CN106905420B - Novel insecticidal protein and nucleotide sequence thereof - Google Patents
Novel insecticidal protein and nucleotide sequence thereof Download PDFInfo
- Publication number
- CN106905420B CN106905420B CN201710219903.2A CN201710219903A CN106905420B CN 106905420 B CN106905420 B CN 106905420B CN 201710219903 A CN201710219903 A CN 201710219903A CN 106905420 B CN106905420 B CN 106905420B
- Authority
- CN
- China
- Prior art keywords
- corn
- protein
- brassica
- maize
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 104
- 102000004169 proteins and genes Human genes 0.000 title claims abstract description 97
- 230000000749 insecticidal effect Effects 0.000 title claims abstract description 50
- 239000002773 nucleotide Substances 0.000 title abstract description 13
- 125000003729 nucleotide group Chemical group 0.000 title abstract description 13
- 230000000361 pesticidal effect Effects 0.000 claims abstract description 30
- 150000001413 amino acids Chemical group 0.000 claims description 52
- 230000009261 transgenic effect Effects 0.000 claims description 46
- 244000005700 microbiome Species 0.000 claims description 32
- 241000196324 Embryophyta Species 0.000 claims description 26
- 240000008042 Zea mays Species 0.000 claims description 23
- 235000002017 Zea mays subsp mays Nutrition 0.000 claims description 23
- 235000011684 Sorghum saccharatum Nutrition 0.000 claims description 21
- 244000062793 Sorghum vulgare Species 0.000 claims description 21
- 235000011331 Brassica Nutrition 0.000 claims description 20
- 241000219198 Brassica Species 0.000 claims description 20
- 241000193388 Bacillus thuringiensis Species 0.000 claims description 15
- 229940097012 bacillus thuringiensis Drugs 0.000 claims description 14
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 claims description 13
- 235000005822 corn Nutrition 0.000 claims description 13
- 241000219112 Cucumis Species 0.000 claims description 12
- 241000588724 Escherichia coli Species 0.000 claims description 12
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 claims description 12
- 241000219122 Cucurbita Species 0.000 claims description 11
- 235000002595 Solanum tuberosum Nutrition 0.000 claims description 10
- 244000061456 Solanum tuberosum Species 0.000 claims description 10
- 235000010071 Cucumis prophetarum Nutrition 0.000 claims description 9
- 238000000034 method Methods 0.000 claims description 9
- 239000000203 mixture Substances 0.000 claims description 9
- 241000346653 Holotrichia parallela Species 0.000 claims description 8
- 150000007523 nucleic acids Chemical class 0.000 claims description 7
- 241000193830 Bacillus <bacterium> Species 0.000 claims description 6
- 244000221633 Brassica rapa subsp chinensis Species 0.000 claims description 6
- 235000010149 Brassica rapa subsp chinensis Nutrition 0.000 claims description 6
- 241000219109 Citrullus Species 0.000 claims description 6
- 240000008067 Cucumis sativus Species 0.000 claims description 6
- 240000004244 Cucurbita moschata Species 0.000 claims description 6
- 235000009854 Cucurbita moschata Nutrition 0.000 claims description 6
- 239000004471 Glycine Substances 0.000 claims description 6
- 241000589516 Pseudomonas Species 0.000 claims description 6
- 241000209140 Triticum Species 0.000 claims description 6
- 235000021307 Triticum Nutrition 0.000 claims description 6
- 240000007124 Brassica oleracea Species 0.000 claims description 5
- 235000010799 Cucumis sativus var sativus Nutrition 0.000 claims description 5
- 241000220259 Raphanus Species 0.000 claims description 5
- 240000004507 Abelmoschus esculentus Species 0.000 claims description 4
- 241000219317 Amaranthaceae Species 0.000 claims description 4
- 241000208173 Apiaceae Species 0.000 claims description 4
- 241000208306 Apium Species 0.000 claims description 4
- 240000007087 Apium graveolens Species 0.000 claims description 4
- 241000209524 Araceae Species 0.000 claims description 4
- 241000208838 Asteraceae Species 0.000 claims description 4
- 235000000832 Ayote Nutrition 0.000 claims description 4
- 241000193410 Bacillus atrophaeus Species 0.000 claims description 4
- 241000193755 Bacillus cereus Species 0.000 claims description 4
- 244000063299 Bacillus subtilis Species 0.000 claims description 4
- 235000014469 Bacillus subtilis Nutrition 0.000 claims description 4
- 241000219193 Brassicaceae Species 0.000 claims description 4
- 235000002566 Capsicum Nutrition 0.000 claims description 4
- 240000008574 Capsicum frutescens Species 0.000 claims description 4
- 235000009804 Cucurbita pepo subsp pepo Nutrition 0.000 claims description 4
- 241000219104 Cucurbitaceae Species 0.000 claims description 4
- 241000208175 Daucus Species 0.000 claims description 4
- 241000220485 Fabaceae Species 0.000 claims description 4
- 241000212314 Foeniculum Species 0.000 claims description 4
- 241001520019 Holotrichia oblita Species 0.000 claims description 4
- 235000003956 Luffa Nutrition 0.000 claims description 4
- 241000227653 Lycopersicon Species 0.000 claims description 4
- 235000002262 Lycopersicon Nutrition 0.000 claims description 4
- 235000007688 Lycopersicon esculentum Nutrition 0.000 claims description 4
- 241000219071 Malvaceae Species 0.000 claims description 4
- 240000004658 Medicago sativa Species 0.000 claims description 4
- 235000017587 Medicago sativa ssp. sativa Nutrition 0.000 claims description 4
- 241000208125 Nicotiana Species 0.000 claims description 4
- 241000209094 Oryza Species 0.000 claims description 4
- 244000062780 Petroselinum sativum Species 0.000 claims description 4
- 241000589540 Pseudomonas fluorescens Species 0.000 claims description 4
- 241000209051 Saccharum Species 0.000 claims description 4
- 235000005775 Setaria Nutrition 0.000 claims description 4
- 241000232088 Setaria <nematode> Species 0.000 claims description 4
- 241000208292 Solanaceae Species 0.000 claims description 4
- 235000002634 Solanum Nutrition 0.000 claims description 4
- 241000207763 Solanum Species 0.000 claims description 4
- 240000003768 Solanum lycopersicum Species 0.000 claims description 4
- 235000002597 Solanum melongena Nutrition 0.000 claims description 4
- 244000061458 Solanum melongena Species 0.000 claims description 4
- 239000001390 capsicum minimum Substances 0.000 claims description 4
- 235000011197 perejil Nutrition 0.000 claims description 4
- 238000002360 preparation method Methods 0.000 claims description 4
- 235000015136 pumpkin Nutrition 0.000 claims description 4
- 235000011303 Brassica alboglabra Nutrition 0.000 claims description 3
- 235000011302 Brassica oleracea Nutrition 0.000 claims description 3
- 235000012828 Citrullus lanatus var citroides Nutrition 0.000 claims description 3
- 241000207199 Citrus Species 0.000 claims description 3
- 235000015510 Cucumis melo subsp melo Nutrition 0.000 claims description 3
- 244000020551 Helianthus annuus Species 0.000 claims description 3
- 235000003222 Helianthus annuus Nutrition 0.000 claims description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 claims description 3
- FJJCIZWZNKZHII-UHFFFAOYSA-N [4,6-bis(cyanoamino)-1,3,5-triazin-2-yl]cyanamide Chemical compound N#CNC1=NC(NC#N)=NC(NC#N)=N1 FJJCIZWZNKZHII-UHFFFAOYSA-N 0.000 claims description 3
- 235000020971 citrus fruits Nutrition 0.000 claims description 3
- 235000003934 Abelmoschus esculentus Nutrition 0.000 claims description 2
- 235000002764 Apium graveolens Nutrition 0.000 claims description 2
- 235000015849 Apium graveolens Dulce Group Nutrition 0.000 claims description 2
- 235000010591 Appio Nutrition 0.000 claims description 2
- 235000011274 Benincasa cerifera Nutrition 0.000 claims description 2
- 244000036905 Benincasa cerifera Species 0.000 claims description 2
- 244000060924 Brassica campestris Species 0.000 claims description 2
- 235000005637 Brassica campestris Nutrition 0.000 claims description 2
- 235000003899 Brassica oleracea var acephala Nutrition 0.000 claims description 2
- 235000011301 Brassica oleracea var capitata Nutrition 0.000 claims description 2
- 235000001169 Brassica oleracea var oleracea Nutrition 0.000 claims description 2
- 240000008100 Brassica rapa Species 0.000 claims description 2
- 235000011292 Brassica rapa Nutrition 0.000 claims description 2
- 235000000536 Brassica rapa subsp pekinensis Nutrition 0.000 claims description 2
- 244000241235 Citrullus lanatus Species 0.000 claims description 2
- 235000009852 Cucurbita pepo Nutrition 0.000 claims description 2
- 241000588914 Enterobacter Species 0.000 claims description 2
- 241000305071 Enterobacterales Species 0.000 claims description 2
- 241000588722 Escherichia Species 0.000 claims description 2
- 235000004204 Foeniculum vulgare Nutrition 0.000 claims description 2
- 241000234280 Liliaceae Species 0.000 claims description 2
- 241000208317 Petroselinum Species 0.000 claims description 2
- 240000009164 Petroselinum crispum Species 0.000 claims description 2
- 235000002770 Petroselinum crispum Nutrition 0.000 claims description 2
