Indoor Temperature
The lifting of degree.
Preferably, heat-insulation unit is covered to skeleton by one layer of heat preservation film and lays insulation quilt, insulation quilt can roll up receive to
One end of sunshading and thermal insulating mechanism, by insulation film and the composite thermal insulation of insulation quilt, prevents temperature change excessive, while insulation quilt exists
Daytime not the used time can twisting cohesion in one end of sunshading and thermal insulating mechanism, can be rolled out when using, it is easy to use.
Preferably, insulation film is made up of following component and its parts by weight：For 90-120 parts of Corvic, adjacent benzene two
18-27 parts of formic acid dihexyl, 9-18 parts of dioctyl adipate, polyether-modified dimethyl silicone polymer 4-9 parts, acetyl citrate
1-7 parts, 7-12 parts of APES, 0.1-0.4 parts of calcium resinate, epoxy tetrahydro-2-ethylhexyl phthalate 1-23
Part, 0.2-0.7 parts of trimethylolpropane oleic acid, 2-10 parts of epoxidized soybean oil, 0.5-2 parts of stearate, polymethylphenyl siloxane fluid 0.1-
0.7 part, 0.1-0.4 parts of stabilizer, the insulation film of the formula can effectively reduce distributing for temperature, and heat is stored in material
In space, and prevent that aerosol is produced on insulation film influences the irradiation of light, also with higher hardness and heat endurance, Yi Jifang
Only insulation bag produces oxidation in high-temperature for a long time, influences the heat insulation effect in whole greenhouse, strengthen the heat-resisting of its insulation film and
Anti-oxidant, ageing resistance, increases the service life, so as to reduce discarded object amount, environmental protection is had a very big significance.
Wherein stabilizer is active peptides, and the amino acid sequence of the active peptides is
TDHQHCKLVNCGAKLLCVDNAITCEGICDATATGLSAHFRGEENVSYKVYGVAYTH CGPNFCCCIS, the active peptides
Stability of the insulation film to light can be effectively improved, the active peptides can reduce ultraviolet and insulation film by absorbing ultraviolet
Radiation, prevent each composition of insulation film to be decomposed by photochemical reaction, slow down insulation film long-term sunlight irradiation under light
Aging.
Preferably, sunshade unit is fixed on skeleton lower end by guide rail, guide rail is provided with fixed mount, and fixed mount section is in
I-shaped, both sides are provided with seal groove, seal groove provided with an act bar is dragged, and drag an act bar to be wrapped with sunshade curtain, fixed mount both sides are provided with close
Sealing groove is easy to placement to drag an act bar, can adjust fixed mount by guide rail so as to adjust the position for dragging act bar, can change the area of sunshade
And the position of sunshade, the biology of culture is fully absorbed light or avoid the irradiation of light high intensity.
Preferably, dragging act bar to be in arc-shaped and parallel with skeleton, the length for dragging act bar is the 65-80% of skeleton, is easy to drag
Curtain bar can be moved close to skeleton, changed different sun shading angles, dragged the specific length of act bar can be according to the biological happiness cultivated
Light, the demand of temperature changes, and certain space is reserved while shading makes light shine in, and part biological is in shading
Or under sunlit environment, also by mobile act bar can be dragged to change environment.
Preferably, sunshading and thermal insulating mechanism is additionally provided with the screening in sealing plate, sunshading and thermal insulating mechanism with supporting mechanism junction
It is additionally provided with positive curtain in some equally distributed regulation rings, regulation ring and is installed with shade supporting wire, shade supporting wire is parallel to sunshade curtain
The direction of motion, sealing plate can effectively prevent the temperature of interior from, toward external diffusion, influenceing heat insulation effect, making whole greenhouse sealingization,
Sunshade curtain is also supported by shade supporting wire in extended state and navigated, and makes the expansion of ante-venna cloth more steady.
