CN106676130A - Paddy rice BADH2 gene site-directed mutagenesis method through using CRISPR-CAS9 technology - Google Patents
Paddy rice BADH2 gene site-directed mutagenesis method through using CRISPR-CAS9 technology Download PDFInfo
- Publication number
- CN106676130A CN106676130A CN201611265175.0A CN201611265175A CN106676130A CN 106676130 A CN106676130 A CN 106676130A CN 201611265175 A CN201611265175 A CN 201611265175A CN 106676130 A CN106676130 A CN 106676130A
- Authority
- CN
- China
- Prior art keywords
- badh2
- cas9
- grna
- culture medium
- mother solution
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8201—Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation
- C12N15/8202—Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation by biological means, e.g. cell mediated or natural vector
- C12N15/8205—Agrobacterium mediated transformation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/80—Vectors containing sites for inducing double-stranded breaks, e.g. meganuclease restriction sites
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- Biophysics (AREA)
- General Engineering & Computer Science (AREA)
- Zoology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Cell Biology (AREA)
- Physics & Mathematics (AREA)
- Medicinal Chemistry (AREA)
- Plant Pathology (AREA)
- Botany (AREA)
- Microbiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
Abstract
The invention provides a paddy rice BADH2 gene site-directed mutagenesis method through using CRISPR-CAS9 technology. According to the fact that a paddy rice BADH2 gene is designed based on a sgRNA sequence of CRISPR/Cas9, a DNA fragment with the sgRNA sequence coded is connected to a carrier carrying CRISPR/Cas, and paddy rice is transformed, thereby achieving site-directed mutagenesis of the paddy rice BADH2 gene. The nucleotide sequence of a sgRNA acting site is shown as SEQ ID NO:1. The paddy rice endogenous gene BADH2 is edited through CRISPR-CAS9 technology to obtain a BADH2 mutant, which is convenient and efficient in creation of jasmine rice germplasm resources.
Description
Technical field
The present invention relates to technical field of plant transgene and field of crop genetic breeding, specifically, are related to a kind of utilization
Method of the CRISPR-CAS9 technologies to Oryza sativa L. BADH2 site-directed point mutations.
Background technology
Fragrant rice is used as the Special member in Oryza sativa L. family, and its cultivation history is quite long, in the world each Rice Production state or
Area nearly all has fragrant seed rice to plant.Fragrance is fine quality rice key character, and fragrant rice breeding has become the important of Genetic and breeding in rice
One of content.Bradbury etc. (2005) has found a gene-BADH2 that there is sequence difference between scented rice and common rice,
This gene code glycine betaine aldehyde dehydrogenase (betaine aldehyde dehydrogenase), thus it is speculated that may be with meter Xiang's
Synthesis is relevant.Chen etc. (2008) by transgene complementation test to demonstrating BADH2 Gene Handling rice perfume, scented rice varieties
There is natural mutation in second of BADH2 genes or the 7th exon, the BADH2 transcripts without total length, 2AP (2-
One of acetyl-1-pyrroline, Oryza sativa L. scented rice fragrance ingredient) a large amount of accumulation;And only there is total length in common rice
BADH2 transcripts, wherein 2AP contents are extremely low.By proceeding to total length BADH2 gene in scented rice varieties, its 2AP content significantly drops
Low, fragrance is lost.Prove that BADH2 is the major gene resistance for controlling meter Xiang.
At present, the cultivation of scented rice varieties is mostly scented rice gene to be proceeded in common rice using Crossing system, although can be with
Assisted Selection is carried out by molecular marker, but this process Complicated Periodic is longer.With ZFN (zinc-finger nucleases)
With the sequence-specific core that TALEN (transcription activator-like effector nucleases) is representative
Sour zymotechnic can be realized pinpointing genome editor.Realize that knocking out BADH2 using TALEN technologies obtains Oryza sativa L. in Oryza sativa L.
Fragrance.But TALEN technology modules assembling process is loaded down with trivial details, a large amount of examining orders are needed, it is relatively costly and with cytotoxicity.ZFN
Upstream and downstream sequence is depended in Technology design, miss rate is high, equally with cytotoxicity.
CRISPR/Cas technologies have been broken away from and have synthesized and assembled the loaded down with trivial details behaviour with specific DNA identification ability module
Make, the design of its gRNA and synthetic work amount are far smaller than the building process of the DNA identification modules of TALEN and ZFN technologies, and poison
Property has the advantages that targeting is accurate, miss rate is low, cytotoxicity is low, cheap easy well below ZFN technologies.CRISPR/Cas9
Technology since the advent of the world, just there is other unrivaled advantages of gene editing technology, after technology is updated, is more considered to
It is enough it is most effective in living cells, most easily " edit " any gene.
The content of the invention
It is an object of the invention to provide a kind of side of utilization CRISPR-CAS9 technologies to Oryza sativa L. BADH2 site-directed point mutations
Method.
In order to realize the object of the invention, the utilization CRISPR-CAS9 technologies that the present invention is provided are gene site-directed to Oryza sativa L. BADH2
The method of mutation, for sgRNA sequence of the Oryza sativa L. BADH2 gene design based on CRISPR/Cas9, will be described containing coding
The DNA fragmentation of sgRNA sequences is connected in the carrier for carrying CRISPR/Cas, and rice transformation is realized to Oryza sativa L. BADH2 genes
Rite-directed mutagenesises.
Wherein, the nucleotides sequence of sgRNA action sites is classified as 5 '-GAGTGGCGCGCCCCCGCGCT-3 '.(SEQ ID
NO:1)
Aforesaid method, carrier construction pHZ1-CAS9-gRNA-BADH2, using Agrobacterium-mediated transformation Oryza sativa L., screening
Positive transgenic plant.
The construction method of the carrier pHZ1-CAS9-gRNA-BADH2 is as follows:
1) structure of OsU6-BADH2-gRNA-polyT fragments
First round PCR is with Cris-GL3 plasmids (by Inst. of Genetics and Development Biology, CAS's doctor's Xu Ran favour
Give) it is template, expand the 20bp target sequences of OsU6 promoteres and BADH2 genes, clip size with primer CRI-F1 and SQ3-R1
329bp;Equally with Cris-GL3 plasmids as template, with primer SQ3-F2 and CRI-R2 the 20bp target sequences of BADH2 genes are expanded
With gRNA-polyT, clip size 180bp;Second wheel PCR be with first round PCR primer as template, with primer CRI-F1 and
CRI-R2 amplifications obtain final product OsU6-BADH2-gRNA-polyT fragments, clip size 489bp, sequence such as SEQ ID NO:Shown in 2;
2) structure of carrier pHZ1-CAS9-gRNA-BADH2
OsU6-BADH2-gRNA-polyT fragments are entered respectively with the PMDC99-Cas9 carriers Jing after Hind III digestions
Row agarose gel electrophoresis, cut and carry out after glue reclaim seamless clone, based on the principle of homologous recombination, OsU6-BADH2-gRNA-
PolyT fragments are fused to the Hind III sites of PMDC99-CAS9 carriers by the method for Infusion, that is, build and obtain
PHZ1-CAS9-gRNA-BADH2 carriers.
Wherein, step 1) used in primer sequence it is as follows:
CRI-F1:5’-CGACGGCCAGTGCCAAGCTTCTCGGATCCACTAGTAACGGC-3’
SQ3-R1:5’-AGCGCGGGGGCGCGCCACTCACACAAGCGACAGCGCGCGGG-3’
SQ3-F2:5’-GAGTGGCGCGCCCCCGCGCTGTTTTAGAGCTAGAAATAGCA-3’
CRI-R2:5’-ACCTGCAGGCATGCAAGCTTCGACCTCGAGCGGCCGCCAGT-3’
The nucleotide sequence such as SEQ ID NO of the pHZ1-CAS9-gRNA-BADH2 carriers of the present invention:Shown in 3.
The present invention also provides application of the methods described in Oryza sativa L. BADH2 site-directed point mutation breedings.
Comprise the following steps:
(1) Oryza sativa L. ' Japan is fine ' mature embryo callus induction;
(2) invade in the Agrobacterium bacterium solution that the calluss immersion of induction is carried pHZ1-CAS9-gRNA-BADH2 carriers
Dye;Agrobacterium strains are preferably used for EHA105;
(3) calluss are moved to and is cultivated in co-cultivation culture medium, washed away and move to after Agrobacterium training in prescreening culture medium
Support, then move to carry out resistant calli screening in screening culture medium;
(4) resistant calli is moved to and is cultivated in regeneration culture, form vegetative seedling;
(5) seedling exercising, transplanting, obtain transgenic paddy rice after vegetative seedling is taken root on root media;
(6) primer is designed according to the nucleotide sequence of sgRNA action sites, identifies that rice plant is mutated position by PCR methods
Point.
In aforementioned applications, step (1) is specially:Shell after mature seed threshing, washed 2 minutes with 75% ethanol, then immerse
In liquor natrii hypochloritises' (active chlorine 5.5%), 30min is shaken on shaking table, washed 5 times, during NBi culture medium is placed in after seed treatment
For callus induction, the dark 10h of 26 DEG C of illumination 14h/ is cultivated 15-20 days;Calluss are stripped, is moved in new NBi culture medium, 26
DEG C light culture is used to infect after 4 days.
The preparation method of the Agrobacterium bacterium solution of the carrying pHZ1-CAS9-gRNA-BADH2 carriers is as follows:From -80 DEG C of ice
Agrobacterium competence being taken in case to thaw on ice, adding 3-5 μ L plasmids pHZ1-CAS9-gRNA-BADH2 to mix, ice puts 30min,
1min in liquid nitrogen is put into, then heat shock 1min in 37 DEG C of water-baths, correspondence adds 1mL YEP culture medium in aseptic operating platform,
2-4h is shaken on 28 DEG C of shaking tables, is taken out, 8000rpm/min centrifugation 1min outwell part supernatant in aseptic operating platform, use spreader
Equably remaining suspension is mixed and is coated on the YEP flat boards added with rifampicin and kanamycin, be put into after sealed membrane sealing
28 DEG C of incubator cultures.Picking single bacterium colony after 2d, 28 DEG C are shaken after bacterium 24-36h, carry out bacterium colony PCR, obtain positive bacterium colony.
With liquid-transfering gun, from 100mL agrobacterium suspensions, (formula of the agrobacterium suspension is calculated as by 1L:20 × N6 mother solutions
50mL, 100 × EDTA-Fe mother solution 10mL, 100 × B5 trace element mother solution 10mL, 100 × B5 vitamin stock solution 10mL, CEH
0.3g, inositol 2g, sucrose 30g, 3 ', 5 '-dimethoxy-4 ' ' 100 μM of-hydroxy acetophenone, 800 μ L are drawn in pH 5.2~5.3)
Flushing Agrobacterium bacterium plate three to four times, draws bacterium solution 3~5 and drips in suspension, and slightly muddiness can (i.e. bacterial concentration reaches
OD600For 0.3 or so), calluss tweezers are sandwiched in suspension, timing 15min rocks once every three four minutes, makes
It is fully contacted.Bacterium solution is gone, the calluss for infecting is poured on aseptic filter paper, blot the bacterium solution of its excess surface,
Wound healing is moved to into NBco after 10min to co-culture on base, is put between tissue culture 26 DEG C, 2~3d of illumination cultivation, until wound healing group
Knit visible Agrobacterium around to grow.