- 241000209504 Poaceae Species 0.000 claims description 2
- 235000006140 Raphanus sativus var sativus Nutrition 0.000 claims description 2
- 241000235070 Saccharomyces Species 0.000 claims description 2
- 239000001387 apium graveolens Substances 0.000 claims description 2
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 claims 10
- 235000009973 maize Nutrition 0.000 claims 10
- 102000039446 nucleic acids Human genes 0.000 claims 6
- 108020004707 nucleic acids Proteins 0.000 claims 6
- 235000003228 Lactuca sativa Nutrition 0.000 claims 2
- 240000008415 Lactuca sativa Species 0.000 claims 2
- 241000219138 Luffa Species 0.000 claims 2
- 235000016993 Agrimonia Nutrition 0.000 claims 1
- 244000307697 Agrimonia eupatoria Species 0.000 claims 1
- 244000003416 Asparagus officinalis Species 0.000 claims 1
- 235000005340 Asparagus officinalis Nutrition 0.000 claims 1
- 244000183685 Citrus aurantium Species 0.000 claims 1
- 235000016840 Citrus aurantium var. amara Nutrition 0.000 claims 1
- 235000009849 Cucumis sativus Nutrition 0.000 claims 1
- 235000010469 Glycine max Nutrition 0.000 claims 1
- 244000068988 Glycine max Species 0.000 claims 1
- 241000208818 Helianthus Species 0.000 claims 1
- 235000018780 Luffa acutangula Nutrition 0.000 claims 1
- 244000280244 Luffa acutangula Species 0.000 claims 1
- 240000009023 Myrrhis odorata Species 0.000 claims 1
- 235000007265 Myrrhis odorata Nutrition 0.000 claims 1
- 235000012550 Pimpinella anisum Nutrition 0.000 claims 1
- 235000019713 millet Nutrition 0.000 claims 1
- 125000003275 alpha amino acid group Chemical group 0.000 abstract 8
- 230000000694 effects Effects 0.000 description 25
- 239000000243 solution Substances 0.000 description 12
- 239000006228 supernatant Substances 0.000 description 9
- 108020004414 DNA Proteins 0.000 description 7
- 241000607479 Yersinia pestis Species 0.000 description 7
- 238000001962 electrophoresis Methods 0.000 description 7
- 239000000499 gel Substances 0.000 description 7
- 239000000047 product Substances 0.000 description 7
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- 239000007788 liquid Substances 0.000 description 5
- 238000002156 mixing Methods 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 235000012015 potatoes Nutrition 0.000 description 5
- 239000002244 precipitate Substances 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 4
- 241000238631 Hexapoda Species 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- 229940098773 bovine serum albumin Drugs 0.000 description 4
- 238000012258 culturing Methods 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 239000002689 soil Substances 0.000 description 4
- 241000254173 Coleoptera Species 0.000 description 3
- 229960000723 ampicillin Drugs 0.000 description 3
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 3
- 239000000427 antigen Substances 0.000 description 3
- 108091007433 antigens Proteins 0.000 description 3
- 102000036639 antigens Human genes 0.000 description 3
- 210000004027 cell Anatomy 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 238000004445 quantitative analysis Methods 0.000 description 3
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 241001465965 Holotrichia Species 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- 244000050983 Luffa operculata Species 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- 244000088415 Raphanus sativus Species 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 108700019146 Transgenes Proteins 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 238000007865 diluting Methods 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 238000003384 imaging method Methods 0.000 description 2
- 210000003000 inclusion body Anatomy 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 231100000956 nontoxicity Toxicity 0.000 description 2
- 229920002401 polyacrylamide Polymers 0.000 description 2
- 239000000523 sample Substances 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 1
- 241000919511 Albugo Species 0.000 description 1
- 101001057129 Bacillus cereus Enterotoxin Proteins 0.000 description 1
- 235000011273 Benincasa Nutrition 0.000 description 1
- 241001148606 Bennia Species 0.000 description 1
- 235000009831 Citrullus lanatus Nutrition 0.000 description 1
- 244000270200 Citrullus vulgaris Species 0.000 description 1
- 235000012840 Citrullus vulgaris Nutrition 0.000 description 1
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 1
- 239000012880 LB liquid culture medium Substances 0.000 description 1
- 241000219823 Medicago Species 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 101000700655 Mycobacterium leprae (strain TN) Serine-rich antigen Proteins 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 241001349593 Praecitrullus Species 0.000 description 1
- 239000006004 Quartz sand Substances 0.000 description 1
- 235000019057 Raphanus caudatus Nutrition 0.000 description 1
- 235000011380 Raphanus sativus Nutrition 0.000 description 1
- 240000000111 Saccharum officinarum Species 0.000 description 1
- 235000007201 Saccharum officinarum Nutrition 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 240000006394 Sorghum bicolor Species 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 238000007605 air drying Methods 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 238000009835 boiling Methods 0.000 description 1
- UDSAIICHUKSCKT-UHFFFAOYSA-N bromophenol blue Chemical compound C1=C(Br)C(O)=C(Br)C=C1C1(C=2C=C(Br)C(O)=C(Br)C=2)C2=CC=CC=C2S(=O)(=O)O1 UDSAIICHUKSCKT-UHFFFAOYSA-N 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 235000013339 cereals Nutrition 0.000 description 1
- 230000009194 climbing Effects 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 239000012154 double-distilled water Substances 0.000 description 1
- 238000004043 dyeing Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000000967 entomopathogenic effect Effects 0.000 description 1
- 230000003203 everyday effect Effects 0.000 description 1
- 238000010195 expression analysis Methods 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- ZJYYHGLJYGJLLN-UHFFFAOYSA-N guanidinium thiocyanate Chemical compound SC#N.NC(N)=N ZJYYHGLJYGJLLN-UHFFFAOYSA-N 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 239000002054 inoculum Substances 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 238000000691 measurement method Methods 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000000575 pesticide Substances 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 238000012257 pre-denaturation Methods 0.000 description 1
- 238000011027 product recovery Methods 0.000 description 1
- 238000002731 protein assay Methods 0.000 description 1
- 239000012264 purified product Substances 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 239000012723 sample buffer Substances 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 238000007789 sealing Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000002791 soaking Methods 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 238000005063 solubilization Methods 0.000 description 1
- 230000007928 solubilization Effects 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 239000012137 tryptone Substances 0.000 description 1
- 239000013598 vector Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/32—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Bacillus (G)
- C07K14/325—Bacillus thuringiensis crystal peptides, i.e. delta-endotoxins
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
- A01N63/00—Biocides, pest repellants or attractants, or plant growth regulators containing microorganisms, viruses, microbial fungi, animals or substances produced by, or obtained from, microorganisms, viruses, microbial fungi or animals, e.g. enzymes or fermentates
- A01N63/10—Animals; Substances produced thereby or obtained therefrom
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Wood Science & Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Virology (AREA)
- Pest Control & Pesticides (AREA)
- Dentistry (AREA)
- Microbiology (AREA)
- Environmental Sciences (AREA)
- Biotechnology (AREA)
- Crystallography & Structural Chemistry (AREA)
- Plant Pathology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Agronomy & Crop Science (AREA)
- Agricultural Chemicals And Associated Chemicals (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
Abstract
The present invention relates to a novel insecticidal protein and its nucleotide sequence. The pesticidal protein has an amino acid sequence as at least one of (I) and (II): (I) an amino acid sequence shown as SEQ ID No. 2; (II) an amino acid sequence which has more than 95% of consistency with the amino acid sequence shown as SEQ ID No.2 and has the same function with the amino acid sequence shown as SEQ ID No. 2; preferably, the amino acid sequence has more than 98 percent of consistency with the amino acid sequence shown as SEQ ID No.2 and has the same function with the amino acid sequence shown as SEQ ID No. 2.
