CN103937759A - Biscarbonyl reductase, and coding gene and application thereof - Google Patents
Biscarbonyl reductase, and coding gene and application thereof Download PDFInfo
- Publication number
- CN103937759A CN103937759A CN201410188168.XA CN201410188168A CN103937759A CN 103937759 A CN103937759 A CN 103937759A CN 201410188168 A CN201410188168 A CN 201410188168A CN 103937759 A CN103937759 A CN 103937759A
- Authority
- CN
- China
- Prior art keywords
- pet
- seq
- carbonyl reduction
- reduction enzyme
- alkyl
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- ZNBKDLCYAFIGOS-UHFFFAOYSA-N CCC(C)(C)OC(CC(CC(COCc1ccccc1)=O)=O)=O Chemical compound CCC(C)(C)OC(CC(CC(COCc1ccccc1)=O)=O)=O ZNBKDLCYAFIGOS-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0006—Oxidoreductases (1.) acting on CH-OH groups as donors (1.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P7/00—Preparation of oxygen-containing organic compounds
- C12P7/62—Carboxylic acid esters
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y101/00—Oxidoreductases acting on the CH-OH group of donors (1.1)
- C12Y101/01—Oxidoreductases acting on the CH-OH group of donors (1.1) with NAD+ or NADP+ as acceptor (1.1.1)
- C12Y101/01184—Carbonyl reductase (NADPH) (1.1.1.184)
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Health & Medical Sciences (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- General Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The invention discloses a biscarbonyl reductase, and a coding gene and application thereof. The biscarbonyl reductase has one of the following amino acid sequences: 1) amino acid sequence disclosed as SEQ NO.1; or 2) SEQ NO.1-derived amino acid sequence subjected to substitution, and/or deletion and/or addition of one or more amino acids with the function of stereoselectively reducing the formula disclosed in the specification into the formula disclosed in the specification, wherein the SEQ NO.1-derived amino acid sequence has more than 80% of homology with SEQ NO.1.R1 is selected from aryl group, alkyl group, cycloalkyl group, alkyl-substituted aryl group, halogen-substituted aryl group, aryl alkyl heterocyclic group, and cycloheteroalkyl or cyclohetero alkylated alkyl group; and R2 is selected from alkyl group, cycloalkyl group, and haloalkyl group or halocycloalkyl group. The biscarbonyl reductase can reduce a diketone substrate in one step to obtain 3R,5S-dihydroxy compounds with single optical purity.
Description
Technical field
The present invention relates to biocatalysis synthesis technical field, in particular to a kind of di-carbonyl reduction enzyme, its encoding gene and application.
Background technology
Chiral alcohol is the important midbody compound of a class, is widely used in the synthetic of chiral drug and other chiral fine chemicals.3R, 5S-dihydroxyl-6-benzyloxy-hecanoic acid t-butyl ester is the crucial chiral intermediate of the inhibitor statins antilipemic drugs of 3-hydroxy-3-methylglutaryl-coenzyme A reductase enzyme, can make by chemosynthesis and the synthetic method of biocatalysis.But by chemosynthesis 3R, there is following point in the two hydroxyl products of 5S-: general need chiral metal catalyst, production cost is high; The optical purity of product is more difficult reaches requirement; In a large number with an organic solvent, cause environmental pollution serious.
Adopting synthetic this compounds of biocatalysis is a kind of effective means, and the substrate that is about to contain carbonyl is reduced to corresponding chiral alcohol by specific enzyme catalysis.Wolberg etc. utilize bacterium Lactobacllus brevis by a kind of β, and the δ-carbonyl reduction in δ-bis-carbonyl substrates becomes δ-hydroxyl, and ee is 98.1%; Deoxyribose-5-phosphoric acid zymohexase (DERA) can be taking acetaldehyde and monochloroacetaldehyde as substrate, introduce two chiral centres by two step aldehyde contracting reactions simultaneously and obtain 3R, the two hydroxyl products of 5S-, ee>99.9%, de=96.6%, but deoxyribose-5-phosphoric acid zymohexase catalyzed reaction production cost is higher.Guo etc. utilize Acinetobacter species SC13874 reduction to prepare 3R, 5S-dihydroxyl-6-benzyloxy-capronate, but de=63.3%.Also there is report itrile group lytic enzyme by 3-HGN desymmetrization being obtained to monohydroxy intermediate R-4 cyano-3-hydroxy butyric acid, then obtain 3R, 5S-dihydroxyl-6-benzyloxy-capronate through polystep reaction.Visible, synthesize 3R by Biocatalysis method, also still there are some technical problems in the prior art of the two hydroxyl products of 5S-: the longer difficulty of nitrilase reaction scheme is larger, and cost is higher; Wolberg etc. utilize in bacterium Lactobacllus brevis synthetic method and need to introduce another chiral centre with additive method; Utilizing needs by enzyme amount greatlyr in deoxyribose-5-phosphoric acid zymohexase (DERA) synthetic method, the very strong and initial reaction raw material of substrate inhibition is inflammable and explosive reagent, and suitability for industrialized production difficulty is higher.
Summary of the invention
The present invention aims to provide a kind of di-carbonyl reduction enzyme, its encoding gene and application, and to simplify 3R, the synthesis step of 5S-dihydroxy compound, reduces to produce and pollute and production cost.
To achieve these goals, according to an aspect of the present invention, provide a kind of di-carbonyl reduction enzyme.This di-carbonyl reduction enzyme has one of following aminoacid sequence: the 1) aminoacid sequence of SEQ NO.1; 2) by the aminoacid sequence of SEQ NO.1 through one or several amino acid whose replacement and/or disappearance and/or add, and have by
stereoselective is reduced to
the aminoacid sequence being derived by SEQ NO.1 of function, and derivative aminoacid sequence and the SEQ NO.1 of SEQ NO.1 have more than 80% homology, wherein, and R
1be selected from aromatic base, alkyl, cycloalkyl, the aromatic base that alkyl replaces, the assorted alkyl of aromatic base, aralkyl heterocyclic radical, ring-type or the assorted alkanisation alkyl of ring-type that halogen replaces, R
2be selected from alkyl, cycloalkyl, alkylhalide group or halogen cycloalkyl.
A kind of encoding gene of above-mentioned di-carbonyl reduction enzyme is provided according to another aspect of the present invention.
Further, above-mentioned encoding gene has the deoxynucleoside acid sequence of one of the following: 1) the deoxynucleoside acid sequence of SEQ NO.2; 2) protein that there is 80% homology and coding with the deoxynucleoside acid sequence of SEQ NO.2 have by
stereoselective reduction is
the deoxynucleoside acid sequence of function.
A kind of recombinant expression vector of the encoding gene that contains above-mentioned di-carbonyl reduction enzyme is provided according to a further aspect of the invention.
A kind of transgenic cell line of the encoding gene that contains above-mentioned di-carbonyl reduction enzyme is provided according to a further aspect of the invention.
A kind of transgenosis recombinant bacterium of the encoding gene that contains above-mentioned di-carbonyl reduction enzyme is provided according to a further aspect of the invention.
According to a further aspect of the invention, provide a kind of above-mentioned di-carbonyl reduction enzyme inciting somebody to action
stereoselective reduction is
in application.
Further, di-carbonyl reduction enzyme is in preparation 3R, the application in 5S-dihydroxyl-6-benzyloxy-hecanoic acid t-butyl ester.
Further,
for
or
Adopt di-carbonyl reduction enzyme (Diketoreductase of the present invention, DKR) be biological catalyst, can one step reduction diketone substrate, prepare the 3R of single optical purity, 5S-dihydroxy compound, apply it to synthetic statins drug midbody, obtaining ee value is that 99%, de value is the 3R of 90% left and right, 5S-dihydroxy compound, simplify synthesis step, reduced to produce and polluted and production cost, be suitable for large-scale industrial production.
Embodiment
It should be noted that, in the situation that not conflicting, the feature in embodiment and embodiment in the application can combine mutually.Describe the present invention in detail below in conjunction with embodiment.
Carbonyl reductase gene of the present invention, derives from this carbonyl reductase of Rhodococcus erythropolis SK121 and has the function of di-carbonyl reduction enzyme.
According to the present invention, a kind of typical embodiment, provides a kind of di-carbonyl reduction enzyme.This di-carbonyl reduction enzyme has one of following aminoacid sequence: the 1) aminoacid sequence of SEQ NO.1; SEQ NO.1 is: MTELKQITVLGTGVLGSQIAYQTACHGFDVVAYDINAEVIEKAKARFDSLAAAYKA ENVEGAKEGKADEALQRITYSYDLGEAVAKADLVIEAIPEDIAIKRDTYEKLATVA PEHTVFATNSSTLLPSDLKEFTGRPEKFLALHFANHVWVNNTAEVMGTESTDPAVY REVVEFAKNIGMVPIELKKEKAGYVLNSLLVPLLNAASDLLIDGIADPDMVDKTWR IGTGAPFGPFQIMDVVGLTTVYNISSQGGEKQREFADYIKKNYIDEGKLGVAVGDG FYNYKG; 2) by the aminoacid sequence of SEQ NO.1 through one or several amino acid whose replacement and/or disappearance and/or add and have by
stereoselective reduction is
the aminoacid sequence being derived by SEQ NO.1 of function,, and derivative aminoacid sequence and the SEQ NO.1 of SEQ NO.1 have more than 80% homology, wherein, and R
1be selected from aromatic base, alkyl, cycloalkyl, the aromatic base that alkyl replaces, the assorted alkyl of aromatic base, aralkyl heterocyclic radical, ring-type or the assorted alkanisation alkyl of ring-type that halogen replaces, R
2be selected from alkyl, cycloalkyl, alkylhalide group or halogen cycloalkyl.Adopt di-carbonyl reduction enzyme (Diketoreductase of the present invention, DKR) be biological catalyst, can one step reduction diketone substrate, prepare the 3R of single optical purity, 5S-dihydroxy compound, applies it to synthetic statins drug midbody, has simplified synthesis step, reduce to produce and polluted and production cost, be suitable for large-scale industrial production.
A kind of typical embodiment according to the present invention, provides a kind of encoding gene of above-mentioned di-carbonyl reduction enzyme, and this encoding gene has the deoxyribonucleoside acid sequence of one of the following: 1) the deoxyribonucleoside acid sequence of SEQ NO.2; SEQ NO.2 is：ATGACTGAACTGAAGCAGATCACCGTTCTGGGTACCGGAGTTCTCGGCTCACAGATCGCCTATCAGACCGCCTGTCACGGTTTCGACGTCGTCGCGTACGACATCAACGCCGAGGTCATCGAAAAGGCCAAGGCTCGGTTCGACTCGTTGGCCGCGGCCTACAAGGCCGAGAACGTCGAGGGTGCCAAGGAAGGCAAGGCTGACGAAGCGCTGCAACGTATTACGTACTCGTACGATCTAGGCGAAGCCGTCGCCAAGGCCGACCTGGTCATCGAGGCAATTCCCGAGGACATCGCCATCAAGCGCGACACCTACGAGAAGCTTGCCACGGTTGCTCCTGAGCACACGGTGTTCGCTACCAACTCCTCGACGCTGCTGCCGAGCGATCTCAAGGAGTTCACCGGCCGTCCCGAGAAGTTCCTCGCACTGCACTTCGCAAATCACGTGTGGGTCAACAACACTGCCGAGGTCATGGGCACCGAGTCCACCGACCCCGCCGTGTACCGCGAGGTCGTCGAGTTCGCGAAGAACATCGGCATGGTGCCGATCGAACTCAAGAAGGAGAAGGCGGGCTACGTACTCAACTCGCTCCTGGTCCCGCTCCTCAACGCGGCCTCCGACCTGCTGATCGACGGCATCGCCGATCCCGACATGGTCGACAAGACGTGGCGTATCGGCACCGGAGCCCCGTTCGGCCCCTTCCAGATCATGGACGTCGTCGGGTTGACCACCGTCTACAACATCTCCTCCCAGGGCGGCGAGAAGCAGCGCGAATTCGCCGACTACATCAAGAAGAACTACATCGACGAGGGCAAGCTCGGCGTTGCTGTCGGCGACGGCTTCTACAACTACAAGGGCTGA；2) protein that there is 80% homology and coding with the deoxyribonucleoside acid sequence of SEQ NO.2 have by
Stereoselective reduction is
The deoxyribonucleoside acid sequence of function.