The wound healing for infecting is put in the empty triangular flask of sterilizing, with aseptic water washing for several times, till water becomes limpid,
200 μ L cephalos (cef, concentration 0.25g/mL, final concentration 500mg/L) are added in the sterilized water of 100mL sterilizings, by wound healing tweezer
Sub-folder enters triangular flask, is put on 28 DEG C of shaking tables and shakes 15min, and the water that will be equipped with cephalo is poured out, and wound healing is pushed and fill on aseptic filter paper
Divide and dry up, regular turnover wound healing is put into wound healing in NBps prescreening culture medium after 1-2 hours, light culture 7d at 26 DEG C.
Wound healing in NBps prescreening culture medium is moved on in NBS screening culture medium.After 1 month, the resistance for growing is healed
Hinder number consecutively to be placed on regeneration culture medium, the dark 10h cultures 3-4 weeks left and right of illumination 14h/ at 26 DEG C.
Kanamycin-resistant callus tissue development in culture medium to be regenerated is grown after 2-3 centimetre of seedling, you can gently pressed from both sides out with tweezers,
Be placed on sterilized empty culture dish, remove Seedling around and root culture medium and old wound healing, be then gently placed with 3.5cm
Taking root in pipe for high root media, often puts a Seedling in pipe, number consistent with regenerating tube numbering.Illumination 14h/ is black at 26 DEG C
Dark 10h cultures 3-4 is all, after seedling grow it is sturdy and after the root system of prosperity by uncap seedling exercising culture, periodically add water in pipe.It is little
Seedling length continues to be put into and takes root in pipe and add water to upright blade and during well developed root system after seedling root culture medium is cleaned, and treats
Plant in soil after seedling is sufficiently robust.
In the present invention, the formula for co-culturing culture medium is calculated as by 2L:
20 × N6 mother solution 100mL, 100 × EDTA-Fe mother solution 20mL, 100 × B5 trace element mother solution 20mL, 100 × B5
Vitamin stock solution 20mL, glutamine 1g, proline 1g, CEH 0.6g, inositol 0.2g, sucrose 60g, 2,4-D 4mg, AS is (i.e.
3 ', 5 '-dimethoxy-4 ' '-hydroxy acetophenone) 100 μM, plant gum 5.2g, pH 5.2~5.3.
The prescreening culture medium prescription is:
NBi culture medium containing 500mg/L cephamycins, pH=5.8.
The formula of the screening culture medium is:
The NBi culture medium of the cephamycin of the hygromycin containing final concentration of 40mg/L and final concentration of 500mg/L, pH
5.8。
It is described regeneration culture formula be:
NBi culture medium without 2,4-D, the 6-BA containing final concentration of 3mg/L, the NAA of final concentration of 0.5mg/L and end
Concentration for 30mg/L hygromycin, pH 5.8.
The formula of the root media is calculated as by 2L:
20 × MS a great number of elements mother solution 50mL, 100 × EDTA-Fe mother solution 10mL, 100 × MS trace element mother solution 10mL,
100 × B5 vitamin stock solution 20mL, inositol 0.2g, glucose 14g, sucrose 6g, plant gum 5.2g, hygromycin final concentration 40mg/
L, pH 5.8.
Wherein, the formula of the NBi culture medium is calculated as by 2L:
20 × N6 mother solution 100mL, 100 × EDTA-Fe mother solution 20mL, 100 × B5 trace element mother solution 20mL, 100 × B5
Vitamin stock solution 20mL, glutamine 1g, proline 1g, CEH 0.6g, inositol 0.2g, sucrose 60g, 2,4-D 4mg, plant gum
5.2g, pH 5.8.
The formula of 20 × N6 mother solutions is calculated as by 1L:
KNO3:56.6g, (NH4)2SO4:9.26g, KH2PO4:8.00g, MgSO4·7H2O:3.70g, CaCl2·2H2O:
3.32g。
The formula of 100 × EDTA-Fe mother solutions is calculated as by 1L:
FeSO4·7H2O 2.78g, Na2-EDTA 3.73g。
The formula of 100 × B5 trace element mother solution is calculated as by 1L:
MnSO4·H2O 1.0g, ZnSO4·7H2O 0.2g, H3BO30.3g, CuSO4·5H2O 2.5mg, Na2MoO4·
2H2O 25.0mg, CoCl2·6H2O 2.5mg, KI 75.0mg.
The formula of 100 × B5 vitamin stock solutions is calculated as by 500mL:
Thiamine hydrochloride VB1 500mg, pyridoxine hydrochloride VB6 50mg, nicotinic acid VB5 50mg.
The formula of 20 × MS a great number of elements mother solution is calculated as by 1L:
KNO338.0g, NH4NO333.0g, KH2PO43.4g, MgSO4·7H2O 7.4g, CaCl2·2H2O 8.8g。
The formula of 100 × MS trace element mother solution is calculated as by 1L:
MnSO4·H2O 1.56g, ZnSO4·7H2O 0.86g, H3BO30.62g, CuSO4·5H2O 2.5mg,
Na2MoO4·2H2O 25.0mg, CoCl2·6H2O 2.5mg, KI 83.0mg.
In aforementioned applications, step (6) chooses each 200bp-400bp sequences of target site upstream and downstream, designs primer, enters performing PCR
Amplification, amplified fragments send sequencing, judge whether target site undergos mutation by peak figure.The primer sequence of identification BADH2 mutation effects
Arrange as follows, clip size 494bp.
JDSQ3F1:5’-ACCTATCGCTTTCCACCTCA-3’
JDSQ3R1:5’-CGGTTCCTCTTCAGCGCCTC-3’
The present invention further provides for the CRISPR-CAS9 carriers of Oryza sativa L. BADH2 site-directed point mutations, the carrier
Nucleotide sequence such as SEQ ID NO:Shown in 3.
The present invention enters edlin by CRISPR-CAS9 technologies to Oryza sativa L. endogenous gene BADH2, obtains BADH2 mutation
Body, the more convenient and efficient in initiative scented rice germ plasm resource.The fixed point to Oryza sativa L. BADH2 genes is successfully realized using the method
Mutation, the method have experimental period it is short, it is easy to operate the features such as, new method is provided for rice modification breeding, for improvement
Rice Characters have important practical significance.
Description of the drawings
Fig. 1 is the structure figure of OsU6-BADH2-gRNA-polyT fragments in the embodiment of the present invention 1.
Fig. 2 is the double digestion electrophoresis result of pHZ1-CAS9-gRNA-BADH2 carriers in the embodiment of the present invention 1.
Fig. 3 is the plasmid map of support C ris-GL3 of the present invention.
Fig. 4 is the plasmid map of carrier PMDC99-CAS9 of the present invention.
Fig. 5 is the plasmid map of carrier pHZ1-CAS9-gRNA-BADH2 of the present invention.
Fig. 6 is the PCR testing results of transgenic paddy rice BADH2 gene knockouts in the embodiment of the present invention 2.
Fig. 7 is transgenic rice plant FZCX3-1 (A) and FZCX3-2 (B) sequencings peak figure in the embodiment of the present invention 2.
Fig. 8 is the pre- of transgenic rice plant (T0 generations) FZCX3-1 and FZCX3-2 mutation types in the embodiment of the present invention 2
Survey result.By analyzing the set peak situation that FZCX3-1, FZCX3-2 plant is sequenced in peak figure, predict the outcome with reference to DSDecode,
The mutation type for confirming BADH2 in FZCX3-1, FZCX3-2 plant is all the disappearance (deletion sites one that a chain has 4 bases
Cause), another chain has the mutation (two strain base mutation positions are inconsistent) of 5 bases.
Specific embodiment
Following examples are used to illustrate the present invention, but are not limited to the scope of the present invention.If not specializing, embodiment
According to conventional laboratory conditions, such as Sambrook equimoleculars Cloning: A Laboratory Manual (Sambrook J&Russell DW,
Molecular Cloning:A Laboratory Manual, 2001), or according to the condition of manufacturer's description suggestion.
The structure of the carrier pHZ1-CAS9-gRNA-BADH2 of embodiment 1
1st, in Oryza sativa L. BADH2 (LOC_Os08g32870) gene target site selection
Log in plant transcription factor data base (http://rice.plantbiology.msu.edu/analyses_
Search_locus.shtml), Oryza sativa L. BADH2 genes (No. LOC are inquired about:LOC_Os08g32870 sequence), design is based on
The sgRNA sequences of CRISPR/Cas9.
The nucleotides sequence of sgRNA action sites is classified as 5 '-GAGTGGCGCGCCCCCGCGCT-3 '.
2nd, the structure of carrier pHZ1-CAS9-gRNA-BADH2
1) structure of OsU6-BADH2-gRNA-polyT fragments
First round PCR with Cris-GL3 plasmids as template, with primer CRI-F1 and SQ3-R1 amplification OsU6 promoteres with
The 20bp target sequences of BADH2 genes, clip size 329bp;It is same with Cris-GL3 plasmids as template, with primer SQ3-F2 and
The 20bp target sequences and gRNA-polyT of CRI-R2 amplification BADH2 genes, clip size 180bp;Second wheel PCR is with the first round
PCR primer is template, and with primer CRI-F1 and CRI-R2 amplification OsU6-BADH2-gRNA-polyT fragments, clip size are obtained final product
489bp, sequence such as SEQ ID NO:Shown in 2.(Fig. 1)
2) structure of carrier pHZ1-CAS9-gRNA-BADH2
OsU6-BADH2-gRNA-polyT fragments are entered respectively with the PMDC99-Cas9 carriers Jing after Hind III digestions
Row agarose gel electrophoresis, cut and carry out after glue reclaim seamless clone, based on the principle of homologous recombination, OsU6-BADH2-gRNA-
PolyT fragments are fused to the Hind III sites of PMDC99-CAS9 carriers by the method for Infusion, that is, build and obtain
PHZ1-CAS9-gRNA-BADH2 carriers (sequence such as SEQ ID NO:Shown in 3).
Wherein, step 1) used in primer sequence it is as follows:
CRI-F1:5’-CGACGGCCAGTGCCAAGCTTCTCGGATCCACTAGTAACGGC-3’
SQ3-R1:5’-AGCGCGGGGGCGCGCCACTCACACAAGCGACAGCGCGCGGG-3’
SQ3-F2:5’-GAGTGGCGCGCCCCCGCGCTGTTTTAGAGCTAGAAATAGCA-3’
CRI-R2:5’-ACCTGCAGGCATGCAAGCTTCGACCTCGAGCGGCCGCCAGT-3’。
The checking of carrier pHZ1-CAS9-gRNA-BADH2:With BamH I/Hind III double digestions.Enzyme action result is shown in Fig. 2,
1st swimming lane represents pHZ1-CAS9-gRNA-BADH2 carrier enzyme action results, can obtain tri- bars of 9205bp, 5180bp, 447bp
Band.2nd swimming lane represents PMDC99-CAS9 control vector enzyme action results, can obtain two bands of 9197bp, 5180bp, and M is 2kb
Marker, stripe size is respectively 2000bp, 1000bp, 750bp, 500bp, 250bp, 100bp.
The plasmid map difference of Cris-GL3 plasmids, PMDC99-CAS9 carriers and carrier pHZ1-CAS9-gRNA-BADH2
See Fig. 3-Fig. 5.
The preparation method of the Oryza sativa L. BADH2 site-directed point mutation plant of embodiment 2
1st, Agrobacterium-mediated Transformation and bacterium colony PCR are identified
Agrobacterium competence is taken from -80 DEG C of refrigerators to thaw on ice, adds 3-5 μ L plasmid pHZ1-CAS9-gRNA-
BADH2 is mixed, and ice puts 30min, is put into 1min in liquid nitrogen, and then heat shock 1min in 37 DEG C of water-baths, right in aseptic operating platform
1mL YEP culture medium should be added, on 28 DEG C of shaking tables 2-4h is shaken, be taken out, 8000rpm/min centrifugation 1min, in aseptic operating platform
Part supernatant is outwelled, equably remaining suspension is mixed with spreader the YEP being coated in added with rifampicin and kanamycin and is put down
On plate, after sealed membrane sealing 28 DEG C of incubator cultures are put into.Picking single bacterium colony after 2d, 28 DEG C are shaken after bacterium 24-36h, carry out bacterium colony
PCR, obtains positive bacterium colony.