Description
Technical Field
The present invention relates to a novel insecticidal protein and its nucleotide sequence.
Background
Bacillus thuringiensis (Bt for short) is a gram-positive bacterium with wide distribution, is an entomopathogenic microorganism with strong toxicity to pests and no toxicity to natural enemies, and has no toxicity to higher animals and people. It is the microbial pesticide which is the most deeply researched and widely used at present and has activity on more than 16 pests of 3000 meshes.
The prior art has generally recognized that Bt can be pesticidally active, primarily due to its ability to produce a variety of Cry, Cyt and Vip proteins.
However, it has been rarely reported that Bt is also capable of producing pesticidal actives other than the above three proteins, particularly pesticidal actives with superior activity against certain coleopteran (Coleoptera) pests, such as Holotrichia parallela (Holotrichia oblita).
Disclosure of Invention
One of the present applications provides an insecticidal protein having an amino acid sequence as at least one of (I) and (II):
(I) an amino acid sequence shown as SEQ ID No. 2;
(II) an amino acid sequence which has more than 95% of consistency with the amino acid sequence shown as SEQ ID No.2 and has the same function with the amino acid sequence shown as SEQ ID No. 2.
It is within the scope of the present application that the pesticidal protein defined by (II) can achieve effects equivalent to or superior to the amino acid sequence shown in SEQ ID No.2 while having the same function as the amino acid sequence shown in SEQ ID No. 2. However, it is within the scope of the present application that the pesticidal protein defined by (II) achieves a slightly inferior effect to the amino acid sequence shown in SEQ ID No.2, for example, an effect of 50% to 99.999% of the effect of the amino acid sequence shown in SEQ ID No.2, while achieving the same function as the amino acid sequence shown in SEQ ID No.2, without affecting the use of the pesticidal protein.
In a specific embodiment, the amino acid sequence of the insecticidal protein is preferably an amino acid sequence which has more than 98% identity with the amino acid sequence shown as SEQ ID No.2 and has the same function as the amino acid sequence shown as SEQ ID No. 2. The insecticidal protein defined in this way can obtain an effect equivalent to or better than the amino acid sequence shown as SEQ ID No.2 while having the same function as the amino acid sequence shown as SEQ ID No.2, which is within the scope of the present application. However, it is within the scope of the present application that the pesticidal protein defined by (II) achieves a slightly inferior effect to the amino acid sequence shown in SEQ ID No.2, for example, an effect of 50% to 99.999% of the effect of the amino acid sequence shown in SEQ ID No.2, while achieving the same function as the amino acid sequence shown in SEQ ID No.2, without affecting the use of the pesticidal protein.
In one embodiment, the amino acid sequence of the insecticidal protein is preferably an amino acid sequence which has more than 99% identity with the amino acid sequence shown as SEQ ID No.2 and has the same function as the amino acid sequence shown as SEQ ID No. 2. The insecticidal protein defined in this way can obtain an effect equivalent to or better than the amino acid sequence shown as SEQ ID No.2 while having the same function as the amino acid sequence shown as SEQ ID No.2, which is within the scope of the present application. However, it is within the scope of the present application that the pesticidal protein defined by (II) achieves a slightly inferior effect to the amino acid sequence shown in SEQ ID No.2, for example, an effect of 50% to 99.999% of the effect of the amino acid sequence shown in SEQ ID No.2, while achieving the same function as the amino acid sequence shown in SEQ ID No.2, without affecting the use of the pesticidal protein.
In one embodiment, the amino acid sequence of the insecticidal protein is preferably an amino acid sequence which has a more than 99.5% identity with the amino acid sequence shown as SEQ ID No.2 and has the same function as the amino acid sequence shown as SEQ ID No. 2. The insecticidal protein defined in this way can obtain an effect equivalent to or better than the amino acid sequence shown as SEQ ID No.2 while having the same function as the amino acid sequence shown as SEQ ID No.2, which is within the scope of the present application. However, it is within the scope of the present application that the pesticidal protein defined by (II) achieves a slightly inferior effect to the amino acid sequence shown in SEQ ID No.2, for example, an effect of 50% to 99.999% of the effect of the amino acid sequence shown in SEQ ID No.2, while achieving the same function as the amino acid sequence shown in SEQ ID No.2, without affecting the use of the pesticidal protein.
In a specific embodiment, the insecticidal protein can also be a protein with the same function as the insecticidal protein with the amino acid sequence shown in (I) after the amino acid sequence shown in (I) is substituted and/or deleted and/or one or more amino acids are added. The insecticidal protein defined in this way can obtain an effect equivalent to or better than the amino acid sequence shown as SEQ ID No.2 while having the same function as the amino acid sequence shown as SEQ ID No.2, which is within the scope of the present application. However, it is within the scope of the present application that the pesticidal protein defined by (II) achieves a slightly inferior effect to the amino acid sequence shown in SEQ ID No.2, for example, an effect of 50% to 99.999% of the effect of the amino acid sequence shown in SEQ ID No.2, while achieving the same function as the amino acid sequence shown in SEQ ID No.2, without affecting the use of the pesticidal protein.
The insecticidal activity of the insecticidal protein of the application on pests, particularly on Holotrichia parallela in North China is remarkably superior to that of the insecticidal protein in the prior art, and the insecticidal protein can make up for the defect that Cry8G protein is weak in insecticidal activity on Holotrichia parallela in North China. Therefore, the method enriches insecticidal protein resources, provides a new gene source for transgenic crops and engineering strains, improves the insect-resistant effect of Bt transgenic products, and has important economic, social and ecological benefits.
The second aspect of the present application provides a nucleotide sequence encoding any one of the pesticidal proteins according to the first aspect of the present application. The nucleotide sequence can be obtained by taking a source strain thereof as a template or a cloned full-length DNA fragment as a template through PCR amplification; it can also be artificially synthesized according to a given sequence.
In a specific embodiment, when the amino acid sequence of the pesticidal protein is shown as SEQ ID No.2, the nucleotide sequence encoding the pesticidal protein is shown as SEQ ID No. 1.
The third application provides a composition comprising at least one insecticidal protein according to one of the first to third applications.
In a specific embodiment, when the amino acid sequence of the pesticidal protein is shown as SEQ ID No.2, the nucleotide sequence encoding the pesticidal protein is shown as SEQ ID No. 1.
The fourth aspect of the present application provides a transgenic microorganism comprising the nucleotide sequence of the second aspect of the present application and capable of producing the pesticidal protein of the first aspect of the present application.
In a particular embodiment, it is preferred that the transgenic microorganism comprises at least one of Bacillus (Bacillus), Pseudomonas (Pseudomonas), enterobacter (Escherichia), and yeast (Saccharomyces).
In a specific embodiment, it is preferable that the Bacillus includes at least one of Bacillus thuringiensis (Bacillus thuringiensis), Bacillus subtilis (Bacillus subtilis), Bacillus atrophaeus (Bacillus atrophaeus), and Bacillus cereus (Bacillus cereus); the Pseudomonas bacteria comprise Pseudomonas fluorescens (Pseudomonas fluorescens); the enterobacteria include Escherichia coli (Escherichia coli).
In a particular embodiment, the starting strain of the transgenic microorganism of the present application (i.e.the microorganism prior to the transfer into the nucleotide sequence described in the second application) is a wild-type microorganism and/or a genetically engineered microorganism.
Wherein, the wild microorganism refers to a microorganism which is separated from the nature and is not artificially modified.
