CN106905420B

CN106905420B - Novel insecticidal protein and nucleotide sequence thereof

Info

Publication number: CN106905420B
Application number: CN201710219903.2A
Authority: CN
Inventors: 束长龙; 耿丽丽; 张�杰; 黄世智; 宋福平; 彭琦
Original assignee: Institute of Plant Protection of Chinese Academy of Agricultural Sciences
Current assignee: Institute of Plant Protection of Chinese Academy of Agricultural Sciences
Priority date: 2017-04-06
Filing date: 2017-04-06
Publication date: 2020-11-24
Anticipated expiration: 2037-04-06
Also published as: CN106905420A

Abstract

The present invention relates to a novel insecticidal protein and its nucleotide sequence. The pesticidal protein has an amino acid sequence as at least one of (I) and (II): (I) an amino acid sequence shown as SEQ ID No. 2; (II) an amino acid sequence which has more than 95% of consistency with the amino acid sequence shown as SEQ ID No.2 and has the same function with the amino acid sequence shown as SEQ ID No. 2; preferably, the amino acid sequence has more than 98 percent of consistency with the amino acid sequence shown as SEQ ID No.2 and has the same function with the amino acid sequence shown as SEQ ID No. 2.

Description

Novel insecticidal protein and nucleotide sequence thereof

Technical Field

The present invention relates to a novel insecticidal protein and its nucleotide sequence.

Background

Bacillus thuringiensis (Bt for short) is a gram-positive bacterium with wide distribution, is an entomopathogenic microorganism with strong toxicity to pests and no toxicity to natural enemies, and has no toxicity to higher animals and people. It is the microbial pesticide which is the most deeply researched and widely used at present and has activity on more than 16 pests of 3000 meshes.

The prior art has generally recognized that Bt can be pesticidally active, primarily due to its ability to produce a variety of Cry, Cyt and Vip proteins.

However, it has been rarely reported that Bt is also capable of producing pesticidal actives other than the above three proteins, particularly pesticidal actives with superior activity against certain coleopteran (Coleoptera) pests, such as Holotrichia parallela (Holotrichia oblita).

Disclosure of Invention

One of the present applications provides an insecticidal protein having an amino acid sequence as at least one of (I) and (II):

(I) an amino acid sequence shown as SEQ ID No. 2;

(II) an amino acid sequence which has more than 95% of consistency with the amino acid sequence shown as SEQ ID No.2 and has the same function with the amino acid sequence shown as SEQ ID No. 2.

It is within the scope of the present application that the pesticidal protein defined by (II) can achieve effects equivalent to or superior to the amino acid sequence shown in SEQ ID No.2 while having the same function as the amino acid sequence shown in SEQ ID No. 2. However, it is within the scope of the present application that the pesticidal protein defined by (II) achieves a slightly inferior effect to the amino acid sequence shown in SEQ ID No.2, for example, an effect of 50% to 99.999% of the effect of the amino acid sequence shown in SEQ ID No.2, while achieving the same function as the amino acid sequence shown in SEQ ID No.2, without affecting the use of the pesticidal protein.

In a specific embodiment, the amino acid sequence of the insecticidal protein is preferably an amino acid sequence which has more than 98% identity with the amino acid sequence shown as SEQ ID No.2 and has the same function as the amino acid sequence shown as SEQ ID No. 2. The insecticidal protein defined in this way can obtain an effect equivalent to or better than the amino acid sequence shown as SEQ ID No.2 while having the same function as the amino acid sequence shown as SEQ ID No.2, which is within the scope of the present application. However, it is within the scope of the present application that the pesticidal protein defined by (II) achieves a slightly inferior effect to the amino acid sequence shown in SEQ ID No.2, for example, an effect of 50% to 99.999% of the effect of the amino acid sequence shown in SEQ ID No.2, while achieving the same function as the amino acid sequence shown in SEQ ID No.2, without affecting the use of the pesticidal protein.

In one embodiment, the amino acid sequence of the insecticidal protein is preferably an amino acid sequence which has more than 99% identity with the amino acid sequence shown as SEQ ID No.2 and has the same function as the amino acid sequence shown as SEQ ID No. 2. The insecticidal protein defined in this way can obtain an effect equivalent to or better than the amino acid sequence shown as SEQ ID No.2 while having the same function as the amino acid sequence shown as SEQ ID No.2, which is within the scope of the present application. However, it is within the scope of the present application that the pesticidal protein defined by (II) achieves a slightly inferior effect to the amino acid sequence shown in SEQ ID No.2, for example, an effect of 50% to 99.999% of the effect of the amino acid sequence shown in SEQ ID No.2, while achieving the same function as the amino acid sequence shown in SEQ ID No.2, without affecting the use of the pesticidal protein.

In one embodiment, the amino acid sequence of the insecticidal protein is preferably an amino acid sequence which has a more than 99.5% identity with the amino acid sequence shown as SEQ ID No.2 and has the same function as the amino acid sequence shown as SEQ ID No. 2. The insecticidal protein defined in this way can obtain an effect equivalent to or better than the amino acid sequence shown as SEQ ID No.2 while having the same function as the amino acid sequence shown as SEQ ID No.2, which is within the scope of the present application. However, it is within the scope of the present application that the pesticidal protein defined by (II) achieves a slightly inferior effect to the amino acid sequence shown in SEQ ID No.2, for example, an effect of 50% to 99.999% of the effect of the amino acid sequence shown in SEQ ID No.2, while achieving the same function as the amino acid sequence shown in SEQ ID No.2, without affecting the use of the pesticidal protein.