A kind of typical embodiment according to the present invention, provides a kind of recombinant expression vector of the encoding gene that contains above-mentioned di-carbonyl reduction enzyme.This carrier can be pET-22b (+), pET-22b (+), pET-3a (+), pET-3d (+), pET-11a (+), pET-12a (+), pET-14b (+), pET-15b (+), pET-16b (+), pET-17b (+), pET-19b (+), pET-20b (+), pET-21a (+), pET-23a (+), pET-23b (+), pET-24a (+), pET-25b (+), pET-26b (+), pET-27b (+), pET-28a (+), pET-29a (+), pET-30a (+), pET-31b (+), pET-32a (+), pET-35b (+), pET-38b (+), pET-39b (+), pET-40b (+), pET-41a (+), pET-41b (+), pET-42a (+), pET-43a (+), pET-43b (+), pET-44a (+), pET-49b (+), pQE2, pQE9, pQE30, pQE31, pQE32, pQE40, pQE70, pQE80, pRSET-A, pRSET-B, pRSET-C, pGEX-5X-1, pGEX-6p-1, pGEX-6p-2, pBV220, pBV221, pBV222, pTrc99A, pTwin1, pEZZ18, pKK232-18, pUC-18 or pUC-19.Expression vector is overexpression in intestinal bacteria, and the molecular weight presenting on SDS-PAGE through the di-carbonyl reduction enzyme of overexpression is about 30KD, at 30 DEG C, under pH6.0 condition, can a step reduction obtain the 3R that optical purity is higher, 5S-dihydroxyl compound.
Certainly the transgenic cell line, transgenosis recombinant bacterium that, comprise above-mentioned encoding gene are also within protection scope of the present invention.A kind of typical embodiment according to the present invention, provides a kind of above-mentioned di-carbonyl reduction enzyme inciting somebody to action
stereoselective reduction is
in application.This enzyme can one step reduction diketone substrate, prepare the 3R of single optical purity, 5S-dihydroxy compound, can be applied to synthetic statins drug midbody.Preferably, di-carbonyl reduction enzyme, at preparation 3R, is applied in 5S-dihydroxyl-6-benzyloxy-hecanoic acid t-butyl ester, wherein,
can be
or
Further illustrate beneficial effect of the present invention below in conjunction with embodiment.
Embodiment 1
(1) derive from the cloning and expression of the di-carbonyl reduction enzyme of Rhodococcus erythropolis SK121 bacterial strain
For the ease of expression and the qualification of di-carbonyl reduction enzyme gene, oligonucleotide primer 5 ' and 3 ' tip designs compatible restriction enzyme site.Its primer pair is as follows: upstream primer SEQ ID NO.3:5 '-GGAATTC
cATATGaCCGAACTGAAACAAATCACC-3 '; Downstream primer SEQ ID NO.4:5 '-CCG
cTCGAGaCCTTTGTAGTTGTAAAAGCCGTCAC-3 '.Was amplified gene sequence (SEQ ID NO.13 :ATGACTGAACTGAAGCAGATCACCGTTCTGGGTACCGGAGTTCTCGGCTCACAGATCGCCTATCAGACCGCCTGTCACGGTTTCGACGTCGTCGCGTACGACATCAACGCCGAGGTCATCGAAAAGGCCAAGGCTCGGTTCGACTCGTTGGCCGCGGCCTACAAGGCCGAGAACGTCGAGGGTGCCAAGGAAGGCAAGGCTGACGAAGCGCTGCAACGTATTACGTACTCGTACGATCTAGGCGAAGCCGTCGCCAAGGCCGACCTGGTCATCGAGGCAATTCCCGAGGACATCGCCATCAAGCGCGACACCTACGAGAAGCTTGCCACGGTTGCTCCTGAGCACACGGTGTTCGCTACCAACTCCTCGACGCTGCTGCCGAGCGATCTCAAGGAGTTCACCGGCCGTCCCGAGAAGTTCCTCGCACTGCACTTCGCAAATCACGTGTGGGTCAACAACACTGCCGAGGTCATGGGCACCGAGTCCACCGACCCCGCCGTGTACCGCGAGGTCGTCGAGTTCGCGAAGAACATCGGCATGGTGCCGATCGAACTCAAGAAGGAGAAGGCGGGCTACGTACTCAACTCGCTCCTGGTCCCGCTCCTCAACGCGGCCTCCGACCTGCTGATCGACGGCATCGCCGATCCCGACATGGTCGACAAGACGTGGCGTATCGGCACCGGAGCCCCGTTCGGCCCCTTCCAGATCATGGACGTCGTCGGGTTGACCACCGTCTACAACATCTCCTCCCAGGGCGGCGAGAAGCAGCGCGAATTCGCCGACTACATCAAGAAGAACTACATCGACGAGGGCAAGCTCGGCGTTGCTGTCGGCGACGGCTTCTACAACTACAAGGGCTGA ) 。
Aminoacid sequence is (SEQ ID NO.1:MTELKQITVLGTGVLGSQIAYQTACHGFDVVAYDINAEVIEKAKARFDSLA AAYKAENVEGAKEGKADEALQRITYSYDLGEAVAKADLVIEAIPEDIAIKRDTYEK LATVAPEHTVFATNSSTLLPSDLKEFTGRPEKFLALHFANHVWVNNTAEVMGTEST DPAVYREVVEFAKNIGMVPIELKKEKAGYVLNSLLVPLLNAASDLLIDGIADPDMV DKTWRIGTGAPFGPFQIMDVVGLTTVYNISSQGGEKQREFADYIKKNYIDEGKLGV AVGDGFYNYKG).
After di-carbonyl reduction enzyme total gene synthesis, be connected on pUC57 carrier, by Nde I and Xho I, by goal gene and pET-22b (+), (pET-22b (+) can be also pET-3a (+) respectively, pET-3d (+), pET-11a (+), pET-12a (+), pET-14b (+), pET-15b (+), pET-16b (+), pET-17b (+), pET-19b (+), pET-20b (+), pET-21a (+), pET-23a (+), pET-23b (+), pET-24a (+), pET-25b (+), pET-26b (+), pET-27b (+), pET-28a (+), pET-29a (+), pET-30a (+), pET-31b (+), pET-32a (+), pET-35b (+), pET-38b (+), pET-39b (+), pET-40b (+), pET-41a (+), pET-41b (+), pET-42a (+), pET-43a (+), pET-43b (+), pET-44a (+), pET-49b (+), pQE2, pQE9, pQE30, pQE31, pQE32, pQE40, pQE70, pQE80, pRSET-A, pRSET-B, pRSET-C, pGEX-5X-1, pGEX-6p-1, pGEX-6p-2, pBV220, pBV221, pBV222, pTrc99A, pTwin1, pEZZ18, pKK232-18, pUC-18, pUC-19) plasmid carries out enzyme simultaneously and cuts, T4DNA ligase enzyme carries out ligation, connection product is transformed in intestinal bacteria competence DH5 α bacterial strain, coat and contain 50 μ g/ml containing in the LB solid medium (Luria-Bertani substratum) of penbritin, 37 DEG C of overnight incubation.Single colony inoculation on the above-mentioned substratum of picking is in containing 50 μ g/ml containing in the LB liquid nutrient medium of penbritin, 37 DEG C of shaking culture are spent the night, through plasmid extraction, after PCR qualification and double digestion qualification, correct cloning vector pET-22b (+)-DKR is transformed in e. coli bl21 (DE3), coat and contain 50 μ g/ml containing in the solid LB substratum of penbritin, 37 DEG C of overnight incubation.Single colony inoculation in the above-mentioned substratum of picking contains in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, identify that through bacterium colony PCR (polymerase chain reaction) correct expression vector carries out abduction delivering, above-mentioned bacterium liquid is transferred and contained in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, and 37 DEG C of shaking culture are to OD
600, add IPTG (isopropylthiogalactoside) to be respectively 0.02mM to final concentration, 0.05mM, 0.1mM at=0.6 o'clock, 0.2mM, 0.4mM, 0.6mM, 0.8mM and 1.0mM carry out abduction delivering at 18 DEG C, and set up the negative control that does not add IPTG inductor.After induction 16h, take out bacterium liquid, the centrifugal 10min of 8000rpm/min collects thalline.Thalline Ultrasonic Cell Disruptor smudge cells, 4 DEG C, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.The amount that found that abduction delivering di-carbonyl reduction enzyme in the time that final concentration is 0.02mMIPTG concentration is maximum.For improving the expression amount of di-carbonyl reduction enzyme, be 0.02mM by the e. coli bl21 that contains recombinant plasmid (DE3) at IPTG final concentration, respectively at 37 DEG C of induction 8h, under 30 DEG C of induction 8h and 25 DEG C of induction 16h conditions, express, and set up the negative control that does not add IPTG inductor simultaneously.After abduction delivering finishes, respectively the induction thalline of three temperature is collected to thalline in the centrifugal 10min of 8000rpm/min.Thalline Ultrasonic Cell Disruptor smudge cells, 4 DEG C, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.Found that the amount of expressing di-carbonyl reduction enzyme when 16h 25 DEG C of inductions is maximum.
(2) derive from the activity identification of the di-carbonyl reduction enzyme of Rhodococcus erythropolis SK121 bacterial strain
Select the ketone compounds of business-like raw material or easy preparation on market
for initial feed, wherein R
1be selected from aromatic base, alkyl, cycloalkyl, the aromatic base that alkyl replaces, the assorted alkyl of aromatic base, aralkyl heterocyclic radical, ring-type or the assorted alkanisation alkyl of ring-type that halogen replaces; R
2be selected from alkyl, cycloalkyl, alkylhalide group or halogen cycloalkyl.Described two hydroxyl products are expressed by following chemical general formula:
wherein R
1be selected from aromatic base, alkyl, cycloalkyl, the aromatic base that alkyl replaces, the assorted alkyl of aromatic base, aralkyl heterocyclic radical, ring-type or the assorted alkanisation alkyl of ring-type that halogen replaces; R
2be selected from alkyl, cycloalkyl, alkylhalide group or halogen cycloalkyl.
In 500ml reaction flask, add 10g main raw material
40ml polyoxyethylene glycol PEG-400, after material dissolution, adds 360ml phosphate buffered saline buffer (100mM, pH=6.0), and substrate is dispersed in damping fluid; Add ketoreductase: add 0.3g NAD
+, 41.2g ammonium formiate, 0.5g coenzyme hydrogenlyase and 1g di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 DEG C of insulation 17h; With 400ml ethyl acetate stopped reaction, use 250g diatomite filtration, 400ml ethyl acetate extracting twice, leaves standstill separatory, and organic phase drying is filtered, the concentrated crude product, dihydroxyl of obtaining
product 92.0%, yield 90%, ee value is greater than 99.5%, de value 90.4%.
The nuclear magnetic data of products obtained therefrom is as follows: 400Hz, CDCl3: δ 7.29 (m, 5H), 4.54 (s, 2H), 4.22 (m, 1H), 4.07 (m, 1H), 3.45～3.40 (m, 4H), 2.41 (d, 2H), 1.65 (t, 2H), 1.43 (S, 9H).