Genetically engineered microorganisms refer to microorganisms artificially modified from wild microorganisms.
The species of the transgenic microorganism and/or genetically engineered microorganism of the present application is not changed by the transgenic modification, and therefore, the transgenic microorganism is the same species as the microorganism before the transgene occurs (i.e., as a recipient microorganism).
In one embodiment, the nucleic acid sequence described in the second application above can be linked to an expression vector. The expression vector may be, for example, a pSTK expression vector capable of shuttling in E.coli and B.thuringiensis.
The fifth aspect of the present application provides the use of a nucleotide sequence according to the second aspect of the present application for the preparation of a transgenic plant, wherein said transgenic plant is capable of producing an insecticidal protein according to the first aspect of the present application; the transgenic plant includes at least one of Cruciferae (Cruciferae), Solanaceae (Solanaceae), Umbelliferae (Umbelliferae), Cucurbitaceae (Cucurbitaceae), Araceae (Araceae), Gramineae (Liliaceae), Leguminosae (Leguminosae), Papilionaceae (Papilionoceae), Chenopodiaceae (Chenopodiaceae), Compositae (Compositae) and Malvaceae (Malvaceae).
In a specific embodiment, it is preferred that the transgenic plant comprises Brassica (Brassica), Raphanus (Raphanus), Nicotiana (Nicotiana), Lycopersicon (Lycopersicon), Solanum (Solanum), Capsicum (Capsicum), Daucus (Daucus), Apium (Apium), parsley (Petroselinum), anisum (Foeniculum), Cucurbita (Cucurbita), Cucumis (Cucumis), Cucurbita (Benincasa), Cucurbita (Luffa), Citrullus (Citrullus), Cucumis (Cucumis), Cucurbita (amophallus), Sorghum (Sorghum), Setaria (Setaria), Oryza (Oryza), Saccharum (Saccharum), Triticum (Glycine), Glycine (Glycine), Brassica), Medicago (Brassica), and at least one species of Brassica (garden).
In a specific example, it is preferred that the transgenic plant includes rape (Brassica campestris), Chinese cabbage (Brassica rapa), pakchoi (Brassica chinensis), cabbage (Brassica oleracea), radish (Raphanus sativus), tomato (Lycopersicon esculentum), potato (Solanum tuberosum), eggplant (Solanum melongena), celery (Apium graveolens), parsley (Petroselinum crispum), fennel (Foenicum vulgare), pumpkin (Cucurbita pepora), pumpkin (Cucurbita moschata), cucumber (Cucumis sativa), white gourd (Bennia hispida), towel gourd (Luffa uva), watermelon (Citrullus vulgaris), watermelon (Citrullus lanatus), melon (Cucumis sativa), cucumber (Amunicolor), cucumber (Brassica sativa), melon (Citrus sativa), wheat (Brassica sativa), alfalfa (Brassica sativa), sugarcane (Brassica sativa), Sorghum vulus), Sorghum vulgare sativa (Brassica sativa), corn (Brassica sativa), Sorghum vulus (Brassica sativa), Sorghum vulus (Brassica sativa), and Sorghum vulus), and Sorghum sativa (Brassica sativa), and Sorghum vulus), and Sorghum sativa (Brassica sativa) including grain (Brassica sativa), and, At least one of sunflower (Helianthus annuus) and okra (Abelmoschus esculentus).
The species of the transgenic plant is not changed by the transgenic modification, and therefore, the transgenic plant is the same species as the plant before the transgene occurs (i.e., as a recipient plant).
The sixth aspect of the present application provides a method for producing an insecticidal protein according to one of the first to the third aspects of the present application, comprising producing said insecticidal protein using a transgenic microorganism according to the fourth aspect of the present application, and/or using a transgenic plant according to the fifth aspect of the present application.
In a specific embodiment, it is preferable that the method further comprises purifying the insecticidal protein to a purity of 80% or more after producing the insecticidal protein using the transgenic microorganism and/or transgenic plant.
In a specific embodiment, it is more preferable that after the production of the insecticidal protein using the transgenic microorganism and/or transgenic plant, the insecticidal protein is purified to have a purity of 90% or more.
In a specific embodiment, the insecticidal protein is purified to a purity of 99% or more even after production of the insecticidal protein using the transgenic microorganism and/or transgenic plant.
Accordingly, the seventh aspect of the present application provides the use of at least one of the pesticidal proteins according to one of the applications, the compositions according to the third aspect of the present application, the transgenic microorganisms according to the fourth aspect of the present application, and the transgenic plants in the use according to the fifth aspect of the present application for controlling at least one pest of the Coleoptera (Coleoptera).
In a particular embodiment, the use of at least one insecticidal protein according to one of the applications, of a composition according to the third of the applications, of a transgenic microorganism according to the fourth of the applications, and of a transgenic plant according to the fifth of the applications for controlling at least one pest of the gill-gold-turtle family (meloenthidae) is preferred.
In a particular embodiment, particular preference is given to the use of at least one of the insecticidal proteins according to one of the applications, the compositions according to the third of the applications, the transgenic microorganisms according to the fourth of the applications, and the transgenic plants for use according to the fifth of the applications for controlling at least one pest in the gill-tortoise (Holotrichia).
In a specific embodiment, most preferably at least one of the insecticidal protein according to one of the present applications, the composition according to the third of the present applications, the transgenic microorganism according to the fourth of the present applications, and the transgenic plant for use according to the fifth of the present applications is used for controlling Holotrichia parallela (Holotrichia oblite).
The technology for preparing monoclonal antibodies is mature, so that the monoclonal antibodies of the insecticidal proteins can be prepared according to the conventional technical means in the prior art. In the process of preparing the monoclonal antibody, the selected antigen can be a full-length sequence of the insecticidal protein in one of the applications, and also can be a partial amino acid sequence of the insecticidal protein in one of the applications. The pure product of the antigen can be obtained by the method for preparing the insecticidal protein provided by the sixth application; the antigen, particularly when it is a partial amino acid sequence, can also be obtained by artificial synthesis. Accordingly, eight of the present applications provide monoclonal antibodies to pesticidal proteins according to one of the present applications. Preferably, the monoclonal antibody is a monoclonal antibody that specifically recognizes only the pesticidal protein.
Unless otherwise indicated herein, all terms used herein are to be understood as being generic to all terms used in the art.
Detailed Description
The present invention will be described in further detail with reference to the following examples, which are provided by way of illustration of preferred embodiments and are not to be construed as limiting the present invention.
1) Liquid LB: tryptone 1%, yeast powder 0.5%, NaCl 1%, pH7.0, 15 pounds sterilized for 15 min. Used for culturing Escherichia coli.
2) Solid LB: 1.3% agar was added to liquid LB medium and 15 lbs. were sterilized for 15 min. Used for culturing Escherichia coli.
3) Antibiotics: ampicillin aqueous solution 100mg/ml, diluted 500 times when using and preserved at-20 ℃. Among them, pET21b plasmid vector has ampicillin resistance.
Electrophoretic detection of proteins
120V pre-electrophoresis for about 10-20min, collecting protein sample 40 μ L, adding 10 μ L5 × sample buffer solution, mixing, diluting the supernatant and precipitate respectively, boiling for 5-10min, centrifuging at 12000rpm for 5min, and collecting 10L supernatant for sampling. Electrophoresis at 80V was carried out at constant pressure until the sample was concentrated to a straight line, and electrophoresis at 150V was carried out at constant pressure until the indicated bromophenol blue reached the bottom of the gel.
And (3) decoloring: and taking out the gel after electrophoresis, washing the gel with distilled water, adding 50mL of the solution I, heating the solution I in a microwave oven for 30s, and oscillating the solution at 60rpm for 10 min.
Dyeing: after the solution I was poured off, solution II (200L of solution III per 50mL of solution II) was added and heated in a microwave oven for 30s with shaking at 60rpm for more than 15 min.
The solution II was decanted, sterile water was added and the gel imaging system was stored photographically.
The observation result shows that the expression of the target protein is compared according to the coloring degree of the protein band, and the target protein is stored by photographing with a gel imaging system.
Table 1 shows the preparation of SDS polyacrylamide gels.