Bacterium colony PCR:The preparation of template:The bacterium solution of 200 μ L is drawn from test tube in 1.5mL centrifuge tubes, first 8000rpm/
Min centrifugation 1min outwell supernatant, are separately added into the ddH of 50 μ L2O suspends and precipitates, and is put in boiling water and boils 2min,
12000rpm/min is centrifuged 5min, draws supernatant as template.Positive control:To dilute 20-50 times of μ L of plasmid 1 as template.
Negative control:With 1 μ L ddH2O is template.
2nd, agriculture bacillus mediated rice conversion
(1) mature embryo callus induction
Need to shell after Oryza sativa L. ' Japan is fine ' mature seed threshing, washed 2 minutes with 75% ethanol, then immerse liquor natrii hypochloritises
In (active chlorine 5.5%), 30min (can shake twice according to practical situation, each 20min) is shaken on shaking table, washed 5 times, seed
Being placed on after process in NBi culture medium is used for callus induction, the dark 10h cultures of illumination 14h/ at 26 DEG C.
(2) calluss are stripped
Mature embryo callus induction needs grow for 15-20 days, in super-clean bench on aseptic filter paper, with tweezers and hook wound healing is stripped
Tissue, moves in new NBi culture medium, light culture at 26 DEG C.Wound healing is cultivated in NBi culture medium after peeling and can be used for for 4 days
Infect, that what is not infected answers the periodically successive transfer culture in new NBi culture medium, and infection rate can decline after long-time is cultivated.
(3) infect
With liquid-transfering gun, from 100mL agrobacterium suspensions, (formula of the agrobacterium suspension is calculated as by 1L:20 × N6 mother solutions
50mL, 100 × EDTA-Fe mother solution 10mL, 100 × B5 trace element mother solution 10mL, 100 × B5 vitamin stock solution 10mL, CEH
100 μM of 0.3g, inositol 2g, sucrose 30g, AS, pH 5.2~5.3) 800 μ L of middle absorption flushing Agrobacterium bacterium plate three to four times, inhale
Take bacterium solution 3~5 to drip in suspension, slightly muddiness can (i.e. bacterial concentration reaches OD600For 0.3 or so), calluss are used
Tweezers are sandwiched in suspension, timing 15min, are rocked once every three four minutes so as to be fully contacted.Bacterium solution is gone, will be infected
The calluss crossed are poured on aseptic filter paper, blot the bacterium solution of its excess surface, wound healing is moved to into NBco after 10min and co-cultures base
On, put between tissue culture 26 DEG C, 2~3d of illumination cultivation, visible Agrobacterium grows around calluss.
(4) wound healing and prescreening are cleaned
The wound healing for infecting is put in the empty triangular flask of sterilizing, with aseptic water washing for several times, till water becomes limpid,
200 μ L cephalos (cef, concentration 0.25g/mL, final concentration 500mg/L) are added in the sterilized water of 100mL sterilizings, by wound healing tweezer
Sub-folder enters triangular flask, is put on 28 DEG C of shaking tables and shakes 15min, and the water that will be equipped with cephalo is poured out, and wound healing is pushed and fill on aseptic filter paper
Divide and dry up, regular turnover wound healing is put into wound healing in NBps prescreening culture medium after 1-2 hours, light culture 7d at 26 DEG C.
(5) screen
Wound healing in NBps prescreening culture medium is moved on in NBS screening culture medium.
(6) regeneration culture
After 1 month, the kanamycin-resistant callus tissue number consecutively for growing is placed on regeneration culture medium, the dark 10h of illumination 14h/ at 26 DEG C
Culture 3-4 week left and right.
(7) root culture
Kanamycin-resistant callus tissue development in culture medium to be regenerated is grown after 2-3 centimetre of seedling, you can gently pressed from both sides out with tweezers,
Be placed on sterilized empty culture dish, remove Seedling around and root culture medium and old wound healing, be then gently placed with 3.5cm
Taking root in pipe for high root media, often puts a Seedling in pipe, number consistent with regenerating tube numbering.Illumination 14h/ is black at 26 DEG C
Dark 10h cultures 3-4 is all, after seedling grow it is sturdy and after the root system of prosperity by uncap seedling exercising culture, periodically to Guan Zhongjia originally
Water.
(8) seedling
Seedling length continues to be put into and takes root in pipe simultaneously to upright blade and during well developed root system after seedling root culture medium is cleaned
Tap water is added, is planted in soil after seedling is sufficiently robust.
3rd, BADH2 knocks out effect detection
The each 200bp-400bp sequences of target site upstream and downstream are chosen, primer is designed, enters performing PCR amplification, amplified fragments send survey
Sequence, judges whether target site undergos mutation by peak figure.The primer sequence of identification BADH2 mutation effects is as follows, clip size
494bp。
JDSQ3F1:5’-ACCTATCGCTTTCCACCTCA-3’
JDSQ3R1:5’-CGGTTCCTCTTCAGCGCCTC-3’
Amplification is shown in Fig. 6, and the 1st swimming lane represents that the 1st Seedling T0 of No. 107 strain is for plant in BADH2 transfer-gen plants,
FZCX3-1 is named as, the 2nd swimming lane represents that the 2nd Seedling T0 of No. 132 strain is for plant in BADH2 transfer-gen plants, by it
It is named as FZCX3-2;+ Japanese fine genome positive control is represented ,-represent ddH2O negative controls, M be 2kb Marker, stripe size
Respectively 2000bp, 1000bp, 750bp, 500bp, 250bp, 100bp.
Sequencing is sent by the PCR fragment of above-mentioned BADH2, sequencing primer is JDSQ3F1, FZCX3-1, FZCX3-2 plant (T0
Generation) sequencing result show BADH2 occur near PAM sites (i.e. CGG sequences) mutation.
FZCX3-1 and FZCX3-2 plant sequencing peak figure is shown in respectively Fig. 7 A and Fig. 7 B.By sequencing result in DSDecode websites
(http://dsdecode.scgene.com/home/) in carry out the prediction of mutation type, as a result see Fig. 8.
It follows that BADH2 is compound heterozygote mutation in FZCX3-1 plant.Wherein one chain lacks 4 bases, separately
One chain is the mutation of 5 bases;BADH2 is also compound heterozygote mutation in FZCX3-2 plant.Wherein one chain lacks 4
In base, deletion sites and FZCX3-1, another chain is the mutation of 5 bases, and mutated site part is different.
The disappearance of 4 bases causes frameshit, translation to terminate in advance in FZCX3-1 and FZCX3-2, base sequence and derives ammonia
Base acid sequence is as follows:
ATGGCCACGGCGATCCCGCAGCGGCAGCTCTTCGTCGCCGGCGAGTGGCGCGCCCGCTCGGCCGCCGCC
TCCCCGTCGTCAACCCCGCCACCGAGTCCCCCATCGGCGAGATCCCGGCGGGCACGGCGGAGGACGTGGACGCGGCG
GTGGCGGCGGCGCGGGAGGCGCTGAAGAGGAACCGGGGCCGCGACTGGGCGCGCGCGCCGGGCGCCGTCCGGGCCAA
GTACCTCCGCGCAATCGCGGCCAAGATAATCGAGAGGAAATCTGAGCTGGCTAGACTAGAGACGCTTGATTGTGGGA
AGCCTCTTGATGAAGCAGCATGGGACATGGACGATGTTGCTGGATGCTTTGAGTACTTTGCAGATCTTGCAGAATCC