Products obtained therefrom mass-spectrometric data is: MW=310 ± 1.
In 500ml reaction flask, add 10g main raw material
40ml polyoxyethylene glycol PEG-400, after material dissolution, adds 360ml phosphate buffered saline buffer (100mM, pH=6.0), and substrate is dispersed in damping fluid; Add ketoreductase: add 0.3g NAD+, 41.2g ammonium formiate, 0.5g coenzyme hydrogenlyase and 1g di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 DEG C of insulation 17h; With 400ml ethyl acetate stopped reaction, use 250g diatomite filtration, 400ml ethyl acetate extracting twice, leaves standstill separatory, and organic phase drying is filtered, the concentrated crude product, dihydroxyl of obtaining
product 85.0%, yield 90%, ee value is greater than 90-99%, de value 80-95%.
Products obtained therefrom mass-spectrometric data is: MW=282 ± 1.
In 500ml reaction flask, add 10g main raw material
40ml polyoxyethylene glycol PEG
-400, after material dissolution, add 360ml phosphate buffered saline buffer (100mM, pH=6.0), substrate is dispersed in damping fluid; Add 0.3g NAD+, 41.2g ammonium formiate, 0.5g coenzyme hydrogenlyase and 1g di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 DEG C insulation 17h; With 400ml ethyl acetate stopped reaction, use 250g diatomite filtration, 400ml ethyl acetate extracting twice, leaves standstill separatory, and organic phase drying is filtered, the concentrated crude product, dihydroxyl of obtaining
product 80%, purity 98.0%, yield 90%, ee value 90-99%, de value 80-95%.
Products obtained therefrom mass-spectrometric data is as follows: MW=268 ± 1.
In 500ml reaction flask, add 10g main raw material
40ml polyoxyethylene glycol PEG-400, after material dissolution, adds 360ml phosphate buffered saline buffer (100mM, pH=6.0), and substrate is dispersed in damping fluid; Add 0.3g NAD+, 41.2g ammonium formiate, 0.5g coenzyme hydrogenlyase and 3g di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 DEG C insulation 17h; With 400ml ethyl acetate stopped reaction, use 250g diatomite filtration, 400ml ethyl acetate extracting twice, leaves standstill separatory, and organic phase drying is filtered, the concentrated crude product, dihydroxyl of obtaining
product 75%, purity 98.0%, yield 90%, ee value 90-99%, de value 80-95%.
Products obtained therefrom mass-spectrometric data is as follows: MW=324 ± 1.
Embodiment 2
With the di-carbonyl reduction enzyme (SEQ ID NO.5) that sequence homology in embodiment 1 is greater than 80%, this gene source is in Rhodococcus erythropolis PR4.
For the ease of expression and the qualification of di-carbonyl reduction enzyme gene, oligonucleotide primer 5 ' and 3 ' tip designs compatible restriction enzyme site.Its primer pair is as follows: upstream primer SEQ ID NO.6:5 '-GGAATTC
cATATGaCCGAACTGAAACAAATCACC-3 '; Downstream primer SEQ ID NO.7:5 '-CCG
cTCGAGaCCTTTGTAGTTGTAAAAGCCGTCAC-3 '.Was amplified gene sequence (SEQ ID NO.13 :ATGACTGAACTGAAGCAGATCACCGTTCTGGGTACCGGAGTTCTCGGCTCGCAGATCGCCTATCAGACCGCCTATCACGGATTCGACGTCGTCGCGTACGACATCAACGCCGAGGTCATCGAGAAGGCCAAGGCTCGGTTCGACTCGTTGGCCGCGGCCTACAAGGCCGAAAACGTCGAGGGCGCCAAGGAAGGCAAGGCCGACGAAGCGCTACAACGTATTACGTACTCGTACGATCTCGCCGAAGCCGTGACCAAGGCCGATCTTGTCATCGAGGCAATTCCCGAGGACTTCGCCATCAAGCGCGACACCTACGAGAAGCTCGCGGCAGTAGCTCCTGAGCACACGGTGTTCGCAACCAACTCCTCGACGCTTCTGCCGAGCGACCTCAAGGAGTTCACCGGCCGCCCCGAGAAGTTCCTCGCACTGCACTTCGCAAATCACGTGTGGGTCAACAACACTGCCGAGGTCATGGGCACCGAGTCCACCGACCCCGCCGTGTACCGCGAGGTCGTCGAATTCGCGAAGAACATCGGCATGGTGCCGATCGAACTCAAGAAGGAGAAGGCGGGCTACGTACTCAACTCGCTCCTGGTCCCGCTCCTCAATGCAGCATCCGACCTGCTGATCGACGGCATCGCCGATCCCGACATGGTCGACAAGACGTGGCGTATCGGCACCGGAGCCCCGTTCGGCCCCTTCCAGATCATGGATGTCGTCGGGTTGACCACCGTCTTCAACATCTCCTCCCAGGGCGGCGAGAAGCAGCGCGCGTTCGCCGACTACATCAAGAAGAACTACATCGACGAAGGCAAGCTCGGCGTCGCTGTCGGCGAGGGCTTCTACAACTACAAAGGCTGA )
Aminoacid sequence is (SEQ ID NO.8:MTELKQITVLGTGVLGSQIAYQTAYHGFDVVAYDINAEVIEKAKARFDSLA AAYKAENVEGAKEGKADEALQRITYSYDLAEAVTKADLVIEAIPEDFAIKRDTYEK LAAVAPEHTVFATNSSTLLPSDLKEFTGRPEKFLALHFANHVWVNNTAEVMGTEST DPAVYREVVEFAKNIGMVPIELKKEKAGYVLNSLLVPLLNAASDLLIDGIADPDMV DKTWRIGTGAPFGPFQIMDVVGLTTVFNISSQGGEKQRAFADYIKKNYIDEGKLGV AVGEGFYNYKG).
After di-carbonyl reduction enzyme total gene synthesis, be connected on pUC57 carrier, by Nde I and Xho I, by goal gene and pET-22b (+), (pET-22b (+) can be also pET-3a (+) respectively, pET-3d (+), pET-11a (+), pET-12a (+), pET-14b (+), pET-15b (+), pET-16b (+), pET-17b (+), pET-19b (+), pET-20b (+), pET-21a (+), pET-23a (+), pET-23b (+), pET-24a (+), pET-25b (+), pET-26b (+), pET-27b (+), pET-28a (+), pET-29a (+), pET-30a (+), pET-31b (+), pET-32a (+), pET-35b (+), pET-38b (+), pET-39b (+), pET-40b (+), pET-41a (+), pET-41b (+), pET-42a (+), pET-43a (+), pET-43b (+), pET-44a (+), pET-49b (+), pQE2, pQE9, pQE30, pQE31, pQE32, pQE40, pQE70, pQE80, pRSET-A, pRSET-B, pRSET-C, pGEX-5X-1, pGEX-6p-1, pGEX-6p-2, pBV220, pBV221, pBV222, pTrc99A, pTwin1, pEZZ18, pKK232-18, pUC-18, pUC-19) plasmid carries out enzyme simultaneously and cuts, T4DNA ligase enzyme carries out ligation, be transformed in the competence of e.colistraindh5α connecting product, coat and contain 50 μ g/ml containing in the solid LB substratum of penbritin, 37 DEG C of overnight incubation.Single colony inoculation on the above-mentioned substratum of picking is in containing 50 μ g/ml containing in the LB liquid nutrient medium of penbritin, 37 DEG C of shaking culture are spent the night, through plasmid extraction, after PCR qualification and double digestion qualification, correct cloning vector pET22b (+)-DKR is transformed in e. coli bl21 (DE3), coat and contain 50 μ g/ml containing in the LB substratum of penbritin, 37 DEG C of overnight incubation.Single colony inoculation in the above-mentioned substratum of picking contains in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, identify that through bacterium colony PCR correct expression vector carries out abduction delivering, above-mentioned bacterium liquid is transferred and contained in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, and 37 DEG C of shaking culture are to OD
600=0.6 o'clock, add IPTG to be respectively 0.02mM to final concentration, 0.05mM, 0.1mM, 0.2mM, 0.4mM, 0.6mM, 0.8mM and 1.0mM carry out abduction delivering at 18 DEG C, and set up the negative control that does not add IPTG inductor.After induction 16h, take out bacterium liquid, the centrifugal 10min of 8000rpm/min collects thalline.Thalline Ultrasonic Cell Disruptor smudge cells, 4 DEG C, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.The amount that found that abduction delivering di-carbonyl reduction enzyme in the time that final concentration is 0.02mM IPTG concentration is maximum.For improving the expression amount of di-carbonyl reduction enzyme, be 0.02mM by the e. coli bl21 that contains recombinant plasmid (DE3) at IPTG final concentration, respectively at 37 DEG C of induction 8h, under 30 DEG C of induction 8h and 25 DEG C of induction 16h conditions, express, and set up the negative control that does not add IPTG inductor simultaneously.After abduction delivering finishes, respectively the induction thalline of three temperature is collected to thalline in the centrifugal 10min of 8000rpm/min.Thalline Ultrasonic Cell Disruptor smudge cells, 4 DEG C, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.Found that the amount of expressing di-carbonyl reduction enzyme when 16h 25 DEG C of inductions is maximum.
Select the ketone compounds of business-like raw material or easy preparation on market
for initial feed, wherein R
1be selected from aromatic base; R
2be selected from alkyl.Described two hydroxyl products are expressed by following chemical general formula:
wherein R
1be selected from aromatic base; R
2be selected from alkyl.
In 10ml reaction flask, add 0.05g main raw material
0.5ml polyoxyethylene glycol PEG
-400, after material dissolution, add 4.5ml phosphate buffered saline buffer (100mM, pH=6.0), substrate is dispersed in damping fluid; Add 1.5mgNAD
+, 20.6mg ammonium formiate, 10mg coenzyme hydrogenlyase and 20mg di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 DEG C of insulation 17h; With 5ml ethyl acetate stopped reaction, use 1.25g diatomite filtration, 5ml ethyl acetate extracting twice, leaves standstill separatory, and organic phase drying is filtered, the concentrated crude product, product of obtaining
83.0%, yield 90%, ee value 98%, de value 91%.
The nuclear magnetic data of products obtained therefrom is as follows: 400Hz, CDCl3: δ 7.29 (m, 5H), 4.54 (s, 2H), 4.22 (m, 1H), 4.07 (m, 1H), 3.45～3.40 (m, 4H), 2.41 (d, 2H), 1.65 (t, 2H), 1.43 (S, 9H).
Products obtained therefrom mass-spectrometric data is as follows: MW=310 ± 1.
Embodiment 3
The di-carbonyl reduction enzyme (SEQ ID NO.9) that is greater than 80% with sequence homology in embodiment 1; , this gene is the mutant of SEQ NO.1.