TABLE 1 preparation of SDS Polyacrylamide gels
EXAMPLE 1 screening and cloning of novel genes
Bt genome extraction
S1: 5mL of 1M Tris-HCl, 1mL of 0.5M EDTA, 171.15g of sucrose, pH7.0, constant volume to 500mL, and sterilization at 115 ℃ for 20 min.
S2:10%SDS 4mL+ddH2O 6mL,pH4.8-5.2。
S3: 5M guanidinium isothiocyanate, 1M NaAc.
TE: 3mL of 10mM Tris-HCL, 600ul of 1mM EDTA, pH8.0, and diluting to 300 mL.
1) Inoculating strain 261-1 of Bacillus thuringiensis on LB culture medium by streaking, and culturing at 30 deg.C overnight;
2) scrape all the cells on the plate as much as possible into a 1.5ml EP tube, and suspend them thoroughly with 150. mu. l S1;
3) adding 100mg of quartz sand, and crushing for 1 minute on a tissue crusher;
4) adding 200 mu l S2, and fully and uniformly mixing;
5) adding 400 mu l S3, fully mixing, and centrifuging at 12000rpm for 10 minutes;
6) transferring the supernatant of the uppermost layer into a 1.5EP tube, adding isopropanol with the same volume, uniformly mixing, and standing for 20 minutes at-20 ℃;
7) centrifuging at 12000rpm for 10min, and discarding the supernatant;
8) washing the precipitate with 70% anhydrous ethanol, and air drying at room temperature;
9) adding 100 mul TE solution to dissolve the precipitate;
10) the extracted genome is checked for quality and concentration by 0.7% agarose gel electrophoresis, and stored at-20 ℃ for later use.
PCR amplification was carried out using 261sip01_ F (seamless BamH I) ATGACTGGTGGACAGCAAATGGGTCGGATGCATTCTATTAAACGATAT (SEQ ID No.3) and 261sip01_ R (seamless BamH I) TGTCGACGGAGCTCGAATTCGGATCAATTAATGGTTCATTATTTTTCAT (SEQ ID No.4) as primers and 261-1 strain genome as a PCR template. And (3) amplification circulation: pre-denaturation at 94 ℃ for 10 min; denaturation at 94 deg.C for 1 min; annealing at 62 deg.C for 1 min; stretching at 72 ℃; 30 cycles, final extension at 72 ℃ for 10min, PCR products were detected by electrophoresis on 1% agarose gel. PCR product recovery was performed according to the instructions of Axygen's DNA recovery kit. After BamH I digestion of pET-21b, DNA fragment ligation was performed with the PCR purified product. Then, 10. mu.L of the ligation product was added to 100. mu.L of DH 5. alpha. competent cells and ice-cooled for 30 min; thermally shocking at 42 deg.C for 90s, ice-cooling for 5min, adding 800 μ L LB liquid culture medium, and culturing at 37 deg.C for 1 h; 200 mu L of the bacterial liquid is smeared on a corresponding resistant (ampicillin resistant) LB plate, cultured for 12-18h at 37 ℃, and a positive transformant containing a positive plasmid is screened out, wherein the positive plasmid is named as pET-261sip 01.
Through sequencing analysis, the 261sip01(SEQ ID No.1) gene length is 1197bp, the coded protein is 261sip01, and the total 399 amino acids (SEQ ID No.2) express 45kDa protein.
The pET-261sip01 recombinant plasmid was then extracted and transformed into the expression strain Rosetta (DE 3). 261sip01 is subjected to IPTG induction expression in Escherichia coli Rosetta (DE3), and SDS-PAGE electrophoresis results show that 261sip01 gene is expressed in both soluble components and insoluble components; in which approximately 45kDa or so protein is expressed, consistent with the expected results. The negative control, i.e.E.coli Rosetta (DE3) which did not contain the 261sip01 gene but contained the pET-21b vector, had no expression band for the corresponding protein in both the soluble and insoluble fractions.
Example 2
Expression and quantitative analysis of proteins
Escherichia coli Rosetta (DE3) strain carrying 261sip01 gene was inoculated in LB liquid medium at an inoculum size of 1%, cultured at 37 ℃ to OD600When the value reached between 0.5 and 1.0, the inducer 50mM IPTG was added and induction was carried out at 150rpm at a low temperature of 20 ℃ for 12 hours. Then centrifuged at 8000rpm for 3min at 4 ℃. The cells were collected by centrifugation and suspended in 50mM Tris & Cl (pH 8.0); breaking thallus (completely breaking by ultrasonic wave), centrifuging the ultrasonically broken bacteria liquid at 4 deg.C at 12,000rpm for 15 min; the supernatant was then collected. The supernatant was subjected to quantitative SDS-PAGE analysis as follows: the following 5 different concentration gradients of BSA were prepared: 0.8. mu.g/. mu.L, 0.4. mu.g/. mu.L, 0.2. mu.g/. mu.L, 0.1. mu.g/. mu.L, 0.05. mu.g/. mu.L, and the target Protein was subjected to gradient dilution so that the final concentration thereof was 0.8 to 0.05. mu.g/. mu.L, and the amounts of the target Protein and 5 kinds of BSA (Protein quantification kit: DC Protein Assay) with different concentrations were each 10. mu.L, and Protein electrophoresis was carried out. A protein concentration standard curve was prepared using Bovine Serum Albumin (BSA) as a standard protein, and the total protein concentration in the recombinant strain of Escherichia coli Rosetta (DE3) was determined. And analyzing the proportion of the target protein in SDS-PAGE by combining ImageMaster VDS software, and calculating the target protein to obtain the concentration of 261sip01 in the supernatant.
Comparative example 1
The expression product of cry8G (SEQ ID No.5) gene cloned into pET21b under the same conditions in Escherichia coli Rosetta (DE3)) was used as a positive control for the assay of biological activity. Expression of the Cry8G (SEQ ID No.6) protein was the same as in example 2. Wherein the expression product of the protein is mainly distributed in the precipitate, i.e. mainly exists in the form of inclusion body, therefore, the precipitate product is used for carrying out the subsequent biological activity determination. Before quantitative analysis and subsequent determination of biological activity, the inclusion bodies are first subjected to conventional solubilization, and the subsequent quantitative analysis is the same as in example 2.
Example 3
Activity assay
The Holotrichia oblita (Holotrichia oblita) is provided by the institute for plant protection, academy of agriculture and forestry, Cangzhou.
(1) Cutting the potatoes into filaments, airing the filaments in the sun until the water loss is about 60% -90%, and meanwhile, exposing the screened soil in the sun for 2-3 hours;
(2) soaking the dried shredded potatoes in a prepared serial diluted supernatant (added with a detergent with a final concentration of 0.1%) for 30 s;
(3) then, the shredded potatoes are respectively arranged in six-hole plates;
(4) mixing the supernatant fluid soaked with the shredded potatoes with soil according to the proportion of adding 18mL of solution into every 100g of soil, and filling the mixed soil into six-hole plates;
(5) inoculating healthy larvae of 5-day-old northern China Holotrichia parallela into a six-hole plate, inoculating 1 test insect into each hole, performing treatment for every 30 test insects, repeating the treatment for three times, and strictly sealing after the inoculation to prevent the larvae from climbing out;
(6) placing in a biochemical incubator at 25 ℃, wherein the photoperiod is 16 h: observing whether the potato shreds are mildewed or not (in order to avoid the mildewing of potatoes) and whether water vapor is condensed or not (in order to avoid the overhigh water content) every day when the humidity is about 50 percent after 8 hours, and adjusting the water content in the biochemical incubator to keep the humidity in the incubator;
(7) after 7 days, the number of dead and live insects in each treatment was investigated, and the mortality, survival, corrected mortality and LC were calculated50。
Wherein LC is performed on the test insects50Before measurement, the concentration range of the insecticidal is preliminarily determined by the above biological activity measurement method through preliminary screening, then the insecticidal activity under a series of concentration gradients is measured, and LC is calculated50. Mortality and corrected mortality at a particular concentration are calculated as follows:
the lethal middle concentration (LC) was calculated from the bioassay data using SPSS (V13.0) software50). The results are shown in Table 2.