TTGGACAAAAGGCAAAATGCACCTGTCTCTCTTCCAATGGAAAACTTTAAATGCTATCTTCGGAAAGAGCCTATCGG
TGTAGTTGGGTTGATCACACCTTGGAACTATCCTCTCCTGATGGCAACATGGAAGGTAGCTCCTGCCCTGGCTGCTG
GCTGTACAGCTGTACTAAAACCATCTGAATTGGCTTCCGTGACTTGTTTGGAGCTTGCTGATGTGTGTAAAGAGGTT
GGTCTTCCTTCAGGTGTGCTAAACATAGTGACTGGATTAGGTTCTGAAGCCGGTGCTCCTTTGTCATCACACCCTGG
TGTAGACAAGGTTGCATTTACTGGGAGTTATGAAACTGGTAAAAAGATTATGGCTTCAGCTGCTCCTATGGTTAAGC
CTGTTTCACTGGAACTTGGTGGAAAAAGTCCTATAGTGGTGTTTGATGATGTTGATGTTGAAAAAGCTGTTGAGTGG
ACTCTCTTTGGTTGCTTTTGGACCAATGGCCAGATTTGCAGTGCAACATCGCGTCTTATTCTTCATAAAAAAATCGC
TAAAGAATTTCAAGAAAGGATGGTTGCATGGGCCAAAAATATTAAGGTGTCAGATCCACTTGAAGAGGGTTGCAGGC
TTGGGCCCGTTGTTAGTGAAGGACAGTATGAGAAGATTAAGCAATTTGTATCTACCGCCAAAAGCCAAGGTGCTACC
ATTCTGACTGGTGGGGTTAGACCCAAGCATCTGGAGAAAGGTTTCTATATTGAACCCACAATCATTACTGATGTCGA
TACATCAATGCAAATTTGGAGGGAAGAAGTTTTTGGTCCAGTGCTCTGTGTGAAAGAATTTAGCACTGAAGAAGAAG
CCATTGAATTGGCCAACGATACTCATTATGGTCTGGCTGGTGCTGTGCTTTCCGGTGACCGCGAGCGATGCCAGAGA
TTAACTGAGGAGATCGATGCCGGAATTATCTGGGTGAACTGCTCGCAACCCTGCTTCTGCCAAGCTCCATGGGGCGG
GAACAAGCGCAGCGGCTTTGGACGCGAGCTCGGAGAAGGGGGCATTGACAACTACCTAAGCGTCAAGCAAGTGACGG
AGTACGCCTCCGATGAGCCGTGGGGATGGTACAAATCCCCTTCCAAGCTGTAA
MATAIPQRQLFVAGEWRARSAAASPSSTPPPSPPSARSRRARRRTWTRRWRRRGRR.RGTGAATGRARRAPSGPSTS
AQSRPR.SRGNLSWLD.RRLIVGSLLMKQHGTWTMLLDALSTLQILQNPWTKGKMHLSLFQWKTLNAIFGKSLSV.L
G.SHLGTILS.WQHGR.LLPWLLAVQLY.NHLNWLP.LVWSLLMCVKRLVFLQVC.T..LD.VLKPVLLCHHTLV.T
RLHLLGVMKLVKRLWLQLLLWLSLFHWNLVEKVL.WCLMMLMLKKLLSGLSLVAFGPMARFAVQHRVLFFIKKSLKN
FKKGWLHGPKILRCQIHLKRVAGLGPLLVKDSMRRLSNLYLPPKAKVLPF.LVGLDPSIWRKVSILNPQSLLMSIHQ
CKFGGKKFLVQCSV.KNLALKKKPLNWPTILIMVWLVLCFPVTASDARD.LRRSMPELSG.TARNPASAKLHGAGTS
AAALDASSEKGALTTT.ASSK.RSTPPMSRGDGTNPLPSC
The mutation of 5 bases in FZCX3-1 causes 3 continuous amino acid mutation, its base sequence and derivation aminoacid sequence
Row are as follows:
ATGGCCACGGCGATCCCGCAGCGGCAGCTCTTCGTCGCCGGCGAGTGGCGCGCCCCCGGGCGGCGGCGC
CGCCTCCCCGTCGTCAACCCCGCCACCGAGTCCCCCATCGGCGAGATCCCGGCGGGCACGGCGGAGGACGTGGACGC
GGCGGTGGCGGCGGCGCGGGAGGCGCTGAAGAGGAACCGGGGCCGCGACTGGGCGCGCGCGCCGGGCGCCGTCCGGG
CCAAGTACCTCCGCGCAATCGCGGCCAAGATAATCGAGAGGAAATCTGAGCTGGCTAGACTAGAGACGCTTGATTGT
GGGAAGCCTCTTGATGAAGCAGCATGGGACATGGACGATGTTGCTGGATGCTTTGAGTACTTTGCAGATCTTGCAGA
ATCCTTGGACAAAAGGCAAAATGCACCTGTCTCTCTTCCAATGGAAAACTTTAAATGCTATCTTCGGAAAGAGCCTA
TCGGTGTAGTTGGGTTGATCACACCTTGGAACTATCCTCTCCTGATGGCAACATGGAAGGTAGCTCCTGCCCTGGCT
GCTGGCTGTACAGCTGTACTAAAACCATCTGAATTGGCTTCCGTGACTTGTTTGGAGCTTGCTGATGTGTGTAAAGA
GGTTGGTCTTCCTTCAGGTGTGCTAAACATAGTGACTGGATTAGGTTCTGAAGCCGGTGCTCCTTTGTCATCACACC
CTGGTGTAGACAAGGTTGCATTTACTGGGAGTTATGAAACTGGTAAAAAGATTATGGCTTCAGCTGCTCCTATGGTT
AAGCCTGTTTCACTGGAACTTGGTGGAAAAAGTCCTATAGTGGTGTTTGATGATGTTGATGTTGAAAAAGCTGTTGA
GTGGACTCTCTTTGGTTGCTTTTGGACCAATGGCCAGATTTGCAGTGCAACATCGCGTCTTATTCTTCATAAAAAAA
TCGCTAAAGAATTTCAAGAAAGGATGGTTGCATGGGCCAAAAATATTAAGGTGTCAGATCCACTTGAAGAGGGTTGC
AGGCTTGGGCCCGTTGTTAGTGAAGGACAGTATGAGAAGATTAAGCAATTTGTATCTACCGCCAAAAGCCAAGGTGC
TACCATTCTGACTGGTGGGGTTAGACCCAAGCATCTGGAGAAAGGTTTCTATATTGAACCCACAATCATTACTGATG
TCGATACATCAATGCAAATTTGGAGGGAAGAAGTTTTTGGTCCAGTGCTCTGTGTGAAAGAATTTAGCACTGAAGAA
GAAGCCATTGAATTGGCCAACGATACTCATTATGGTCTGGCTGGTGCTGTGCTTTCCGGTGACCGCGAGCGATGCCA
GAGATTAACTGAGGAGATCGATGCCGGAATTATCTGGGTGAACTGCTCGCAACCCTGCTTCTGCCAAGCTCCATGGG
GCGGGAACAAGCGCAGCGGCTTTGGACGCGAGCTCGGAGAAGGGGGCATTGACAACTACCTAAGCGTCAAGCAAGTG
ACGGAGTACGCCTCCGATGAGCCGTGGGGATGGTACAAATCCCCTTCCAAGCTGTAA
MATAIPQRQLFVAGEWRAPGRRRRLPVVNPATESPIGEIPAGTAEDVDAAVAAAREALKRNRGRDWARA
PGAVRAKYLRAIAAKIIERKSELARLETLDCGKPLDEAAWDMDDVAGCFEYFADLAESLDKRQNAPVSLPMENFKCY
LRKEPIGVVGLITPWNYPLLMATWKVAPALAAGCTAVLKPSELASVTCLELADVCKEVGLPSGVLNIVTGLGSEAGA
PLSSHPGVDKVAFTGSYETGKKIMASAAPMVKPVSLELGGKSPIVVFDDVDVEKAVEWTLFGCFWTNGQICSATSRL
ILHKKIAKEFQERMVAWAKNIKVSDPLEEGCRLGPVVSEGQYEKIKQFVSTAKSQGATILTGGVRPKHLEKGFYIEP
TIITDVDTSMQIWREEVFGPVLCVKEFSTEEEAIELANDTHYGLAGAVLSGDRERCQRLTEEIDAGIIWVNCSQPCF
CQAPWGGNKRSGFGRELGEGGIDNYLSVKQVTEYASDEPWGWYKSPSKL
The mutation of 5 bases in FZCX3-2 causes 2 amino acid mutations, and its base sequence and derivation aminoacid sequence are such as
Under:
ATGGCCACGGCGATCCCGCAGCGGCAGCTCTTCGTCGCCGGCGAGTGGCGCGCCCCGGGGCTGCGGCGC
CGCCTCCCCGTCGTCAACCCCGCCACCGAGTCCCCCATCGGCGAGATCCCGGCGGGCACGGCGGAGGACGTGGACGC
GGCGGTGGCGGCGGCGCGGGAGGCGCTGAAGAGGAACCGGGGCCGCGACTGGGCGCGCGCGCCGGGCGCCGTCCGGG
CCAAGTACCTCCGCGCAATCGCGGCCAAGATAATCGAGAGGAAATCTGAGCTGGCTAGACTAGAGACGCTTGATTGT
GGGAAGCCTCTTGATGAAGCAGCATGGGACATGGACGATGTTGCTGGATGCTTTGAGTACTTTGCAGATCTTGCAGA
ATCCTTGGACAAAAGGCAAAATGCACCTGTCTCTCTTCCAATGGAAAACTTTAAATGCTATCTTCGGAAAGAGCCTA
TCGGTGTAGTTGGGTTGATCACACCTTGGAACTATCCTCTCCTGATGGCAACATGGAAGGTAGCTCCTGCCCTGGCT
GCTGGCTGTACAGCTGTACTAAAACCATCTGAATTGGCTTCCGTGACTTGTTTGGAGCTTGCTGATGTGTGTAAAGA
GGTTGGTCTTCCTTCAGGTGTGCTAAACATAGTGACTGGATTAGGTTCTGAAGCCGGTGCTCCTTTGTCATCACACC
CTGGTGTAGACAAGGTTGCATTTACTGGGAGTTATGAAACTGGTAAAAAGATTATGGCTTCAGCTGCTCCTATGGTT
AAGCCTGTTTCACTGGAACTTGGTGGAAAAAGTCCTATAGTGGTGTTTGATGATGTTGATGTTGAAAAAGCTGTTGA
GTGGACTCTCTTTGGTTGCTTTTGGACCAATGGCCAGATTTGCAGTGCAACATCGCGTCTTATTCTTCATAAAAAAA
TCGCTAAAGAATTTCAAGAAAGGATGGTTGCATGGGCCAAAAATATTAAGGTGTCAGATCCACTTGAAGAGGGTTGC
AGGCTTGGGCCCGTTGTTAGTGAAGGACAGTATGAGAAGATTAAGCAATTTGTATCTACCGCCAAAAGCCAAGGTGC
TACCATTCTGACTGGTGGGGTTAGACCCAAGCATCTGGAGAAAGGTTTCTATATTGAACCCACAATCATTACTGATG
TCGATACATCAATGCAAATTTGGAGGGAAGAAGTTTTTGGTCCAGTGCTCTGTGTGAAAGAATTTAGCACTGAAGAA
GAAGCCATTGAATTGGCCAACGATACTCATTATGGTCTGGCTGGTGCTGTGCTTTCCGGTGACCGCGAGCGATGCCA
GAGATTAACTGAGGAGATCGATGCCGGAATTATCTGGGTGAACTGCTCGCAACCCTGCTTCTGCCAAGCTCCATGGG
GCGGGAACAAGCGCAGCGGCTTTGGACGCGAGCTCGGAGAAGGGGGCATTGACAACTACCTAAGCGTCAAGCAAGTG
ACGGAGTACGCCTCCGATGAGCCGTGGGGATGGTACAAATCCCCTTCCAAGCTGTAA
MATAIPQRQLFVAGEWRAPGLRRRLPVVNPATESPIGEIPAGTAEDVDAAVAAAREALKRNRGRDWARAPGAVRAKY
LRAIAAKIIERKSELARLETLDCGKPLDEAAWDMDDVAGCFEYFADLAESLDKRQNAPVSLPMENFKCYLRKEPIGV
VGLITPWNYPLLMATWKVAPALAAGCTAVLKPSELASVTCLELADVCKEVGLPSGVLNIVTGLGSEAGAPLSSHPGV
DKVAFTGSYETGKKIMASAAPMVKPVSLELGGKSPIVVFDDVDVEKAVEWTLFGCFWTNGQICSATSRLILHKKIAK
EFQERMVAWAKNIKVSDPLEEGCRLGPVVSEGQYEKIKQFVSTAKSQGATILTGGVRPKHLEKGFYIEPTIITDVDT
SMQIWREEVFGPVLCVKEFSTEEEAIELANDTHYGLAGAVLSGDRERCQRLTEEIDAGIIWVNCSQPCFCQAPWGGN
KRSGFGRELGEGGIDNYLSVKQVTEYASDEPWGWYKSPSKL.
The present invention successfully builds and obtains heterozygous BADH2 Mutant Rice plant FZCX3-1, FZCX3-2.Using carrier
PHZ1-CAS9-gRNA-BADH2 is 50% to the efficiency of Oryza sativa L. BADH2 site-directed point mutations.
Although above with a general description of the specific embodiments the present invention is described in detail,
On the basis of the present invention, it can be made some modifications or improvements, this will be apparent to those skilled in the art.Cause
This, without departing from theon the basis of the spirit of the present invention these modifications or improvements, belong to the scope of protection of present invention.
Sequence table
<110>Hua Zhi rice biologicals Technology Co., Ltd.
<120>Using method of the CRISPR-CAS9 technologies to Oryza sativa L. BADH2 site-directed point mutations
<130> KHP161117616.2
<160> 9
<170> PatentIn version 3.3
<210> 1
<211> 20
<212> DNA
<213>Oryza sativa L.