Preferably, regulation ring is hexagonal, regulation ring is equipped with flexible circular arc on each angle, and flexible circular arc side is provided with
Limited block, sunshade curtain is both passed through with shade supporting wire and is connected in the flexible circular arc of regulation ring, and each angle of regulation ring is provided with
Flexible circular arc can freely adjust the size of circular arc by limited block, sunshade curtain is pulled certainly in flexible circular arc with shade supporting wire
Such as, it can also fasten, and regulation ring is designed to hexagonal symmetry structure, can be each with changing successively after a flexible circular arc breaks down
Flexible circular arc on individual angle, improves the use degree of regulation ring, and regulation ring is not limited only to hexagon or octagon, odd plots of land that can be cultivated
Shape and diagonal polygon.
Preferably, the power transmission shaft side that transmission mechanism has a two ends to be tied with draw curtain cable wire is connected by decelerator and motor
Connect, the draw curtain cable wire at power transmission shaft two ends is with dragging an act bar to be connected, and draw curtain cable wire is fixed by some equally distributed pulleys, makes to drag curtain
Bar is steadily stablized when being driven, and the front and rear stretching for dragging act bar is realized by the rotating of electrode, reaches intelligentized control, draw curtain
Cable wire makes transmission more steady by pulley fixed guide.
Compared with prior art, beneficial effects of the present invention：This intelligent greenhouse external sunshade control that the present invention is provided
Device, daytime draws curtain at thing gable in, the illumination in greenhouse is not influenceed, night deploys curtain, curtain reflecting properties
It is good, the heat radiation in greenhouse is reflected back, greenhouse cooling speed is reduced, plays excellent heat insulation effect, the energy is being saved
Under the premise of, it is that the plant in greenhouse builds good growing environment, the yield and quality of crop is improved, with high-barrier, anti-spoke
Penetrate performance and extremely low solar radiation absorbility factor, high insulating effect；Intensity is big and soft, and ageing resistace is good, long lifespan, holds
Easily retracting, device operating flexibility and security are added using track type movement mechanism.
Intelligent greenhouse external sunshade control device is provided present invention employs above-mentioned technical proposal, prior art is compensate for
Deficiency, it is reasonable in design, it is easy to operate.
Brief description of the drawings
Fig. 1 is the structural representation of intelligent greenhouse external sunshade control device of the invention；
Fig. 2 is the structural representation of sunshading and thermal insulating mechanism of the present invention；
Fig. 3 is the structural representation of transmission mechanism of the present invention；
Fig. 4 is the structural representation of fixed mount in sunshading and thermal insulating mechanism of the present invention；
Fig. 5 is that act bar and sunshade curtain connection diagram are dragged in fixed mount of the present invention；
Fig. 6 is regulation ring and sunshade curtain connection diagram in sunshading and thermal insulating mechanism of the present invention；
Fig. 7 is the structural representation of sealing plate of the present invention；
Fig. 8 is the structural representation of regulation ring of the present invention.
Description of reference numerals：1st, supporting mechanism；2nd, sunshading and thermal insulating mechanism；3rd, transmission mechanism；4th, skeleton；5th, insulation film；6、
Insulation quilt；7th, guide rail；8th, fixed mount；9th, an act bar is dragged；10th, sunshade curtain；11st, sealing plate；12nd, regulation ring；13rd, shade supporting wire；14、
Draw curtain cable wire；15th, power transmission shaft；16th, decelerator；17th, motor；18th, pulley.
Embodiment
It is described in further detail below in conjunction with drawings and examples：
Embodiment 1：
As shown in figures 1-8, intelligent greenhouse external sunshade control device, including supporting mechanism 1, sunshading and thermal insulating mechanism 2, transmission mechanism
3, the supporting mechanism 1 is by some support metope compositions and is built into greenhouse periphery, and sunshading and thermal insulating mechanism 2 is fixed on support machine
On structure 1, sunshading and thermal insulating mechanism 2 is connected with the transmission mechanism 3 of control sunshading and thermal insulating mechanism 2, and transmission mechanism 3 is fixed and supporting mechanism
On 1.