For the ease of expression and the qualification of di-carbonyl reduction enzyme gene, oligonucleotide primer 5 ' and 3 ' tip designs compatible restriction enzyme site.Its primer pair is as follows: upstream primer SEQ ID NO.10:5 '-GGAATTC
cATATGaCCGAACTGAAACAAATCACC-3 '; Downstream primer SEQ ID NO.11:5 '-CCG
cTCGAGaCCTTTGTAGTTGTAAAAGCCGTCAC-3 '.Was amplified gene sequence (SEQ ID NO.13 :ATGACTGAACTGAAGCAGATCACCGTTCTGGGTACCGGAGTTCTCGGCTCACAGATCGCCTATCAGACCGCCTGTCACGGTTTCGACGTCGTCGCGTACGACATCAACGCCGAGGTCATCGAAAAGGCCAAGGCTCGGTTCGACTCGTTGGCCGCGGCCTACAAGGCCGAGAACGTCGAGGGTGCCAAGGAAGGCAAGGCTGACGAAGCGCTGCAACGTATTACGTACTCGTACGATCTAGGCGAAGCCGTCGCCAAGGCCGACCTGGTCATCGAGGCAGTTCCCGAGGACATCGCCATCAAGCGCGACACCTACGAGAAGCTTGCCACGGTTGCTCCTGAGCACACGGTGTTCGCTACCAACTCCTCGACGCTGCTGCCGAGCGATCTCAAGGAGTTCACCGGCCGTCCCGAGAAGTTCCTCGCACTGCACTTCGCAAATCACGTGTGGGTCAACAACACTGCCGAGGTCATGGGCACCGAGTCCACCGACCCCGCCGTGTACCGCGAGGTCGTCGAGTTCGCGAAGAACATCGGCATGGTGCCGATCGAACTCAAGAAGGAGAAGGCGGGCTACGTACTCAACTCGCTCCTGGTCCCGCTCCTCAACGCGGCCTCCGACCTGCTGATCGACGGCATCGCCGATCCCGACATGGTCGACAAGACGTGGCGTATCGGCACCGGAGCCCCGTTCGGCCCCTTCCAGATCATGGACGTCGTCGGGTTGACCACCGTCTACAACATCTCCTCCCAGGGCGGCGAGAAGCAGCGCGAATTCGCCGACTACATCAAGAAGAACTACATCGACGAGGGCAAGCTCGGCGTTGCTGTCGGCGACGGCTTCTACAACTACAAGGGCTGA ) 。
Its aminoacid sequence is (SEQ ID NO.12:MTELKQITVLGTGVLGSQIAYQTACHGFDVVAYDINAEVIEKAKARFDSL AAAYKAENVEGAKEGKADEALQRITYSYDLGEAVAKADLVIEAVPEDIAIKRDTYE KLATVAPEHTVFATNSSTLLPSDLKEFTGRPEKFLALHFANHVWVNNTAEVMGTES TDPAVYREVVEFAKNIGMVPIELKKEKAGYVLNSLLVPLLNAASDLLIDGIADPDM VDKTWRIGTGAPFGPFQIMDVVGLTTVYNISSQGGEKQREFADYIKKNYIDEGKLG VAVGDGFYNYKG).
After di-carbonyl reduction enzyme total gene synthesis, be connected on pUC57 carrier, by Nde I and Xho I, by goal gene and pET-22b (+), (pET-22b (+) can be also pET-3a (+) respectively, pET-3d (+), pET-11a (+), pET-12a (+), pET-14b (+), pET-15b (+), pET-16b (+), pET-17b (+), pET-19b (+), pET-20b (+), pET-21a (+), pET-23a (+), pET-23b (+), pET-24a (+), pET-25b (+), pET-26b (+), pET-27b (+), pET-28a (+), pET-29a (+), pET-30a (+), pET-31b (+), pET-32a (+), pET-35b (+), pET-38b (+), pET-39b (+), pET-40b (+), pET-41a (+), pET-41b (+), pET-42a (+), pET-43a (+), pET-43b (+), pET-44a (+), pET-49b (+), pQE2, pQE9, pQE30, pQE31, pQE32, pQE40, pQE70, pQE80, pRSET-A, pRSET-B, pRSET-C, pGEX-5X-1, pGEX-6p-1, pGEX-6p-2, pBV220, pBV221, pBV222, pTrc99A, pTwin1, pEZZ18, pKK232-18, pUC-18, pUC-19) plasmid carries out enzyme simultaneously and cuts, T4DNA ligase enzyme carries out ligation, be transformed in the competence of e.colistraindh5α connecting product, coat and contain 50 μ g/ml containing in the solid LB substratum of penbritin, 37 DEG C of overnight incubation.Single colony inoculation on the above-mentioned substratum of picking is in containing 50 μ g/ml containing in the LB liquid nutrient medium of penbritin, 37 DEG C of shaking culture are spent the night, through plasmid extraction, after PCR qualification and double digestion qualification, correct cloning vector pET22b (+)-DKR is transformed in e. coli bl21 (DE3), coat and contain 50 μ g/ml containing in the solid LB substratum of penbritin, 37 DEG C of overnight incubation.Single colony inoculation in the above-mentioned substratum of picking contains in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, identify that through bacterium colony PCR correct expression vector carries out abduction delivering, above-mentioned bacterium liquid is transferred and contained in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, and 37 DEG C of shaking culture are to OD
600=0.6 o'clock, add IPTG to be respectively 0.02mM to final concentration, 0.05mM, 0.1mM, 0.2mM, 0.4mM, 0.6mM, 0.8mM and 1.0mM carry out abduction delivering at 18 DEG C, and set up the negative control that does not add IPTG inductor.After induction 16h, take out bacterium liquid, the centrifugal 10min of 8000rpm/min collects thalline.Thalline Ultrasonic Cell Disruptor smudge cells, 4 DEG C, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.The amount that found that abduction delivering di-carbonyl reduction enzyme in the time that final concentration is 0.02mM IPTG concentration is maximum.For improving the expression amount of di-carbonyl reduction enzyme, be 0.02mM by the e. coli bl21 that contains recombinant plasmid (DE3) at IPTG final concentration, respectively at 37 DEG C of induction 8h, under 30 DEG C of induction 8h and 25 DEG C of induction 16h conditions, express, and set up the negative control that does not add IPTG inductor simultaneously.After abduction delivering finishes, respectively the induction thalline of three temperature is collected to thalline in the centrifugal 10min of 8000rpm/min.Thalline Ultrasonic Cell Disruptor smudge cells, 4 DEG C, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.Found that the amount of expressing di-carbonyl reduction enzyme when 16h 25 DEG C of inductions is maximum.
Select the ketone compounds of business-like raw material or easy preparation on market
for initial feed, wherein R
1be selected from aromatic base; R
2be selected from alkyl.Described two hydroxyl products are expressed by following chemical general formula:
wherein R1 is selected from aromatic base; R2 is selected from alkyl.
In 10ml reaction flask, add 0.01g main raw material
0.04ml polyoxyethylene glycol PEG
-400, after material dissolution, add 0.86ml phosphate buffered saline buffer (100mM, pH=6.0), substrate is dispersed in damping fluid; Add 1mgNAD
+, 4.12mg ammonium formiate, 2mg coenzyme hydrogenlyase and 4mg di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 DEG C of insulation 15-24h; With 1ml ethyl acetate stopped reaction, use 0.25g diatomite filtration, 1ml ethyl acetate extracting twice, leaves standstill separatory, and organic phase drying is filtered, the concentrated crude product, product of obtaining
80.06%, yield 90%, ee value 99.5%, de value 90.2%.
The nuclear magnetic data of products obtained therefrom is as follows: 400Hz, CDCl3: δ 7.29 (m, 5H), 4.54 (s, 2H), 4.22 (m, 1H), 4.07 (m, 1H), 3.45～3.40 (m, 4H), 2.41 (d, 2H), 1.65 (t, 2H), 1.43 (S, 9H).
Products obtained therefrom mass-spectrometric data is as follows: MW=310 ± 1.
Embodiment 4:
The di-carbonyl reduction enzyme (SEQ ID NO.13) that is greater than 80% with sequence homology in embodiment 1; This gene is the mutant of SEQ NO.1.
For the ease of expression and the qualification of di-carbonyl reduction enzyme gene, oligonucleotide primer 5 ' and 3 ' tip designs compatible restriction enzyme site.Its primer pair is as follows: upstream primer SEQ ID NO.14:5 '-GGAATTC
cATATGaCCGAACTGAAACAAATCACC-3 '; Downstream primer SEQ ID NO.15:5 '-CCG
cTCGAGaCCTTTGTAGTTGTAAAAGCCGTCAC-3 '.Was amplified gene sequence (SEQ ID NO.13 :ATGACTGAACTGAAGCAGATCACCGTTCTGGGTACCGGAGTTCTCGGCTCACAGATCGCCTATCAGACCGCCTGTCACGGTTTCGACGTCGTCGCGTACGACATCAACGCCGAGGTCATCGAAAAGGCCAAGGCTCGGTTCGACTCGTTGGCCGCGGCCTACAAGGCCGAGAACGTCGAGGGTGCCAAGGAAGGCAAGGCTGACGAAGCGCTGCAACGTATTACGTACTCGTACGATCTAGGCGAAGCCGTCGCCAAGGCCGACCTGGTCATCGAGGCAATTCCCGAGGACATCGCCATCAAGCGCGACACCTACGAGAAGCTTGCCACGGTTGCTCCTGAGCACACGGTGTTCGCTACCAACTCCTCGACGCTGCTGCCGAGCGATCTCAAGGAGTTCACCGGCCGTCCCGAGAAGTTCCTCGCACTGCACTTCGCAAATCGCGTGTGGGTCAACAACACTGCCGAGGTCATGGGCACCGAGTCCACCGACCCCGCCGTGTACCGCGAGGTCGTCGAGTTCGCGAAGAACATCGGCATGGTGCCGATCGAACTCAAGAAGGAGAAGGCGGGCTACGTACTCAACTCGCTCCTGGTCCCGCTCCTCAACGCGGCCTCCGACCTGCTGATCGACGGCATCGCCGATCCCGACATGGTCGACAAGACGTGGCGTATCGGCACCGGAGCCCCGTTCGGCCCCTTCCAGATCATGGACGTCGTCGGGTTGACCACCGTCTACAACATCTCCTCCCAGGGCGGCGAGAAGCAGCGCGAATTCGCCGACTACATCAAGAAGAACTACATCGACGAGGGCAAGCTCGGCGTTGCTGTCGGCGACGGCTTCTACAACTACAAGGGCTGA )
Its aminoacid sequence is (SEQ ID NO.16:MTELKQITVLGTGVLGSQIAYQTACHGFDVVAYDINAEVIEKAKARFDSL AAAYKAENVEGAKEGKADEALQRITYSYDLGEAVAKADLVIEAIPEDIAIKRDTYE KLATVAPEHTVFATNSSTLLPSDLKEFTGRPEKFLALHFANRVWVNNTAEVMGTES TDPAVYREVVEFAKNIGMVPIELKKEKAGYVLNSLLVPLLNAASDLLIDGIADPDM VDKTWRIGTGAPFGPFQIMDVVGLTTVYNISSQGGEKQREFADYIKKNYIDEGKLG VAVGDGFYNYKG).