<400> 1
gagtggcgcg cccccgcgct 20
<210> 2
<211> 347
<212> DNA
<213>OsU6-BADH2-gRNA-polyT fragments
<400> 2
ggatcatgaa ccaacggcct ggctgtattt ggtggttgtg tagggagatg gggagaagaa 60
aagcccgatt ctcttcgctg tgatgggctg gatgcatgcg ggggagcggg aggcccaagt 120
acgtgcacgg tgagcggccc acagggcgag tgtgagcgcg agaggcggga ggaacagttt 180
agtaccacat tgcccagcta actcgaacgc gaccaactta taaacccgcg cgctgtcgct 240
tgtgtgagtg gcgcgccccc gcgctgtttt agagctagaa atagcaagtt aaaataaggc 300
tagtccgtta tcaacttgaa aaagtggcac cgagtcggtg ctttttt 347
<210> 3
<211> 14832
<212> DNA
<213>PHZ1-CAS9-gRNA-BADH2 carriers
<400> 3
cgtaatcatg gtcatagctg tttcctgtgt gaaattgtta tccgctcaca attccacaca 60
acatacgagc cggaagcata aagtgtaaag cctggggtgc ctaatgagtg agctaactca 120
cattaattgc gttgcgctca ctgcccgctt tccagtcggg aaacctgtcg tgccagctgc 180
attaatgaat cggccaacgc gcggggagag gcggtttgcg tattggctag agcagcttgc 240
caacatggtg gagcacgaca ctctcgtcta ctccaagaat atcaaagata cagtctcaga 300
agaccaaagg gctattgaga cttttcaaca aagggtaata tcgggaaacc tcctcggatt 360
ccattgccca gctatctgtc acttcatcaa aaggacagta gaaaaggaag gtggcaccta 420
caaatgccat cattgcgata aaggaaaggc tatcgttcaa gatgcctctg ccgacagtgg 480
tcccaaagat ggacccccac ccacgaggag catcgtggaa aaagaagacg ttccaaccac 540
gtcttcaaag caagtggatt gatgtgataa catggtggag cacgacactc tcgtctactc 600
caagaatatc aaagatacag tctcagaaga ccaaagggct attgagactt ttcaacaaag 660
ggtaatatcg ggaaacctcc tcggattcca ttgcccagct atctgtcact tcatcaaaag 720
gacagtagaa aaggaaggtg gcacctacaa atgccatcat tgcgataaag gaaaggctat 780
cgttcaagat gcctctgccg acagtggtcc caaagatgga cccccaccca cgaggagcat 840
cgtggaaaaa gaagacgttc caaccacgtc ttcaaagcaa gtggattgat gtgatatctc 900
cactgacgta agggatgacg cacaatccca ctatccttcg caagaccttc ctctatataa 960
ggaagttcat ttcatttgga gaggacacgc tgaaatcacc agtctctctc tacaaatcta 1020
tctctctcga gctttcgcag atcccggggg gcaatgagat atgaaaaagc ctgaactcac 1080
cgcgacgtct gtcgagaagt ttctgatcga aaagttcgac agcgtctccg acctgatgca 1140
gctctcggag ggcgaagaat ctcgtgcttt cagcttcgat gtaggagggc gtggatatgt 1200
cctgcgggta aatagctgcg ccgatggttt ctacaaagat cgttatgttt atcggcactt 1260
tgcatcggcc gcgctcccga ttccggaagt gcttgacatt ggggagttta gcgagagcct 1320
gacctattgc atctcccgcc gtgcacaggg tgtcacgttg caagacctgc ctgaaaccga 1380
actgcccgct gttctacaac cggtcgcgga ggctatggat gcgatcgctg cggccgatct 1440
tagccagacg agcgggttcg gcccattcgg accgcaagga atcggtcaat acactacatg 1500
gcgtgatttc atatgcgcga ttgctgatcc ccatgtgtat cactggcaaa ctgtgatgga 1560
cgacaccgtc agtgcgtccg tcgcgcaggc tctcgatgag ctgatgcttt gggccgagga 1620
ctgccccgaa gtccggcacc tcgtgcacgc ggatttcggc tccaacaatg tcctgacgga 1680
caatggccgc ataacagcgg tcattgactg gagcgaggcg atgttcgggg attcccaata 1740
cgaggtcgcc aacatcttct tctggaggcc gtggttggct tgtatggagc agcagacgcg 1800
ctacttcgag cggaggcatc cggagcttgc aggatcgcca cgactccggg cgtatatgct 1860
ccgcattggt cttgaccaac tctatcagag cttggttgac ggcaatttcg atgatgcagc 1920
ttgggcgcag ggtcgatgcg acgcaatcgt ccgatccgga gccgggactg tcgggcgtac 1980
acaaatcgcc cgcagaagcg cggccgtctg gaccgatggc tgtgtagaag tactcgccga 2040
tagtggaaac cgacgcccca gcactcgtcc gagggcaaag aaatagagta gatgccgacc 2100
ggatctgtcg atcgacaagc tcgagtttct ccataataat gtgtgagtag ttcccagata 2160
agggaattag ggttcctata gggtttcgct catgtgttga gcatataaga aacccttagt 2220
atgtatttgt atttgtaaaa tacttctatc aataaaattt ctaattccta aaaccaaaat 2280
ccagtactaa aatccagatc ccccgaatta attcggcgtt aattcagtac attaaaaacg 2340
tccgcaatgt gttattaagt tgtctaagcg tcaatttgtt tacaccacaa tatatcctgc 2400
caccagccag ccaacagctc cccgaccggc agctcggcac aaaatcacca ctcgatacag 2460
gcagcccatc agtccgggac ggcgtcagcg ggagagccgt tgtaaggcgg cagactttgc 2520
tcatgttacc gatgctattc ggaagaacgg caactaagct gccgggtttg aaacacggat 2580
gatctcgcgg agggtagcat gttgattgta acgatgacag agcgttgctg cctgtgatca 2640
ccgcggtttc aaaatcggct ccgtcgatac tatgttatac gccaactttg aaaacaactt 2700
tgaaaaagct gttttctggt atttaaggtt ttagaatgca aggaacagtg aattggagtt 2760
cgtcttgtta taattagctt cttggggtat ctttaaatac tgtagaaaag aggaaggaaa 2820
taataaatgg ctaaaatgag aatatcaccg gaattgaaaa aactgatcga aaaataccgc 2880
tgcgtaaaag atacggaagg aatgtctcct gctaaggtat ataagctggt gggagaaaat 2940
gaaaacctat atttaaaaat gacggacagc cggtataaag ggaccaccta tgatgtggaa 3000
cgggaaaagg acatgatgct atggctggaa ggaaagctgc ctgttccaaa ggtcctgcac 3060
tttgaacggc atgatggctg gagcaatctg ctcatgagtg aggccgatgg cgtcctttgc 3120
tcggaagagt atgaagatga acaaagccct gaaaagatta tcgagctgta tgcggagtgc 3180
atcaggctct ttcactccat cgacatatcg gattgtccct atacgaatag cttagacagc 3240
cgcttagccg aattggatta cttactgaat aacgatctgg ccgatgtgga ttgcgaaaac 3300
tgggaagaag acactccatt taaagatccg cgcgagctgt atgatttttt aaagacggaa 3360
aagcccgaag aggaacttgt cttttcccac ggcgacctgg gagacagcaa catctttgtg 3420
aaagatggca aagtaagtgg ctttattgat cttgggagaa gcggcagggc ggacaagtgg 3480
tatgacattg ccttctgcgt ccggtcgatc agggaggata tcggggaaga acagtatgtc 3540
gagctatttt ttgacttact ggggatcaag cctgattggg agaaaataaa atattatatt 3600
ttactggatg aattgtttta gtacctagaa tgcatgacca aaatccctta acgtgagttt 3660
tcgttccact gagcgtcaga ccccgtagaa aagatcaaag gatcttcttg agatcctttt 3720
tttctgcgcg taatctgctg cttgcaaaca aaaaaaccac cgctaccagc ggtggtttgt 3780
ttgccggatc aagagctacc aactcttttt ccgaaggtaa ctggcttcag cagagcgcag 3840
ataccaaata ctgtccttct agtgtagccg tagttaggcc accacttcaa gaactctgta 3900
gcaccgccta catacctcgc tctgctaatc ctgttaccag tggctgctgc cagtggcgat 3960
aagtcgtgtc ttaccgggtt ggactcaaga cgatagttac cggataaggc gcagcggtcg 4020
ggctgaacgg ggggttcgtg cacacagccc agcttggagc gaacgaccta caccgaactg 4080
agatacctac agcgtgagct atgagaaagc gccacgcttc ccgaagggag aaaggcggac 4140
aggtatccgg taagcggcag ggtcggaaca ggagagcgca cgagggagct tccaggggga 4200
aacgcctggt atctttatag tcctgtcggg tttcgccacc tctgacttga gcgtcgattt 4260
ttgtgatgct cgtcaggggg gcggagccta tggaaaaacg ccagcaacgc ggccttttta 4320
cggttcctgg ccttttgctg gccttttgct cacatgttct ttcctgcgtt atcccctgat 4380
tctgtggata accgtattac cgcctttgag tgagctgata ccgctcgccg cagccgaacg 4440
accgagcgca gcgagtcagt gagcgaggaa gcggaagagc gcctgatgcg gtattttctc 4500
cttacgcatc tgtgcggtat ttcacaccgc atatggtgca ctctcagtac aatctgctct 4560
gatgccgcat agttaagcca gtatacactc cgctatcgct acgtgactgg gtcatggctg 4620
cgccccgaca cccgccaaca cccgctgacg cgccctgacg ggcttgtctg ctcccggcat 4680
ccgcttacag acaagctgtg accgtctccg ggagctgcat gtgtcagagg ttttcaccgt 4740
catcaccgaa acgcgcgagg cagggtgcct tgatgtgggc gccggcggtc gagtggcgac 4800
ggcgcggctt gtccgcgccc tggtagattg cctggccgta ggccagccat ttttgagcgg 4860
ccagcggccg cgataggccg acgcgaagcg gcggggcgta gggagcgcag cgaccgaagg 4920
gtaggcgctt tttgcagctc ttcggctgtg cgctggccag acagttatgc acaggccagg 4980
cgggttttaa gagttttaat aagttttaaa gagttttagg cggaaaaatc gccttttttc 5040
tcttttatat cagtcactta catgtgtgac cggttcccaa tgtacggctt tgggttccca 5100
atgtacgggt tccggttccc aatgtacggc tttgggttcc caatgtacgt gctatccaca 5160
ggaaagagac cttttcgacc tttttcccct gctagggcaa tttgccctag catctgctcc 5220
gtacattagg aaccggcgga tgcttcgccc tcgatcaggt tgcggtagcg catgactagg 5280
atcgggccag cctgccccgc ctcctccttc aaatcgtact ccggcaggtc atttgacccg 5340
atcagcttgc gcacggtgaa acagaacttc ttgaactctc cggcgctgcc actgcgttcg 5400
tagatcgtct tgaacaacca tctggcttct gccttgcctg cggcgcggcg tgccaggcgg 5460
tagagaaaac ggccgatgcc gggatcgatc aaaaagtaat cggggtgaac cgtcagcacg 5520
tccgggttct tgccttctgt gatctcgcgg tacatccaat cagctagctc gatctcgatg 5580
tactccggcc gcccggtttc gctctttacg atcttgtagc ggctaatcaa ggcttcaccc 5640
tcggataccg tcaccaggcg gccgttcttg gccttcttcg tacgctgcat ggcaacgtgc 5700
gtggtgttta accgaatgca ggtttctacc aggtcgtctt tctgctttcc gccatcggct 5760
cgccggcaga acttgagtac gtccgcaacg tgtggacgga acacgcggcc gggcttgtct 5820
cccttccctt cccggtatcg gttcatggat tcggttagat gggaaaccgc catcagtacc 5880
aggtcgtaat cccacacact ggccatgccg gccggccctg cggaaacctc tacgtgcccg 5940
tctggaagct cgtagcggat cacctcgcca gctcgtcggt cacgcttcga cagacggaaa 6000
acggccacgt ccatgatgct gcgactatcg cgggtgccca cgtcatagag catcggaacg 6060
aaaaaatctg gttgctcgtc gcccttgggc ggcttcctaa tcgacggcgc accggctgcc 6120
ggcggttgcc gggattcttt gcggattcga tcagcggccg cttgccacga ttcaccgggg 6180
cgtgcttctg cctcgatgcg ttgccgctgg gcggcctgcg cggccttcaa cttctccacc 6240
aggtcatcac ccagcgccgc gccgatttgt accgggccgg atggtttgcg accgtcacgc 6300
cgattcctcg ggcttggggg ttccagtgcc attgcagggc cggcagacaa cccagccgct 6360
tacgcctggc caaccgcccg ttcctccaca catggggcat tccacggcgt cggtgcctgg 6420
ttgttcttga ttttccatgc cgcctccttt agccgctaaa attcatctac tcatttattc 6480
atttgctcat ttactctggt agctgcgcga tgtattcaga tagcagctcg gtaatggtct 6540
tgccttggcg taccgcgtac atcttcagct tggtgtgatc ctccgccggc aactgaaagt 6600
tgacccgctt catggctggc gtgtctgcca ggctggccaa cgttgcagcc ttgctgctgc 6660
gtgcgctcgg acggccggca cttagcgtgt ttgtgctttt gctcattttc tctttacctc 6720
