Embodiment
It should be noted that, in the situation that not conflicting, embodiment and the feature in embodiment in the application can combine mutually.Below in conjunction with embodiment, describe the present invention in detail.
Carbonyl reductase gene source of the present invention has the function of di-carbonyl reduction enzyme in this carbonyl reductase of Mycobacterium fortuitum subsp.fortuitum DSM46621.
According to the present invention, a kind of typical embodiment, provides a kind of di-carbonyl reduction enzyme.This di-carbonyl reduction enzyme has one of following aminoacid sequence: 1) (SEQ NO.1 is the aminoacid sequence of SEQ NO.1: MTNSVKTVTVLGTGVLGSQIAFQSAFKGFTVTAYDINDEVLEAAKARFEKLAETYA NEVPDARDGKAREALGRLTLTSDLKAAVADADLVIEAIPEILDLKRETYQKLGDLA PAKTIFATNSSTLLPSDLKDSTGRPDKFLALHFANRVWQFNTAEIMGTADTDPSVF AAVVEFAKAIGMVPIELHKEKAGYVLNSLLVPFLNAAAELAAGGYADPSAVDDTWR IATGAPVGPFQIYDIIGLTTPYNIMANGDAEAQKLAAWLKENYIDKGKLGLASGEG FYKYN); 2) by the aminoacid sequence of SEQ NO.1 through one or several amino acid whose replacement and/or disappearance and/or add and have by
stereoselective reduction is
the aminoacid sequence being derived by SEQ NO.1 of function, wherein, R
1be selected from aromatic base, R2 is selected from alkyl.Adopt di-carbonyl reduction enzyme (Diketoreductase of the present invention, DKR) be biological catalyst, can one step reduction diketone substrate, prepare the 3R of single optical purity, 5S-dihydroxy compound, applies it to synthetic statins drug midbody, has simplified synthesis step, reduced to produce and polluted and production cost, be suitable for large-scale industrial production.
According to the present invention, an exemplary embodiment; provides a carbonyl reductase of the double-encoding gene, the genes encoding one of the following deoxyribonucleotide sequence: deoxynucleotide sequence 1) SEQ NO.2 (the SEQ NO.2 as:ATGACGAACTCCGTGAAGACGGTGACCGTTCTCGGGACCGGAGTGCTCGGTTCCCAGATCGCGTTCCAATCCGCGTTCAAGGGTTTCACCGTCACCGCGTACGACATCAATGATGAGGTTCTCGAAGCGGCCAAAGCGCGGTTCGAGAAGCTGGCCGAGACCTACGCCAACGAGGTACCCGACGCGCGTGACGGCAAGGCCCGGGAAGCGTTGGGCCGGCTCACGCTGACCTCCGACCTGAAGGCAGCGGTGGCCGACGCCGATCTGGTGATCGAGGCGATCCCGGAGATCCTCGATCTCAAGCGGGAGACCTACCAGAAGCTCGGGGACCTCGCGCCGGCCAAGACCATCTTCGCCACCAACTCCTCGACGCTGCTGCCCAGCGACCTCAAGGATTCCACCGGCAGGCCCGACAAGTTCCTGGCACTGCACTTCGCAAACCGGGTGTGGCAGTTCAACACTGCCGAGATCATGGGGACCGCGGACACCGACCCGAGCGTTTTCGCCGCGGTGGTCGAGTTCGCCAAGGCCATCGGGATGGTGCCGATCGAGCTGCACAAGGAGAAGGCCGGCTACGTCCTCAACTCACTTCTGGTCCCGTTCCTCAATGCCGCCGCCGAACTCGCGGCCGGTGGCTACGCCGACCCCAGCGCCGTGGACGACACCTGGCGGATCGCCACCGGCGCACCGGTGGGCCCGTTCCAGATCTACGACATCATCGGCCTGACCACGCCGTACAACATCATGGCCAATGGGGACGCCGAAGCTCAGAAGCTCGCCGCGTGGCTGAAAGAGAACTACATCGACAAAGGCAAGTTGGGCCTCGCCAGCGGCGAAGGCTTCTACAAGTACAACTGA ) ;2) protein that there is 80% homology and coding with the deoxyribonucleoside acid sequence of SEQ NO.2 have by
Stereoselective reduction is
The deoxyribonucleoside acid sequence of function.
A kind of typical embodiment according to the present invention, provides a kind of recombinant expression vector of the encoding gene that contains above-mentioned di-carbonyl reduction enzyme.This carrier can be pET-22b (+), pET-22b (+), pET-3a (+), pET-3d (+), pET-11a (+), pET-12a (+), pET-14b (+), pET-15b (+), pET-16b (+), pET-17b (+), pET-19b (+), pET-20b (+), pET-21a (+), pET-23a (+), pET-23b (+), pET-24a (+), pET-25b (+), pET-26b (+), pET-27b (+), pET-28a (+), pET-29a (+), pET-30a (+), pET-31b (+), pET-32a (+), pET-35b (+), pET-38b (+), pET-39b (+), pET-40b (+), pET-41a (+), pET-41b (+), pET-42a (+), pET-43a (+), pET-43b (+), pET-44a (+), pET-49b (+), pQE2, pQE9, pQE30, pQE31, pQE32, pQE40, pQE70, pQE80, pRSET-A, pRSET-B, pRSET-C, pGEX-5X-1, pGEX-6p-1, pGEX-6p-2, pBV220, pBV221, pBV222, pTrc99A, pTwin1, pEZZ18, pKK232-18, pUC-18 or pUC-19.Expression vector is overexpression in intestinal bacteria, and the molecular weight presenting on SDS-PAGE through the di-carbonyl reduction enzyme of overexpression is about 30KD, at 30 ℃, under pH6.0 condition, can a step reduction obtain the 3R that optical purity is higher, 5S-dihydroxyl compound.
Certainly, the transgenic cell line, transgenosis recombinant bacterium that comprise above-mentioned encoding gene are also within protection scope of the present invention.A kind of typical embodiment according to the present invention, provides a kind of above-mentioned di-carbonyl reduction enzyme inciting somebody to action
stereoselective reduction is
in application.This enzyme can one step reduction diketone substrate, prepare the 3R of single optical purity, 5S-dihydroxy compound, can be applied to synthetic statins drug midbody.Preferably, di-carbonyl reduction enzyme, at preparation 3R, is applied in 5S-dihydroxyl-6-benzyloxy-hecanoic acid t-butyl ester, wherein,
can be
Below in conjunction with embodiment, further illustrate beneficial effect of the present invention.