After di-carbonyl reduction enzyme total gene synthesis, be connected on pUC57 carrier, by Nde I and Xho I, by goal gene and pET-22b (+), (pET-22b (+) can be also pET-3a (+) respectively, pET-3d (+), pET-11a (+), pET-12a (+), pET-14b (+), pET-15b (+), pET-16b (+), pET-17b (+), pET-19b (+), pET-20b (+), pET-21a (+), pET-23a (+), pET-23b (+), pET-24a (+), pET-25b (+), pET-26b (+), pET-27b (+), pET-28a (+), pET-29a (+), pET-30a (+), pET-31b (+), pET-32a (+), pET-35b (+), pET-38b (+), pET-39b (+), pET-40b (+), pET-41a (+), pET-41b (+), pET-42a (+), pET-43a (+), pET-43b (+), pET-44a (+), pET-49b (+), pQE2, pQE9, pQE30, pQE31, pQE32, pQE40, pQE70, pQE80, pRSET-A, pRSET-B, pRSET-C, pGEX-5X-1, pGEX-6p-1, pGEX-6p-2, pBV220, pBV221, pBV222, pTrc99A, pTwin1, pEZZ18, pKK232-18, pUC-18, pUC-19) plasmid carries out enzyme simultaneously and cuts, T4DNA ligase enzyme carries out ligation, be transformed in the competence of e.colistraindh5α connecting product, coat and contain 50 μ g/ml containing in the solid LB substratum of penbritin, 37 DEG C of overnight incubation.Single colony inoculation on the above-mentioned culture dish of picking is in containing 50 μ g/ml containing in the LB liquid nutrient medium of penbritin, 37 DEG C of shaking culture are spent the night, through plasmid extraction, after PCR qualification and double digestion qualification, correct cloning vector pET22b (+)-DKR is transformed in e. coli bl21 (DE3), coat and contain 50 μ g/ml containing in the solid LB substratum of penbritin, 37 DEG C of overnight incubation.Single colony inoculation in the above-mentioned substratum of picking contains in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, identify that through bacterium colony PCR correct expression vector carries out abduction delivering, above-mentioned bacterium liquid is transferred and contained in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, and 37 DEG C of shaking culture are to OD
600=0.6 o'clock, add IPTG to be respectively 0.02mM to final concentration, 0.05mM, 0.1mM, 0.2mM, 0.4mM, 0.6mM, 0.8mM and 1.0mM carry out abduction delivering at 18 DEG C, and set up the negative control that does not add IPTG inductor.After induction 16h, take out bacterium liquid, the centrifugal 10min of 8000rpm/min collects thalline.Thalline Ultrasonic Cell Disruptor smudge cells, 4 DEG C, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.The amount that found that abduction delivering di-carbonyl reduction enzyme in the time that final concentration is 0.02mM IPTG concentration is maximum.For improving the expression amount of di-carbonyl reduction enzyme, be 0.02mM by the e. coli bl21 that contains recombinant plasmid (DE3) at IPTG final concentration, respectively at 37 DEG C of induction 8h, under 30 DEG C of induction 8h and 25 DEG C of induction 16h conditions, express, and set up the negative control that does not add IPTG inductor simultaneously.After abduction delivering finishes, respectively the induction thalline of three temperature is collected to thalline in the centrifugal 10min of 8000rpm/min.Thalline Ultrasonic Cell Disruptor smudge cells, 4 DEG C, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.Found that the amount of expressing di-carbonyl reduction enzyme when 16h 25 DEG C of inductions is maximum.
Select the ketone compounds of business-like raw material or easy preparation on market
for initial feed, wherein R
1be selected from aromatic base; R
2be selected from alkyl.Described two hydroxyl products are expressed by following chemical general formula:
wherein R
1be selected from aromatic base; R
2be selected from alkyl.
In 10ml reaction flask, add 0.01g main raw material
0.04ml polyoxyethylene glycol PEG-400, after material dissolution, adds 0.86ml phosphate buffered saline buffer (100mM, pH=6.0), and substrate is dispersed in damping fluid; Add 1mgNAD
+, 4.12mg ammonium formiate, 2mg coenzyme hydrogenlyase and 4mg di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 DEG C of insulation 15-24h; With 1ml ethyl acetate stopped reaction, use 0.25g diatomite filtration, 1ml ethyl acetate extracting twice, leaves standstill separatory, and organic phase drying is filtered, the concentrated crude product, product of obtaining
70%, yield 90%, ee value 100%, de value 87.95%.
The nuclear magnetic data of products obtained therefrom is as follows: 400Hz, CDCl3: δ 7.29 (m, 5H), 4.54 (s, 2H), 4.22 (m, 1H), 4.07 (m, 1H), 3.45～3.40 (m, 4H), 2.41 (d, 2H), 1.65 (t, 2H), 1.43 (S, 9H).
Products obtained therefrom mass-spectrometric data is as follows: MW=310 ± 1.
Embodiment 5:
The di-carbonyl reduction enzyme (SEQ ID NO.17) that is greater than 80% with sequence homology in embodiment 1; This gene is the mutant of SEQ NO.1.
For the ease of expression and the qualification of di-carbonyl reduction enzyme gene, oligonucleotide primer 5 ' and 3 ' tip designs compatible restriction enzyme site.Its primer pair is as follows: upstream primer SEQ ID NO.18:5 '-GGAATTC
cATATGaCCGAACTGAAACAAATCACC-3 '; Downstream primer SEQ ID NO.19:5 '-CCG
cTCGAGaCCTTTGTAGTTGTAAAAGCCGTCAC-3 '.Was amplified gene sequence (SEQ IDNO.17:ATGACTGAACTGAAGCAGATCACCGTTCTGGGTACCGGAGTTCTCGGCTCACAGATCGCCTATCAGACCGCCTGTCACGGTTTCGACGTCGTCGCGTACGACATCAACGCCGAGGTCATCGAAAAGGCCAAGGCTCGGTTCGACTCGTTGGCCGCGGCCTACAAGGCCGAGAACGTCGAGGGTGCCAAGGAAGGCAAGGCTGACGAAGCGCTGCAACGTATTACGTACTCGTACGATCTAGGCGAAGCCGTCGCCAAGGCCGACCTGGTCATCGAGGCAATTCCCGAGGACATCGCCATCAAGCGCGACACCTACGAGAAGCTTGCCACGGTTGCTCCTGAGCACACGGTGTTCGCTACCAACTCCTCGACGCTGCTGCCGAGCGATCTCAAGGAGTTCACCGGCCGTCCCGAGAAGTTCCTCGCACTGCACTTCGCAAATCACGTGTGGGTCAACAACACTGCCGAGGTCATGGGCACCGAGTCCACCGACCCCGCCGTGTACCGCGAGGTCGTCGAGTTCGCGAAGAACATCGGCATGGTGCCGATCGAACTCAAGAAGGAGAAGGCGGGCTACGTACTCAACTCGCTCCTGGTCCCGCTCCTCAACGCGGCCTCCGACCTGCTGATCGACGGCATCGCCGATCCCGACATGGTCGACAAGACGTGGCGTATCGGCACCGGAGCCCCGTTCGGCCCCTTCCAGATCATGGACATTGTCGGGTTGACCACCGTCTACAACATCTCCTCCCAGGGCGGCGAGAAGCAGCGCGAATTCGCCGACTACATCAAGAAGAACTACATCGACGAGGGCAAGCTCGGCGTTGCTGTCGGCGACGGCTTCTACAACTACAAGGGCTGA )
Its aminoacid sequence is (SEQ ID NO.20:MTELKQITVLGTGVLGSQIAYQTACHGFDVVAYDINAEVIEKAKARFDSL AAAYKAENVEGAKEGKADEALQRITYSYDLGEAVAKADLVIEAIPEDIAIKRDTYE KLATVAPEHTVFATNSSTLLPSDLKEFTGRPEKFLALHFANHVWVNNTAEVMGTES TDPAVYREVVEFAKNIGMVPIELKKEKAGYVLNSLLVPLLNAASDLLIDGIADPDM VDKTWRIGTGAPFGPFQIMDIVGLTTVYNISSQGGEKQREFADYIKKNYIDEGKLG VAVGDGFYNYKG).
After di-carbonyl reduction enzyme total gene synthesis, be connected on pUC57 carrier, by Nde I and Xho I, by goal gene and pET-22b (+), (pET-22b (+) can be also pET-3a (+) respectively, pET-3d (+), pET-11a (+), pET-12a (+), pET-14b (+), pET-15b (+), pET-16b (+), pET-17b (+), pET-19b (+), pET-20b (+), pET-21a (+), pET-23a (+), pET-23b (+), pET-24a (+), pET-25b (+), pET-26b (+), pET-27b (+), pET-28a (+), pET-29a (+), pET-30a (+), pET-31b (+), pET-32a (+), pET-35b (+), pET-38b (+), pET-39b (+), pET-40b (+), pET-41a (+), pET-41b (+), pET-42a (+), pET-43a (+), pET-43b (+), pET-44a (+), pET-49b (+), pQE2, pQE9, pQE30, pQE31, pQE32, pQE40, pQE70, pQE80, pRSET-A, pRSET-B, pRSET-C, pGEX-5X-1, pGEX-6p-1, pGEX-6p-2, pBV220, pBV221, pBV222, pTrc99A, pTwin1, pEZZ18, pKK232-18, pUC-18, pUC-19) plasmid carries out enzyme simultaneously and cuts, T4DNA ligase enzyme carries out ligation, be transformed in the competence of e.colistraindh5α connecting product, coat and contain 50 μ g/ml containing in the solid LB substratum of penbritin, 37 DEG C of overnight incubation.Single colony inoculation on the above-mentioned culture dish of picking is in containing 50 μ g/ml containing in the LB liquid nutrient medium of penbritin, 37 DEG C of shaking culture are spent the night, through plasmid extraction, after PCR qualification and double digestion qualification, correct cloning vector pET22b (+)-DKR is transformed in e. coli bl21 (DE3), coat and contain 50 μ g/ml containing in the solid LB substratum of penbritin, 37 DEG C of overnight incubation.Single colony inoculation in the above-mentioned substratum of picking contains in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, identify that through bacterium colony PCR correct expression vector carries out abduction delivering, above-mentioned bacterium liquid is transferred and contained in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, and 37 DEG C of shaking culture are to OD
600=0.6 o'clock, add IPTG to be respectively 0.02mM to final concentration, 0.05mM, 0.1mM, 0.2mM, 0.4mM, 0.6mM, 0.8mM and 1.0mM carry out abduction delivering at 18 DEG C, and set up the negative control that does not add IPTG inductor.After induction 16h, take out bacterium liquid, the centrifugal 10min of 8000rpm/min collects thalline.Thalline Ultrasonic Cell Disruptor smudge cells, 4 DEG C, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.The amount that found that abduction delivering di-carbonyl reduction enzyme in the time that final concentration is 0.02mM IPTG concentration is maximum.For improving the expression amount of di-carbonyl reduction enzyme, be 0.02mM by the e. coli bl21 that contains recombinant plasmid (DE3) at IPTG final concentration, respectively at 37 DEG C of induction 8h, under 30 DEG C of induction 8h and 25 DEG C of induction 16h conditions, express, and set up the negative control that does not add IPTG inductor simultaneously.After abduction delivering finishes, respectively the induction thalline of three temperature is collected to thalline in the centrifugal 10min of 8000rpm/min.Thalline Ultrasonic Cell Disruptor smudge cells, 4 DEG C, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.Found that the amount of expressing di-carbonyl reduction enzyme when 16h 25 DEG C of inductions is maximum.
Select the ketone compounds of business-like raw material or easy preparation on market
for initial feed, wherein R
1be selected from aromatic base; R
2be selected from alkyl.Described two hydroxyl products are expressed by following chemical general formula:
wherein R
1be selected from aromatic base; R
2be selected from alkyl.
In 10ml reaction flask, add 0.01g main raw material
0.04ml polyoxyethylene glycol PEG-400, after material dissolution, adds 0.86ml phosphate buffered saline buffer (100mM, pH=6.0), and substrate is dispersed in damping fluid; Add 1mgNAD
+, 4.12mg ammonium formiate, 2mg coenzyme hydrogenlyase and 4mg di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 DEG C of insulation 15-24h; With 1ml ethyl acetate stopped reaction, use 0.25g diatomite filtration, 1ml ethyl acetate extracting twice, leaves standstill separatory, and organic phase drying is filtered, the concentrated crude product, product of obtaining
73.24%, yield 90%, ee value 100%, de value 88.98%.
The nuclear magnetic data of products obtained therefrom is as follows: 400Hz, CDCl3: δ 7.29 (m, 5H), 4.54 (s, 2H), 4.22 (m, 1H), 4.07 (m, 1H), 3.45～3.40 (m, 4H), 2.41 (d, 2H), 1.65 (t, 2H), 1.43 (S, 9H).