attaactcaa atgagttttg atttaatttc agcggccagc gcctggacct cgcgggcagc 6780
gtcgccctcg ggttctgatt caagaacggt tgtgccggcg gcggcagtgc ctgggtagct 6840
cacgcgctgc gtgatacggg actcaagaat gggcagctcg tacccggcca gcgcctcggc 6900
aacctcaccg ccgatgcgcg tgcctttgat cgcccgcgac acgacaaagg ccgcttgtag 6960
ccttccatcc gtgacctcaa tgcgctgctt aaccagctcc accaggtcgg cggtggccca 7020
tatgtcgtaa gggcttggct gcaccggaat cagcacgaag tcggctgcct tgatcgcgga 7080
cacagccaag tccgccgcct ggggcgctcc gtcgatcact acgaagtcgc gccggccgat 7140
ggccttcacg tcgcggtcaa tcgtcgggcg gtcgatgccg acaacggtta gcggttgatc 7200
ttcccgcacg gccgcccaat cgcgggcact gccctgggga tcggaatcga ctaacagaac 7260
atcggccccg gcgagttgca gggcgcgggc tagatgggtt gcgatggtcg tcttgcctga 7320
cccgcctttc tggttaagta cagcgataac cttcatgcgt tccccttgcg tatttgttta 7380
tttactcatc gcatcatata cgcagcgacc gcatgacgca agctgtttta ctcaaataca 7440
catcaccttt ttagacggcg gcgctcggtt tcttcagcgg ccaagctggc cggccaggcc 7500
gccagcttgg catcagacaa accggccagg atttcatgca gccgcacggt tgagacgtgc 7560
gcgggcggct cgaacacgta cccggccgcg atcatctccg cctcgatctc ttcggtaatg 7620
aaaaacggtt cgtcctggcc gtcctggtgc ggtttcatgc ttgttcctct tggcgttcat 7680
tctcggcggc cgccagggcg tcggcctcgg tcaatgcgtc ctcacggaag gcaccgcgcc 7740
gcctggcctc ggtgggcgtc acttcctcgc tgcgctcaag tgcgcggtac agggtcgagc 7800
gatgcacgcc aagcagtgca gccgcctctt tcacggtgcg gccttcctgg tcgatcagct 7860
cgcgggcgtg cgcgatctgt gccggggtga gggtagggcg ggggccaaac ttcacgcctc 7920
gggccttggc ggcctcgcgc ccgctccggg tgcggtcgat gattagggaa cgctcgaact 7980
cggcaatgcc ggcgaacacg gtcaacacca tgcggccggc cggcgtggtg gtgtcggccc 8040
acggctctgc caggctacgc aggcccgcgc cggcctcctg gatgcgctcg gcaatgtcca 8100
gtaggtcgcg ggtgctgcgg gccaggcggt ctagcctggt cactgtcaca acgtcgccag 8160
ggcgtaggtg gtcaagcatc ctggccagct ccgggcggtc gcgcctggtg ccggtgatct 8220
tctcggaaaa cagcttggtg cagccggccg cgtgcagttc ggcccgttgg ttggtcaagt 8280
cctggtcgtc ggtgctgacg cgggcatagc ccagcaggcc agcggcggcg ctcttgttca 8340
tggcgtaatg tctccggttc tagtcgcaag tattctactt tatgcgacta aaacacgcga 8400
caagaaaacg ccaggaaaag ggcagggcgg cagcctgtcg cgtaacttag gacttgtgcg 8460
acatgtcgtt ttcagaagac ggctgcactg aacgtcagaa gccgactgca ctatagcagc 8520
ggaggggttg gatcaaagta ctttgatccc gaggggaacc ctgtggttgg catgcacata 8580
caaatggacg aacggataaa ccttttcacg cccttttaaa tatccgttat tctaataaac 8640
gctcttttct cttaggttta cccgccaata tatcctgtca aacactgata gtttaaactg 8700
aaggcgggaa acgacaatct gatccaagct caagctgctc tagcattcgc cattcaggct 8760
gcgcaactgt tgggaagggc gatcggtgcg ggcctcttcg ctattacgcc agctggcgaa 8820
agggggatgt gctgcaaggc gattaagttg ggtaacgcca gggttttccc agtcacgacg 8880
ttgtaaaacg acggccagtg ccaagctctc ggatccacta gtaacggccg ccagtgtgct 8940
ggaattgccc ttggatcatg aaccaacggc ctggctgtat ttggtggttg tgtagggaga 9000
tggggagaag aaaagcccga ttctcttcgc tgtgatgggc tggatgcatg cgggggagcg 9060
ggaggcccaa gtacgtgcac ggtgagcggc ccacagggcg agtgtgagcg cgagaggcgg 9120
gaggaacagt ttagtaccac attgcccagc taactcgaac gcgaccaact tataaacccg 9180
cgcgctgtcg cttgtgtgag tggcgcgccc ccgcgctgtt ttagagctag aaatagcaag 9240
ttaaaataag gctagtccgt tatcaacttg aaaaagtggc accgagtcgg tgcttttttt 9300
gtcccttcga agggcaattc tgcagatatc catcacactg gcggccgctc gaggtcgaag 9360
cttgcatgcc tgcaggtcaa catggtggag cacgacacac ttgtctactc caaaaatatc 9420
aaagatacag tctcagaaga ccaaagggca attgagactt ttcaacaaag ggtaatatcc 9480
ggaaacctcc tcggattcca ttgcccagct atctgtcact ttattgtgaa gatagtggaa 9540
aaggaaggtg gctcctacaa atgccatcat tgcgataaag gaaaggccat cgttgaagat 9600
gcctctgccg acagtggtcc caaagatgga cccccaccca cgaggagcat cgtggaaaaa 9660
gaagacgttc caaccacgtc ttcaaagcaa gtggattgat gtgataacat ggtggagcac 9720
gacacacttg tctactccaa aaatatcaaa gatacagtct cagaagacca aagggcaatt 9780
gagacttttc aacaaagggt gatatccgga aacctcctcg gattccattg cccagctatc 9840
tgtcacttta ttgtgaagat agtggaaaag gaaggtggct cctacaaatg ccatcattgc 9900
gataaaggaa aggccatcgt tgaagatgcc tctgccgaca gtggtcccaa agatggaccc 9960
ccacccacga ggagcatcgt ggaaaaagaa gacgttccaa ccacgtcttc aaagcaagtg 10020
gattgatgtg atatctccac tgacgtaagg gatgacgcac aatcccacta tccttcgcaa 10080
gacccttcct ctatataagg aagttcattt catttggaga ggacctcgac ctcaacacaa 10140
catatacaaa acaaacgaat ctcaagcaat caagcattct acttctattg cagcaattta 10200
aatcatttct tttaaagcaa aagcaatttt ctgaaaattt tcaccattta cgaacgatac 10260
tcgagatgga ctataaggac cacgacggag actacaagga tcatgatatt gattacaaag 10320
acgatgacga taagatggcc ccaaagaaga agcggaaggt cggtatccac ggagtcccag 10380
cagccgacaa gaagtacagc atcggcctgg acatcggcac caactctgtg ggctgggccg 10440
tgatcaccga cgagtacaag gtgcccagca agaaattcaa ggtgctgggc aacaccgacc 10500
ggcacagcat caagaagaac ctgatcggag ccctgctgtt cgacagcggc gaaacagccg 10560
aggccacccg gctgaagaga accgccagaa gaagatacac cagacggaag aaccggatct 10620
gctatctgca agagatcttc agcaacgaga tggccaaggt ggacgacagc ttcttccaca 10680
gactggaaga gtccttcctg gtggaagagg ataagaagca cgagcggcac cccatcttcg 10740
gcaacatcgt ggacgaggtg gcctaccacg agaagtaccc caccatctac cacctgagaa 10800
agaaactggt ggacagcacc gacaaggccg acctgcggct gatctatctg gccctggccc 10860
acatgatcaa gttccggggc cacttcctga tcgagggcga cctgaacccc gacaacagcg 10920
acgtggacaa gctgttcatc cagctggtgc agacctacaa ccagctgttc gaggaaaacc 10980
ccatcaacgc cagcggcgtg gacgccaagg ccatcctgtc tgccagactg agcaagagca 11040
gacggctgga aaatctgatc gcccagctgc ccggcgagaa gaagaatggc ctgttcggaa 11100
acctgattgc cctgagcctg ggcctgaccc ccaacttcaa gagcaacttc gacctggccg 11160
aggatgccaa actgcagctg agcaaggaca cctacgacga cgacctggac aacctgctgg 11220
cccagatcgg cgaccagtac gccgacctgt ttctggccgc caagaacctg tccgacgcca 11280
tcctgctgag cgacatcctg agagtgaaca ccgagatcac caaggccccc ctgagcgcct 11340
ctatgatcaa gagatacgac gagcaccacc aggacctgac cctgctgaaa gctctcgtgc 11400
ggcagcagct gcctgagaag tacaaagaga ttttcttcga ccagagcaag aacggctacg 11460
ccggctacat tgacggcgga gccagccagg aagagttcta caagttcatc aagcccatcc 11520
tggaaaagat ggacggcacc gaggaactgc tcgtgaagct gaacagagag gacctgctgc 11580
ggaagcagcg gaccttcgac aacggcagca tcccccacca gatccacctg ggagagctgc 11640
acgccattct gcggcggcag gaagattttt acccattcct gaaggacaac cgggaaaaga 11700
tcgagaagat cctgaccttc cgcatcccct actacgtggg ccctctggcc aggggaaaca 11760
gcagattcgc ctggatgacc agaaagagcg aggaaaccat caccccctgg aacttcgagg 11820
aagtggtgga caagggcgct tccgcccaga gcttcatcga gcggatgacc aacttcgata 11880
agaacctgcc caacgagaag gtgctgccca agcacagcct gctgtacgag tacttcaccg 11940
tgtataacga gctgaccaaa gtgaaatacg tgaccgaggg aatgagaaag cccgccttcc 12000
tgagcggcga gcagaaaaag gccatcgtgg acctgctgtt caagaccaac cggaaagtga 12060
ccgtgaagca gctgaaagag gactacttca agaaaatcga gtgcttcgac tccgtggaaa 12120
tctccggcgt ggaagatcgg ttcaacgcct ccctgggcac ataccacgat ctgctgaaaa 12180
ttatcaagga caaggacttc ctggacaatg aggaaaacga ggacattctg gaagatatcg 12240
tgctgaccct gacactgttt gaggacagag agatgatcga ggaacggctg aaaacctatg 12300
cccacctgtt cgacgacaaa gtgatgaagc agctgaagcg gcggagatac accggctggg 12360
gcaggctgag ccggaagctg atcaacggca tccgggacaa gcagtccggc aagacaatcc 12420
tggatttcct gaagtccgac ggcttcgcca acagaaactt catgcagctg atccacgacg 12480
acagcctgac ctttaaagag gacatccaga aagcccaggt gtccggccag ggcgatagcc 12540
tgcacgagca cattgccaat ctggccggca gccccgccat taagaagggc atcctgcaga 12600
cagtgaaggt ggtggacgag ctcgtgaaag tgatgggccg gcacaagccc gagaacatcg 12660
tgatcgaaat ggccagagag aaccagacca cccagaaggg acagaagaac agccgcgaga 12720
gaatgaagcg gatcgaagag ggcatcaaag agctgggcag ccagatcctg aaagaacacc 12780
ccgtggaaaa cacccagctg cagaacgaga agctgtacct gtactacctg cagaatgggc 12840
gggatatgta cgtggaccag gaactggaca tcaaccggct gtccgactac gatgtggacc 12900
atatcgtgcc tcagagcttt ctgaaggacg actccatcga caacaaggtg ctgaccagaa 12960
gcgacaagaa ccggggcaag agcgacaacg tgccctccga agaggtcgtg aagaagatga 13020
agaactactg gcggcagctg ctgaacgcca agctgattac ccagagaaag ttcgacaatc 13080
tgaccaaggc cgagagaggc ggcctgagcg aactggataa ggccggcttc atcaagagac 13140
agctggtgga aacccggcag atcacaaagc acgtggcaca gatcctggac tcccggatga 13200
acactaagta cgacgagaat gacaagctga tccgggaagt gaaagtgatc accctgaagt 13260
ccaagctggt gtccgatttc cggaaggatt tccagtttta caaagtgcgc gagatcaaca 13320
actaccacca cgcccacgac gcctacctga acgccgtcgt gggaaccgcc ctgatcaaaa 13380
agtaccctaa gctggaaagc gagttcgtgt acggcgacta caaggtgtac gacgtgcgga 13440
agatgatcgc caagagcgag caggaaatcg gcaaggctac cgccaagtac ttcttctaca 13500
gcaacatcat gaactttttc aagaccgaga ttaccctggc caacggcgag atccggaagc 13560
ggcctctgat cgagacaaac ggcgaaaccg gggagatcgt gtgggataag ggccgggatt 13620
ttgccaccgt gcggaaagtg ctgagcatgc cccaagtgaa tatcgtgaaa aagaccgagg 13680
tgcagacagg cggcttcagc aaagagtcta tcctgcccaa gaggaacagc gataagctga 13740
tcgccagaaa gaaggactgg gaccctaaga agtacggcgg cttcgacagc cccaccgtgg 13800