Embodiment 1
(1) derive from the cloning and expression of the di-carbonyl reduction enzyme of Mycobacterium fortuitum subsp.fortuitum DSM46621
For the ease of expression and the evaluation of di-carbonyl reduction enzyme gene (DKR), in 5 ' and 3 ' tip designs of oligonucleotide primer compatible restriction enzyme site.Its primer pair is as follows: upstream primer SEQ ID NO.3:5 '-GGAATTC
cATATGaCTAACTCTGTAAAAACGGTGACTGTTC-3 '; Downstream primer SEQ ID NO.4:5 '-CCG
cTCGAGgTTATATTTGTAGAAACCTTCACCAGAAGCC-3 '.Was amplified gene sequence (SEQ ID NO.2:ATGACGAACTCCGTGAAGACGGTGACCGTTCTCGGGACCGGAGTGCTCGGTTCCCAGATCGCGTTCCAATCCGCGTTCAAGGGTTTCACCGTCACCGCGTACGACATCAATGATGAGGTTCTCGAAGCGGCCAAAGCGCGGTTCGAGAAGCTGGCCGAGACCTACGCCAACGAGGTACCCGACGCGCGTGACGGCAAGGCCCGGGAAGCGTTGGGCCGGCTCACGCTGACCTCCGACCTGAAGGCAGCGGTGGCCGACGCCGATCTGGTGATCGAGGCGATCCCGGAGATCCTCGATCTCAAGCGGGAGACCTACCAGAAGCTCGGGGACCTCGCGCCGGCCAAGACCATCTTCGCCACCAACTCCTCGACGCTGCTGCCCAGCGACCTCAAGGATTCCACCGGCAGGCCCGACAAGTTCCTGGCACTGCACTTCGCAAACCGGGTGTGGCAGTTCAACACTGCCGAGATCATGGGGACCGCGGACACCGACCCGAGCGTTTTCGCCGCGGTGGTCGAGTTCGCCAAGGCCATCGGGATGGTGCCGATCGAGCTGCACAAGGAGAAGGCCGGCTACGTCCTCAACTCACTTCTGGTCCCGTTCCTCAATGCCGCCGCCGAACTCGCGGCCGGTGGCTACGCCGACCCCAGCGCCGTGGACGACACCTGGCGGATCGCCACCGGCGCACCGGTGGGCCCGTTCCAGATCTACGACATCATCGGCCTGACCACGCCGTACAACATCATGGCCAATGGGGACGCCGAAGCTCAGAAGCTCGCCGCGTGGCTGAAAGAGAACTACATCGACAAAGGCAAGTTGGGCCTCGCCAGCGGCGAAGGCTTCTACAAGTACAACTGA ) 。
Its aminoacid sequence is (SEQ ID NO.1:MTNSVKTVTVLGTGVLGSQIAFQSAFKGFTVTAYDINDEVLEAAKARFEKL AETYANEVPDARDGKAREALGRLTLTSDLKAAVADADLVIEAIPEILDLKRETYQK LGDLAPAKTIFATNSSTLLPSDLKDSTGRPDKFLALHFANRVWQFNTAEIMGTADT DPSVFAAVVEFAKAIGMVPIELHKEKAGYVLNSLLVPFLNAAAELAAGGYADPSAV DDTWRIATGAPVGPFQIYDIIGLTTPYNIMANGDAEAQKLAAWLKENYIDKGKLGL ASGEGFYKYN).
After di-carbonyl reduction enzyme total gene synthesis, be connected on pUC57 carrier, by Nde I and Xho I, by goal gene and pET22b (+), (pET-22b (+) can be also pET-3a (+) respectively, pET-3d (+), pET-11a (+), pET-12a (+), pET-14b (+), pET-15b (+), pET-16b (+), pET-17b (+), pET-19b (+), pET-20b (+), pET-21a (+), pET-23a (+), pET-23b (+), pET-24a (+), pET-25b (+), pET-26b (+), pET-27b (+), pET-28a (+), pET-29a (+), pET-30a (+), pET-31b (+), pET-32a (+), pET-35b (+), pET-38b (+), pET-39b (+), pET-40b (+), pET-41a (+), pET-41b (+), pET-42a (+), pET-43a (+), pET-43b (+), pET-44a (+), pET-49b (+), pQE2, pQE9, pQE30, pQE31, pQE32, pQE40, pQE70, pQE80, pRSET-A, pRSET-B, pRSET-C, pGEX-5X-1, pGEX-6p-1, pGEX-6p-2, pBV220, pBV221, pBV222, pTrc99A, pTwin1, pEZZ18, pKK232-18, pUC-18, pUC-19) plasmid carries out enzyme simultaneously and cuts, T4DNA ligase enzyme carries out ligation, connection product is transformed in intestinal bacteria competence DH5 α bacterial strain, coat and contain 50 μ g/ml containing in the solid LB substratum (Luria-Bertani substratum) of penbritin, 37 ℃ of overnight incubation.Single colony inoculation on the above-mentioned substratum of picking is in containing 50 μ g/ml containing in the LB liquid nutrient medium of penbritin, 37 ℃ of shaking culture are spent the night, through plasmid extraction, after PCR evaluation and double digestion are identified, correct cloning vector pET-22b (+)-DKR is transformed in e. coli bl21 (DE3), coat and contain 50 μ g/ml containing in the LB substratum of penbritin, 37 ℃ of overnight incubation.Single colony inoculation in the above-mentioned substratum of picking contains in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, through bacterium colony PCR (polymerase chain reaction), identify that correct expression vector carries out abduction delivering, above-mentioned bacterium liquid is transferred and contained in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, and 37 ℃ of shaking culture are to OD
600=0.6 o'clock, add IPTG (isopropylthiogalactoside) to be respectively 0.02mM to final concentration, 0.05mM, 0.1mM, 0.2mM, 0.4mM, 0.6mM, 0.8mM and 1.0mM carry out abduction delivering at 18 ℃, and set up the negative control that does not add IPTG inductor.After induction 16h, take out bacterium liquid, the centrifugal 10min of 8000rpm/min collects thalline.Thalline Ultrasonic Cell Disruptor smudge cells, 4 ℃, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.The amount that found that abduction delivering di-carbonyl reduction enzyme when final concentration is 0.02mM IPTG concentration is maximum.For improving the expression amount of di-carbonyl reduction enzyme, by the e. coli bl21 that contains recombinant plasmid (DE3), at IPTG final concentration, be 0.02mM, respectively at 37 ℃ of induction 8h, under 30 ℃ of induction 8h and 25 ℃ of induction 16h conditions, express, and set up the negative control that does not add IPTG inductor simultaneously.After abduction delivering finishes, respectively the induction thalline of three temperature is collected to thalline in the centrifugal 10min of 8000rpm/min.Thalline Ultrasonic Cell Disruptor smudge cells, 4 ℃, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.Found that the amount of expressing di-carbonyl reduction enzyme during 8h 30 ℃ of inductions is maximum.
(2) derive from the activity identification of the di-carbonyl reduction enzyme of Mycobacterium fortuitum subsp.fortuitum DSM46621
Select the ketone compounds of business-like raw material or easy preparation on market
for initial feed, wherein R1 is selected from aromatic base; R
2be selected from alkyl.Described two hydroxyl products are expressed by following chemical general formula:
r wherein
1be selected from aromatic base; R
2be selected from alkyl.
In 500ml reaction flask, add 10g main raw material
40ml polyoxyethylene glycol PEG-400 (poly(oxyethylene glycol) 400), after material dissolution, adds 360ml phosphate buffered saline buffer (100mM, pH=6.0), and substrate is dispersed in damping fluid; Add ketoreductase: add 0.6g NAD+ (Reduced nicotinamide-adenine dinucleotide), 118g D-Glucose, 0.6g coenzyme Hexose phosphate dehydrogenase and 1g di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 ℃ of insulation 40h; With 400ml ethyl acetate stopped reaction, use 250g diatomite filtration, 400ml ethyl acetate extracting twice, standing separatory, organic phase drying, filters, and concentrates and obtains crude product, then obtain through column chromatography purification the product that 4g purity is higher
purity 98.0%, yield 50%, ee value 99%, de value 93%.
The nuclear magnetic data of products obtained therefrom is as follows: 400Hz, CDCl3: δ 7.29 (m, 5H), 4.54 (s, 2H), 4.22 (m, 1H), 4.07 (m, 1H), 3.45~3.40 (m, 4H), 2.41 (d, 2H), 1.65 (t, 2H), 1.43 (S, 9H).
Products obtained therefrom mass-spectrometric data is as follows: MW=310 ± 1.
In 500ml reaction flask, add 10g main raw material
40ml polyoxyethylene glycol PEG-400, after material dissolution, adds 360ml phosphate buffered saline buffer (100mM, pH=6.0), and substrate is dispersed in damping fluid; Add ketoreductase: add 0.3g NAD+, 41.2g ammonium formiate, 0.5g coenzyme hydrogenlyase and 1g di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 ℃ of insulation 17h; With 400ml ethyl acetate stopped reaction, use 250g diatomite filtration, 400ml ethyl acetate extracting twice, standing separatory, organic phase drying, filters, the concentrated crude product, dihydroxyl of obtaining
product 65.0%, yield 90%, ee value is greater than 90-99%, de value 80-95%.
Products obtained therefrom mass-spectrometric data is: MW=282 ± 1.
In 500ml reaction flask, add 10g main raw material
40ml polyoxyethylene glycol PEG-400, after material dissolution, adds 360ml phosphate buffered saline buffer (100mM, pH=6.0), and substrate is dispersed in damping fluid; Add ketoreductase: add 0.3g NAD+, 41.2g ammonium formiate, 0.5g coenzyme hydrogenlyase and 1g di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 ℃ insulation 17h; With 400ml ethyl acetate stopped reaction, use 250g diatomite filtration, 400ml ethyl acetate extracting twice, standing separatory, organic phase drying, filters, the concentrated crude product, dihydroxyl of obtaining
product 50%, purity 98.0%, yield 90%, ee value 90-99%, de value 80-95%.
Products obtained therefrom mass-spectrometric data is as follows: MW=268 ± 1.
In 500ml reaction flask, add 10g main raw material
40ml polyoxyethylene glycol PEG-400, after material dissolution, adds 360ml phosphate buffered saline buffer (100mM, pH=6.0), and substrate is dispersed in damping fluid; Add ketoreductase: add 0.3g NAD+, 41.2g ammonium formiate, 0.5g coenzyme hydrogenlyase and 3g di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 ℃ insulation 17h; With 400ml ethyl acetate stopped reaction, use 250g diatomite filtration, 400ml ethyl acetate extracting twice, standing separatory, organic phase drying, filters, the concentrated crude product, dihydroxyl of obtaining
product 60%, purity 98.0%, yield 90%, ee value 90-99%, de value 80-95%.
Products obtained therefrom mass-spectrometric data is as follows: MW=324 ± 1.
Embodiment 2
With the di-carbonyl reduction enzyme (SEQ ID NO.5) that sequence homology in embodiment 1 is greater than 90%, this gene is the mutant of SEQ NO.1.
For the ease of expression and the evaluation of di-carbonyl reduction enzyme gene, in 5 ' and 3 ' tip designs of oligonucleotide primer compatible restriction enzyme site.Its primer pair is as follows: upstream primer SEQ ID NO.6:5 '-GGAATTC
cATATGaCCGAACTGAAACAAATCACC-3 '; Downstream primer SEQ ID NO.7:5 '-CCG
cTCGAGaCCTTTGTAGTTGTAAAAGCCGTCAC-3 '.Was amplified gene sequence (SEQ ID NO.2:ATGACGAACTCCGTGAAGACGGTGACCGTTCTCGGGACCGGAGTGCTCGGTTCCCAGATCGCGTTCCAATCCGCGTTCAAGGGTTTCACCGTCACCGCGTACGACATCAATGATGAGGTTCTCGAAGCGGCCAAAGCGCGGTTCGAGAAGCTGGCCGAGACCTACGCCAACGAGGTACCCGACGCGCGTGACGGCAAGGCCCGGGAAGCGTTGGGCCGGCTCACGCTGACCTCCGACCTGAAGGCAGCGGTGGCCGACGCCGATCTGGTGATCGAGGCGATCCCGGAGATCCTCGATCTCAAGCGGGAGACCTACCAGAAGCTCGGGGACCTCGCGCCGGCCAAGACCATCTTCGCCACCAACTCCTCGACGCTGCTGCCCAGCGACCTCAAGGATTCCACCGGCAGGCCCGACAAGTTCCTGGCACTGCACTTCGCAAACCATGTGTGGCAGTTCAACACTGCCGAGATCATGGGGACCGCGGACACCGACCCGAGCGTTTTCGCCGCGGTGGTCGAGTTCGCCAAGGCCATCGGGATGGTGCCGATCGAGCTGCACAAGGAGAAGGCCGGCTACGTCCTCAACTCACTTCTGGTCCCGTTCCTCAATGCCGCCGCCGAACTCGCGGCCGGTGGCTACGCCGACCCCAGCGCCGTGGACGACACCTGGCGGATCGCCACCGGCGCACCGGTGGGCCCGTTCCAGATCTACGACATCATCGGCCTGACCACGCCGTACAACATCATGGCCAATGGGGACGCCGAAGCTCAGAAGCTCGCCGCGTGGCTGAAAGAGAACTACATCGACAAAGGCAAGTTGGGCCTCGCCAGCGGCGAAGGCTTCTACAAGTACAACTGA ) 。
Its aminoacid sequence is (SEQ ID NO.8:MTNSVKTVTVLGTGVLGSQIAFQSAFKGFTVTAYDINDEVLEAAKARFEKL AETYANEVPDARDGKAREALGRLTLTSDLKAAVADADLVIEAIPEILDLKRETYQK LGDLAPAKTIFATNSSTLLPSDLKDSTGRPDKFLALHFANHVWQFNTAEIMGTADT DPSVFAAVVEFAKAIGMVPIELHKEKAGYVLNSLLVPFLNAAAELAAGGYADPSAV DDTWRIATGAPVGPFQIYDIIGLTTPYNIMANGDAEAQKLAAWLKENYIDKGKLGL ASGEGFYKYN).
After di-carbonyl reduction enzyme total gene synthesis, be connected on pUC57 carrier, by Nde I and Xho I, by goal gene and pET-22b (+), (pET-22b (+) can be also pET-3a (+) respectively, pET-3d (+), pET-11a (+), pET-12a (+), pET-14b (+), pET-15b (+), pET-16b (+), pET-17b (+), pET-19b (+), pET-20b (+), pET-21a (+), pET-23a (+), pET-23b (+), pET-24a (+), pET-25b (+), pET-26b (+), pET-27b (+), pET-28a (+), pET-29a (+), pET-30a (+), pET-31b (+), pET-32a (+), pET-35b (+), pET-38b (+), pET-39b (+), pET-40b (+), pET-41a (+), pET-41b (+), pET-42a (+), pET-43a (+), pET-43b (+), pET-44a (+), pET-49b (+), pQE2, pQE9, pQE30, pQE31, pQE32, pQE40, pQE70, pQE80, pRSET-A, pRSET-B, pRSET-C, pGEX-5X-1, pGEX-6p-1, pGEX-6p-2, pBV220, pBV221, pBV222, pTrc99A, pTwin1, pEZZ18, pKK232-18, pUC-18, pUC-19) plasmid carries out enzyme simultaneously and cuts, T4DNA ligase enzyme carries out ligation, by connecting product, be transformed in the competence of e.colistraindh5α, coat and contain 50 μ g/ml containing in the solid LB culture dish of penbritin, 37 ℃ of overnight incubation.Single colony inoculation on the above-mentioned substratum of picking is in containing 50 μ g/ml containing in the LB liquid nutrient medium of penbritin, 37 ℃ of shaking culture are spent the night, through plasmid extraction, after PCR evaluation and double digestion are identified, correct cloning vector pET22b (+)-DKR is transformed in e. coli bl21 (DE3), coat and contain 50 μ g/ml containing in the LB substratum of penbritin, 37 ℃ of overnight incubation.Single colony inoculation in the above-mentioned substratum of picking contains in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, through bacterium colony PCR, identify that correct expression vector carries out abduction delivering, above-mentioned bacterium liquid is transferred and contained in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, and 37 ℃ of shaking culture are to OD
600=0.6 o'clock, add IPTG to be respectively 0.02mM to final concentration, 0.05mM, 0.1mM, 0.2mM, 0.4mM, 0.6mM, 0.8mM and 1.0mM carry out abduction delivering at 18 ℃, and set up the negative control that does not add IPTG inductor.After induction 16h, take out bacterium liquid, the centrifugal 10min of 8000rpm/min collects thalline.Thalline Ultrasonic Cell Disruptor smudge cells, 4 ℃, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.The amount that found that abduction delivering di-carbonyl reduction enzyme when final concentration is 0.02mM IPTG concentration is maximum.For improving the expression amount of di-carbonyl reduction enzyme, by the e. coli bl21 that contains recombinant plasmid (DE3), at IPTG final concentration, be 0.02mM, respectively at 37 ℃ of induction 8h, under 30 ℃ of induction 8h and 25 ℃ of induction 16h conditions, express, and set up the negative control that does not add IPTG inductor simultaneously.After abduction delivering finishes, respectively the induction thalline of three temperature is collected to thalline in the centrifugal 10min of 8000rpm/min.Thalline Ultrasonic Cell Disruptor smudge cells, 4 ℃, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.Found that the amount of expressing di-carbonyl reduction enzyme during 16h 25 ℃ of inductions is maximum.Select the ketone compounds of business-like raw material or easy preparation on market
for initial feed, R wherein
1be selected from aromatic base; R
2be selected from alkyl.Described two hydroxyl products are expressed by following chemical general formula:
r wherein
1be selected from aromatic base; R
2be selected from alkyl.
In 10ml reaction flask, add 0.01g main raw material
0.04ml polyoxyethylene glycol PEG-400, after material dissolution, adds 0.86ml phosphate buffered saline buffer (100mM, pH=6.0), and substrate is dispersed in damping fluid; Add 1mgNAD
+, 4.12mg ammonium formiate, 2mg coenzyme hydrogenlyase and 4mg di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 ℃ of insulation 15-24h; With 1ml ethyl acetate stopped reaction, use 0.25g diatomite filtration, 1ml ethyl acetate extracting twice, standing separatory, organic phase drying, filters, the concentrated crude product, product of obtaining
67.35%, yield 90%, ee value 92.1%, de value 78.9%.
The nuclear magnetic data of products obtained therefrom is as follows: 400Hz, CDCl3: δ 7.29 (m, 5H), 4.54 (s, 2H), 4.22 (m, 1H), 4.07 (m, 1H), 3.45~3.40 (m, 4H), 2.41 (d, 2H), 1.65 (t, 2H), 1.43 (S, 9H).
Products obtained therefrom mass-spectrometric data is as follows: MW=310 ± 1.
Embodiment 3
The di-carbonyl reduction enzyme (SEQ ID NO.9) that is greater than 90% with sequence homology in embodiment 1; This gene is the mutant of SEQ NO.1.
For the ease of expression and the evaluation of di-carbonyl reduction enzyme gene, in 5 ' and 3 ' tip designs of oligonucleotide primer compatible restriction enzyme site.Its primer pair is as follows: upstream primer SEQ ID NO.10:5 '-GGAATTC
cATATGaCCGAACTGAAACAAATCACC-3 '; Downstream primer SEQ ID NO.11:5 '-CCG
cTCGAGaCCTTTGTAGTTGTAAAAGCCGTCAC-3 '.Was amplified gene sequence (SEQ ID NO.9:ATGACGAACTCCGTGAAGACGGTGACCGTTCTCGGGACCGGAGTGCTCGGTTCCCAGATCGCGTTCCAATCCGCGTTCAAGGGTTTCACCGTCACCGCGTACGACATCAATGATGAGGTTCTCGAAGCGGCCAAAGCGCGGTTCGAGAAGCTGGCCGAGACCTACGCCAACGAGGTACCCGACGCGCGTGACGGCAAGGCCCGGGAAGCGTTGGGCCGGCTCACGCTGACCTCCGACCTGAAGGCAGCGGTGGCCGACGCCGATCTGGTGATCGAGGCGATCCCGGAGATCCTCGATCTCAAGCGGGAGACCTACCAGAAGCTCGGGGACCTCGCGCCGGCCAAGACCATCTTCGCCACCAACTCCTCGACGCTGCTGCCCAGCGACCTCAAGGATTCCACCGGCAGGCCCGACAAGTTCCTGGCACTGCACTTCGCAAACCGGGTGTGGCAGAACAACACTGCCGAGATCATGGGGACCGCGGACACCGACCCGAGCGTTTTCGCCGCGGTGGTCGAGTTCGCCAAGGCCATCGGGATGGTGCCGATCGAGCTGCACAAGGAGAAGGCCGGCTACGTCCTCAACTCACTTCTGGTCCCGTTCCTCAATGCCGCCGCCGAACTCGCGGCCGGTGGCTACGCCGACCCCAGCGCCGTGGACGACACCTGGCGGATCGCCACCGGCGCACCGGTGGGCCCGTTCCAGATCTACGACATCATCGGCCTGACCACGCCGTACAACATCATGGCCAATGGGGACGCCGAAGCTCAGAAGCTCGCCGCGTGGCTGAAAGAGAACTACATCGACAAAGGCAAGTTGGGCCTCGCCAGCGGCGAAGGCTTCTACAAGTACAACTGA ) 。
Its aminoacid sequence is (SEQ ID NO.12:MTNSVKTVTVLGTGVLGSQIAFQSAFKGFTVTAYDINDEVLEAAKARFEK LAETYANEVPDARDGKAREALGRLTLTSDLKAAVADADLVIEAIPEILDLKRETYQ KLGDLAPAKTIFATNSSTLLPSDLKDSTGRPDKFLALHFANRVWQNNTAEIMGTAD TDPSVFAAVVEFAKAIGMVPIELHKEKAGYVLNSLLVPFLNAAAELAAGGYADPSA VDDTWRIATGAPVGPFQIYDIIGLTTPYNIMANGDAEAQKLAAWLKENYIDKGKLG LASGEGFYKYN).
After di-carbonyl reduction enzyme total gene synthesis, be connected on pUC57 carrier, by Nde I and Xho I, by goal gene and pET-22b (+), (pET-22b (+) can be also pET-3a (+) respectively, pET-3d (+), pET-11a (+), pET-12a (+), pET-14b (+), pET-15b (+), pET-16b (+), pET-17b (+), pET-19b (+), pET-20b (+), pET-21a (+), pET-23a (+), pET-23b (+), pET-24a (+), pET-25b (+), pET-26b (+), pET-27b (+), pET-28a (+), pET-29a (+), pET-30a (+), pET-31b (+), pET-32a (+), pET-35b (+), pET-38b (+), pET-39b (+), pET-40b (+), pET-41a (+), pET-41b (+), pET-42a (+), pET-43a (+), pET-43b (+), pET-44a (+), pET-49b (+), pQE2, pQE9, pQE30, pQE31, pQE32, pQE40, pQE70, pQE80, pRSET-A, pRSET-B, pRSET-C, pGEX-5X-1, pGEX-6p-1, pGEX-6p-2, pBV220, pBV221, pBV222, pTrc99A, pTwin1, pEZZ18, pKK232-18, pUC-18, pUC-19) plasmid carries out enzyme simultaneously and cuts, T4DNA ligase enzyme carries out ligation, by connecting product, be transformed in the competence of e.colistraindh5α, coat and contain 50 μ g/ml containing in the solid LB substratum of penbritin, 37 ℃ of overnight incubation.Single colony inoculation on the above-mentioned substratum of picking is in containing 50 μ g/ml containing in the LB liquid nutrient medium of penbritin, 37 ℃ of shaking culture are spent the night, through plasmid extraction, after PCR evaluation and double digestion are identified, correct cloning vector pET22b (+)-DKR is transformed in e. coli bl21 (DE3), coat and contain 50 μ g/ml containing in the LB substratum of penbritin, 37 ℃ of overnight incubation.Single colony inoculation in the above-mentioned substratum of picking contains in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, through bacterium colony PCR, identify that correct expression vector carries out abduction delivering, above-mentioned bacterium liquid is transferred and contained in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, and 37 ℃ of shaking culture are to OD
600=0.6 o'clock, add IPTG to be respectively 0.02mM to final concentration, 0.05mM, 0.1mM, 0.2mM, 0.4mM, 0.6mM, 0.8mM and 1.0mM carry out abduction delivering at 18 ℃, and set up the negative control that does not add IPTG inductor.After induction 16h, take out bacterium liquid, the centrifugal 10min of 8000rpm/min collects thalline.Thalline Ultrasonic Cell Disruptor smudge cells, 4 ℃, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.The amount that found that abduction delivering di-carbonyl reduction enzyme when final concentration is 0.02mM IPTG concentration is maximum.For improving the expression amount of di-carbonyl reduction enzyme, by the e. coli bl21 that contains recombinant plasmid (DE3), at IPTG final concentration, be 0.02mM, respectively at 37 ℃ of induction 8h, under 30 ℃ of induction 8h and 25 ℃ of induction 16h conditions, express, and set up the negative control that does not add IPTG inductor simultaneously.After abduction delivering finishes, respectively the induction thalline of three temperature is collected to thalline in the centrifugal 10min of 8000rpm/min.Thalline Ultrasonic Cell Disruptor smudge cells, 4 ℃, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.Found that the amount of expressing di-carbonyl reduction enzyme during 16h 25 ℃ of inductions is maximum.
Select the ketone compounds of business-like raw material or easy preparation on market
for initial feed, R wherein
1be selected from aromatic base; R
2be selected from alkyl.Described two hydroxyl products are expressed by following chemical general formula:
r wherein
1be selected from aromatic base; R
2be selected from alkyl.
In 10ml reaction flask, add 0.01g main raw material
0.04ml polyoxyethylene glycol PEG-400, after material dissolution, adds 0.86ml phosphate buffered saline buffer (100mM, pH=6.0), and substrate is dispersed in damping fluid; Add 1mgNAD
+, 4.12mg ammonium formiate, 2mg coenzyme hydrogenlyase and 4mg di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 ℃ of insulation 15-24h; With 1ml ethyl acetate stopped reaction, use 0.25g diatomite filtration, 1ml ethyl acetate extracting twice, standing separatory, organic phase drying, filters, the concentrated crude product, product of obtaining
59.46%, yield 90%, ee value 93.9%, de value 90.7%.
The nuclear magnetic data of products obtained therefrom is as follows: 400Hz, CDCl3: δ 7.29 (m, 5H), 4.54 (s, 2H), 4.22 (m, 1H), 4.07 (m, 1H), 3.45~3.40 (m, 4H), 2.41 (d, 2H), 1.65 (t, 2H), 1.43 (S, 9H).
Products obtained therefrom mass-spectrometric data is as follows: MW=310 ± 1.
Embodiment 4:
The di-carbonyl reduction enzyme (SEQ ID NO.13) that is greater than 90% with sequence homology in embodiment 1; This gene is the mutant of SEQ NO.1.
For the ease of expression and the evaluation of di-carbonyl reduction enzyme gene, in 5 ' and 3 ' tip designs of oligonucleotide primer compatible restriction enzyme site.Its primer pair is as follows: upstream primer SEQ ID NO.14:5 '-GGAATTC
cATATGaCCGAACTGAAACAAATCACC-3 '; Downstream primer SEQ ID NO.15:5 '-CCG
cTCGAGaCCTTTGTAGTTGTAAAAGCCGTCAC-3 '.Was amplified gene sequence (SEQ ID NO.13 :ATGACGAACTCCGTGAAGACGGTGACCGTTCTCGGGACCGGAGTGCTCGGTTCCCAGATCGCGTTCCAATCCGCGTTCAAGGGTTTCACCGTCACCGCGTACGACATCAATGATGAGGTTCTCGAAGCGGCCAAAGCGCGGTTCGAGAAGCTGGCCGAGACCTACGCCAACGAGGTACCCGACGCGCGTGACGGCAAGGCCCGGGAAGCGTTGGGCCGGCTCACGCTGACCTCCGACCTGAAGGCAGCGGTGGCCGACGCCGATCTGGTGATCGAGGCGATCCCGGAGATCCTCGATCTCAAGCGGGAGACCTACCAGAAGCTCGGGGACCTCGCGCCGGCCAAGACCATCTTCGCCACCAACTCCTCGACGCTGCTGCCCAGCGACCTCAAGGATTCCACCGGCAGGCCCGACAAGTTCCTGGCACTGCACTTCGCAAACCGGGTGTGGCAGTTCAACACTGCCGAGATCATGGGGACCGCGGACACCGACCCGAGCGTTTTCGCCGCGGTGGTCGAGTTCGCCAAGGCCATCGGGATGGTGCCGATCGAGCTGCACAAGGAGAAGGCCGGCTACGTCCTCAACTCACTTCTGGTCCCGTTCCTCAATGCCGCCGCCGAACTCGCGGCCGGTGGCTACGCCGACCCCAGCGCCGTGGACAAGACCTGGCGGATCGCCACCGGCGCACCGGTGGGCCCGTTCCAGATCTACGACATCATCGGCCTGACCACGCCGTACAACATCATGGCCAATGGGGACGCCGAAGCTCAGAAGCTCGCCGCGTGGCTGAAAGAGAACTACATCGACAAAGGCAAGTTGGGCCTCGCCAGCGGCGAAGGCTTCTACAAGTACAACTGA ) 。
Its aminoacid sequence is (SEQ ID NO.16:MTNSVKTVTVLGTGVLGSQIAFQSAFKGFTVTAYDINDEVLEAAKARFEK LAETYANEVPDARDGKAREALGRLTLTSDLKAAVADADLVIEAIPEILDLKRETYQ KLGDLAPAKTIFATNSSTLLPSDLKDSTGRPDKFLALHFANRVWQFNTAEIMGTAD TDPSVFAAVVEFAKAIGMVPIELHKEKAGYVLNSLLVPFLNAAAELAAGGYADPSA VDKTWRIATGAPVGPFQIYDIIGLTTPYNIMANGDAEAQKLAAWLKENYIDKGKLG LASGEGFYKYN).
After di-carbonyl reduction enzyme total gene synthesis, be connected on pUC57 carrier, by Nde I and Xho I, by goal gene and pET-22b (+), (pET-22b (+) can be also pET-3a (+) respectively, pET-3d (+), pET-11a (+), pET-12a (+), pET-14b (+), pET-15b (+), pET-16b (+), pET-17b (+), pET-19b (+), pET-20b (+), pET-21a (+), pET-23a (+), pET-23b (+), pET-24a (+), pET-25b (+), pET-26b (+), pET-27b (+), pET-28a (+), pET-29a (+), pET-30a (+), pET-31b (+), pET-32a (+), pET-35b (+), pET-38b (+), pET-39b (+), pET-40b (+), pET-41a (+), pET-41b (+), pET-42a (+), pET-43a (+), pET-43b (+), pET-44a (+), pET-49b (+), pQE2, pQE9, pQE30, pQE31, pQE32, pQE40, pQE70, pQE80, pRSET-A, pRSET-B, pRSET-C, pGEX-5X-1, pGEX-6p-1, pGEX-6p-2, pBV220, pBV221, pBV222, pTrc99A, pTwin1, pEZZ18, pKK232-18, pUC-18, pUC-19) plasmid carries out enzyme simultaneously and cuts, T4DNA ligase enzyme carries out ligation, by connecting product, be transformed in the competence of e.colistraindh5α, coat and contain 50 μ g/ml containing in the solid LB substratum of penbritin, 37 ℃ of overnight incubation.Single colony inoculation on the above-mentioned substratum of picking is in containing 50 μ g/ml containing in the LB liquid nutrient medium of penbritin, 37 ℃ of shaking culture are spent the night, through plasmid extraction, after PCR evaluation and double digestion are identified, correct cloning vector pET22b (+)-DKR is transformed in e. coli bl21 (DE3), coat and contain 50 μ g/ml containing in the LB substratum of penbritin, 37 ℃ of overnight incubation.Single colony inoculation in the above-mentioned substratum of picking contains in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, through bacterium colony PCR, identify that correct expression vector carries out abduction delivering, above-mentioned bacterium liquid is transferred and contained in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, and 37 ℃ of shaking culture are to OD
600=0.6 o'clock, add IPTG to be respectively 0.02mM to final concentration, 0.05mM, 0.1mM, 0.2mM, 0.4mM, 0.6mM, 0.8mM and 1.0mM carry out abduction delivering at 18 ℃, and set up the negative control that does not add IPTG inductor.After induction 16h, take out bacterium liquid, the centrifugal 10min of 8000rpm/min collects thalline.Thalline Ultrasonic Cell Disruptor smudge cells, 4 ℃, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.The amount that found that abduction delivering di-carbonyl reduction enzyme when final concentration is 0.02mM IPTG concentration is maximum.For improving the expression amount of di-carbonyl reduction enzyme, by the e. coli bl21 that contains recombinant plasmid (DE3), at IPTG final concentration, be 0.02mM, respectively at 37 ℃ of induction 8h, under 30 ℃ of induction 8h and 25 ℃ of induction 16h conditions, express, and set up the negative control that does not add IPTG inductor simultaneously.After abduction delivering finishes, respectively the induction thalline of three temperature is collected to thalline in the centrifugal 10min of 8000rpm/min.Thalline Ultrasonic Cell Disruptor smudge cells, 4 ℃, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.Found that the amount of expressing di-carbonyl reduction enzyme during 16h 25 ℃ of inductions is maximum.
Select the ketone compounds of business-like raw material or easy preparation on market
for initial feed, R wherein
1be selected from aromatic base; R
2be selected from alkyl.Described two hydroxyl products are expressed by following chemical general formula:
r wherein
1be selected from aromatic base; R
2be selected from alkyl.
In 10ml reaction flask, add 0.01g main raw material
0.04ml polyoxyethylene glycol PEG-400, after material dissolution, adds 0.86ml phosphate buffered saline buffer (100mM, pH=6.0), and substrate is dispersed in damping fluid; Add 1mgNAD
+, 4.12mg ammonium formiate, 2mg coenzyme hydrogenlyase and 4mg di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 ℃ of insulation 15-24h; With 1ml ethyl acetate stopped reaction, use 0.25g diatomite filtration, 1ml ethyl acetate extracting twice, standing separatory, organic phase drying, filters, the concentrated crude product, product of obtaining
50.75%, yield 90%, ee value 91.74%, de value 91.6%.
The nuclear magnetic data of products obtained therefrom is as follows: 400Hz, CDCl3: δ 7.29 (m, 5H), 4.54 (s, 2H), 4.22 (m, 1H), 4.07 (m, 1H), 3.45~3.40 (m, 4H), 2.41 (d, 2H), 1.65 (t, 2H), 1.43 (S, 9H).
Products obtained therefrom mass-spectrometric data is as follows: MW=310 ± 1.
Embodiment 5:
The di-carbonyl reduction enzyme (SEQ ID NO.17) that is greater than 90% with sequence homology in embodiment 1; This gene is the mutant of SEQ NO.1.
For the ease of expression and the evaluation of di-carbonyl reduction enzyme gene, in 5 ' and 3 ' tip designs of oligonucleotide primer compatible restriction enzyme site.Its primer pair is as follows: upstream primer SEQ ID NO.18:5 '-GGAATTC
cATATGaCCGAACTGAAACAAATCACC-3 '; Downstream primer SEQ ID NO.19:5 '-CCG
cTCGAGaCCTTTGTAGTTGTAAAAGCCGTCAC-3 '.Was amplified gene sequence (SEQ ID NO.13 :ATGACGAACTCCGTGAAGACGGTGACCGTTCTCGGGACCGGAGTGCTCGGTTCCCAGATCGCGTTCCAATCCGCGTTCAAGGGTTTCACCGTCACCGCGTACGACATCAATGATGAGGTTCTCGAAGCGGCCAAAGCGCGGTTCGAGAAGCTGGCCGAGACCTACGCCAACGAGGTACCCGACGCGCGTGACGGCAAGGCCCGGGAAGCGTTGGGCCGGCTCACGCTGACCTCCGACCTGAAGGCAGCGGTGGCCGACGCCGATCTGGTGATCGAGGCGGTTCCGGAGATCCTCGATCTCAAGCGGGAGACCTACCAGAAGCTCGGGGACCTCGCGCCGGCCAAGACCATCTTCGCCACCAACTCCTCGACGCTGCTGCCCAGCGACCTCAAGGATTCCACCGGCAGGCCCGACAAGTTCCTGGCACTGCACTTCGCAAACCGGGTGTGGCAGTTCAACACTGCCGAGATCATGGGGACCGCGGACACCGACCCGAGCGTTTTCGCCGCGGTGGTCGAGTTCGCCAAGGCCATCGGGATGGTGCCGATCGAGCTGCACAAGGAGAAGGCCGGCTACGTCCTCAACTCACTTCTGGTCCCGTTCCTCAATGCCGCCGCCGAACTCGCGGCCGGTGGCTACGCCGACCCCAGCGCCGTGGACGACACCTGGCGGATCGCCACCGGCGCACCGGTGGGCCCGTTCCAGATCTACGACATCATCGGCCTGACCACGCCGTACAACATCATGGCCAATGGGGACGCCGAAGCTCAGAAGCTCGCCGCGTGGCTGAAAGAGAACTACATCGACAAAGGCAAGTTGGGCCTCGCCAGCGGCGAAGGCTTCTACAAGTACAACTGA ) 。
Its aminoacid sequence is (SEQ ID NO.20:MTNSVKTVTVLGTGVLGSQIAFQSAFKGFTVTAYDINDEVLEAAKARFEK LAETYANEVPDARDGKAREALGRLTLTSDLKAAVADADLVIEAVPEILDLKRETYQ KLGDLAPAKTIFATNSSTLLPSDLKDSTGRPDKFLALHFANRVWQFNTAEIMGTAD TDPSVFAAVVEFAKAIGMVPIELHKEKAGYVLNSLLVPFLNAAAELAAGGYADPSA VDDTWRIATGAPVGPFQIYDIIGLTTPYNIMANGDAEAQKLAAWLKENYIDKGKLG LASGEGFYKYN).
After di-carbonyl reduction enzyme total gene synthesis, be connected on pUC57 carrier, by Nde I and Xho I, by goal gene and pET-22b (+), (pET-22b (+) can be also pET-3a (+) respectively, pET-3d (+), pET-11a (+), pET-12a (+), pET-14b (+), pET-15b (+), pET-16b (+), pET-17b (+), pET-19b (+), pET-20b (+), pET-21a (+), pET-23a (+), pET-23b (+), pET-24a (+), pET-25b (+), pET-26b (+), pET-27b (+), pET-28a (+), pET-29a (+), pET-30a (+), pET-31b (+), pET-32a (+), pET-35b (+), pET-38b (+), pET-39b (+), pET-40b (+), pET-41a (+), pET-41b (+), pET-42a (+), pET-43a (+), pET-43b (+), pET-44a (+), pET-49b (+), pQE2, pQE9, pQE30, pQE31, pQE32, pQE40, pQE70, pQE80, pRSET-A, pRSET-B, pRSET-C, pGEX-5X-1, pGEX-6p-1, pGEX-6p-2, pBV220, pBV221, pBV222, pTrc99A, pTwin1, pEZZ18, pKK232-18, pUC-18, pUC-19) plasmid carries out enzyme simultaneously and cuts, T4DNA ligase enzyme carries out ligation, by connecting product, be transformed in the competence of e.colistraindh5α, coat and contain 50 μ g/ml containing in the solid LB substratum of penbritin, 37 ℃ of overnight incubation.Single colony inoculation on the above-mentioned substratum of picking is in containing 50 μ g/ml containing in the LB liquid nutrient medium of penbritin, 37 ℃ of shaking culture are spent the night, through plasmid extraction, after PCR evaluation and double digestion are identified, correct cloning vector pET22b (+)-DKR is transformed in e. coli bl21 (DE3), coat and contain 50 μ g/ml containing in the LB substratum of penbritin, 37 ℃ of overnight incubation.Single colony inoculation in the above-mentioned substratum of picking contains in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, through bacterium colony PCR, identify that correct expression vector carries out abduction delivering, above-mentioned bacterium liquid is transferred and contained in the LB liquid nutrient medium of penbritin containing 50 μ g/ml in 5ml, and 37 ℃ of shaking culture are to OD
600=0.6 o'clock, add IPTG to be respectively 0.02mM to final concentration, 0.05mM, 0.1mM, 0.2mM, 0.4mM, 0.6mM, 0.8mM and 1.0mM carry out abduction delivering at 18 ℃, and set up the negative control that does not add IPTG inductor.After induction 16h, take out bacterium liquid, the centrifugal 10min of 8000rpm/min collects thalline.Thalline Ultrasonic Cell Disruptor smudge cells, 4 ℃, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.The amount that found that abduction delivering di-carbonyl reduction enzyme when final concentration is 0.02mM IPTG concentration is maximum.For improving the expression amount of di-carbonyl reduction enzyme, by the e. coli bl21 that contains recombinant plasmid (DE3), at IPTG final concentration, be 0.02mM, respectively at 37 ℃ of induction 8h, under 30 ℃ of induction 8h and 25 ℃ of induction 16h conditions, express, and set up the negative control that does not add IPTG inductor simultaneously.After abduction delivering finishes, respectively the induction thalline of three temperature is collected to thalline in the centrifugal 10min of 8000rpm/min.Thalline Ultrasonic Cell Disruptor smudge cells, 4 ℃, the centrifugal 20min of 12000rpm/min obtains supernatant liquor and precipitation, and supernatant liquor carries out SDS-PAGE detection with vertical electrophoresis apparatus.Found that the amount of expressing di-carbonyl reduction enzyme during 16h 25 ℃ of inductions is maximum.
Select the ketone compounds of business-like raw material or easy preparation on market
for initial feed, R wherein
1be selected from aromatic base; R
2be selected from alkyl.Described two hydroxyl products are expressed by following chemical general formula:
r wherein
1be selected from aromatic base; R
2be selected from alkyl.
In 10ml reaction flask, add 0.01g main raw material
0.04ml polyoxyethylene glycol PEG-400, after material dissolution, adds 0.86ml phosphate buffered saline buffer (100mM, pH=6.0), and substrate is dispersed in damping fluid; Add 1mgNAD
+, 4.12mg ammonium formiate, 2mg coenzyme hydrogenlyase and 4mg di-carbonyl reduction enzyme, system pH=6.0, and in 30 ± 3 ℃ of insulation 15-24h; With 1ml ethyl acetate stopped reaction, use 0.25g diatomite filtration, 1ml ethyl acetate extracting twice, standing separatory, organic phase drying, filters, the concentrated crude product, product of obtaining
73.19%, yield 90%, ee value 93.8%, de value 85.9%.
The nuclear magnetic data of products obtained therefrom is as follows: 400Hz, CDCl3: δ 7.29 (m, 5H), 4.54 (s, 2H), 4.22 (m, 1H), 4.07 (m, 1H), 3.45~3.40 (m, 4H), 2.41 (d, 2H), 1.65 (t, 2H), 1.43 (S, 9H).
Products obtained therefrom mass-spectrometric data is as follows: MW=310 ± 1.
From above description, can find out, the above embodiments of the present invention have realized following technique effect: adopting di-carbonyl reduction enzyme of the present invention (Diketoreductase, DKR) is biological catalyst, can one step reduction diketone substrate, prepare the 3R of single optical purity, 5S-dihydroxy compound, applies it to synthetic statins drug midbody, has simplified synthesis step, reduced to produce and polluted and production cost, be suitable for large-scale industrial production.
The foregoing is only the preferred embodiments of the present invention, be not limited to the present invention, for a person skilled in the art, the present invention can have various modifications and variations.Within the spirit and principles in the present invention all, any modification of doing, be equal to replacement, improvement etc., within all should being included in protection scope of the present invention.