Products obtained therefrom mass-spectrometric data is as follows: MW=310 ± 1.
Embodiment 6:
The di-carbonyl reduction enzyme (SEQ ID NO.21) that is greater than 80% with sequence homology in embodiment 1; This gene is the mutant of SEQ NO.1.
For the ease of expression and the qualification of di-carbonyl reduction enzyme gene, oligonucleotide primer 5 ' and 3 ' tip designs compatible restriction enzyme site.Its primer pair is as follows: upstream primer SEQ ID NO.22:5 '-GGAATTC
cATATGaCCGAACTGAAACAAATCACC-3 '; Downstream primer SEQ ID NO.23:5 '-CCG
cTCGAGaCCTTTGTAGTTGTAAAAGCCGTCAC-3 '.Was amplified gene sequence (SEQ IDNO.21:ATGACTGAACTGAAGCAGATCACCGTTCTGGGTACCGGAGTTCTCGGCTCACAGATCGCCTATCAGACCGCCTGTCACGGTTTCGACGTCGTCGCGTACGACATCAACGCCGAGGTCATCGAAAAGGCCAAGGCTCGGTTCGACTCGTTGGCCGCGGCCTACAAGGCCGAGAACGTCGAGGGTGCCAAGGAAGGCAAGGCTGACGAAGCGCTGCAACGTATTACGTACTCGTACGATCTAGGCGAAGCCGTCGCCAAGGCCGACCTGGTCATCGAGGCAATTCCCGAGGACATCGCCATCAAGCGCGACACCTACGAGAAGCTTGCCACGGTTGCTCCTGAGCACACGGTGTTCGCTACCAACTCCTCGACGCTGCTGCCGAGCGATCTCAAGGAGTTCACCGGCCGTCCCGAGAAGTTCCTCGCACTGCACTTCGCAAATCACGTGTGGGTCAACAACACTGCCGAGGTCATGGGCACCGAGTCCACCGACCCCGCCGTGTACCGCGAGGTCGTCGAGTTCGCGAAGAACATCGGCATGGTGCCGATCGAACTCAAGAAGGAGAAGGCGGGCTACGTACTCAACTCGCTCCTGGTCCCGCTCCTCAACGCGGCCTCCGACCTGCTGATCGACGGCATCGCCGATCCCGACATGGTCGACAAGACGTGGCGTATCGGCACCGGAGCCCCGTTCGGCCCCTTCCAGATCATGGACGTCGTCGGGTTGACCACCGTCTACAACATCTCCTCCCAGGGCGGCGAGAAGCAGAAAGAATTCGCCGACTACATCAAGAAGAACTACATCGACGAGGGCAAGCTCGGCGTTGCTGTCGGCGACGGCTTCTACAACTACAAGGGCTGA ) 。
Its aminoacid sequence is (SEQ ID NO.24:MTELKQITVLGTGVLGSQIAYQTACHGFDVVAYDINAEVIEKAKARFDSL AAAYKAENVEGAKEGKADEALQRITYSYDLGEAVAKADLVIEAIPEDIAIKRDTYE KLATVAPEHTVFATNSSTLLPSDLKEFTGRPEKFLALHFANHVWVNNTAEVMGTES TDPAVYREVVEFAKNIGMVPIELKKEKAGYVLNSLLVPLLNAASDLLIDGIADPDM VDKTWRIGTGAPFGPFQIMDVVGLTTVYNISSQGGEKQKEFADYIKKNYIDEGKLG VAVGDGFYNYKG).
After di-carbonyl reduction enzyme total gene synthesis, be connected on pUC57 carrier, by Nde I and Xho I, by goal gene and pET-22b (+), (pET-22b (+) can be also pET-3a (+) respectively, pET-3d (+), pET-11a (+), pET-12a (+), pET-14b (+), pET-15b (+), pET-16b (+), pET-17b (+), pET-19b (+), pET-20b (+), pET-21a (+), pET-23a (+), pET-23b (+), pET-24a (+), pET-25b (+), pET-26b (+), pET-27b (+), pET-28a (+), pET-29a (+), pET-30a (+), pET-31b (+), pET-32a (+), pET-35b (+), pET-38b (+), pET-39b (+), pET-40b (+), pET-41a (+), pET-41b (+), pET-42a (+), pET-43a (+), pET-43b (+), pET-44a (+), pET-49b (+), pQE2, pQE9, pQE30, pQE31, pQE32, pQE40, pQE70, pQE80, pRSET-A, pRSET-B, pRSET-C, pGEX-5X-1, pGEX-6p-1, pGEX-6p-2, pBV220, pBV221, pBV222, pTrc99A, pTwin1, pEZZ18, pKK232-18, pUC-18, pUC-19) plasmid carries out enzyme simultaneously and cuts, T4DNA ligase enzyme carries out ligation, be transformed in the competence of e.colistraindh5α connecting product, coat and contain 50 μ g/ml containing in the solid LB substratum of penbritin, 37 DEG C of overnight incubation.Single colony inoculation on the above-mentioned substratum of picking is in containing 50 μ g/ml containing in the LB liquid nutrient medium of penbritin, 37 DEG C of shaking culture are spent the night, through plasmid extraction, after PCR qualification and double digestion qualification, correct cloning vector pET22b (+)-DKR is transformed in e. coli bl21 (DE3), coat and contain 50 μ g/ml containing in the solid LB substratum of penbritin, 37 DEG C of overnight incubation.Single colony inoculation in the above-mentioned substratum of picking contains in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, identify that through bacterium colony PCR correct expression vector carries out abduction delivering, above-mentioned bacterium liquid is transferred and contained in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, and 37 DEG C of shaking culture are to OD
600=0.6 o'clock, add IPTG to be respectively 0.02mM to final concentration, 0.05mM, 0.1mM, 0.2mM, 0.4mM, 0.6mM, 0.8mM and 1.0mM carry out abduction delivering at 18 DEG C, and set up the negative control that does not add IPTG inductor.After induction 16h, take out bacterium liquid, the centrifugal 10min of 8000rpm/min collects thalline.Thalline Ultrasonic Cell Disruptor smudge cells, 4 DEG C, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.The amount that found that abduction delivering di-carbonyl reduction enzyme in the time that final concentration is 0.02mM IPTG concentration is maximum.For improving the expression amount of di-carbonyl reduction enzyme, be 0.02mM by the e. coli bl21 that contains recombinant plasmid (DE3) at IPTG final concentration, respectively at 37 DEG C of induction 8h, under 30 DEG C of induction 8h and 25 DEG C of induction 16h conditions, express, and set up the negative control that does not add IPTG inductor simultaneously.After abduction delivering finishes, respectively the induction thalline of three temperature is collected to thalline in the centrifugal 10min of 8000rpm/min.Thalline Ultrasonic Cell Disruptor smudge cells, 4 DEG C, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.Found that the amount of expressing di-carbonyl reduction enzyme when 16h 25 DEG C of inductions is maximum.
Select the ketone compounds of business-like raw material or easy preparation on market
for initial feed, wherein R
1be selected from aromatic base; R
2be selected from alkyl.Described two hydroxyl products are expressed by following chemical general formula:
wherein R
1be selected from aromatic base; R
2be selected from alkyl.
In 10ml reaction flask, add 0.01g main raw material
0.04ml polyoxyethylene glycol PEG-400, after material dissolution, adds 0.86ml phosphate buffered saline buffer (100mM, pH=6.0), and substrate is dispersed in damping fluid; Add 1mgNAD
+, 4.12mg ammonium formiate, 2mg coenzyme hydrogenlyase and 4mg di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 DEG C of insulation 15-24h; With 1ml ethyl acetate stopped reaction, use 0.25g diatomite filtration, 1ml ethyl acetate extracting twice, leaves standstill separatory, and organic phase drying is filtered, the concentrated crude product, product of obtaining
72.31%, yield 90%, ee value 100%, de value 89.16%.
The nuclear magnetic data of products obtained therefrom is as follows: 400Hz, CDCl3: δ 7.29 (m, 5H), 4.54 (s, 2H), 4.22 (m, 1H), 4.07 (m, 1H), 3.45～3.40 (m, 4H), 2.41 (d, 2H), 1.65 (t, 2H), 1.43 (S, 9H).
Products obtained therefrom mass-spectrometric data is as follows: MW=310 ± 1.
Embodiment 7
The di-carbonyl reduction enzyme (SEQ ID NO.25) that is greater than 80% with sequence homology in embodiment 1; This gene is the mutant of SEQ NO.1.
For the ease of expression and the qualification of di-carbonyl reduction enzyme gene, oligonucleotide primer 5 ' and 3 ' tip designs compatible restriction enzyme site.Its primer pair is as follows: upstream primer SEQ ID NO.26:5 '-GGAATTCCATATGACCGAACTGAAACAAATCACC-3 '; Downstream primer SEQ ID NO.27:5 '-CCGCTCGAGACCTTTGTAGTTGTAAAAGCCGTCAC-3 '.Was amplified gene sequence (SEQ IDNO.21:ATGACTGAACTGAAGCAGATCACCGTTCTGGGTACCGGAGTTCTCGGCTCACAGATCGCCTATCAGACCGCCTGTCACGGTTTCGACGTCGTCGCGTACGACATCAACGCCGAGGTCATCGAAAAGGCCAAGGCTCGGTTCGACTCGTTGGCCGCGGCCTACAAGGCCGAGAACGTCGAGGGTGCCAAGGAAGGCAAGGCTGACGAAGCGCTGCAACGTATTACGTACTCGTACGATCTAGGCGAAGCCGTCGCCAAGGCCGACCTGGTCATCGAGGCAATTCCCGAGGACATCGCCATCAAGCGCGACACCTACGAGAAGCTTGCCACGGTTGCTCCTGAGCACACGGTGTTCGCTACCAACTCCTCGACGCTGCTGCCGAGCGATCTCAAGGAGTTCACCGGCCGTCCCGAGAAGTTCCTCGCACTGCACTTCGCAAATCACGTGTGGGTCAACAACACTGCCGAGGTCATGGGCACCGAGTCCACCGACCCCGCCGTGTACCGCGAGGTCGTCGAGTTCGCGAAGAACATCGGCATGGTGCCGATCGAACTCAAGAAGGAGAAGGCGGGCTACGTACTCAACTCGCTCCTGGTCCCGCTCCTCAACGCGGCCTCCGACCTGCTGATCGACGGCATCGCCGATCCCGACATGGTCGACAAGACGTGGCGTATCGGCACCGGAGCCCCGTTCGGCCCCTTCCAGATCATGGACGCTGTCGGGTTGACCACCGTCTACAACATCTCCTCCCAGGGCGGCGAGAAGCAGCGCGAATTCGCCGACTACATCAAGAAGAACTACATCGACGAGGGCAAGCTCGGCGTTGCTGTCGGCGACGGCTTCTACAACTACAAGGGCTGA ) 。
Its aminoacid sequence is (SEQ ID NO.28:MTELKQITVLGTGVLGSQIAYQTACHGFDVVAYDINAEVIEKAKARFDSL AAAYKAENVEGAKEGKADEALQRITYSYDLGEAVAKADLVIEAIPEDIAIKRDTYE KLATVAPEHTVFATNSSTLLPSDLKEFTGRPEKFLALHFANHVWVNNTAEVMGTES TDPAVYREVVEFAKNIGMVPIELKKEKAGYVLNSLLVPLLNAASDLLIDGIADPDM VDKTWRIGTGAPFGPFQIMDAVGLTTVYNISSQGGEKQREFADYIKKNYIDEGKLG VAVGDGFYNYKG).After di-carbonyl reduction enzyme total gene synthesis, be connected on pUC57 carrier, by Nde I and Xho I, by goal gene and pET-22b (+), (pET-22b (+) can be also pET-3a (+) respectively, pET-3d (+), pET-11a (+), pET-12a (+), pET-14b (+), pET-15b (+), pET-16b (+), pET-17b (+), pET-19b (+), pET-20b (+), pET-21a (+), pET-23a (+), pET-23b (+), pET-24a (+), pET-25b (+), pET-26b (+), pET-27b (+), pET-28a (+), pET-29a (+), pET-30a (+), pET-31b (+), pET-32a (+), pET-35b (+), pET-38b (+), pET-39b (+), pET-40b (+), pET-41a (+), pET-41b (+), pET-42a (+), pET-43a (+), pET-43b (+), pET-44a (+), pET-49b (+), pQE2, pQE9, pQE30, pQE31, pQE32, pQE40, pQE70, pQE80, pRSET-A, pRSET-B, pRSET-C, pGEX-5X-1, pGEX-6p-1, pGEX-6p-2, pBV220, pBV221, pBV222, pTrc99A, pTwin1, pEZZ18, pKK232-18, pUC-18, pUC-19) plasmid carries out enzyme simultaneously and cuts, T4DNA ligase enzyme carries out ligation, be transformed in the competence of e.colistraindh5α connecting product, coat and contain 50 μ g/ml containing in the solid LB substratum of penbritin, 37 DEG C of overnight incubation.Single colony inoculation on the above-mentioned substratum of picking is in containing 50 μ g/ml containing in the LB liquid nutrient medium of penbritin, 37 DEG C of shaking culture are spent the night, through plasmid extraction, after PCR qualification and double digestion qualification, correct cloning vector pET22b (+)-DKR is transformed in e. coli bl21 (DE3), coat and contain 50 μ g/ml containing in the solid LB substratum of penbritin, 37 DEG C of overnight incubation.Single colony inoculation in the above-mentioned substratum of picking contains in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, identify that through bacterium colony PCR correct expression vector carries out abduction delivering, above-mentioned bacterium liquid is transferred and contained in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, and 37 DEG C of shaking culture are to OD
600=0.6 o'clock, add IPTG to be respectively 0.02mM to final concentration, 0.05mM, 0.1mM, 0.2mM, 0.4mM, 0.6mM, 0.8mM and 1.0mM carry out abduction delivering at 18 DEG C, and set up the negative control that does not add IPTG inductor.After induction 16h, take out bacterium liquid, the centrifugal 10min of 8000rpm/min collects thalline.Thalline Ultrasonic Cell Disruptor smudge cells, 4 DEG C, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.The amount that found that abduction delivering di-carbonyl reduction enzyme in the time that final concentration is 0.02mM IPTG concentration is maximum.For improving the expression amount of di-carbonyl reduction enzyme, be 0.02mM by the e. coli bl21 that contains recombinant plasmid (DE3) at IPTG final concentration, respectively at 37 DEG C of induction 8h, under 30 DEG C of induction 8h and 25 DEG C of induction 16h conditions, express, and set up the negative control that does not add IPTG inductor simultaneously.After abduction delivering finishes, respectively the induction thalline of three temperature is collected to thalline in the centrifugal 10min of 8000rpm/min.Thalline Ultrasonic Cell Disruptor smudge cells, 4 DEG C, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.Found that the amount of expressing di-carbonyl reduction enzyme when 16h 25 DEG C of inductions is maximum.