In a specific embodiment, the insecticidal protein can also be a protein with the same function as the insecticidal protein with the amino acid sequence shown in (I) after the amino acid sequence shown in (I) is substituted and/or deleted and/or one or more amino acids are added. The insecticidal protein defined in this way can obtain an effect equivalent to or better than the amino acid sequence shown as SEQ ID No.2 while having the same function as the amino acid sequence shown as SEQ ID No.2, which is within the scope of the present application. However, it is within the scope of the present application that the pesticidal protein defined by (II) achieves a slightly inferior effect to the amino acid sequence shown in SEQ ID No.2, for example, an effect of 50% to 99.999% of the effect of the amino acid sequence shown in SEQ ID No.2, while achieving the same function as the amino acid sequence shown in SEQ ID No.2, without affecting the use of the pesticidal protein.

The insecticidal activity of the insecticidal protein of the application on pests, particularly on Holotrichia parallela in North China is remarkably superior to that of the insecticidal protein in the prior art, and the insecticidal protein can make up for the defect that Cry8G protein is weak in insecticidal activity on Holotrichia parallela in North China. Therefore, the method enriches insecticidal protein resources, provides a new gene source for transgenic crops and engineering strains, improves the insect-resistant effect of Bt transgenic products, and has important economic, social and ecological benefits.

The second aspect of the present application provides a nucleotide sequence encoding any one of the pesticidal proteins according to the first aspect of the present application. The nucleotide sequence can be obtained by taking a source strain thereof as a template or a cloned full-length DNA fragment as a template through PCR amplification; it can also be artificially synthesized according to a given sequence.

In a specific embodiment, when the amino acid sequence of the pesticidal protein is shown as SEQ ID No.2, the nucleotide sequence encoding the pesticidal protein is shown as SEQ ID No. 1.

The third application provides a composition comprising at least one insecticidal protein according to one of the first to third applications.

The fourth aspect of the present application provides a transgenic microorganism comprising the nucleotide sequence of the second aspect of the present application and capable of producing the pesticidal protein of the first aspect of the present application.

In a particular embodiment, it is preferred that the transgenic microorganism comprises at least one of Bacillus (Bacillus), Pseudomonas (Pseudomonas), enterobacter (Escherichia), and yeast (Saccharomyces).

In a specific embodiment, it is preferable that the Bacillus includes at least one of Bacillus thuringiensis (Bacillus thuringiensis), Bacillus subtilis (Bacillus subtilis), Bacillus atrophaeus (Bacillus atrophaeus), and Bacillus cereus (Bacillus cereus); the Pseudomonas bacteria comprise Pseudomonas fluorescens (Pseudomonas fluorescens); the enterobacteria include Escherichia coli (Escherichia coli).

In a particular embodiment, the starting strain of the transgenic microorganism of the present application (i.e.the microorganism prior to the transfer into the nucleotide sequence described in the second application) is a wild-type microorganism and/or a genetically engineered microorganism.

Wherein, the wild microorganism refers to a microorganism which is separated from the nature and is not artificially modified.

Genetically engineered microorganisms refer to microorganisms artificially modified from wild microorganisms.

The species of the transgenic microorganism and/or genetically engineered microorganism of the present application is not changed by the transgenic modification, and therefore, the transgenic microorganism is the same species as the microorganism before the transgene occurs (i.e., as a recipient microorganism).

In one embodiment, the nucleic acid sequence described in the second application above can be linked to an expression vector. The expression vector may be, for example, a pSTK expression vector capable of shuttling in E.coli and B.thuringiensis.

The fifth aspect of the present application provides the use of a nucleotide sequence according to the second aspect of the present application for the preparation of a transgenic plant, wherein said transgenic plant is capable of producing an insecticidal protein according to the first aspect of the present application; the transgenic plant includes at least one of Cruciferae (Cruciferae), Solanaceae (Solanaceae), Umbelliferae (Umbelliferae), Cucurbitaceae (Cucurbitaceae), Araceae (Araceae), Gramineae (Liliaceae), Leguminosae (Leguminosae), Papilionaceae (Papilionoceae), Chenopodiaceae (Chenopodiaceae), Compositae (Compositae) and Malvaceae (Malvaceae).

In a specific embodiment, it is preferred that the transgenic plant comprises Brassica (Brassica), Raphanus (Raphanus), Nicotiana (Nicotiana), Lycopersicon (Lycopersicon), Solanum (Solanum), Capsicum (Capsicum), Daucus (Daucus), Apium (Apium), parsley (Petroselinum), anisum (Foeniculum), Cucurbita (Cucurbita), Cucumis (Cucumis), Cucurbita (Benincasa), Cucurbita (Luffa), Citrullus (Citrullus), Cucumis (Cucumis), Cucurbita (amophallus), Sorghum (Sorghum), Setaria (Setaria), Oryza (Oryza), Saccharum (Saccharum), Triticum (Glycine), Glycine (Glycine), Brassica), Medicago (Brassica), and at least one species of Brassica (garden).

In a specific example, it is preferred that the transgenic plant includes rape (Brassica campestris), Chinese cabbage (Brassica rapa), pakchoi (Brassica chinensis), cabbage (Brassica oleracea), radish (Raphanus sativus), tomato (Lycopersicon esculentum), potato (Solanum tuberosum), eggplant (Solanum melongena), celery (Apium graveolens), parsley (Petroselinum crispum), fennel (Foenicum vulgare), pumpkin (Cucurbita pepora), pumpkin (Cucurbita moschata), cucumber (Cucumis sativa), white gourd (Bennia hispida), towel gourd (Luffa uva), watermelon (Citrullus vulgaris), watermelon (Citrullus lanatus), melon (Cucumis sativa), cucumber (Amunicolor), cucumber (Brassica sativa), melon (Citrus sativa), wheat (Brassica sativa), alfalfa (Brassica sativa), sugarcane (Brassica sativa), Sorghum vulus), Sorghum vulgare sativa (Brassica sativa), corn (Brassica sativa), Sorghum vulus (Brassica sativa), Sorghum vulus (Brassica sativa), and Sorghum vulus), and Sorghum sativa (Brassica sativa), and Sorghum vulus), and Sorghum sativa (Brassica sativa) including grain (Brassica sativa), and, At least one of sunflower (Helianthus annuus) and okra (Abelmoschus esculentus).