Sunshading and thermal insulating mechanism 2 includes：Heat-insulation unit, sunshade unit, and be connected heat-insulation unit and sunshade unit
Skeleton 4, heat-insulation unit can control greenhouse temperature, and biological required temperature is controlled in the hot-house culture biochron, prevents temperature from spreading
Too fast greenhouse temperature is not reached necessary requirement, sunshade unit can reduce the intensity of illumination of plant, and slow down carrying for indoor temperature
Rise.
Heat-insulation unit is covered to skeleton 4 by one layer of heat preservation film 5 and lays insulation quilt 6, and insulation quilt 6 can be rolled up to receive to sunshade and protected
One end of warm mechanism 2, by insulation film 5 and the composite thermal insulation of insulation quilt 6, prevents temperature change excessive, while insulation quilt 6 is white
It not the used time can twisting cohesion in one end of sunshading and thermal insulating mechanism 2, can be rolled out when using, it is easy to use.
Insulation film 5 is made up of following component and its parts by weight：For 120 parts of Corvic, DHP
27 parts, 18 parts of dioctyl adipate, 9 parts of polyether-modified dimethyl silicone polymer, 7 parts of acetyl citrate, alkyl phenol polyoxy second
12 parts of alkene ether, 0.4 part of calcium resinate, 23 parts of epoxy tetrahydro-2-ethylhexyl phthalate, 0.7 part of trimethylolpropane oleic acid, ring
10 parts of oxygen soybean oil, 2 parts of stearate, 0.7 part of polymethylphenyl siloxane fluid, 0.2 part of stabilizer, the insulation film 5 of the formula can be effective
Distributing for temperature is reduced, heat is stored in the space of material, and prevents that aerosol is produced on insulation film 5 influences the photograph of light
Penetrate, also with higher hardness and heat endurance, and prevent insulation bag from producing oxidation in high-temperature for a long time, influence is whole
The heat insulation effect in greenhouse, strengthens the heat-resisting and anti-oxidant of its insulation film 5, ageing resistance, increases the service life, so as to reduce useless
Gurry amount, has a very big significance to environmental protection.
Wherein stabilizer is active peptides, and the amino acid sequence of the active peptides is
TDHQHCKLVNCGAKLLCVDNAITCEGICDATATGLSAHFRGEENVSYKVYGVAYTH CGPNFCCCIS, the active peptides
The stability of 5 pairs of light of insulation film can be effectively improved, the active peptides can reduce ultraviolet and insulation film by absorbing ultraviolet
5 radiation, prevents each composition of insulation film 5 to be decomposed by photochemical reaction, slows down insulation film 5 under the irradiation of long-term sunlight
Light aging.
Sunshade unit is fixed on the lower end of skeleton 4 by guide rail 7, and guide rail 7 is provided with fixed mount 8, and the section of fixed mount 8 is in I-shaped
Type, both sides are provided with seal groove, seal groove provided with act bar 9 is dragged, and drag act bar 9 to be wrapped with sunshade curtain 10, the both sides of fixed mount 8 are provided with close
Sealing groove is easy to placement to drag act bar 9, can adjust fixed mount 8 by guide rail 7 so as to adjust the position for dragging act bar 9, can change sunshade
Area and the position of sunshade, make the biology of culture fully absorb light or avoid the irradiation of light high intensity.
It is in arc-shaped and parallel with skeleton 4 to drag act bar 9, and the length for dragging act bar 9 is the 70% of skeleton 4, is easy to drag act bar 9 can
Moved close to skeleton 4, change different sun shading angles, drag the specific length of act bar 9 can be according to the biological light cultivated, temperature
The demand of degree changes, and certain space is reserved while shading makes light shine in, and part biological is in shading or sun
In the environment of light irradiation, also by mobile act bar 9 can be dragged to change environment.