Select the ketone compounds of business-like raw material or easy preparation on market
for initial feed, wherein R
1be selected from aromatic base; R
2be selected from alkyl.Described two hydroxyl products are expressed by following chemical general formula:
wherein R
1be selected from aromatic base; R
2be selected from alkyl.
In 10ml reaction flask, add 0.01g main raw material
0.04ml polyoxyethylene glycol PEG-400, after material dissolution, adds 0.86ml phosphate buffered saline buffer (100mM, pH=6.0), and substrate is dispersed in damping fluid; Add 1mgNAD
+, 4.12mg ammonium formiate, 2mg coenzyme hydrogenlyase and 4mg di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 DEG C of insulation 15-24h; With 1ml ethyl acetate stopped reaction, use 0.25g diatomite filtration, 1ml ethyl acetate extracting twice, leaves standstill separatory, and organic phase drying is filtered, the concentrated crude product, product of obtaining
56.96%, yield 90%, ee value 100%, de value 92.36%.
The nuclear magnetic data of products obtained therefrom is as follows: 400Hz, CDCl3: δ 7.29 (m, 5H), 4.54 (s, 2H), 4.22 (m, 1H), 4.07 (m, 1H), 3.45～3.40 (m, 4H), 2.41 (d, 2H), 1.65 (t, 2H), 1.43 (S, 9H).
Products obtained therefrom mass-spectrometric data is as follows: MW=310 ± 1.
Embodiment 8
The di-carbonyl reduction enzyme (SEQ ID NO.29) that is greater than 80% with sequence homology in embodiment 1; This gene is the mutant of SEQ NO.1.
For the ease of expression and the qualification of di-carbonyl reduction enzyme gene, oligonucleotide primer 5 ' and 3 ' tip designs compatible restriction enzyme site.Its primer pair is as follows: upstream primer SEQ ID NO.30:5 '-GGAATTCCATATGACCGAACTGAAACAAATCACC-3 '; Downstream primer SEQ ID NO.31:5 '-CCGCTCGAGACCTTTGTAGTTGTAAAAGCCGTCAC-3 '.Was amplified gene sequence (SEQ IDNO.29 :ATGACTGAACTGAAGCAGATCACCGTTCTGGGTACCGGAGTTCTCGGCTCACAGATCGCCTATCAGACCGCCTGTCACGGTTTCGACGTCGTCGCGTACGACATCAACGCCGAGGTCATCGAAAAGGCCAAGGCTCGGTTCGACTCGTTGGCCGCGGCCTACAAGGCCGAGAACGTCGAGGGTGCCAAGGAAGGCAAGGCTGACGAAGCGCTGCAACGTATTACGTACTCGTACGATCTAGGCGAAGCCGTCGCCAAGGCCGACCTGGTCATCGAGGCAATTCCCGAGGACATCGCCATCAAGCGCGACACCTACGAGAAGCTTGCCACGGTTGCTCCTGAGCACACGGTGTTCGCTACCAACTCCTCGACGCTGCTGCCGAGCGATCTCAAGGAGTTCACCGGCCGTCCCGAGAAGTTCCTCGCACTGCACTTCGCAAATCACGTGTGGGTCAACAACACTGCCGAGGTCATGGGCACCGAGTCCACCGACCCCGCCGTGTACCGCGAGGTCGTCGAGTTCGCGAAGAACATCGGCATGGTGCCGATCGAACTCAAGAAGGAGAAGGCGGGCTACGTACTCAACTCGCTCCTGGTCCCGCTCCTCAACGCGGCCTCCGACCTGCTGATCGACGGCATCGCCGATCCCGACATGGTCGACAAGACGTGGCGTATCGGCACCGGAGCCCCGTTCGGCCCCTTCCAGATCATGGACGTCGCTGGGTTGACCACCGTCTACAACATCTCCTCCCAGGGCGGCGAGAAGCAGCGCGAATTCGCCGACTACATCAAGAAGAACTACATCGACGAGGGCAAGCTCGGCGTTGCTGTCGGCGACGGCTTCTACAACTACAAGGGCTGA ) 。
Its aminoacid sequence is (SEQ ID NO.32:MTELKQITVLGTGVLGSQIAYQTACHGFDVVAYDINAEVIEKAKARFDSL AAAYKAENVEGAKEGKADEALQRITYSYDLGEAVAKADLVIEAIPEDIAIKRDTYE KLATVAPEHTVFATNSSTLLPSDLKEFTGRPEKFLALHFANHVWVNNTAEVMGTES TDPAVYREVVEFAKNIGMVPIELKKEKAGYVLNSLLVPLLNAASDLLIDGIADPDM VDKTWRIGTGAPFGPFQIMDVAGLTTVYNISSQGGEKQREFADYIKKNYIDEGKLG VAVGDGFYNYKG).
After di-carbonyl reduction enzyme total gene synthesis, be connected on pUC57 carrier, by Nde I and Xho I, by goal gene and pET-22b (+), (pET-22b (+) can be also pET-3a (+) respectively, pET-3d (+), pET-11a (+), pET-12a (+), pET-14b (+), pET-15b (+), pET-16b (+), pET-17b (+), pET-19b (+), pET-20b (+), pET-21a (+), pET-23a (+), pET-23b (+), pET-24a (+), pET-25b (+), pET-26b (+), pET-27b (+), pET-28a (+), pET-29a (+), pET-30a (+), pET-31b (+), pET-32a (+), pET-35b (+), pET-38b (+), pET-39b (+), pET-40b (+), pET-41a (+), pET-41b (+), pET-42a (+), pET-43a (+), pET-43b (+), pET-44a (+), pET-49b (+), pQE2, pQE9, pQE30, pQE31, pQE32, pQE40, pQE70, pQE80, pRSET-A, pRSET-B, pRSET-C, pGEX-5X-1, pGEX-6p-1, pGEX-6p-2, pBV220, pBV221, pBV222, pTrc99A, pTwin1, pEZZ18, pKK232-18, pUC-18, pUC-19) plasmid carries out enzyme simultaneously and cuts, T4DNA ligase enzyme carries out ligation, be transformed in the competence of e.colistraindh5α connecting product, coat and contain 50 μ g/ml containing in the solid LB substratum of penbritin, 37 DEG C of overnight incubation.Single colony inoculation on the above-mentioned substratum of picking is in containing 50 μ g/ml containing in the LB liquid nutrient medium of penbritin, 37 DEG C of shaking culture are spent the night, through plasmid extraction, after PCR qualification and double digestion qualification, correct cloning vector pET22b (+)-DKR is transformed in e. coli bl21 (DE3), coat and contain 50 μ g/ml containing in the solid LB substratum of penbritin, 37 DEG C of overnight incubation.Single colony inoculation in the above-mentioned substratum of picking contains in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, identify that through bacterium colony PCR correct expression vector carries out abduction delivering, above-mentioned bacterium liquid is transferred and contained in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, and 37 DEG C of shaking culture are to OD
600=0.6 o'clock, add IPTG to be respectively 0.02mM to final concentration, 0.05mM, 0.1mM, 0.2mM, 0.4mM, 0.6mM, 0.8mM and 1.0mM carry out abduction delivering at 18 DEG C, and set up the negative control that does not add IPTG inductor.After induction 16h, take out bacterium liquid, the centrifugal 10min of 8000rpm/min collects thalline.Thalline Ultrasonic Cell Disruptor smudge cells, 4 DEG C, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.The amount that found that abduction delivering di-carbonyl reduction enzyme in the time that final concentration is 0.02mM IPTG concentration is maximum.For improving the expression amount of di-carbonyl reduction enzyme, be 0.02mM by the e. coli bl21 that contains recombinant plasmid (DE3) at IPTG final concentration, respectively at 37 DEG C of induction 8h, under 30 DEG C of induction 8h and 25 DEG C of induction 16h conditions, express, and set up the negative control that does not add IPTG inductor simultaneously.After abduction delivering finishes, respectively the induction thalline of three temperature is collected to thalline in the centrifugal 10min of 8000rpm/min.Thalline Ultrasonic Cell Disruptor smudge cells, 4 DEG C, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.Found that the amount of expressing di-carbonyl reduction enzyme when 16h 25 DEG C of inductions is maximum.
Select the ketone compounds of business-like raw material or easy preparation on market
for initial feed, wherein R
1be selected from aromatic base; R
2be selected from alkyl.Described two hydroxyl products are expressed by following chemical general formula:
wherein R
1be selected from aromatic base; R
2be selected from alkyl.