The species of the transgenic plant is not changed by the transgenic modification, and therefore, the transgenic plant is the same species as the plant before the transgene occurs (i.e., as a recipient plant).

The sixth aspect of the present application provides a method for producing an insecticidal protein according to one of the first to the third aspects of the present application, comprising producing said insecticidal protein using a transgenic microorganism according to the fourth aspect of the present application, and/or using a transgenic plant according to the fifth aspect of the present application.

In a specific embodiment, it is preferable that the method further comprises purifying the insecticidal protein to a purity of 80% or more after producing the insecticidal protein using the transgenic microorganism and/or transgenic plant.

In a specific embodiment, it is more preferable that after the production of the insecticidal protein using the transgenic microorganism and/or transgenic plant, the insecticidal protein is purified to have a purity of 90% or more.

In a specific embodiment, the insecticidal protein is purified to a purity of 99% or more even after production of the insecticidal protein using the transgenic microorganism and/or transgenic plant.

Accordingly, the seventh aspect of the present application provides the use of at least one of the pesticidal proteins according to one of the applications, the compositions according to the third aspect of the present application, the transgenic microorganisms according to the fourth aspect of the present application, and the transgenic plants in the use according to the fifth aspect of the present application for controlling at least one pest of the Coleoptera (Coleoptera).

In a particular embodiment, the use of at least one insecticidal protein according to one of the applications, of a composition according to the third of the applications, of a transgenic microorganism according to the fourth of the applications, and of a transgenic plant according to the fifth of the applications for controlling at least one pest of the gill-gold-turtle family (meloenthidae) is preferred.

In a particular embodiment, particular preference is given to the use of at least one of the insecticidal proteins according to one of the applications, the compositions according to the third of the applications, the transgenic microorganisms according to the fourth of the applications, and the transgenic plants for use according to the fifth of the applications for controlling at least one pest in the gill-tortoise (Holotrichia).

In a specific embodiment, most preferably at least one of the insecticidal protein according to one of the present applications, the composition according to the third of the present applications, the transgenic microorganism according to the fourth of the present applications, and the transgenic plant for use according to the fifth of the present applications is used for controlling Holotrichia parallela (Holotrichia oblite).

The technology for preparing monoclonal antibodies is mature, so that the monoclonal antibodies of the insecticidal proteins can be prepared according to the conventional technical means in the prior art. In the process of preparing the monoclonal antibody, the selected antigen can be a full-length sequence of the insecticidal protein in one of the applications, and also can be a partial amino acid sequence of the insecticidal protein in one of the applications. The pure product of the antigen can be obtained by the method for preparing the insecticidal protein provided by the sixth application; the antigen, particularly when it is a partial amino acid sequence, can also be obtained by artificial synthesis. Accordingly, eight of the present applications provide monoclonal antibodies to pesticidal proteins according to one of the present applications. Preferably, the monoclonal antibody is a monoclonal antibody that specifically recognizes only the pesticidal protein.

Unless otherwise indicated herein, all terms used herein are to be understood as being generic to all terms used in the art.

Detailed Description

The present invention will be described in further detail with reference to the following examples, which are provided by way of illustration of preferred embodiments and are not to be construed as limiting the present invention.

1) Liquid LB: tryptone 1%, yeast powder 0.5%, NaCl 1%, pH7.0, 15 pounds sterilized for 15 min. Used for culturing Escherichia coli.

2) Solid LB: 1.3% agar was added to liquid LB medium and 15 lbs. were sterilized for 15 min. Used for culturing Escherichia coli.

3) Antibiotics: ampicillin aqueous solution 100mg/ml, diluted 500 times when using and preserved at-20 ℃. Among them, pET21b plasmid vector has ampicillin resistance.

Electrophoretic detection of proteins

120V pre-electrophoresis for about 10-20min, collecting protein sample 40 μ L, adding 10 μ L5 × sample buffer solution, mixing, diluting the supernatant and precipitate respectively, boiling for 5-10min, centrifuging at 12000rpm for 5min, and collecting 10L supernatant for sampling. Electrophoresis at 80V was carried out at constant pressure until the sample was concentrated to a straight line, and electrophoresis at 150V was carried out at constant pressure until the indicated bromophenol blue reached the bottom of the gel.

And (3) decoloring: and taking out the gel after electrophoresis, washing the gel with distilled water, adding 50mL of the solution I, heating the solution I in a microwave oven for 30s, and oscillating the solution at 60rpm for 10 min.

Dyeing: after the solution I was poured off, solution II (200L of solution III per 50mL of solution II) was added and heated in a microwave oven for 30s with shaking at 60rpm for more than 15 min.

The solution II was decanted, sterile water was added and the gel imaging system was stored photographically.

The observation result shows that the expression of the target protein is compared according to the coloring degree of the protein band, and the target protein is stored by photographing with a gel imaging system.

Table 1 shows the preparation of SDS polyacrylamide gels.

TABLE 1 preparation of SDS Polyacrylamide gels

EXAMPLE 1 screening and cloning of novel genes

Bt genome extraction

S1: 5mL of 1M Tris-HCl, 1mL of 0.5M EDTA, 171.15g of sucrose, pH7.0, constant volume to 500mL, and sterilization at 115 ℃ for 20 min.