cctattctgt gctggtggtg gccaaagtgg aaaagggcaa gtccaagaaa ctgaagagtg 13860
tgaaagagct gctggggatc accatcatgg aaagaagcag cttcgagaag aatcccatcg 13920
actttctgga agccaagggc tacaaagaag tgaaaaagga cctgatcatc aagctgccta 13980
agtactccct gttcgagctg gaaaacggcc ggaagagaat gctggcctct gccggcgaac 14040
tgcagaaggg aaacgaactg gccctgccct ccaaatatgt gaacttcctg tacctggcca 14100
gccactatga gaagctgaag ggctcccccg aggataatga gcagaaacag ctgtttgtgg 14160
aacagcacaa gcactacctg gacgagatca tcgagcagat cagcgagttc tccaagagag 14220
tgatcctggc cgacgctaat ctggacaaag tgctgtccgc ctacaacaag caccgggata 14280
agcccatcag agagcaggcc gagaatatca tccacctgtt taccctgacc aatctgggag 14340
cccctgccgc cttcaagtac tttgacacca ccatcgaccg gaagaggtac accagcacca 14400
aagaggtgct ggacgccacc ctgatccacc agagcatcac cggcctgtac gagacacgga 14460
tcgacctgtc tcagctggga ggcgacaaaa ggccggcggc cacgaaaaag gccggccagg 14520
caaaaaagaa aaagtaagga tcctgattga tcgatagagc tcgaatttcc ccgatcgttc 14580
aaacatttgg caataaagtt tcttaagatt gaatcctgtt gccggtcttg cgatgattat 14640
catataattt ctgttgaatt acgttaagca tgtaataatt aacatgtaat gcatgacgtt 14700
atttatgaga tgggttttta tgattagagt cccgcaatta tacatttaat acgcgataga 14760
aaacaaaata tagcgcgcaa actaggataa attatcgcgc gcggtgtcat ctatgttact 14820
agatcgggaa tt 14832
<210> 4
<211> 41
<212> DNA
<213>Artificial sequence
<400> 4
cgacggccag tgccaagctt ctcggatcca ctagtaacgg c 41
<210> 5
<211> 41
<212> DNA
<213>Artificial sequence
<400> 5
agcgcggggg cgcgccactc acacaagcga cagcgcgcgg g 41
<210> 6
<211> 41
<212> DNA
<213>Artificial sequence
<400> 6
gagtggcgcg cccccgcgct gttttagagc tagaaatagc a 41
<210> 7
<211> 41
<212> DNA
<213>Artificial sequence
<400> 7
acctgcaggc atgcaagctt cgacctcgag cggccgccag t 41
<210> 8
<211> 20
<212> DNA
<213>Artificial sequence
<400> 8
acctatcgct ttccacctca 20
<210> 9
<211> 20
<212> DNA
<213>Artificial sequence
<400> 9
cggttcctct tcagcgcctc 20
Claims (9)
1. method of the CRISPR-CAS9 technologies to Oryza sativa L. BADH2 site-directed point mutations is utilized, it is characterised in that for Oryza sativa L.
SgRNA sequence of the BADH2 gene design based on CRISPR/Cas9, by the DNA fragmentation connection containing the coding sgRNA sequences
To in the carrier for carrying CRISPR/Cas, rice transformation realizes the rite-directed mutagenesises to Oryza sativa L. BADH2 genes;
Wherein, the nucleotides sequence of sgRNA action sites is classified as 5 '-GAGTGGCGCGCCCCCGCGCT-3 '.
2. method according to claim 1, it is characterised in that carrier construction pHZ1-CAS9-gRNA-BADH2, using agriculture
Bacillus mediated method rice transformation, screens positive transgenic plant;
The construction method of the carrier pHZ1-CAS9-gRNA-BADH2 is as follows:
1) structure of OsU6-BADH2-gRNA-polyT fragments
First round PCR expands OsU6 promoteres and BADH2 bases with Cris-GL3 plasmids as template with primer CRI-F1 and SQ3-R1
The 20bp target sequences of cause, clip size 329bp;Equally with Cris-GL3 plasmids as template, expanded with primer SQ3-F2 and CRI-R2
Increase the 20bp target sequences and gRNA-polyT of BADH2 genes, clip size 180bp;Second wheel PCR is with first round PCR primer
For template, with primer CRI-F1 and CRI-R2 amplification OsU6-BADH2-gRNA-polyT fragments, clip size 489bp, sequence are obtained final product
Row such as SEQ ID NO:Shown in 2;
2) structure of carrier pHZ1-CAS9-gRNA-BADH2
OsU6-BADH2-gRNA-polyT fragments are carried out into respectively fine jade with the PMDC99-Cas9 carriers Jing after Hind III digestions
Sepharose electrophoresis, cuts and carry out after glue reclaim seamless clone, based on the principle of homologous recombination, OsU6-BADH2-gRNA-polyT
Fragment is fused to the Hind III sites of PMDC99-CAS9 carriers by the method for Infusion, that is, build and obtain pHZ1-
CAS9-gRNA-BADH2 carriers;
Wherein, step 1) used in primer sequence it is as follows:
CRI-F1:5’-CGACGGCCAGTGCCAAGCTTCTCGGATCCACTAGTAACGGC-3’
SQ3-R1:5’-AGCGCGGGGGCGCGCCACTCACACAAGCGACAGCGCGCGGG-3’
SQ3-F2:5’-GAGTGGCGCGCCCCCGCGCTGTTTTAGAGCTAGAAATAGCA-3’
CRI-R2:5’-ACCTGCAGGCATGCAAGCTTCGACCTCGAGCGGCCGCCAGT-3’。
3. method according to claim 2, it is characterised in that the nucleotide of the pHZ1-CAS9-gRNA-BADH2 carriers
Sequence such as SEQ ID NO:Shown in 3.
4. application of any one of the claim 1-3 methods described in Oryza sativa L. BADH2 site-directed point mutation breedings.
5. application according to claim 4, it is characterised in that comprise the following steps:
(1) Oryza sativa L. ' Japan is fine ' mature embryo callus induction;
(2) infect in the Agrobacterium bacterium solution that the calluss immersion of induction is carried pHZ1-CAS9-gRNA-BADH2 carriers;It is excellent
Choosing is EHA105 using agrobacterium strains;
(3) calluss are moved to and is cultivated in co-cultivation culture medium, washed away and move to after Agrobacterium culture in prescreening culture medium, then
Move to and carry out in screening culture medium resistant calli screening;
(4) resistant calli is moved to and is cultivated in regeneration culture, form vegetative seedling;
(5) seedling exercising, transplanting, obtain transgenic paddy rice after vegetative seedling is taken root on root media;
(6) primer is designed according to the nucleotide sequence of sgRNA action sites, rice plant mutational site is identified by PCR methods.
6. application according to claim 5, it is characterised in that step (1) is specially:Shell after mature seed threshing, use
75% ethanol is washed 2 minutes, then is immersed in the liquor natrii hypochloritises of active chlorine content 5.5%, and 30min, washing 5 are shaken on shaking table
Secondary, being placed in after seed treatment in NBi culture medium is used for callus induction, and the dark 10h of 26 DEG C of illumination 14h/ is cultivated 15-20 days;Strip more
Injured tissue, moves in new NBi culture medium, and 26 DEG C of light cultures are used to infect after 4 days.
7. the application according to claim 5 or 6, it is characterised in that
The formula for co-culturing culture medium is calculated as by 2L:
20 × N6 mother solution 100mL, 100 × EDTA-Fe mother solution 20mL, 100 × B5 trace element mother solution 20mL, 100 × B5 dimension life
Plain mother solution 20mL, glutamine 1g, proline 1g, CEH 0.6g, inositol 0.2g, sucrose 60g, 2,4-D 4mg, 3 ', 5 '-diformazan
Epoxide -4 ' 100 μM of-hydroxy acetophenone, plant gum 5.2g, pH 5.2~5.3;
The prescreening culture medium prescription is:
NBi culture medium containing 500mg/L cephamycins, pH=5.8;
The formula of the screening culture medium is:
The NBi culture medium of the cephamycin of the hygromycin containing final concentration of 40mg/L and final concentration of 500mg/L, pH 5.8;
It is described regeneration culture formula be:
NBi culture medium without 2,4-D, the 6-BA containing final concentration of 3mg/L, the NAA of final concentration of 0.5mg/L and final concentration
For the hygromycin of 30mg/L, pH 5.8;
The formula of the root media is calculated as by 2L:
20 × MS a great number of elements mother solution 50mL, 100 × EDTA-Fe mother solution 10mL, 100 × MS trace element mother solution 10mL, 100 ×
B5 vitamin stock solution 20mL, inositol 0.2g, glucose 14g, sucrose 6g, plant gum 5.2g, hygromycin final concentration 40mg/L, pH
5.8;
Wherein, the formula of the NBi culture medium is calculated as by 2L:
20 × N6 mother solution 100mL, 100 × EDTA-Fe mother solution 20mL, 100 × B5 trace element mother solution 20mL, 100 × B5 dimension life
Plain mother solution 20mL, glutamine 1g, proline 1g, CEH 0.6g, inositol 0.2g, sucrose 60g, 2,4-D 4mg, plant gum
5.2g, pH5.8;
The formula of 20 × N6 mother solutions is calculated as by 1L:
KNO3:56.6g, (NH4)2SO4:9.26g, KH2PO4:8.00g, MgSO4·7H2O:3.70g, CaCl2·2H2O:3.32g;
The formula of 100 × EDTA-Fe mother solutions is calculated as by 1L:
FeSO4·7H2O 2.78g, Na2-EDTA 3.73g;
The formula of 100 × B5 trace element mother solution is calculated as by 1L:
MnSO4·H2O 1.0g, ZnSO4·7H2O 0.2g, H3BO30.3g, CuSO4·5H2O 2.5mg, Na2MoO4·2H2O
25.0mg, CoCl2·6H2O 2.5mg, KI 75.0mg;
The formula of 100 × B5 vitamin stock solutions is calculated as by 500mL:
Thiamine hydrochloride VB1 500mg, pyridoxine hydrochloride VB6 50mg, nicotinic acid VB5 50mg;
The formula of 20 × MS a great number of elements mother solution is calculated as by 1L:
KNO338.0g, NH4NO333.0g, KH2PO43.4g, MgSO4·7H2O 7.4g, CaCl2·2H2O 8.8g;
The formula of 100 × MS trace element mother solution is calculated as by 1L:
MnSO4·H2O 1.56g, ZnSO4·7H2O 0.86g, H3BO30.62g, CuSO4·5H2O 2.5mg, Na2MoO4·
2H2O 25.0mg, CoCl2·6H2O 2.5mg, KI 83.0mg.