In 10ml reaction flask, add 0.01g main raw material
0.04ml polyoxyethylene glycol PEG-400, after material dissolution, adds 0.86ml phosphate buffered saline buffer (100mM, pH=6.0), and substrate is dispersed in damping fluid; Add 1mgNAD
+, 4.12mg ammonium formiate, 2mg coenzyme hydrogenlyase and 4mg di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 DEG C of insulation 15-24h; With 1ml ethyl acetate stopped reaction, use 0.25g diatomite filtration, 1ml ethyl acetate extracting twice, leaves standstill separatory, and organic phase drying is filtered, the concentrated crude product, product of obtaining
71.94%, yield 90%, ee value 100%, de value 88.29%.
The nuclear magnetic data of products obtained therefrom is as follows: 400Hz, CDCl3: δ 7.29 (m, 5H), 4.54 (s, 2H), 4.22 (m, 1H), 4.07 (m, 1H), 3.45～3.40 (m, 4H), 2.41 (d, 2H), 1.65 (t, 2H), 1.43 (S, 9H).
Products obtained therefrom mass-spectrometric data is as follows: MW=310 ± 1.
From above description, can find out, the above embodiments of the present invention have realized following technique effect: adopting di-carbonyl reduction enzyme of the present invention (Diketoreductase, DKR) is biological catalyst, can one step reduction diketone substrate, prepare the 3R of single optical purity, 5S-dihydroxy compound, applies it to synthetic statins drug midbody, has simplified synthesis step, reduce to produce and polluted and production cost, be suitable for large-scale industrial production.
The foregoing is only the preferred embodiments of the present invention, be not limited to the present invention, for a person skilled in the art, the present invention can have various modifications and variations.Within the spirit and principles in the present invention all, any amendment of doing, be equal to replacement, improvement etc., within all should being included in protection scope of the present invention.
Claims (9)
1. a di-carbonyl reduction enzyme, is characterized in that, has one of following aminoacid sequence:
1) aminoacid sequence of SEQ NO.1;
2) by the aminoacid sequence of SEQ NO.1 through one or several amino acid whose replacement and/or disappearance and/or add, and have by
stereoselective is reduced to
the aminoacid sequence being derived by SEQ NO.1 of function, and derivative aminoacid sequence and the described SEQ NO.1 of described SEQ NO.1 have more than 80% homology, wherein, and R
1be selected from aromatic base, alkyl, cycloalkyl, the aromatic base that alkyl replaces, the assorted alkyl of aromatic base, aralkyl heterocyclic radical, ring-type or the assorted alkanisation alkyl of ring-type that halogen replaces, R
2be selected from alkyl, cycloalkyl, alkylhalide group or halogen cycloalkyl.
2. the encoding gene of di-carbonyl reduction enzyme claimed in claim 1.
3. encoding gene according to claim 2, is characterized in that, has the deoxynucleoside acid sequence of one of the following:
1) the deoxynucleoside acid sequence of SEQ NO.2;
2) protein that there is 80% homology and coding with the deoxynucleoside acid sequence of SEQ NO.2 have by
stereoselective reduction is
the deoxynucleoside acid sequence of function.
4. contain the recombinant expression vector of the encoding gene of di-carbonyl reduction enzyme claimed in claim 1.
5. contain the transgenic cell line of the encoding gene of di-carbonyl reduction enzyme claimed in claim 1.
6. contain the transgenosis recombinant bacterium of the encoding gene of di-carbonyl reduction enzyme claimed in claim 1.
7. di-carbonyl reduction enzyme as claimed in claim 1 is being incited somebody to action
stereoselective reduction is
in application.
8. application according to claim 7, is characterized in that, described di-carbonyl reduction enzyme is in preparation 3R, the application in 5S-dihydroxyl-6-benzyloxy-hecanoic acid t-butyl ester.
9. application according to claim 8, is characterized in that, described in
for
or
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201410188168.XA CN103937759B (en) | 2014-05-06 | 2014-05-06 | Biscarbonyl reductase, and coding gene and application thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201410188168.XA CN103937759B (en) | 2014-05-06 | 2014-05-06 | Biscarbonyl reductase, and coding gene and application thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN103937759A true CN103937759A (en) | 2014-07-23 |
| CN103937759B CN103937759B (en) | 2017-03-22 |
Family
ID=51185633
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201410188168.XA Active CN103937759B (en) | 2014-05-06 | 2014-05-06 | Biscarbonyl reductase, and coding gene and application thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN103937759B (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN104560907A (en) * | 2014-12-19 | 2015-04-29 | 凯莱英医药集团（天津）股份有限公司 | Diketoreductase mutant and application thereof |
| WO2015168999A1 (en) * | 2014-05-09 | 2015-11-12 | 凯莱英医药集团（天津）股份有限公司 | Double-carbonyl reductase mutant and application of same |
| WO2016095223A1 (en) * | 2014-12-19 | 2016-06-23 | 凯莱英医药集团（天津）股份有限公司 | Double-carbonyl reductase mutant and application thereof |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000018914A2 (en) * | 1998-09-25 | 2000-04-06 | Amgen Inc. | Novel dkr polypeptides |
| CN101429514A (en) * | 2007-11-08 | 2009-05-13 | 陈依军 | Di-carbonyl reduction enzyme, its gene and uses thereof |
| CN102277338A (en) * | 2011-08-02 | 2011-12-14 | 中国药科大学 | Diketoreductase mutant and application thereof |
-
2014
- 2014-05-06 CN CN201410188168.XA patent/CN103937759B/en active Active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000018914A2 (en) * | 1998-09-25 | 2000-04-06 | Amgen Inc. | Novel dkr polypeptides |
| CN101429514A (en) * | 2007-11-08 | 2009-05-13 | 陈依军 | Di-carbonyl reduction enzyme, its gene and uses thereof |
| CN102277338A (en) * | 2011-08-02 | 2011-12-14 | 中国药科大学 | Diketoreductase mutant and application thereof |
Non-Patent Citations (1)
| Title |
|---|
| NCBI: "Accession:WP_003943258", 《GENBANK》 * |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2015168999A1 (en) * | 2014-05-09 | 2015-11-12 | 凯莱英医药集团（天津）股份有限公司 | Double-carbonyl reductase mutant and application of same |
| US10131883B2 (en) | 2014-05-09 | 2018-11-20 | Asymchem Laboratories (Tianjin) Co., Ltd | Diketoreductase mutant and application thereof |
| CN104560907A (en) * | 2014-12-19 | 2015-04-29 | 凯莱英医药集团（天津）股份有限公司 | Diketoreductase mutant and application thereof |
| WO2016095223A1 (en) * | 2014-12-19 | 2016-06-23 | 凯莱英医药集团（天津）股份有限公司 | Double-carbonyl reductase mutant and application thereof |
| CN104560907B (en) * | 2014-12-19 | 2017-12-22 | 凯莱英医药集团（天津）股份有限公司 | Diketoreductase mutant and its application |
Also Published As
| Publication number | Publication date |
|---|---|
| CN103937759B (en) | 2017-03-22 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Juneidi et al. | Intensification of biotransformations using deep eutectic solvents: Overview and outlook | |
| CN103122355B (en) | Recombinant heat resisting aldehyde ketoreductase gene, coding enzyme, vector, engineering bacteria and application | |
| Hosseini‐Abari et al. | Surface display of bacterial tyrosinase on spores of Bacillus subtilis using CotE as an anchor protein | |
| EP2893026B1 (en) | Process for preparing sebacic acid | |
| CN103703137B (en) | The method being manufactured useful chemicals by p-phthalic acid potassium salt | |
| CN103937759A (en) | Biscarbonyl reductase, and coding gene and application thereof | |
| CN103937761A (en) | Biscarbonyl reductase, and coding gene and application thereof | |
| CN103937760A (en) | Biscarbonyl reductase, and coding gene and application thereof | |
| RU2283864C2 (en) | Nitrilase from rhodococcus rhodochrous ncimb 11216 | |
| CN104498466B (en) | nitrile hydratase and its application | |
| KR101835160B1 (en) | Stable aqueous acrylamide solution | |
| JP5648354B2 (en) | Method for preserving microbial cells and suspension of microbial cells | |
| WO2016095223A1 (en) | Double-carbonyl reductase mutant and application thereof | |
| Agarwal et al. | Nitrilases-an attractive nitrile degrading biocatalyst | |
| EP2821483B1 (en) | Method for preserving enzyme | |
| KR100463966B1 (en) | Preparation Of Dicarboxylic Acid Monoesters From Cyanocarboxylic Acid Esters | |
| CN104726471A (en) | L-glutamate oxidase gene from streptomyces diastatochromogenes as well as preparation method and application thereof | |
| US20160186217A1 (en) | Method for biocatalytic synthesis of substituted or unsubstituted phenylacetic acids and ketones having enzymes of microbial styrene degradation | |
| WO2015168867A1 (en) | Double-carbonyl reductase, coding gene of same, and application thereof | |
| JP7362999B2 (en) | Method for producing killed microorganisms, method for producing S,S-ethylenediamine-N,N'-disuccinic acid or its salt, and bacterial cell fluid | |
| WO2015168866A1 (en) | Double-carbonyl reductase, coding gene of same, and application thereof | |
| CN113249350B (en) | Copper-containing amine oxidase capable of degrading biogenic amine and derived from saccharopolyspora holtziae and application of copper-containing amine oxidase | |
| CN101457217A (en) | Thermophilic lipase with alpha-phenyl ethyl alcohol disassemble activity, coding gene and use thereof | |
| CN116888269A (en) | Enhancement of nitrile hydratase reactivity with aldehydes | |
| JP2006174726A (en) | Method for culturing microorganism, and method for producing optically active carboxylic acid |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C10 | Entry into substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| C53 | Correction of patent of invention or patent application | ||
| CB03 | Change of inventor or designer information |
Inventor after: Hong Hao Inventor after: James.Gaga Inventor after: Chen Chaoyong Inventor after: Zhou Yan Inventor after: Gao Feng Inventor after: Lv Tong Inventor after: Guo Lina Inventor before: Hong Hao Inventor before: James.Gaga Inventor before: Chen Chaoyong Inventor before: Zhou Yan Inventor before: Gao Feng Inventor before: Lv Tong Inventor before: Guo Lina |
|
| C14 | Grant of patent or utility model | ||
| GR01 | Patent grant | ||
| TR01 | Transfer of patent right | ||
| TR01 | Transfer of patent right |
Effective date of registration: 20200421 Address after: 300457 No. 6, Dongting street, Tianjin economic and Technological Development Zone, Binhai New Area Co-patentee after: ASYMCHEM LIFE SCIENCE (TIANJIN) Co.,Ltd. Patentee after: ASYMCHEM LABORATORIES (TIANJIN) Co.,Ltd. Co-patentee after: ASYCHEM PHARMACEUTICALS (TIANJIN) Co.,Ltd. Co-patentee after: ASYMCHEM LABORATORIES (FUXIN) Inc. Co-patentee after: ASYMCHEM LABORATORIES (JILIN) Co.,Ltd. Co-patentee after: Shanghai kailaiying Biotechnology Co., Ltd Address before: 300457, No. 6, Dongting street, Tianjin economic and Technological Development Zone, Binhai New Area, Tianjin Co-patentee before: ASYMCHEM LIFE SCIENCE (TIANJIN) Co.,Ltd. Patentee before: ASYMCHEM LABORATORIES (TIANJIN) Co.,Ltd. Co-patentee before: ASYCHEM PHARMACEUTICALS (TIANJIN) Co.,Ltd. Co-patentee before: ASYMCHEM LABORATORIES (FUXIN) Inc. Co-patentee before: ASYMCHEM LABORATORIES (JILIN) Co.,Ltd. |