S2：10％SDS 4mL+ddH₂O 6mL，pH4.8-5.2。

S3: 5M guanidinium isothiocyanate, 1M NaAc.

TE: 3mL of 10mM Tris-HCL, 600ul of 1mM EDTA, pH8.0, and diluting to 300 mL.

1) Inoculating strain 261-1 of Bacillus thuringiensis on LB culture medium by streaking, and culturing at 30 deg.C overnight;

2) scrape all the cells on the plate as much as possible into a 1.5ml EP tube, and suspend them thoroughly with 150. mu. l S1;

3) adding 100mg of quartz sand, and crushing for 1 minute on a tissue crusher;

4) adding 200 mu l S2, and fully and uniformly mixing;

5) adding 400 mu l S3, fully mixing, and centrifuging at 12000rpm for 10 minutes;

6) transferring the supernatant of the uppermost layer into a 1.5EP tube, adding isopropanol with the same volume, uniformly mixing, and standing for 20 minutes at-20 ℃;

7) centrifuging at 12000rpm for 10min, and discarding the supernatant;

8) washing the precipitate with 70% anhydrous ethanol, and air drying at room temperature;

9) adding 100 mul TE solution to dissolve the precipitate;

10) the extracted genome is checked for quality and concentration by 0.7% agarose gel electrophoresis, and stored at-20 ℃ for later use.

PCR amplification was carried out using 261sip01_ F (seamless BamH I) ATGACTGGTGGACAGCAAATGGGTCGGATGCATTCTATTAAACGATAT (SEQ ID No.3) and 261sip01_ R (seamless BamH I) TGTCGACGGAGCTCGAATTCGGATCAATTAATGGTTCATTATTTTTCAT (SEQ ID No.4) as primers and 261-1 strain genome as a PCR template. And (3) amplification circulation: pre-denaturation at 94 ℃ for 10 min; denaturation at 94 deg.C for 1 min; annealing at 62 deg.C for 1 min; stretching at 72 ℃; 30 cycles, final extension at 72 ℃ for 10min, PCR products were detected by electrophoresis on 1% agarose gel. PCR product recovery was performed according to the instructions of Axygen's DNA recovery kit. After BamH I digestion of pET-21b, DNA fragment ligation was performed with the PCR purified product. Then, 10. mu.L of the ligation product was added to 100. mu.L of DH 5. alpha. competent cells and ice-cooled for 30 min; thermally shocking at 42 deg.C for 90s, ice-cooling for 5min, adding 800 μ L LB liquid culture medium, and culturing at 37 deg.C for 1 h; 200 mu L of the bacterial liquid is smeared on a corresponding resistant (ampicillin resistant) LB plate, cultured for 12-18h at 37 ℃, and a positive transformant containing a positive plasmid is screened out, wherein the positive plasmid is named as pET-261sip 01.

Through sequencing analysis, the 261sip01(SEQ ID No.1) gene length is 1197bp, the coded protein is 261sip01, and the total 399 amino acids (SEQ ID No.2) express 45kDa protein.

The pET-261sip01 recombinant plasmid was then extracted and transformed into the expression strain Rosetta (DE 3). 261sip01 is subjected to IPTG induction expression in Escherichia coli Rosetta (DE3), and SDS-PAGE electrophoresis results show that 261sip01 gene is expressed in both soluble components and insoluble components; in which approximately 45kDa or so protein is expressed, consistent with the expected results. The negative control, i.e.E.coli Rosetta (DE3) which did not contain the 261sip01 gene but contained the pET-21b vector, had no expression band for the corresponding protein in both the soluble and insoluble fractions.

Example 2

Expression and quantitative analysis of proteins

Escherichia coli Rosetta (DE3) strain carrying 261sip01 gene was inoculated in LB liquid medium at an inoculum size of 1%, cultured at 37 ℃ to OD₆₀₀When the value reached between 0.5 and 1.0, the inducer 50mM IPTG was added and induction was carried out at 150rpm at a low temperature of 20 ℃ for 12 hours. Then centrifuged at 8000rpm for 3min at 4 ℃. The cells were collected by centrifugation and suspended in 50mM Tris & Cl (pH 8.0); breaking thallus (completely breaking by ultrasonic wave), centrifuging the ultrasonically broken bacteria liquid at 4 deg.C at 12,000rpm for 15 min; the supernatant was then collected. The supernatant was subjected to quantitative SDS-PAGE analysis as follows: the following 5 different concentration gradients of BSA were prepared: 0.8. mu.g/. mu.L, 0.4. mu.g/. mu.L, 0.2. mu.g/. mu.L, 0.1. mu.g/. mu.L, 0.05. mu.g/. mu.L, and the target Protein was subjected to gradient dilution so that the final concentration thereof was 0.8 to 0.05. mu.g/. mu.L, and the amounts of the target Protein and 5 kinds of BSA (Protein quantification kit: DC Protein Assay) with different concentrations were each 10. mu.L, and Protein electrophoresis was carried out. A protein concentration standard curve was prepared using Bovine Serum Albumin (BSA) as a standard protein, and the total protein concentration in the recombinant strain of Escherichia coli Rosetta (DE3) was determined. And analyzing the proportion of the target protein in SDS-PAGE by combining ImageMaster VDS software, and calculating the target protein to obtain the concentration of 261sip01 in the supernatant.