8. the application according to any one of claim 5-7, it is characterised in that the primer sequence of step (6) is as follows:
JDSQ3F1:5’-ACCTATCGCTTTCCACCTCA-3’
JDSQ3R1:5’-CGGTTCCTCTTCAGCGCCTC-3’.
9. the CRISPR-CAS9 carriers of Oryza sativa L. BADH2 site-directed point mutations are used for, it is characterised in that the nucleotide of the carrier
Sequence such as SEQ ID NO:Shown in 3.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201611265175.0A CN106676130A (en) | 2016-12-30 | 2016-12-30 | Paddy rice BADH2 gene site-directed mutagenesis method through using CRISPR-CAS9 technology |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201611265175.0A CN106676130A (en) | 2016-12-30 | 2016-12-30 | Paddy rice BADH2 gene site-directed mutagenesis method through using CRISPR-CAS9 technology |
Publications (1)
Publication Number | Publication Date |
---|---|
CN106676130A true CN106676130A (en) | 2017-05-17 |
Family
ID=58849651
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201611265175.0A Pending CN106676130A (en) | 2016-12-30 | 2016-12-30 | Paddy rice BADH2 gene site-directed mutagenesis method through using CRISPR-CAS9 technology |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN106676130A (en) |
Cited By (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN108103092A (en) * | 2018-01-05 | 2018-06-01 | 中国农业科学院作物科学研究所 | System and its application for downgrading rice are obtained using CRISPR-Cas systems modification OsHPH genes |
CN108823236A (en) * | 2018-05-25 | 2018-11-16 | 厦门大学 | A kind of method that gene editing technology target practice OsELF3 gene extends Rice Heading |
CN108823235A (en) * | 2018-05-25 | 2018-11-16 | 福建省农业科学院生物技术研究所 | A method of red rice strain is formulated with gene editing technology target practice Rc gene |
CN110592135A (en) * | 2019-09-23 | 2019-12-20 | 浙江省农业科学院 | Method for editing rice aroma gene Badh2 by CRISPR/Cas9 |
CN113106126A (en) * | 2020-01-09 | 2021-07-13 | 中国科学院分子植物科学卓越创新中心 | Method and kit for improving protoplast transformation efficiency or gene editing efficiency of fungi |
CN113215187A (en) * | 2020-01-21 | 2021-08-06 | 江苏省农业科学院 | Method for rapidly obtaining fragrant rice material by using CRISPR/Cas9 technology |
CN113403336A (en) * | 2021-08-03 | 2021-09-17 | 广东省农业科学院水稻研究所 | Method for cultivating giant embryo japonica rice variety by editing rice giant embryo gene GE |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN105154531A (en) * | 2015-07-28 | 2015-12-16 | 华南农业大学 | Molecular marker for identifying wild type and mutant of 1000-grain weight gene TGW6 of rice |
CN105505979A (en) * | 2015-11-28 | 2016-04-20 | 湖北大学 | Method for acquiring aromatic rice strain by targeting Badh2 gene via CRISPR/Cas9 gene editing technology |
CN105543228A (en) * | 2016-01-25 | 2016-05-04 | 宁夏农林科学院 | Method for transforming rice into fragrant rice rapidly |
CN106243208A (en) * | 2016-08-31 | 2016-12-21 | 四川农业大学 | A kind of Oryza sativa L. uneven class sizes gene and the protein of coding thereof |
-
2016
- 2016-12-30 CN CN201611265175.0A patent/CN106676130A/en active Pending
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN105154531A (en) * | 2015-07-28 | 2015-12-16 | 华南农业大学 | Molecular marker for identifying wild type and mutant of 1000-grain weight gene TGW6 of rice |
CN105505979A (en) * | 2015-11-28 | 2016-04-20 | 湖北大学 | Method for acquiring aromatic rice strain by targeting Badh2 gene via CRISPR/Cas9 gene editing technology |
CN105543228A (en) * | 2016-01-25 | 2016-05-04 | 宁夏农林科学院 | Method for transforming rice into fragrant rice rapidly |
CN106243208A (en) * | 2016-08-31 | 2016-12-21 | 四川农业大学 | A kind of Oryza sativa L. uneven class sizes gene and the protein of coding thereof |
Non-Patent Citations (4)
Title |
---|
BORTESI, LUISA; FISCHER, RAINER: "《The CRISPR/Cas9 system for plant genome editing and beyond》", 《BIOTECHNOLOGY ADVANCES 》 * |
CHEN, SAIHUA; YANG, YI; SHI, WEIWEI; 等.: "《Badh2, encoding betaine aldehyde dehydrogenase, inhibits the biosynthesis of 2-acetyl-1-pyrroline, a major component in rice fragrance》", 《THE PLANT CELL》 * |
SHAN Q等: "《Targeted genome modification of crop plants using a CRISPR-Cas system》", 《NATURE BIOTECHNOLOGY》 * |
单奇伟: "《植物基因组编辑技术研究与应用》", 《中国科学院大学博士学位论文》 * |
Cited By (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN108103092A (en) * | 2018-01-05 | 2018-06-01 | 中国农业科学院作物科学研究所 | System and its application for downgrading rice are obtained using CRISPR-Cas systems modification OsHPH genes |
CN108103092B (en) * | 2018-01-05 | 2021-02-12 | 中国农业科学院作物科学研究所 | System for modifying OsHPH gene by using CRISPR-Cas system to obtain dwarf rice and application thereof |
CN108823236A (en) * | 2018-05-25 | 2018-11-16 | 厦门大学 | A kind of method that gene editing technology target practice OsELF3 gene extends Rice Heading |
CN108823235A (en) * | 2018-05-25 | 2018-11-16 | 福建省农业科学院生物技术研究所 | A method of red rice strain is formulated with gene editing technology target practice Rc gene |
CN108823235B (en) * | 2018-05-25 | 2022-09-06 | 福建省农业科学院生物技术研究所 | Method for creating red rice strain by targeting Rc gene through gene editing technology |
CN110592135A (en) * | 2019-09-23 | 2019-12-20 | 浙江省农业科学院 | Method for editing rice aroma gene Badh2 by CRISPR/Cas9 |
CN113106126A (en) * | 2020-01-09 | 2021-07-13 | 中国科学院分子植物科学卓越创新中心 | Method and kit for improving protoplast transformation efficiency or gene editing efficiency of fungi |
WO2021139779A1 (en) * | 2020-01-09 | 2021-07-15 | 中国科学院分子植物科学卓越创新中心 | Optimized method for editing fungal doubled genome in vitro |
CN113106126B (en) * | 2020-01-09 | 2023-07-18 | 中国科学院分子植物科学卓越创新中心 | Method and kit for improving protoplast transformation efficiency or gene editing efficiency of fungi |
CN113215187A (en) * | 2020-01-21 | 2021-08-06 | 江苏省农业科学院 | Method for rapidly obtaining fragrant rice material by using CRISPR/Cas9 technology |
CN113403336A (en) * | 2021-08-03 | 2021-09-17 | 广东省农业科学院水稻研究所 | Method for cultivating giant embryo japonica rice variety by editing rice giant embryo gene GE |
CN113403336B (en) * | 2021-08-03 | 2021-11-19 | 广东省农业科学院水稻研究所 | Method for cultivating giant embryo japonica rice variety by editing rice giant embryo gene GE |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN106755077A (en) | Using CRISPR CAS9 technologies to the method for paddy rice CENH3 site-directed point mutations | |
CN106676130A (en) | Paddy rice BADH2 gene site-directed mutagenesis method through using CRISPR-CAS9 technology | |
Yamaguchi et al. | An NB-LRR gene, TYNBS1, is responsible for resistance mediated by the Ty-2 Begomovirus resistance locus of tomato | |
CN111748578B (en) | In-situ synthesis gene editing method of plant guide template and application | |
Lentz et al. | Cassava geminivirus agroclones for virus-induced gene silencing in cassava leaves and roots | |
CN111073904B (en) | Genetic transformation, gene editing and analysis method of soybean main cultivar | |
US20030018993A1 (en) | Methods of gene silencing using inverted repeat sequences | |
CN105543228A (en) | Method for transforming rice into fragrant rice rapidly | |
AU2013348113A1 (en) | TAL-mediated transfer DNA insertion | |
WO2014144094A1 (en) | Tal-mediated transfer dna insertion | |
WO2021093258A1 (en) | Use of vvduf642 gene for causing plant seed abortion | |
CN104745622A (en) | Efficient transgenic method for maize skeleton inbred lines | |
CN107338265B (en) | Gene editing system and method for editing plant genome by applying same | |
CN114940996A (en) | Application of tomato SlULT1 gene in improving drought resistance of tomato | |
CN113930433B (en) | Plant coding sequence, amplification primer and application of amplification primer in optimizing plant height | |
Stavnstrup et al. | Ancient horizontal gene transfer from Rhizobium rhizogenes to European genera of the Figwort family (Scrophulariaceae) | |
CN109593772A (en) | CRISPR/Cas9 plasmid and its construction method, application method | |
CN113122568A (en) | Method for improving corn biomass | |
CN113122567B (en) | Method for controlling male sterility of corn by herbicide | |
CN102321667B (en) | Virulence auxiliary vector for agrobacterium tumefaciens-mediated high molecular weight T-DNA (Transfer-Deoxyribonucleic Acid) transformation and preparation method as well as application thereof | |
KR101636162B1 (en) | Methyltrasnferase gene resistant to a bacterial blight, and the transgenic plant using the same | |
KR101636163B1 (en) | Methyltrasnferase gene resistant to a bacterial blight, and the transgenic plant using the same | |
KR101637708B1 (en) | Methyltrasnferase gene resistant to a bacterial blight, and the transgenic plant using the same | |
CN112795589A (en) | Non-transgenic mixed infection method for inhibiting tobacco leaf from being blackened during baking and application thereof | |
KR101636154B1 (en) | Methyltrasnferase gene resistant to a bacterial blight, and the transgenic plant using the same |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
RJ01 | Rejection of invention patent application after publication | ||
RJ01 | Rejection of invention patent application after publication |
Application publication date: 20170517 |