TABLE 2
As can be seen from the results in table 2, the 261sip01 insecticidal protein of the present application has significantly better activity against Holotrichia parallela albugo in North China than the known Cry-class insecticidal protein Cry 8G. The 261sip01 insecticidal protein is used for preventing and treating Holotrichia parallela in North China, not only provides a novel insecticidal protein, but also can remarkably reduce the production cost, thereby bringing more considerable economic benefits.
While the present invention has been described with reference to the preferred embodiments thereof, it will be understood by those skilled in the art that various changes may be made without departing from the true spirit and scope of the invention. For example, many modifications may be made to adapt a particular situation, material, composition of matter, or method step to the teachings of the invention. All such modifications are intended to be included within the scope of the present invention as defined in the appended claims. Moreover, the technical content disclosed above is subject to some variations or modifications, which are equivalent to the equivalent embodiments, and all fall within the scope of the technical solution.
LHA1760149 nucleotide and amino acid sequence Table
<110> institute of plant protection of Chinese academy of agricultural sciences
<120> a novel insecticidal protein and nucleotide sequence thereof
<130> LHA1760149
<160> 6
<170> PatentIn version 3.5
<210> 1
<211> 1197
<212> DNA
<213> Bacillus thuringiensis (Bacillus thuringiensis)
<223> 261sip01
<400> 1
ATGCATTCTATTAAACGATATAAAAAAATGGGAATTGTTGTTCCACTGGCTTGTTTATTAGGTACAGGTTTTACATTTGTGAATCAGCCAATTCATGCCGCTGCGGCAGTTACAACTAATGCTACAGTTACTAATAATGCTTCAGCAGAGTTTAAGGAAGTTGATTTAAATACTTTACGTGGAGATCTATACGAAAGATATTTTACATTATTATTAACAAAACCTGAATTAATTGGTGGAGAAGCTGCTTGGAAATCATGGGGTGATGATTCAAAAGCGAATTATAATATAAAGTATAATATGACTCAGTGGGTTGAAAATTTAAAACAGGGAAATTATAAATATTTTGAAGAGACTTGGGGGGGATTTGGTTCGTTAGCAAGACATATTGGTCAAATAAATGCATTTTTAGATTGGAATCCTCAATATAGTAATACAACTAAAAATTATGATTTAAAAGCAATACCAGGAGATATAAATCATGATTCAATAGAAGTATATAAATATACTAATCCCGCAAATTCTGTGGAACAAAAGTTTTTAACAGATGCAAAAGATGTTGAAATCGGACATACATTCACAGAAACTCATACTACTGGGGGGAAATTCGGATATAATGCTGCAACTACATTTAAAGTAGGTGTACCATTAAATCAAGCTACAACAACACATACGTTTACATTTGAAGCAAATTATAATTATACAAATACACATACAAAAACAGATAAAGAAACAAAACATTATCCATCTCAAACAGTAATTTGTAAACCTGGTTATACTACAAAATTAACAATTGATAAATCTACAGCAACTTATACTGGAGATTTGGAGTTTGATATTGGAGCAAGTGCAGAAGAGTTAATAACTAAAATTAATGCGAATATTAAGGATCTACCTAATCATACAAACAAGAATTATAAAGGACCTAAAACTACAATAAAAGCAGATTCAGAAGAATTCTTGTATAATTTATATAAATATTCAGGATATGATCTTCCATCATATATAACATTAGATGATGAGCATAAAACCGTGTCATTTGGAAAAGTAAAAAGTACCTATAGTGGTGTAACAGGTACAGCAAGTGAAATGATATTAGAATTGATACCAATTGATCCAAAAGATACAACAAAGAAACCAATAAAAATGCTTTTCAAAGAATATCAACAAAAAATGAAAAATAATGAACCATTAATT;
<210> 2
<211>399
<212> PRT
<213> Bacillus thuringiensis (Bacillus thuringiensis)
<223> 261sip01
<400> 2
MHSIKRYKKMGIVVPLACLLGTGFTFVNQPIHAAAAVTTNATVTNNASAEFKEVDLNTLRGDLYERYFTLLLTKPELIGGEAAWKSWGDDSKANYNIKYNMTQWVENLKQGNYKYFEETWGGFGSLARHIGQINAFLDWNPQYSNTTKNYDLKAIPGDINHDSIEVYKYTNPANSVEQKFLTDAKDVEIGHTFTETHTTGGKFGYNAATTFKVGVPLNQATTTHTFTFEANYNYTNTHTKTDKETKHYPSQTVICKPGYTTKLTIDKSTATYTGDLEFDIGASAEELITKINANIKDLPNHTNKNYKGPKTTIKADSEEFLYNLYKYSGYDLPSYITLDDEHKTVSFGKVKSTYSGVTGTASEMILELIPIDPKDTTKKPIKMLFKEYQQKMKNNEPLI;
<210>3
<211> 48
<212> DNA
<213> Artificial sequence
<223> 261sip01_F
<400> 3
ATGACTGGTGGACAGCAAATGGGTCGGATGCATTCTATTAAACGATAT;
<210> 4
<211> 49
<212> DNA
<213> Artificial sequence
<223>261sip01_R
<400> 4
TGTCGACGGAGCTCGAATTCGGATCAATTAATGGTTCATTATTTTTCAT;
<210> 5
<211> 3468
<212> DNA
<213> Bacillus thuringiensis (Bacillus thuringiensis)
<223> cry8G
<400> 5
ATGAGTCCGAATAATCAGAACGAATATGAAATTATAGATGCGTCATCACCTACTTCTGTATCTAATAACTCAGTGAAATACCCTTTAGCAAGTGATCAAACGACCACATTACAAAATATGAACTATAAAGATTATCTGAGAATGTCTGAGGGAGAGAATCCTGAATTATTTGGAAATCCAGAGACGTTTATTAGTGCGCAGGATGCGGTTGGAACTGGGATTGATATTGTGAGTAAACTACTAGGTAGTTTAGGGGTTCCACTTGTTGGGCAAGCCGCAACGGCACTTAAATGGATTATAGGTAAATTGTGGCCTTCTTCAGGAAACCCGTGGGATGATTTGATGACGGCAGTAGAAGAACTCATAAATCAAAAAATAGAAGCATATGCAAGAAGTAAGGCACTTGCTGAATTGGGTGTTTCGGGAAGAGCTGTAAAATCCTATCAAACCGCACTTGAAGAGTGGCAAAAAAACCCGAATAACGCGCGAAGCGCAGCACTTGTAAGGGAAAGATTTTCAGATGCAGAACATACATTGCGTACTCAAATGAGTTTATTTACCGTTCGTGGTTATGAAATTCCGCTTTTAGCAACATATGCACAAGCTGCCAATTTGCATTTGTTTGTAATGAAGGATATTCAAATTTACGGGAGAGAATGGGGATATACTCAGGGAGATATTAACCTTTTCTATCGAGAACAAGTAGAATTTACAGGGGAATACTCTGATTATTGTGTTAAGTGGTACAATGCTGGCTTAGATAAATTAAGAGGCTCGACTGCTCTACAATGGATTAACTATAATCGTTTCCGCAGAGAAATGACAGTGATGGCACTGGATATAGTTGCATTATTCCCAAATTATGACATACGCATGTATCCAATGAAAACAACCGCAGAATTAACGCGAAGAATTTATACAGATCCGCTTGGTTATACGGGAAGTGGGTCTAACACGCCACCATGGTATAATTATGGATATTCTTTCTCATGGATAGAAAATAATGCCGTGCCAGCACCTGGATTGTTCCAGTGGTTACAAGGAATTGGGATTTATACTAAATTTGCTCGTATAACTCCATTTTATGCGAACTATTGGTCAGGACATACTGTATTTTATAAATTTACTAACGATTCTACTGAGAGACGTGTTCAGTATGGAGATACAGATACTCCAGAATTAGATAGTTCTTCCTTTGAAAATGTTGACATTTATAAGGTTTCAGCATCAGTTGGTTCGTACAAAAGTAATACCGTACTATTACCAACTTTTAAAGCTACTTTTGAGGGGGTAAATCAAAATAATCAGTTAAAGACCTTTAGGTATCAAAAAGAATCTAATGTCCCAAGTCAAACGAAAAACTCAACCACAGAGCTGCCTGTTCAGTTATCAACTCCGCCTACTTACGGAGATTCTGAACAGTACAGTCATAGACTAGCCTATGTTTTTGATGCCCCAATCGATTCATATACAGGCATATATCGCATGTATGGATTTGCCCCTATTCTTGGTTGGACACATATTAGTGTAAGTCGTGACAATAGGATTGATCCAGATAAAATTACTCAAATTCCAGCTGTAAAGGCATATGCTGAGGGTCTTGCTAATTATATCAAAGATCCGGGGTTTACAGGAGGAGATTTATTAGCTTTAGGTAGAAACTCAAATACTTCATTGATTGTCAATTTTTCGAAGCCTCAAACATACCGTATTCGTATTCGTTATGCTGCTAGTAAAACTTCGTATTTTCAACTACGTGGGCTGCATAATATAGCTCAGTCTCAGCGTTTCGAAGCGACGTATTCTAATAAAAATGAAAACGATTTGACATTTAACGATTTTAAATATGTAGAAATTCAAAAAACTGTTTCAATAGACAATCCATCAGAAAGTCGTAGTATAAGTATATACACTCAATCAGATACAGAATACTTATTATGGACAAATCGAATTCATCCCAGTAGATGCAACATTTGGAGCGGAACAAGACCTAGATGTGGCAAAGAAAGCGGTGAATGGCTTGTGTACCAATACAAAAGATGCCTTACAGACAAGTGTAACGGATTATCAAGTCAATCAAGCGGCAAACTTAGTAGAATGCCTATCGATGAGTTATACCCAAATGAAAAACGCATGTTATGGGATGCAGTGAAAGAGGCGAAACGACTTGTTCAGGCACGTAACTTACTCCAAGATACAGGCTTTAATGTAATAAATGGAGAAAACGGATGGACGGGAAGTACGGGAATTGAGGTTGTGGAAGGGGATGTTCTGTTTAAAGATCGTTCGCTTCGTTTGCCAAGTGCGAGAGAGATTGATACAGAAACATATCCAACGTATCTCTATCAACAAATAGATGAATCGCTTTTAAAACCATATACAAGATATAGACTAAGAGGTTTTATAGGAAGTAGTCAAGATTTAGAGATTAAATTAATACGTCATCGGGCAAATCAAATTGTCAAAAATGTACCGGATAACCTCTTGCCAGATGTACGCCCTGTCAATTCTTGTGGTGGAGTCGATCGCTGCAGTGAACAACAGTATGTAGACGCGAATTTAGCACTCGAAAACAATGGAGAAAATAGAAATATGTCTTCTGATTCCCATGCATTTTCTTTCCATATGGATACAGGTGAAATAGATTTAAATGAAAATACAGGTATTTGGGTCGTATTTAAAATTCCGACAACAAATGGATACGCAACATTAGGAAACCTTGAATTGGTAGAAGAGGGGCCATTATCAGGAGACGCACTAGAACGCTTGCAAAGAGAAGAACAGCAGTGGAAGCTTCAAAGAACCAAAAGACGTGAAGAGACGGATAGAAAATATATGGCAGCAAAACAAGCCATTGATCGTTTATTCGCAGATTATCAAGACCAACAACTCAATTCTGGTGTAGAAATGTCAGATTTGCTTGCAGCTCAAAACCTTGTACAGTCCATTCCTTATGTGTATAACGAAATGTTCCCAGAAATCCCTGGAATGAACTATACAAATTTCACAGAGTTAACAAACAGACTCCAACAAGCATGGAATTTGTATGATCTTCGAAATGCTATACCAAATGGAGATTTTCGAAATGGATTAAGTGATTGGAATGCAACATCAGATATAAATGTGCAACAACTAAACGATACATCTGTCCTTGTCATTCCAAACTGGAATTCTCAAGTGTCACAACAATTTACAGTTCAACCGAATTATAGATATGTATTACGTGTCACAGCGAGAAAAGAGGGAGCAGGAGACGGATATGTGATCATCCGTGATGGTACAAATCAGACAGAAACACTCGCATTTAATACATGTGATAATGATGCAGGTGTTTTATCTACTAATCAAGCTAGCTATATCACAAAAACAGTGGAATTCACGCCATCTACAGAGCAAGTTTGGATTGACATGAGTGAGACCGAAGGTGTATTCAACATAGAAAGTGTAGAACTCGTGTTAGAAGAAGAG;
<210> 6
<211> 1156
<212> PRT
<213> Bacillus thuringiensis (Bacillus thuringiensis)
<223> Cry8G
<400> 6
MSPNNQNEYEIIDASSPTSVSNNSVKYPLASDQTTTLQNMNYKDYLRMSEGENPELFGNPETFISAQDAVGTGIDIVSKLLGSLGVPLVGQAATALKWIIGKLWPSSGNPWDDLMTAVEELINQKIEAYARSKALAELGVSGRAVKSYQTALEEWQKNPNNARSAALVRERFSDAEHTLRTQMSLFTVRGYEIPLLATYAQAANLHLFVMKDIQIYGREWGYTQGDINLFYREQVEFTGEYSDYCVKWYNAGLDKLRGSTALQWINYNRFRREMTVMALDIVALFPNYDIRMYPMKTTAELTRRIYTDPLGYTGSGSNTPPWYNYGYSFSWIENNAVPAPGLFQWLQGIGIYTKFARITPFYANYWSGHTVFYKFTNDSTERRVQYGDTDTPELDSSSFENVDIYKVSASVGSYKSNTVLLPTFKATFEGVNQNNQLKTFRYQKESNVPSQTKNSTTELPVQLSTPPTYGDSEQYSHRLAYVFDAPIDSYTGIYRMYGFAPILGWTHISVSRDNRIDPDKITQIPAVKAYAEGLANYIKDPGFTGGDLLALGRNSNTSLIVNFSKPQTYRIRIRYAASKTSYFQLRGLHNIAQSQRFEATYSNKNENDLTFNDFKYVEIQKTVSIDNPSESRSISIYTQSDTEYLLWTNRIHPSRCNIWSGTRPRCGKESGEWLVYQYKRCLTDKCNGLSSQSSGKLSRMPIDELYPNEKRMLWDAVKEAKRLVQARNLLQDTGFNVINGENGWTGSTGIEVVEGDVLFKDRSLRLPSAREIDTETYPTYLYQQIDESLLKPYTRYRLRGFIGSSQDLEIKLIRHRANQIVKNVPDNLLPDVRPVNSCGGVDRCSEQQYVDANLALENNGENRNMSSDSHAFSFHMDTGEIDLNENTGIWVVFKIPTTNGYATLGNLELVEEGPLSGDALERLQREEQQWKLQRTKRREETDRKYMAAKQAIDRLFADYQDQQLNSGVEMSDLLAAQNLVQSIPYVYNEMFPEIPGMNYTNFTELTNRLQQAWNLYDLRNAIPNGDFRNGLSDWNATSDINVQQLNDTSVLVIPNWNSQVSQQFTVQPNYRYVLRVTARKEGAGDGYVIIRDGTNQTETLAFNTCDNDAGVLSTNQASYITKTVEFTPSTEQVWIDMSETEGVFNIESVELVLEEE。
Claims (16)
1. An insecticidal protein, the amino acid sequence of which is shown in SEQ ID No. 2.
2. A nucleic acid encoding the pesticidal protein of claim 1.
3. The nucleic acid according to claim 2, wherein the sequence of the nucleic acid is represented by SEQ ID number 1.
4. A composition comprising the pesticidal protein of claim 1.
5. The composition of claim 4, wherein the sequence of the nucleic acid encoding the pesticidal protein is set forth in SEQ ID number 1.
6. A transgenic microorganism comprising the nucleic acid of claim 2 or 3 and capable of producing the pesticidal protein of claim 1.
7. The transgenic microorganism according to claim 6, wherein the transgenic microorganism comprises at least one of Bacillus (Bacillus), Pseudomonas (Pseudomonas), Enterobacter (Escherichia), and Yeast (Saccharomyces).