Comparative example 1

The expression product of cry8G (SEQ ID No.5) gene cloned into pET21b under the same conditions in Escherichia coli Rosetta (DE3)) was used as a positive control for the assay of biological activity. Expression of the Cry8G (SEQ ID No.6) protein was the same as in example 2. Wherein the expression product of the protein is mainly distributed in the precipitate, i.e. mainly exists in the form of inclusion body, therefore, the precipitate product is used for carrying out the subsequent biological activity determination. Before quantitative analysis and subsequent determination of biological activity, the inclusion bodies are first subjected to conventional solubilization, and the subsequent quantitative analysis is the same as in example 2.

Example 3

Activity assay

The Holotrichia oblita (Holotrichia oblita) is provided by the institute for plant protection, academy of agriculture and forestry, Cangzhou.

(1) Cutting the potatoes into filaments, airing the filaments in the sun until the water loss is about 60% -90%, and meanwhile, exposing the screened soil in the sun for 2-3 hours;

(2) soaking the dried shredded potatoes in a prepared serial diluted supernatant (added with a detergent with a final concentration of 0.1%) for 30 s;

(3) then, the shredded potatoes are respectively arranged in six-hole plates;

(4) mixing the supernatant fluid soaked with the shredded potatoes with soil according to the proportion of adding 18mL of solution into every 100g of soil, and filling the mixed soil into six-hole plates;

(5) inoculating healthy larvae of 5-day-old northern China Holotrichia parallela into a six-hole plate, inoculating 1 test insect into each hole, performing treatment for every 30 test insects, repeating the treatment for three times, and strictly sealing after the inoculation to prevent the larvae from climbing out;

(6) placing in a biochemical incubator at 25 ℃, wherein the photoperiod is 16 h: observing whether the potato shreds are mildewed or not (in order to avoid the mildewing of potatoes) and whether water vapor is condensed or not (in order to avoid the overhigh water content) every day when the humidity is about 50 percent after 8 hours, and adjusting the water content in the biochemical incubator to keep the humidity in the incubator;

(7) after 7 days, the number of dead and live insects in each treatment was investigated, and the mortality, survival, corrected mortality and LC were calculated₅₀。

Wherein LC is performed on the test insects₅₀Before measurement, the concentration range of the insecticidal is preliminarily determined by the above biological activity measurement method through preliminary screening, then the insecticidal activity under a series of concentration gradients is measured, and LC is calculated₅₀. Mortality and corrected mortality at a particular concentration are calculated as follows:

the lethal middle concentration (LC) was calculated from the bioassay data using SPSS (V13.0) software₅₀). The results are shown in Table 2.

TABLE 2

As can be seen from the results in table 2, the 261sip01 insecticidal protein of the present application has significantly better activity against Holotrichia parallela albugo in North China than the known Cry-class insecticidal protein Cry 8G. The 261sip01 insecticidal protein is used for preventing and treating Holotrichia parallela in North China, not only provides a novel insecticidal protein, but also can remarkably reduce the production cost, thereby bringing more considerable economic benefits.

While the present invention has been described with reference to the preferred embodiments thereof, it will be understood by those skilled in the art that various changes may be made without departing from the true spirit and scope of the invention. For example, many modifications may be made to adapt a particular situation, material, composition of matter, or method step to the teachings of the invention. All such modifications are intended to be included within the scope of the present invention as defined in the appended claims. Moreover, the technical content disclosed above is subject to some variations or modifications, which are equivalent to the equivalent embodiments, and all fall within the scope of the technical solution.

LHA1760149 nucleotide and amino acid sequence Table

<110> institute of plant protection of Chinese academy of agricultural sciences

<120> a novel insecticidal protein and nucleotide sequence thereof

<130> LHA1760149

<160> 6

<170> PatentIn version 3.5

<210> 1

<211> 1197

<212> DNA

<213> Bacillus thuringiensis (Bacillus thuringiensis)

<223> 261sip01

<400> 1

ATGCATTCTATTAAACGATATAAAAAAATGGGAATTGTTGTTCCACTGGCTTGTTTATTAGGTACAGGTTTTACATTTGTGAATCAGCCAATTCATGCCGCTGCGGCAGTTACAACTAATGCTACAGTTACTAATAATGCTTCAGCAGAGTTTAAGGAAGTTGATTTAAATACTTTACGTGGAGATCTATACGAAAGATATTTTACATTATTATTAACAAAACCTGAATTAATTGGTGGAGAAGCTGCTTGGAAATCATGGGGTGATGATTCAAAAGCGAATTATAATATAAAGTATAATATGACTCAGTGGGTTGAAAATTTAAAACAGGGAAATTATAAATATTTTGAAGAGACTTGGGGGGGATTTGGTTCGTTAGCAAGACATATTGGTCAAATAAATGCATTTTTAGATTGGAATCCTCAATATAGTAATACAACTAAAAATTATGATTTAAAAGCAATACCAGGAGATATAAATCATGATTCAATAGAAGTATATAAATATACTAATCCCGCAAATTCTGTGGAACAAAAGTTTTTAACAGATGCAAAAGATGTTGAAATCGGACATACATTCACAGAAACTCATACTACTGGGGGGAAATTCGGATATAATGCTGCAACTACATTTAAAGTAGGTGTACCATTAAATCAAGCTACAACAACACATACGTTTACATTTGAAGCAAATTATAATTATACAAATACACATACAAAAACAGATAAAGAAACAAAACATTATCCATCTCAAACAGTAATTTGTAAACCTGGTTATACTACAAAATTAACAATTGATAAATCTACAGCAACTTATACTGGAGATTTGGAGTTTGATATTGGAGCAAGTGCAGAAGAGTTAATAACTAAAATTAATGCGAATATTAAGGATCTACCTAATCATACAAACAAGAATTATAAAGGACCTAAAACTACAATAAAAGCAGATTCAGAAGAATTCTTGTATAATTTATATAAATATTCAGGATATGATCTTCCATCATATATAACATTAGATGATGAGCATAAAACCGTGTCATTTGGAAAAGTAAAAAGTACCTATAGTGGTGTAACAGGTACAGCAAGTGAAATGATATTAGAATTGATACCAATTGATCCAAAAGATACAACAAAGAAACCAATAAAAATGCTTTTCAAAGAATATCAACAAAAAATGAAAAATAATGAACCATTAATT；

<210> 2

<211>399

<212> PRT

<213> Bacillus thuringiensis (Bacillus thuringiensis)

<223> 261sip01

<400> 2

MHSIKRYKKMGIVVPLACLLGTGFTFVNQPIHAAAAVTTNATVTNNASAEFKEVDLNTLRGDLYERYFTLLLTKPELIGGEAAWKSWGDDSKANYNIKYNMTQWVENLKQGNYKYFEETWGGFGSLARHIGQINAFLDWNPQYSNTTKNYDLKAIPGDINHDSIEVYKYTNPANSVEQKFLTDAKDVEIGHTFTETHTTGGKFGYNAATTFKVGVPLNQATTTHTFTFEANYNYTNTHTKTDKETKHYPSQTVICKPGYTTKLTIDKSTATYTGDLEFDIGASAEELITKINANIKDLPNHTNKNYKGPKTTIKADSEEFLYNLYKYSGYDLPSYITLDDEHKTVSFGKVKSTYSGVTGTASEMILELIPIDPKDTTKKPIKMLFKEYQQKMKNNEPLI；

<210>3

<211> 48

<212> DNA

<213> Artificial sequence

<223> 261sip01_F

<400> 3

ATGACTGGTGGACAGCAAATGGGTCGGATGCATTCTATTAAACGATAT；

<210> 4

<211> 49

<212> DNA

<213> Artificial sequence

<223>261sip01_R

<400> 4

TGTCGACGGAGCTCGAATTCGGATCAATTAATGGTTCATTATTTTTCAT；

<210> 5

<211> 3468

<212> DNA

<213> Bacillus thuringiensis (Bacillus thuringiensis)

<223> cry8G

<400> 5

ATGAGTCCGAATAATCAGAACGAATATGAAATTATAGATGCGTCATCACCTACTTCTGTATCTAATAACTCAGTGAAATACCCTTTAGCAAGTGATCAAACGACCACATTACAAAATATGAACTATAAAGATTATCTGAGAATGTCTGAGGGAGAGAATCCTGAATTATTTGGAAATCCAGAGACGTTTATTAGTGCGCAGGATGCGGTTGGAACTGGGATTGATATTGTGAGTAAACTACTAGGTAGTTTAGGGGTTCCACTTGTTGGGCAAGCCGCAACGGCACTTAAATGGATTATAGGTAAATTGTGGCCTTCTTCAGGAAACCCGTGGGATGATTTGATGACGGCAGTAGAAGAACTCATAAATCAAAAAATAGAAGCATATGCAAGAAGTAAGGCACTTGCTGAATTGGGTGTTTCGGGAAGAGCTGTAAAATCCTATCAAACCGCACTTGAAGAGTGGCAAAAAAACCCGAATAACGCGCGAAGCGCAGCACTTGTAAGGGAAAGATTTTCAGATGCAGAACATACATTGCGTACTCAAATGAGTTTATTTACCGTTCGTGGTTATGAAATTCCGCTTTTAGCAACATATGCACAAGCTGCCAATTTGCATTTGTTTGTAATGAAGGATATTCAAATTTACGGGAGAGAATGGGGATATACTCAGGGAGATATTAACCTTTTCTATCGAGAACAAGTAGAATTTACAGGGGAATACTCTGATTATTGTGTTAAGTGGTACAATGCTGGCTTAGATAAATTAAGAGGCTCGACTGCTCTACAATGGATTAACTATAATCGTTTCCGCAGAGAAATGACAGTGATGGCACTGGATATAGTTGCATTATTCCCAAATTATGACATACGCATGTATCCAATGAAAACAACCGCAGAATTAACGCGAAGAATTTATACAGATCCGCTTGGTTATACGGGAAGTGGGTCTAACACGCCACCATGGTATAATTATGGATATTCTTTCTCATGGATAGAAAATAATGCCGTGCCAGCACCTGGATTGTTCCAGTGGTTACAAGGAATTGGGATTTATACTAAATTTGCTCGTATAACTCCATTTTATGCGAACTATTGGTCAGGACATACTGTATTTTATAAATTTACTAACGATTCTACTGAGAGACGTGTTCAGTATGGAGATACAGATACTCCAGAATTAGATAGTTCTTCCTTTGAAAATGTTGACATTTATAAGGTTTCAGCATCAGTTGGTTCGTACAAAAGTAATACCGTACTATTACCAACTTTTAAAGCTACTTTTGAGGGGGTAAATCAAAATAATCAGTTAAAGACCTTTAGGTATCAAAAAGAATCTAATGTCCCAAGTCAAACGAAAAACTCAACCACAGAGCTGCCTGTTCAGTTATCAACTCCGCCTACTTACGGAGATTCTGAACAGTACAGTCATAGACTAGCCTATGTTTTTGATGCCCCAATCGATTCATATACAGGCATATATCGCATGTATGGATTTGCCCCTATTCTTGGTTGGACACATATTAGTGTAAGTCGTGACAATAGGATTGATCCAGATAAAATTACTCAAATTCCAGCTGTAAAGGCATATGCTGAGGGTCTTGCTAATTATATCAAAGATCCGGGGTTTACAGGAGGAGATTTATTAGCTTTAGGTAGAAACTCAAATACTTCATTGATTGTCAATTTTTCGAAGCCTCAAACATACCGTATTCGTATTCGTTATGCTGCTAGTAAAACTTCGTATTTTCAACTACGTGGGCTGCATAATATAGCTCAGTCTCAGCGTTTCGAAGCGACGTATTCTAATAAAAATGAAAACGATTTGACATTTAACGATTTTAAATATGTAGAAATTCAAAAAACTGTTTCAATAGACAATCCATCAGAAAGTCGTAGTATAAGTATATACACTCAATCAGATACAGAATACTTATTATGGACAAATCGAATTCATCCCAGTAGATGCAACATTTGGAGCGGAACAAGACCTAGATGTGGCAAAGAAAGCGGTGAATGGCTTGTGTACCAATACAAAAGATGCCTTACAGACAAGTGTAACGGATTATCAAGTCAATCAAGCGGCAAACTTAGTAGAATGCCTATCGATGAGTTATACCCAAATGAAAAACGCATGTTATGGGATGCAGTGAAAGAGGCGAAACGACTTGTTCAGGCACGTAACTTACTCCAAGATACAGGCTTTAATGTAATAAATGGAGAAAACGGATGGACGGGAAGTACGGGAATTGAGGTTGTGGAAGGGGATGTTCTGTTTAAAGATCGTTCGCTTCGTTTGCCAAGTGCGAGAGAGATTGATACAGAAACATATCCAACGTATCTCTATCAACAAATAGATGAATCGCTTTTAAAACCATATACAAGATATAGACTAAGAGGTTTTATAGGAAGTAGTCAAGATTTAGAGATTAAATTAATACGTCATCGGGCAAATCAAATTGTCAAAAATGTACCGGATAACCTCTTGCCAGATGTACGCCCTGTCAATTCTTGTGGTGGAGTCGATCGCTGCAGTGAACAACAGTATGTAGACGCGAATTTAGCACTCGAAAACAATGGAGAAAATAGAAATATGTCTTCTGATTCCCATGCATTTTCTTTCCATATGGATACAGGTGAAATAGATTTAAATGAAAATACAGGTATTTGGGTCGTATTTAAAATTCCGACAACAAATGGATACGCAACATTAGGAAACCTTGAATTGGTAGAAGAGGGGCCATTATCAGGAGACGCACTAGAACGCTTGCAAAGAGAAGAACAGCAGTGGAAGCTTCAAAGAACCAAAAGACGTGAAGAGACGGATAGAAAATATATGGCAGCAAAACAAGCCATTGATCGTTTATTCGCAGATTATCAAGACCAACAACTCAATTCTGGTGTAGAAATGTCAGATTTGCTTGCAGCTCAAAACCTTGTACAGTCCATTCCTTATGTGTATAACGAAATGTTCCCAGAAATCCCTGGAATGAACTATACAAATTTCACAGAGTTAACAAACAGACTCCAACAAGCATGGAATTTGTATGATCTTCGAAATGCTATACCAAATGGAGATTTTCGAAATGGATTAAGTGATTGGAATGCAACATCAGATATAAATGTGCAACAACTAAACGATACATCTGTCCTTGTCATTCCAAACTGGAATTCTCAAGTGTCACAACAATTTACAGTTCAACCGAATTATAGATATGTATTACGTGTCACAGCGAGAAAAGAGGGAGCAGGAGACGGATATGTGATCATCCGTGATGGTACAAATCAGACAGAAACACTCGCATTTAATACATGTGATAATGATGCAGGTGTTTTATCTACTAATCAAGCTAGCTATATCACAAAAACAGTGGAATTCACGCCATCTACAGAGCAAGTTTGGATTGACATGAGTGAGACCGAAGGTGTATTCAACATAGAAAGTGTAGAACTCGTGTTAGAAGAAGAG；

<210> 6

<211> 1156

<212> PRT

<213> Bacillus thuringiensis (Bacillus thuringiensis)

<223> Cry8G

<400> 6

MSPNNQNEYEIIDASSPTSVSNNSVKYPLASDQTTTLQNMNYKDYLRMSEGENPELFGNPETFISAQDAVGTGIDIVSKLLGSLGVPLVGQAATALKWIIGKLWPSSGNPWDDLMTAVEELINQKIEAYARSKALAELGVSGRAVKSYQTALEEWQKNPNNARSAALVRERFSDAEHTLRTQMSLFTVRGYEIPLLATYAQAANLHLFVMKDIQIYGREWGYTQGDINLFYREQVEFTGEYSDYCVKWYNAGLDKLRGSTALQWINYNRFRREMTVMALDIVALFPNYDIRMYPMKTTAELTRRIYTDPLGYTGSGSNTPPWYNYGYSFSWIENNAVPAPGLFQWLQGIGIYTKFARITPFYANYWSGHTVFYKFTNDSTERRVQYGDTDTPELDSSSFENVDIYKVSASVGSYKSNTVLLPTFKATFEGVNQNNQLKTFRYQKESNVPSQTKNSTTELPVQLSTPPTYGDSEQYSHRLAYVFDAPIDSYTGIYRMYGFAPILGWTHISVSRDNRIDPDKITQIPAVKAYAEGLANYIKDPGFTGGDLLALGRNSNTSLIVNFSKPQTYRIRIRYAASKTSYFQLRGLHNIAQSQRFEATYSNKNENDLTFNDFKYVEIQKTVSIDNPSESRSISIYTQSDTEYLLWTNRIHPSRCNIWSGTRPRCGKESGEWLVYQYKRCLTDKCNGLSSQSSGKLSRMPIDELYPNEKRMLWDAVKEAKRLVQARNLLQDTGFNVINGENGWTGSTGIEVVEGDVLFKDRSLRLPSAREIDTETYPTYLYQQIDESLLKPYTRYRLRGFIGSSQDLEIKLIRHRANQIVKNVPDNLLPDVRPVNSCGGVDRCSEQQYVDANLALENNGENRNMSSDSHAFSFHMDTGEIDLNENTGIWVVFKIPTTNGYATLGNLELVEEGPLSGDALERLQREEQQWKLQRTKRREETDRKYMAAKQAIDRLFADYQDQQLNSGVEMSDLLAAQNLVQSIPYVYNEMFPEIPGMNYTNFTELTNRLQQAWNLYDLRNAIPNGDFRNGLSDWNATSDINVQQLNDTSVLVIPNWNSQVSQQFTVQPNYRYVLRVTARKEGAGDGYVIIRDGTNQTETLAFNTCDNDAGVLSTNQASYITKTVEFTPSTEQVWIDMSETEGVFNIESVELVLEEE。

Claims

1. An insecticidal protein, the amino acid sequence of which is shown in SEQ ID No. 2.

2. A nucleic acid encoding the pesticidal protein of claim 1.

3. The nucleic acid according to claim 2, wherein the sequence of the nucleic acid is represented by SEQ ID number 1.

4. A composition comprising the pesticidal protein of claim 1.

5. The composition of claim 4, wherein the sequence of the nucleic acid encoding the pesticidal protein is set forth in SEQ ID number 1.

6. A transgenic microorganism comprising the nucleic acid of claim 2 or 3 and capable of producing the pesticidal protein of claim 1.

7. The transgenic microorganism according to claim 6, wherein the transgenic microorganism comprises at least one of Bacillus (Bacillus), Pseudomonas (Pseudomonas), Enterobacter (Escherichia), and Yeast (Saccharomyces).

8. The transgenic microorganism according to claim 7, wherein the Bacillus comprises at least one of Bacillus thuringiensis (Bacillus thuringiensis), Bacillus subtilis (Bacillus subtilis), Bacillus atrophaeus (Bacillus atrophaeus) and Bacillus cereus (Bacillus cereus); the Pseudomonas bacteria comprise Pseudomonas fluorescens (Pseudomonas fluorescens); the enterobacteria include Escherichia coli (Escherichia coli).

9. Use of a nucleic acid according to claim 2 or 3 for the preparation of a transgenic plant capable of producing the pesticidal protein of claim 1; the transgenic plant includes at least one of Cruciferae (Cruciferae), Solanaceae (Solanaceae), Umbelliferae (Umbelliferae), Cucurbitaceae (Cucurbitaceae), Araceae (Araceae), Gramineae (Liliaceae), Leguminosae (Leguminosae), Papilionaceae (Papilionoceae), Chenopodiaceae (Chenopodiaceae), Compositae (Compositae) and Malvaceae (Malvaceae).

10. The use according to claim 9, wherein the transgenic plant comprises Brassica (Brassica), Raphanus (Raphanus), Nicotiana (Nicotiana), Lycopersicon (Lycopersicon), Solanum (Solanum), Capsicum (Capsicum), Daucus (Daucus), Apium (Apium), parsley (Petroselinum), anise (Foeniculum), Cucurbita (Cucurbita), Cucumis (Cucumis), Cucurbita (benina), Luffa (Luffa), Citrullus (Citrullus), Cucumis (cucum), agrimonia (alorhus), Sorghum (Sorghum), Setaria (Setaria), Oryza (Oryza), Saccharum (Saccharum), Triticum (Triticum), Glycine (Glycine), soybean (Glycine), asparagus (Brassica), alfalfa (Brassica), or alfalfa (garden).

11. The use according to claim 10, wherein the transgenic plant comprises rape (Brassica campestris), Chinese cabbage (Brassica rapa), pakchoi (Brassica chinensis), cabbage (Brassica oleracea), radish (raphius), tomato (Lycopersicon esculentum), potato (Solanum tuberosum), eggplant (Solanum melongena), celery (Apium graveolens), parsley (Petroselinum crispum), fennel (Foenicum vulgare), pumpkin (Cubita peltata), pumpkin (Cucurbita moschata), cucumber (Cucumis sativus), white gourd (Begonina hispida), towel gourd (Luffa acutangula), watermelon (Citrus citrullosa), melon (Citrus vulgaris (Citrus luteus), cucumber (Amunicus), wheat (Brassica oleracea), wheat (Sorghum vulgara), alfalfa (Sorghum vulgare sativa), corn (Sorghum vulgare), corn (maize (Sorghum vulgare), millet (Sorghum vulgare), corn (Sorghum vulgare), Sorghum vulgare sinensis), corn (maize (Sorghum vulgare), corn (maize), corn (maize), corn (Sorghum vulgare, maize (maize), corn (maize), corn (maize), corn (maize), corn (maize), corn, At least one of lettuce (Lactuca sativa), sunflower (Helianthus), and okra (Abelmoschus esculentus).

12. A method of producing the pesticidal protein of claim 1, comprising using the transgenic microorganism of any one of claims 6 to 8, and/or using the transgenic plant in the use of any one of claims 9 to 11 to produce the pesticidal protein.

13. The method of claim 12, further comprising purifying the insecticidal protein to a purity of 80% or greater after producing the insecticidal protein using the transgenic microorganism and/or transgenic plant.

14. The method of claim 13, wherein the insecticidal protein is more than 90% pure.

15. The method of claim 14, wherein the insecticidal protein is more than 99% pure.

16. Use of at least one of the insecticidal protein according to claim 1, the composition according to claim 4 or 5, the transgenic microorganism according to any one of claims 6 to 8, and the transgenic plant for use according to any one of claims 9 to 11 for controlling Holotrichia parallela (Holotrichia oblita).