Sunshading and thermal insulating mechanism 2 is additionally provided with the ante-venna in sealing plate 11, sunshading and thermal insulating mechanism 2 with the junction of supporting mechanism 1
It is additionally provided with cloth 10 in some equally distributed regulation rings 12, regulation ring 12 and is installed with shade supporting wire 13, shade supporting wire 13 is parallel to sunshade
The direction of motion of curtain 10, sealing plate 11 can effectively prevent the temperature of interior from, toward external diffusion, influenceing heat insulation effect, making whole temperature
Room sealingization, sunshade curtain 10 is also supported by shade supporting wire 13 in extended state and navigated, and makes sunshade curtain 10 deploy more to put down
Surely.
Regulation ring 12 is hexagonal, and regulation ring 12 is equipped with flexible circular arc on each angle, and circular arc side of stretching is provided with spacing
Block, sunshade curtain 10 is both passed through with shade supporting wire 13 and is connected in the flexible circular arc of regulation ring 12, and regulation ring 12 is set on each angle
The flexible circular arc having can freely adjust the size of circular arc by limited block, make sunshade curtain 10 with shade supporting wire 13 in flexible circular arc
Interior pulling freely, can also be fastened, and regulation ring 12 is designed into hexagonal symmetry structure, can after a flexible circular arc breaks down
Successively with changing the flexible circular arc on each angle, the use degree of regulation ring 12 is improved, regulation ring 12 is not limited only to hexagon, can also
It is octagon, decagon and diagonal polygon.
The side of power transmission shaft 15 that transmission mechanism 3 has a two ends to be tied with draw curtain cable wire 14 is connected by decelerator 16 with motor 17
Connect, the draw curtain cable wire 14 at the two ends of power transmission shaft 15 is with dragging act bar 9 to be connected, and draw curtain cable wire 14 is solid by some equally distributed pulleys 18
It is fixed, make steadily to stablize when dragging act bar 9 to be driven, and the front and rear stretching for dragging act bar 9 is realized by the rotating of electrode, reach intellectuality
Control, draw curtain cable wire 14 makes transmission more steady by the fixed guide of pulley 18.
The prior art of routine techniques dawn known to those skilled in the art in the present embodiment, does not make to chat in detail herein
State.
Embodiment 2：
As shown in figures 1-8, intelligent greenhouse external sunshade control device, plants some potted plant, greenhouse leads to during real work, in greenhouse
Connecting framework 4 on the outer enclosure wall that some support metopes build greenhouse, outer enclosure wall is crossed, is connected sunshading and thermal insulating mechanism 2 by skeleton 4
Connecing in fixation, sunshading and thermal insulating mechanism 2 drags act bar 9 to be connected with transmission mechanism 3, and transmission mechanism 3 is fixed on greenhouse inwall, when white
When its sunlight shines into greenhouse, due to the development of prolonged irradiation influence plant, and some plants belong to dislike of bright lights needs in short-term
Between when irradiating, rotated by motor 17, drive power transmission shaft 15, the draw curtain cable wire 14 at the two ends of power transmission shaft 15 pulls sunshading and thermal insulating mechanism
Act bar 9 is dragged in 2, drags act bar 9 to be placed in the seal groove of fixed mount 8, after the expansion of sunshade curtain 10 that the curls inward of act bar 9 has is dragged
Pull next fixed mount 8 so as to drive it is next drag act bar 9, deploy next sunshade curtain 10, operating personnel can be according to need
Deploy required areal extent sunshade curtain 10, fixed mount 8 is moved when moving by guide rail 7, reliable and stable, sunshade curtain 10
Sunshade curtain 10 is deployed smooth by the cooperation of regulation ring 12 and draw curtain line during expansion, prevent the wrinkle of sunshade curtain 10 from sticking to
Together, can be according to the demands of greenhouse implants, the sunshade curtain 10 with changing different light transmittances, skeleton 4 during 10 sunshade of sunshade curtain
Upside is covered with insulation film 5, and insulation film 5 has the function of Antifogging heat-resisting oxidation-resistance, enhances the insulation effect of insulation film 5, hides
Positive heat preservation mechanism 2 is additionally provided with sealing plate 11 with the junction of supporting mechanism 1, it is ensured that the sealing in greenhouse, improves the guarantor of heat-insulation unit
Temp effect, sunlight is shining into greenhouse through insulation film 5, and sunshade unit is opened by rotating mechanism when sunlight is excessive, reduces plant
Be exposed to the sun the time, and slow down the elevation amplitude of warm indoor temperature, be that, in order to play more preferable heat insulation effect, will protect when reaching evening
Temperature is rolled out by 6 to be laid on insulation film 5, reduces the reduction of temperature, it is ensured that plant can obtain suitable temperature in greenhouse, when white
Its not used time, insulation quilt 6 is by twisting cohesion in one end of sunshading and thermal insulating mechanism 2.
The prior art of routine techniques dawn known to those skilled in the art in above-described embodiment, does not make to chat in detail herein
State.
Specific embodiment described herein is only to present invention explanation for example.The technical field of the invention
Technical staff can be made various modifications or supplement to described specific embodiment or be substituted using similar mode, but
Without departing from the present invention's or surmount scope defined in appended claims.
SEQUENCE LISTING
<110>Ningbo Li Tai Electronic Science and Technology Co., Ltd.s
<120>Intelligent greenhouse external sunshade control device
<130> 1
<160> 1
<170> PatentIn version 3.5
<210> 1
<211> 66
<212> PRT
<213>It is artificial synthesized
<400> 1
Thr Asp His Gln His Cys Lys Leu Val Asn Cys Gly Ala Lys Leu Leu
1 5 10 15
Cys Val Asp Asn Ala Ile Thr Cys Glu Gly Ile Cys Asp Ala Thr Ala
20 25 30
Thr Gly Leu Ser Ala His Phe Arg Gly Glu Glu Asn Val Ser Tyr Lys
35 40 45
Val Tyr Gly Val Ala Tyr Thr His Cys Gly Pro Asn Phe Cys Cys Cys
50 55 60
Ile Ser
65
Claims (9)
1. intelligent greenhouse external sunshade control device, including supporting mechanism（1）, sunshading and thermal insulating mechanism（2）, transmission mechanism（3）, its
It is characterised by, the supporting mechanism（1）It is made up of some support metopes and is built into greenhouse periphery, sunshading and thermal insulating mechanism（2）
It is fixed on supporting mechanism（1）On, sunshading and thermal insulating mechanism（2）With control sunshading and thermal insulating mechanism（2）Transmission mechanism（3）Connection, is passed
Motivation structure（3）Fixed and supporting mechanism（1）On.
2. intelligent greenhouse external sunshade control device according to claim 1, it is characterised in that the sunshading and thermal insulating mechanism
（2）Including：Heat-insulation unit, sunshade unit, and be connected heat-insulation unit and sunshade unit skeleton（4）.
3. intelligent greenhouse external sunshade control device according to claim 2, it is characterised in that the heat-insulation unit is by one
Layer insulation film（5）Cover to skeleton（4）Go up and lay insulation quilt（6）, insulation quilt（6）It can roll up and receive to sunshading and thermal insulating mechanism（2）'s
One end.
4. intelligent greenhouse external sunshade control device according to claim 3, it is characterised in that the insulation film（5）By
Following component and its parts by weight composition：For 90-120 parts of Corvic, 18-27 parts of DHP, adipic acid
9-18 parts of dioctyl ester, polyether-modified dimethyl silicone polymer 4-9 parts, 1-7 parts of acetyl citrate, APES 7-
12 parts, 0.1-0.4 parts of calcium resinate, 1-23 parts of epoxy tetrahydro-2-ethylhexyl phthalate, trimethylolpropane oleic acid 0.2-0.7
Part, 2-10 parts of epoxidized soybean oil, 0.5-2 parts of stearate, 0.1-0.7 parts of polymethylphenyl siloxane fluid, 0.1-0.4 parts of stabilizer.
5. intelligent greenhouse external sunshade control device according to claim 2, it is characterised in that the sunshade unit passes through
Guide rail（7）It is fixed on skeleton（4）Lower end, guide rail（7）It is provided with fixed mount（8）, fixed mount（8）Section is in I-shaped, and both sides are set
Have to be provided with seal groove, seal groove and drag an act bar（9）, drag an act bar（9）It is wrapped with sunshade curtain（10）.
6. intelligent greenhouse external sunshade control device according to claim 5, it is characterised in that described to drag an act bar（9）It is in
Arc-shaped and and skeleton（4）It is parallel, drag an act bar（9）Length be skeleton（4）65-80%.
7. intelligent greenhouse external sunshade control device according to claim 1, it is characterised in that the sunshading and thermal insulating mechanism
（2）With supporting mechanism（1）Junction is additionally provided with sealing plate（11）, sunshading and thermal insulating mechanism（2）In sunshade curtain（10）On also set
There are some equally distributed regulation rings（12）, regulation ring（12）Inside it is installed with shade supporting wire（13）, shade supporting wire（13）Parallel to ante-venna
Cloth（10）The direction of motion.
8. intelligent greenhouse external sunshade control device according to claim 7, it is characterised in that the regulation ring（12）It is in
Hexagon, regulation ring（12）Flexible circular arc is equipped with each angle, circular arc side of stretching is provided with limited block, sunshade curtain（10）With
Shade supporting wire（13）Both pass through regulation ring（12）Flexible circular arc in be connected.
9. intelligent greenhouse external sunshade control device according to claim 1, it is characterised in that the transmission mechanism（3）
There are a two ends to be tied with draw curtain cable wire（14）Power transmission shaft（15）Side passes through decelerator（16）With motor（17）Connection, power transmission shaft
（15）The draw curtain cable wire at two ends（14）With dragging an act bar（9）Connection, draw curtain cable wire（14）Pass through some equally distributed pulleys（18）
It is fixed.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710391860.6A CN107211772A (en) | 2017-05-27 | 2017-05-27 | Intelligent greenhouse external sunshade control device |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710391860.6A CN107211772A (en) | 2017-05-27 | 2017-05-27 | Intelligent greenhouse external sunshade control device |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107211772A true CN107211772A (en) | 2017-09-29 |
Family
ID=59946697
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710391860.6A Pending CN107211772A (en) | 2017-05-27 | 2017-05-27 | Intelligent greenhouse external sunshade control device |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107211772A (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114766250A (en) * | 2022-05-19 | 2022-07-22 | 宁夏任进礼新连栋温室技术发展有限公司 | Greenhouse |
| CN114830951A (en) * | 2022-05-19 | 2022-08-02 | 宁夏任进礼新连栋温室技术发展有限公司 | Roll up box module closing device |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN202435891U (en) * | 2012-02-16 | 2012-09-19 | 乐晓芳 | Novel sun-shading and cooling functional separated greenhouse cluster |
| CN103858706A (en) * | 2014-03-18 | 2014-06-18 | 中国农业大学 | Sunlight greenhouse auxiliary internal thermal insulation/sun-shading system |
| CN203775804U (en) * | 2014-03-28 | 2014-08-20 | 合肥市日之丰农业发展有限公司 | External sunshade and insect prevention device for greenhouse |
| CN104100198A (en) * | 2014-07-31 | 2014-10-15 | 上海都市绿色工程有限公司 | Greenhouse steel ladder and external sun-shading framework connecting device |
| CN205378610U (en) * | 2016-02-23 | 2016-07-13 | 宁夏地德科技有限公司 | Inside and outside heat -preservation type sunlight greenhouse |
-
2017
- 2017-05-27 CN CN201710391860.6A patent/CN107211772A/en active Pending
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN202435891U (en) * | 2012-02-16 | 2012-09-19 | 乐晓芳 | Novel sun-shading and cooling functional separated greenhouse cluster |
| CN103858706A (en) * | 2014-03-18 | 2014-06-18 | 中国农业大学 | Sunlight greenhouse auxiliary internal thermal insulation/sun-shading system |
| CN203775804U (en) * | 2014-03-28 | 2014-08-20 | 合肥市日之丰农业发展有限公司 | External sunshade and insect prevention device for greenhouse |
| CN104100198A (en) * | 2014-07-31 | 2014-10-15 | 上海都市绿色工程有限公司 | Greenhouse steel ladder and external sun-shading framework connecting device |
| CN205378610U (en) * | 2016-02-23 | 2016-07-13 | 宁夏地德科技有限公司 | Inside and outside heat -preservation type sunlight greenhouse |
Non-Patent Citations (1)
| Title |
|---|
| 邹承鲁: "《当代生物学》", 30 April 2000 * |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114766250A (en) * | 2022-05-19 | 2022-07-22 | 宁夏任进礼新连栋温室技术发展有限公司 | Greenhouse |
| CN114830951A (en) * | 2022-05-19 | 2022-08-02 | 宁夏任进礼新连栋温室技术发展有限公司 | Roll up box module closing device |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN208273728U (en) | A kind of energy-saving photovoltaic green-house with dimming function | |
| CN201682842U (en) | Plastic-covered greenhouse | |
| CN107211772A (en) | Intelligent greenhouse external sunshade control device | |
| CN106521974B (en) | A kind of outdoor fabric of temperature control heat insulation and heat control intelligence based on microcapsules and aeroge | |
| CN203814284U (en) | Auxiliary heat-insulating/sun-shading system in sunlight greenhouse | |
| CN205884187U (en) | A greenhouse that is used for interior heat preservation solar shading system of multistage formula in greenhouse and contains this system | |
| CN209218745U (en) | One kind is followed spot formula photovoltaic heliogreenhouse | |
| CN205875887U (en) | From tent that adjusts temperature based on phase change energy storage technique | |
| CN105875269A (en) | Agricultural greenhouse | |
| CN202435891U (en) | Novel sun-shading and cooling functional separated greenhouse cluster | |
| CN201640089U (en) | Temperature adjustable greenhouse | |
| CN206380392U (en) | A kind of rotatable lighting roof in greenhouse | |
| CN204579319U (en) | A kind of rope film booth | |
| CN203387993U (en) | Single-span plastic greenhouse | |
| CN207135705U (en) | A kind of municipal gardens seedling protective stent | |
| CN206227164U (en) | A kind of greenhouse of the plantation for being provided with device of solar generating | |
| CN106879402A (en) | High-efficiency and energy-saving type greenhouse external sunshade control device | |
| CN209473155U (en) | A kind of daylight ecological greenhouse suitable for extremely frigid zones | |
| CN207022723U (en) | A kind of two-part vinyl house internal insulation structure | |
| CN201278721Y (en) | Sun-shading incubation system in greenhouse | |
| CN108076913A (en) | A kind of two-layer insulation type crops cultivation greenhouse | |
| CN107559753A (en) | A kind of solar street light with sight | |
| CN107048965A (en) | A kind of cloth curtain that can be heat-insulated | |
| CN209185217U (en) | A kind of agricultural greenhouse of environment protecting and power-saving | |
| CN202059807U (en) | Sunlight greenhouse with light-increasing and temperature-increasing functions |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| RJ01 | Rejection of invention patent application after publication | ||
| RJ01 | Rejection of invention patent application after publication |
Application publication date: 20170929 |