8. The transgenic microorganism according to claim 7, wherein the Bacillus comprises at least one of Bacillus thuringiensis (Bacillus thuringiensis), Bacillus subtilis (Bacillus subtilis), Bacillus atrophaeus (Bacillus atrophaeus) and Bacillus cereus (Bacillus cereus); the Pseudomonas bacteria comprise Pseudomonas fluorescens (Pseudomonas fluorescens); the enterobacteria include Escherichia coli (Escherichia coli).
9. Use of a nucleic acid according to claim 2 or 3 for the preparation of a transgenic plant capable of producing the pesticidal protein of claim 1; the transgenic plant includes at least one of Cruciferae (Cruciferae), Solanaceae (Solanaceae), Umbelliferae (Umbelliferae), Cucurbitaceae (Cucurbitaceae), Araceae (Araceae), Gramineae (Liliaceae), Leguminosae (Leguminosae), Papilionaceae (Papilionoceae), Chenopodiaceae (Chenopodiaceae), Compositae (Compositae) and Malvaceae (Malvaceae).
10. The use according to claim 9, wherein the transgenic plant comprises Brassica (Brassica), Raphanus (Raphanus), Nicotiana (Nicotiana), Lycopersicon (Lycopersicon), Solanum (Solanum), Capsicum (Capsicum), Daucus (Daucus), Apium (Apium), parsley (Petroselinum), anise (Foeniculum), Cucurbita (Cucurbita), Cucumis (Cucumis), Cucurbita (benina), Luffa (Luffa), Citrullus (Citrullus), Cucumis (cucum), agrimonia (alorhus), Sorghum (Sorghum), Setaria (Setaria), Oryza (Oryza), Saccharum (Saccharum), Triticum (Triticum), Glycine (Glycine), soybean (Glycine), asparagus (Brassica), alfalfa (Brassica), or alfalfa (garden).
11. The use according to claim 10, wherein the transgenic plant comprises rape (Brassica campestris), Chinese cabbage (Brassica rapa), pakchoi (Brassica chinensis), cabbage (Brassica oleracea), radish (raphius), tomato (Lycopersicon esculentum), potato (Solanum tuberosum), eggplant (Solanum melongena), celery (Apium graveolens), parsley (Petroselinum crispum), fennel (Foenicum vulgare), pumpkin (Cubita peltata), pumpkin (Cucurbita moschata), cucumber (Cucumis sativus), white gourd (Begonina hispida), towel gourd (Luffa acutangula), watermelon (Citrus citrullosa), melon (Citrus vulgaris (Citrus luteus), cucumber (Amunicus), wheat (Brassica oleracea), wheat (Sorghum vulgara), alfalfa (Sorghum vulgare sativa), corn (Sorghum vulgare), corn (maize (Sorghum vulgare), millet (Sorghum vulgare), corn (Sorghum vulgare), Sorghum vulgare sinensis), corn (maize (Sorghum vulgare), corn (maize), corn (maize), corn (Sorghum vulgare, maize (maize), corn (maize), corn (maize), corn (maize), corn (maize), corn, At least one of lettuce (Lactuca sativa), sunflower (Helianthus), and okra (Abelmoschus esculentus).
12. A method of producing the pesticidal protein of claim 1, comprising using the transgenic microorganism of any one of claims 6 to 8, and/or using the transgenic plant in the use of any one of claims 9 to 11 to produce the pesticidal protein.
13. The method of claim 12, further comprising purifying the insecticidal protein to a purity of 80% or greater after producing the insecticidal protein using the transgenic microorganism and/or transgenic plant.
14. The method of claim 13, wherein the insecticidal protein is more than 90% pure.
15. The method of claim 14, wherein the insecticidal protein is more than 99% pure.
16. Use of at least one of the insecticidal protein according to claim 1, the composition according to claim 4 or 5, the transgenic microorganism according to any one of claims 6 to 8, and the transgenic plant for use according to any one of claims 9 to 11 for controlling Holotrichia parallela (Holotrichia oblita).
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201710219903.2A CN106905420B (en) | 2017-04-06 | 2017-04-06 | Novel insecticidal protein and nucleotide sequence thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201710219903.2A CN106905420B (en) | 2017-04-06 | 2017-04-06 | Novel insecticidal protein and nucleotide sequence thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CN106905420A CN106905420A (en) | 2017-06-30 |
CN106905420B true CN106905420B (en) | 2020-11-24 |
Family
ID=59195417
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201710219903.2A Active CN106905420B (en) | 2017-04-06 | 2017-04-06 | Novel insecticidal protein and nucleotide sequence thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN106905420B (en) |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JPH07179A (en) * | 1991-08-02 | 1995-01-06 | Kubota Corp | Novel microorganism and insecticide |
CN101113424A (en) * | 2007-07-04 | 2008-01-30 | 中国农业科学院植物保护研究所 | Coleoptera pest efficient Bacillus thuringiensis cry8G gene, protein and uses thereof |
-
2017
- 2017-04-06 CN CN201710219903.2A patent/CN106905420B/en active Active
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JPH07179A (en) * | 1991-08-02 | 1995-01-06 | Kubota Corp | Novel microorganism and insecticide |
CN101113424A (en) * | 2007-07-04 | 2008-01-30 | 中国农业科学院植物保护研究所 | Coleoptera pest efficient Bacillus thuringiensis cry8G gene, protein and uses thereof |
Non-Patent Citations (2)
Title |
---|
"Vegetative insecticidal protein of Bacillus thuringiensis BLB459 and its efficiency against Lepidoptera";Hanen Boukedi等;《ELSEVIER》;20170220;第129卷;第89-94页 * |
"两株杀鞘翅目害虫Bt菌株的生物活性及杀虫蛋白基因的鉴定";初立良等;《华北农学报》;20100628;第25卷(第3期);第235-238页 * |
Also Published As
Publication number | Publication date |
---|---|
CN106905420A (en) | 2017-06-30 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN107022010B (en) | Novel insecticidal protein and nucleotide sequence thereof | |
CN100427600C (en) | Zoophobous fusion protein and use thereof | |
Liao et al. | Overexpression of a Metarhizium robertsii HSP25 gene increases thermotolerance and survival in soil | |
CN106928329B (en) | Novel insecticidal protein and nucleotide sequence thereof | |
CN112266887B (en) | Bacillus thuringiensis | |
CN112480225B (en) | Application of GrpE protein and coding gene thereof as molecular target in breeding resistant plants | |
CN110093301B (en) | Bacillus thuringiensis and application thereof in preventing and treating lepidoptera pests | |
CN110066322B (en) | Bt protein Cyt2-like and gene and application thereof | |
CN112175896B (en) | Bacillus thuringiensis strain with insecticidal activity on spodoptera frugiperda | |
CN107022009B (en) | Novel insecticidal protein and nucleotide sequence thereof | |
CN101984045A (en) | The Cry8Na1 gene of bacillus thuringiensis, expression protein and application thereof | |
CN104388349B (en) | Thuringiensis secretes killing gene sip1A, expressing protein and its application | |
CN111235166B (en) | Novel induction-expressed Cry2Ab insecticidal gene and application thereof | |
CN106905420B (en) | Novel insecticidal protein and nucleotide sequence thereof | |
CN106905421B (en) | Novel insecticidal protein and nucleotide sequence thereof | |
CN109929015B (en) | Bacillus thuringiensis insecticidal gene cry79Aa1, expression protein and application thereof | |
CN111850009A (en) | Cry2Ab-2 insecticidal gene and application thereof | |
CN114958647A (en) | Bacillus thuringiensis and application thereof | |
CN112522132B (en) | Bacillus SJ110, insecticidal protein, vip3-like insecticidal gene and application | |
CN104673706A (en) | Bacillus thuringiensis FH21, insecticide gene, expression protein and application thereof | |
CN108359673A (en) | A kind of Bt cry11 genes, coding albumen and its application efficiently killing edible mushroom eye fungus gnat | |
CN103215290A (en) | Insect-resistant fusion gene as well as insect-resistant fusion protein and application of insect-resistant fusion gene and insect-resistant fusion protein | |
CN103525836B (en) | A kind of Bt Cry71Aa1 operon gene and proteins encoded thereof and application | |
CN103525837B (en) | Bt PROTEIN C ry72Aa1 operon genes and its application | |
CN102408475B (en) | Bt protein Cryt1Da1, and coding gene and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |