CN103463620A

CN103463620A - Application of anti-inflammatory protein TIPE2 in preparation of medicines used for treating atherosclerosis

Info

Publication number: CN103463620A
Application number: CN2013103172594A
Authority: CN
Inventors: 刘素侠; 邵洁; 章桂忠
Original assignee: Shandong University
Current assignee: Shandong University
Priority date: 2013-07-25
Filing date: 2013-07-25
Publication date: 2013-12-25
Anticipated expiration: 2033-07-25
Also published as: CN103463620B

Abstract

The invention discloses application of a novel anti-inflammatory protein (an immunoregulation molecule) TIPE2 in preparation of medicines used for treating diseases related to atherosclerosis. The invention further discloses a recombinant adenovirus expressing TIPE2. According to the invention, the recombinant adenovirus of TIPE2 is used to realize high-efficiency, stable and continuous expression of the anti-inflammatory protein TIPE2 in ApoE-/- mice, exerts an effect on inhibiting formation of atherosclerotic plaques, effectively prevents and treats diseases like acute coronary syndromes, angina pectoris, cerebral stroke, thrombosis, vascular occlusion and cerebral ischemia with atherosclerosis as a pathological base, substantially improves life quality of patients and prognosis of diseases, opens up a novel approach with wide prospects for effective clinical prevention and treatment of formation of atherosclerosis and related diseases and provides a novel direction and novel bases for development of novel drugs used for treating related diseases with formation of atherosclerotic plaques as a pathological base.

Description

The application of Antiinflammatory protein TIPE2 in the atherosclerotic medicine of preparation treatment

Technical field

The present invention relates to recombinant adenovirus and the application thereof of a kind of high expressed novel anti-inflammatory albumen TIPE2, particularly relate to the application of TIPE2 as novel control treatment of atherosclerosis medicine.

Background technology

The acute coronary artery syndrome such as acute myocardial infarction, sudden cardiac death (acute coronary syndromes, ACS) be the worldwide disease of serious harm human life health, and sickness rate increases year by year, its pathophysiological basis is the formation of atherosclerosis (Atherosclerosis, AS) speckle and breaks.Atherosclerosis is that a kind of cause of disease is complicated, pathological development slowly, take the chronic disease that part or systemic inflammatory and immunoreation be characteristics.Comprise that a large amount of of Monocytes/Macrophages, lymphocyte, smooth muscle cell etc. participate in and formed a series of immune response mechanisms with Ia cell; destroyed immune stable state; cause atherosclerotic generation [referring to 1.[Peter Libby, Paul M.Ridker and Attilio Maseri.Inflammation and Atherosclerosis.Circulation.2002; 105:1135-1143.2.Guido Stoll and Martin Bendszus.Inflammation and Atherosclerosis:Novel Insights Into Plaque Formation and Destabilization.Stroke.2006; 37:1923-1932.3.Goran K.Hansson.Inflammation, Atherosclerosis, and Coronary Artery Disease.N Engl J Med.2005; 352:1685-1695.].Thereby research is thought at present; inflammatory reaction is through atherosclerotic whole pathological process; comprise atheromatous plaque formation, develop and break [referring to LibbyP; OkamotoY; Rocha VZ, Folco E.Inflammation in atherosclerosis:transition from theory to practice.Circulation Journal.2010; 74 (2): 213 – 220.van Leuven SI; Franssen R, Kastelein JJ, Levi M; Stroes ESG, Tak PP.Systemic inflammation as a risk factor for atherothrombosis.Rheumatology.2008; 47 (1): 3 – 7.].For immunoreactive antiinflammatory strategy, be to prevent and treat arteriosclerosis to form and the effective scheme that develops, intervenes prognosis of disease.

TIPE2, be tumor necrosis factor α induced protein 8-2 (Tumor Necrosis Factor-α Induced Protein-8-like 2, TNFAIP8L-2), 2002 from experimental autoimmune encephalomyelitis (Experimental Autoimmune Encephalomyelitis, EAE) screen in the unconventionality expression gene of mouse model and go out, and by the main research worker of present inventor place seminar, and the Chen Youhai professor laboratory of long-term affiliate Pennsylvania university identifies that in research in 2008 it is Novel immune negative regulator [1.Carmody, R.J., etal.Genomic scale profiling of autoimmune inflammation in the central nervous system:the nervous response to inflammation[J] .J Neuroimmunol.2002, 133 (1-2): 95-107.2.Sun, H., etal.TIPE2, a negative regulator of innate and adaptive immunity that maintains immune homeostasis[J] .Cell.2008, 133 (3): 415-26.].Research is found, TIPE2 belongs to tumor necrosis factor α induced protein 8(Tumor necrosis factor-α-induced protein-8, TNFAIP8, TIPE) family, the selective expression is in lymphoid tissue and inflammation tissues such as thymus, spleen, lymph nodes, and there is histiocyte, urogenital cell of secretory function etc. [referring to Zhang, G., et al.Tissue-specific expression of TIPE2 provides insights into its function[J] .Mol Immunol.2010,47 (15): 2435-42.].Further research is found, TIPE2 is by suppressing MAPK(Mitogen-activated protein kinase) and NF-κ B(Nuclear factor-kappa B) activation of signal path brings into play negative regulate inherent immunity and adaptive immunity, that novel Antiinflammatory protein is [referring to Sun, H., et al.TIPE2, a negative regulator of innate and adaptive immunity that maintains immune homeostasis[J] .Cell.2008,133 (3): 415-26.].TIPE2 gene delection shows as gradual many organs inflammation [referring to Sun mice, H., et al.TIPE2, a negative regulator of innate and adaptive immunity that maintains immune homeostasis[J] .Cell.2008, 133 (3): 415-26.], chronic infection at the intracellular abnormal expression of human tissue and hepatitis B virus (HBV), autoimmune disease is relevant [referring to 1:Xi, W., et al.Roles of TIPE2 in Hepatitis B Virus-induced Hepatic Inflammation in Humans and Mice.Mol Immunol, 2011, 48 (9-10): 1203-1208.2:LiD., et al.Down-regulation of TIPE2 mRNA expression in peripheral blood mononuclear cells from patients with systemic lupus erythematosus.Clinical Immunology 2009, 133:422-427.].The present invention be take inflammation as point of penetration, the effect of TIPE2 in atherosclerosis occurs and mechanism have systematically been studied with animal model, cell model, find that TIPE2, by suppressing macrophage-mediated inflammatory reaction performance anti-atherogenic Mottling formation effect, adopts the recombinant adenovirus of high expressed TIPE2 to study the therapeutical effect that TIPE2 forms artery plaque then.

Adenovirus vector is applied to the carrier of gene therapy, and have obvious superiority: host range is wide, and unconformity, in host genome, without insertion mutation, only infects division cells, safe to the people; Can carry out Effective multiplication, amplification in vitro can obtain the recombinant virus of high titre, is the best instrument of current gene therapy.The present invention is through studies confirm that, inflammatory reaction through the formation of atheromatous plaque, develop and the whole process of breaking, and TIPE2 is as a kind of novel anti-inflammatory albumen, there is the effect that atherosclerotic plaque forms that suppresses, therefore this research and utilization recombinant adenovirus is realized the lasting high expressed expression in vivo of TIPE2 albumen, thereby performance suppresses the effect that atheromatous plaque forms.

Summary of the invention

For above-mentioned prior art, important function for inflammatory reaction in atherogenesis, the subject matter that the present invention will solve is to provide a kind of TIPE2 Antiinflammatory protein that can effectively suppress the mediated by recombinant adenovirus of atheromatous plaque formation, and the application of the medicine that further provides this Antiinflammatory protein to form as effective control atheromatous plaque.

The present invention is achieved by the following technical solutions:

Immunity negative regulator (Antiinflammatory protein) TIPE2, i.e. TNFAIP8L2 (tumor necrosis factor alpha-induced protein 8-like2, GeneID:69769), its CDS sequence [NM-027206] is as follows:

Atggctggtcggtccgtggcgcatctctttatcgacgagaccagcagcgaggtgctagacgagctttaccgcgtgtccaaagaatacacgcacagccggcccaaggcacagcgggtgatcaaagacctcatcaaggtagcggttaaagtggctgtgctgcaccgcagtggctgctttggccctggggagctggctctggctacacgatttcgtcagaagctacggcagggcgccatgaccgcacttagcttcggtgaggtggacttcacctttgaggctgccgtgctagcaggtctgctcgtcgagtgccgggacattctgctggagctggtggagcaccacctcacacccaagtcacatgaccgcatcaggcacgtgtttgatcactactctgaccccgacctgctggctgccctctatgggcctgacttcactcagcaccttggcaagatctgtgatgggctccggaagctgctggacgagggcaagctctga,As shown in sequence in sequence table 1。

The aminoacid sequence [NP-081482] of TIPE2 gene code translation of the present invention is as follows:

Mesfsskslalqaekkllskmagrsvahlfidetssevldelyrvskeythsrpka qrvikdlikvavkvavlhrsgcfgpgelalatrfrqklrqgamtalsfgevdftfe aavlagllvecrdillelvehhltpkshdrirhvfdhysdpdllaalygpdftqhl gkicdglrklldegkl, as shown in sequence in sequence table 2.

Build the detailed description of TIPE2 recombinant adenovirus:

The gene order design primer provided according to GeneID:69769, pcr amplification TIPE2 full-length cDNA, two ends design BamHI and XhoI restriction enzyme site, reclaim carrier and purpose fragment, enzyme is successively win to obtain the pRK5-TIPE2 plasmid, and order-checking confirms to connect correct (sequencing result Fig. 2).

BamHI and XhoI double digestion pRK5-TIPE2 plasmid and pShuttle-GFP-CMV shuttle plasmid (this plasmid is existing conventional plasmid in prior art), reclaim TIPE2 purpose fragment and shuttle vector, and enzyme is successively win to obtain the pShuttle-GFP-CMV-TIPE2 plasmid; Use afterwards restricted enzyme I-Ceu I and I-Sce I double digestion pADxsi skeleton plasmid (this plasmid is existing conventional plasmid in prior art) and pShuttle-GFP-CMV-TIPE2 plasmid, and purpose fragment and pADxsi enzyme are connected, product transforms DH5 α and carries out homologous recombination in antibacterial, and the positive colony after screening increases in a large number and obtains the pADxsi-GFP-CMV-TIPE2 recombinant adenovirus plasmid.

After PacI linearization for enzyme restriction recombinant adenovirus plasmid, the incasing cells HEK293 cell with Lipofectamine2000 liposome transfection coverage rate 80% left and right, after 3-5d, obvious plaque occurs.When cytopathy appears in the cell until about 90%, collecting cell, centrifugal collection supernatant after multigelation 3 times, continue to infect the HEK293 cell, and amplicon virus is preserved in liquid nitrogen after collecting the virus liquid purification.TCID 50 methods mensuration virus titers [referring to: Vedtofte L, Bodvarsdottir T B, Karlsen A E, et al.Developmental biology of the Psammomys obesus pancreas:cloning and expression of the Neurogenin-3 gene ［ J ］ .JHistochem Cytochem, 2007,55 (1): 97-104.].

Above-mentioned TIPE2 recombinant adenovirus has two CMV promoteres, and simultaneously independent high efficient expression TIPE2 albumen and GFP, both can pass judgment on expression and the observe the curative effect of TIPE2 by detecting the GFP fluorescence intensity, do not affect again the biologic activity of TIPE2 albumen.

Zoopery shows, the recombinant adenovirus of above-mentioned high expressed TIPE2 albumen can effectively suppress the formation of atherosclerotic plaque in mice and atherosclerosis is played to effective therapeutical effect.Therefore, immunoregulation molecule TIPE2 is expected to be developed as the novel drugs that the control atheromatous plaque formed and brought into play after Mottling formation therapeutical effect.

The recombinant adenovirus of above-mentioned high expressed TIPE2 albumen forms prevention and the curative drug application of the cardiovascular and cerebrovascular disease of pathologic basis with atheromatous plaque as other, as diseases such as acute coronary syndrome, angina pectoris, apoplexy, thrombosis, vascular occlusion, cerebral ischemias.

Further, the present invention be generalized to TIPE2 albumen, derivative all application of the product relevant to TIPE2 in disease described above such as peptide by TIPE2.

Pharmacological evaluation and result prove:

Laboratory mice is SPF level ApoE ^-/-, age in 8-10 week, body weight 18-22g, feeding environment is carried out in strict accordance with the SPF level.

Treatment experimental program 1.TIPE2 prevention ApoE ^-/-the experiment that the mouse model atherosclerotic plaque forms

The ApoE in age in 8-10 week ^-/-after first high fat is fed 1 week, be divided at random experimental group and matched group: every mouse tail vein injection of experimental group 1 * 10 ⁹pfu restructuring TIPE2 adenovirus, matched group is injected the contrast adenovirus of expressing GPF, at interval of 2 weeks repetition single administrations, successive administration 4 times, all high fat nursings in whole process, be after high fat is fed 9 weeks, mice is put to death in excessive pentobarbital sodium anesthesia, after lavation is fixing, separates aortic root and ventral aorta.Aortic root carries out HE dyeing, oil red O stain for making 5 μ m frozen sections, and ventral aorta is for cardinal principle oil red O stain, inhibitory action atherosclerotic plaque formed to detect TIPE2.

Treatment experimental program 2.TIPE2 recombinant adenovirus is to established ApoE ^-/-the inhibitory action of mice atherosclerotic plaque

The ApoE in age in 8-10 week ^-/-after first high fat is fed 1 week, 0.8% pentobarbital sodium anesthetized mice, get dorsal position fixedly mice extremity and head, iodophor disinfection collare center sagittal otch, and the careful separation submaxillary gland, expose left carotid artery.Adhere to the vagus nerve on it by the glass needle careful separation, get afterwards left carotid artery and place epitheca pipe (the epitheca pipe be take silica gel tube as raw material, is placed in 75% ethanol sterilization, and internal diameter 0.30mm, be about 3mm) outward, surgical thread ties and prevents that the epitheca pipe from coming off.Submaxillary gland is sewed up the incision after resetting.Mice continues to raise in SPF level environment, and continues high fat nursing.

After building atherosclerotic plaque in mice formation model 6 weeks (high fat is fed the 7th week), mice is divided into to experimental group and matched group at random: to experimental mice tail vein injection 1 * 10 ⁹the TIPE2 recombinant adenovirus of pfu, matched group is injected the contrast adenovirus of expressing GPF, and (high fat is fed the 9th week) strengthened being administered once after 2 weeks, high fat is fed the 10th week processing mice and drawn materials: excessive pentobarbital sodium is put to death mice, after lavation is fixing, separates left carotid artery, aortic root and ventral aorta.Carotid artery and aortic root are made 5 μ m frozen sections and are carried out HE dyeing, oil red O stain, and ventral aorta carries out the cardinal principle oil red O stain to detect TIPE2 to atherosclerotic therapeutic effect.

Utilize the recombinant adenovirus of high expressed TIPE2 of the present invention and the result for the treatment of experimental program 1 to show: TIPE2 recombinant adenovirus of the present invention can be in Mice Body high expressed (seeing Fig. 7, Figure 13), and can effectively suppress ApoE ^-/-the formation of atherosclerotic plaque in mice, delay the accumulation of lipid at aortic root, aortic arch, ventral aorta, to the good preventive effect of being formed with of speckle; The result for the treatment of experimental program 2 shows: TIPE2 recombinant adenovirus of the present invention not only can effectively prevent the formation of speckle, and can effectively suppress further developing of established atheromatous plaque, thereby suppress vascular occlusion and atherosclerotic further deterioration.Therefore, Antiinflammatory protein TIPE2 will have great using value in the preparation control suppresses clinically and treats atherosclerotic medicine, have extremely wide development prospect.

The present invention utilizes the recombinant adenovirus of TIPE2 to realize in body continuing high expressed TIPE2 Antiinflammatory protein, and performance suppresses the effect (Fig. 4-Fig. 9) that atheromatous plaque forms, and established atheromatous plaque is played to effective therapeutical effect (Figure 10-Figure 17) simultaneously.The present invention is for effectively preventing and treating the atherosclerosis relevant disease has opened up a new way that prospect is boundless clinically, for the exploitation of newtype drug is had laid a good foundation.

The accompanying drawing explanation

Fig. 1: the physical map of plasmid pRK5.

Fig. 2: mice TIPE2 gene pRK5 expression vector order-checking collection of illustrative plates, the arrow indication is the TIPE2 sequence.

Fig. 3: experimental technique route map.

Fig. 4: treatment experimental program 1 aortic root HE coloration result, wherein A is the matched group speckle, B is the speckle after the TIPE2 treatment.

Fig. 5: treatment experimental program 1 aortic root Patch size analysis of statistical results.

Fig. 6: treatment experimental program 1 aortic root oil red O stain result, wherein A is the matched group speckle, B is the speckle after the TIPE2 treatment.

Fig. 7: treatment experimental program 1 aortic root autofluorescence shows the expression of TIPE2 or GFP, the expression that wherein A is matched group GFP, and B is the TIPE2 treatment group.

Fig. 8: treatment experimental program 1 aortic arch, ventral aorta be the oil red O stain result substantially, and wherein A is the matched group speckle, and B is the speckle after the TIPE2 treatment.

Fig. 9: treatment experimental program 1 aortic arch, ventral aorta cardinal principle oil red O stain be statistical analysis as a result.

Figure 10: treatment experimental program 2 aortic root HE coloration results, wherein A is the matched group speckle, B is the speckle after the TIPE2 treatment.

Figure 11: treatment experimental program 2 aortic root Patch size analysis of statistical results.

Figure 12: treatment experimental program 2 aortic root oil red O stain results, wherein A is the matched group speckle, B is the speckle after the TIPE2 treatment.

Figure 13: treatment experimental program 2 aortic root autofluorescences show the expression of TIPE2 or GFP, and wherein A is matched group, and B is the TIPE2 treatment group.

Figure 14: treatment experimental program 2 aortic arch, ventral aorta be the oil red O stain result substantially, and wherein A is the matched group speckle, and B is the speckle after the TIPE2 treatment.

Figure 15: treatment experimental program 2 aortic arch, ventral aorta cardinal principle oil red O stain be statistical analysis as a result

Figure 16: treatment experimental program 2 carotid artery HE coloration results, wherein A is the matched group speckle, B is the speckle after the TIPE2 treatment.

Figure 17: treatment experimental program 2 carotid artery autofluorescence situations, wherein A is matched group, B is the TIPE2 treatment group.

The specific embodiment

Below in conjunction with embodiment, the present invention is further illustrated.

Embodiment 1: mice TIPE2 gene pRK5 expression vector establishment

(1) mice TIPE2 gene C DS district obtains

The PCR design of primers:

According to the design of primers principle, designed mice TIPE2 gene C DS zone amplication primer, and added respectively respectively the restriction enzyme site of BamH1 and Xho1 in the primer upstream and downstream, to facilitate follow-up plasmid construction.In addition, add and be beneficial to Kozak ' the s sequence of transcribing between forward primer restriction enzyme site and start codon ATG.Concrete primer sequence is as follows:

mTIPE2BamH1F:5’-ATTATTGGATCCGCCACCATGGAGTCCTTCAGCTCAAAGA-3’；

MTIPE2Xho1R:5 '-ATTATTCTCGAGTCAGAGCTTGCCCTCGTCCAGC-3 '; As shown in sequence in sequence table 3,4.

(2) mice TIPE2 gene C DS region sequence amplification

With 2 * TaqPCRMix product, the reverse transcription of take is template from the cDNA of the total RNA of C57BL/6J Turnover of Mouse Peritoneal Macrophages, adopts the pcr amplification method to obtain mice TIPE2 gene C DS district fragment, and reaction system is 50 μ L, as shown in table 1.

Table 1

Template	1μg
		Forward primer F	1μL
Downstream primer R	1μL
		2×Taq?PCR?Mix	25μL
ddH2O	Benefit to 50 μ L

The setting of PCR reaction cycle:

The PCR electrophoresis is identified and target fragment is obtained in the glue recovery

50 μ LPCR products all carry out the agarose gel electrophoresis evaluation, and reclaim with glue the band that test kit reclaims 584bp.

(3) gene recombinaton

Double digestion target fragment, pRK5 carrier: utilize BamH1 and Xho1 double digestion target fragment and pRK5 carrier (Fig. 1 is shown in by collection of illustrative plates) respectively, 37 ℃ of enzyme action 3h, (50 μ L) is as shown in table 2 for reaction system:

Table 2

Target fragment or pRK5 carrier	30μL
			10×K?Buffer	5μL
BamH?1	2.5μL
		Xho?1	2.5μL
ddH2O	10μL

Above enzyme action product carries out agarose gel electrophoresis, and reclaims test kit with glue and reclaim the linearisation fragment.

The purpose fragment is connected with carrier: set up following reaction system (20 μ L) by the genes of interest fragment reclaimed after above-mentioned enzyme action and linearizing carrier segments, as shown in table 3:

Table 3

Room temperature continues 4 ℃ and spends the night after connecting 1h, 70 ℃ of water-bath deactivation ligases then, cessation reaction.

Connecting product transforms: take bacillus coli DH 5 alpha as Host Strains, utilize the CaCl2 method by the Host Strains of above-mentioned connection product transformed competence colibacillus, be coated with bacterium and cultivate 16h in the LA flat board in 37 ℃ of constant incubators.

Positive recombinant vector is identified: DNA sequencing is identified: the corresponding strain of recon is delivered to the Hua Da gene and is carried out automatic sequencing, and sequencing result is shown in Fig. 2.

Embodiment 2: the structure of mice TIPE2 adenovirus expression carrier and virus packing

The pShuttle-GFP-CMV-TIPE2 shuttle plasmid builds: (our unit preserves for BamH I and Xho I double digestion pRK5-TIPE2 plasmid, construction method is shown in embodiment 1) and the pShuttle-GFP-CMV shuttle plasmid, reclaim TIPE2 genes of interest fragment and carrier, enzyme is successively win to obtain the pShuttle-GFP-CMV-TIPE2 plasmid.

The pADxsi-GFP-CMV-TIPE2 virus particle builds: with restricted enzyme I-Ceu I+I-Sce I double digestion pADxsi skeleton plasmid and pShuttle-GFP-CMV-TIPE2 plasmid, purpose fragment and pADxsi enzyme are connected, connect product conversion bacillus coli DH 5 alpha and carry out homologous recombination in antibacterial, antibiotic plate screening positive colony is a large amount of amplifications after identifying, called after pADxsi-GFP-CMV-TIPE2 virus particle.

Virus packing: Pac I linearization for enzyme restriction recombinant adenovirus plasmid, then use HEK 293 cells of Lipofectamine 2000 liposome transfection coverage rate 80% left and right, after 3-5d, obvious plaque appears.When the most cells pathological changes, the collecting cell supernatant, 3 later centrifugal collection supernatants of multigelation, continue to infect HEK 293 cells, amplicon virus, the virus liquid after purification is preserved in liquid nitrogen.TCID 50 methods are measured the cytopathy (CPE) after viral infection, by following formula, calculate virus titer:

Sample titre (pfu/mL)=extension rate * dilution factor (CPE positive cell hole count-4)/8

Virus titer that said method is surveyed is 2 * 10 ¹¹pfu/mL.

Embodiment 3: treatment experimental program 1.TIPE2 prevention ApoE ^-/-the experiment that the mouse model atherosclerotic plaque forms

(1) ApoE in age in 8-10 week ^-/-after first high fat is fed 1 week, be divided at random experimental group and matched group: every mouse tail vein injection of experimental group (n=25) 1 * 10 ⁹pfu restructuring TIPE2 adenovirus, matched group (n=15) is injected the contrast adenovirus that isdose table reaches GPF, at interval of 2 weeks, repeats single administration, successive administration 4 times (totally 8 weeks), all high fat nursings in whole process.

(2) high fat was fed after the 9th week, 0.8% pentobarbital sodium intraperitoneal anesthesia mice, after the mice holonarcosis with whole perfusion method original position fixing organization organ.Specific as follows: mice is got dorsal position fixing limbs and head, cuts off abdominal cavity and thoracic cavity, fully exposes heart, and transfusion needle thrusts left ventricle, cuts off right auricle.First with autoclaved PBS, rinse residual blood in the mice circulation, succeeded by the fixing 10min of 4% paraformaldehyde original position.With tweezers, Intraabdominal organ is pushed externally, separate downwards ventral aorta near heart, the clip heart is to obtain aortic root.All be placed in fixedly 24h of 4% paraformaldehyde.Test course as shown in Figure 3.

Embodiment 4: treatment experimental program 2.TIPE2 recombinant adenovirus is to established ApoE ^-/-the inhibitory action of mice atherosclerotic plaque

(1) ApoE ^-/-the foundation of mice atherosclerotic plaque

Age in 8-10 week, SPF level ApoE-knockout mice was weighed, and every animal is in ratio lumbar injection 0.8% pentobarbital sodium of 1mL/200g body weight.After the mice deep anaesthesia, get dorsal position fixedly mice extremity and head on the mice operating-table.

Iodophor disinfection collare center sagittal otch, the careful separation submaxillary gland, expose left carotid.

Separate left carotid, and adhere to the vagus nerve on it by the glass needle careful separation, carotid artery is placed the epitheca pipe outward, and surgical thread ties and prevents that the epitheca pipe from coming off.

Submaxillary gland is resetted, and sew up the incision, carefully look after mice to reviving.

Postoperative mice continues to raise in SPF level environment, for following experiment.

(2) therapeutical effect of TIPE2 recombinant adenovirus to atherosclerotic plaque in mice

After the total arterial cannula of ApoE-knockout mice left side strength, continue at SPF level environment and raise.Diet, the body weight of regularly observing mice, estimate the impact of operation on the mouse growth state.

Be divided at random experimental group (n=20) and matched group (n=15), respectively at postoperative 6 weeks, 8 weeks to every mouse tail vein injection of experimental group 1 * 10 ⁹the TIPE2 recombinant adenovirus of pfu, and to the dosage GPF such as control group mice tail vein injection contrast adenovirus.

After the 10th week, 0.8% pentobarbital sodium intraperitoneal anesthesia mice, after the mice holonarcosis with whole perfusion method original position fixing organization organ.Specific as follows: mice is got dorsal position fixing limbs and head, cuts off abdominal cavity and thoracic cavity, fully exposes heart, and transfusion needle thrusts left ventricle, cuts off right auricle.First with autoclaved PBS, rinse residual blood in the mice circulation, succeeded by the fixing 10min of 4% paraformaldehyde original position.Neck top fur is cut off in the neck center, vertically cuts off skin and flesh layer, with tweezers, separates thyroid, respectively at the below, left and right, tears sheath, exposes the left common carotid artery of ligation.Careful separation common carotid artery surrounding tissue, get sleeve pipe place and lower 0.5cm place tremulous pulse body thereof, and ventral aorta and aortic root, all be placed in fixedly 24h of 4% paraformaldehyde.

Test course as shown in Figure 3.

Embodiment 5: specimen preparation and dyeing

(1) tissue specimen preparation: aortic root, aortic arch, ventral aorta and the sleeve pipe place carotid artery specimen of collecting embodiment 3 and embodiment 4, through 4% paraformaldehyde fixedly after 24h, the OCT embedding, make the continuous frozen section of 5 μ m (pathological analysis is carried out in section when sleeve pipe carotid artery disconnects in the nearly heart in the 500 μ m scopes of position):

1. prepare the aortic root frozen section: the mouse heart of OCT embedding is carried out to serial section in centripetal bottom from transverse section, while the lobe leaf certainly occurring, adjust gradually the angle of specimen and blade, make three sizes such as lobe leaf in same section.Continuous 5 μ m sections, until cusp of aortic valve disappearance place, for HE and oil red O stain.

2. prepare sleeve pipe carotid artery frozen section: sleeve pipe is carefully extractd, and OCT embedding sleeve pipe carotid artery, start serial section in proximal part, and HE dyeing is carried out in the section of choosing in the front 500 μ m scopes of sleeve pipe.

(2) HE dyeing is for observing aortic root and sleeve pipe carotid atherosclerotic plaque size cases:

1. the dry 30min of frozen section room temperature;

2. PBS washes 3 times, each 5min;

3. haematoxylin dyeing 3min;

4. tap water rinses

5. hydrochloride alcohol breaks up 3s;

6. tap water is washed oil blackeite 10min;

7. Yihong dyeing 5min;

8. washing fast;

9. gradient alcohol dehydration: 70% ethanol, 30s → 80% ethanol, 1min → 90% ethanol, 2min → 95% ethanol, 2min → 100% ethanol, 5min;

10. dimethylbenzene is transparent: dimethylbenzene I, 5min → dimethylbenzene II, 5min;

microscope is taken pictures;

by 6.0 pairs of plaque area of Image pro plus, measured.

(3) oil red O stain is to detect aortic root lipidosis situation:

1. room temperature is dried section 30min

2. 60% isopropyl alcohol infiltrates 5min;

3. oil red O dye liquor infiltrates 10min;

4. 60% isopropyl alcohol infiltrates 2min;

5. PBS washes once;

6. haematoxylin dyeing dyes 5min;

7. PBS washes once;

8. gradient alcohol dehydration, dimethylbenzene is transparent, the neutral gum mounting, microscopy, measured plaque area with Imageproplus6.0.

(4) substantially oil red O stain for detection of aortic arch, ventral aorta speckle situation:

1. the PBS buffer rinses aorta 3 times;

2. pure isopropyl alcohol infiltrates aorta 5min;

3. aorta is placed in new EP pipe, adds the oil red O working solution that diluted (compound method: oil red O 0.5g, 98% isopropyl alcohol 100ml, get liquid 6ml before use, adds distilled water 4ml, the quiet 10min of putting filters) 1ml, room temperature dyeing 3h.

4. the PBS buffer rinses aorta 1 time;

5. 75% ethanol decolouring 5min;

6. carefully divest the tunica adventitia tissue, the tissue of blood vessel extrinsic color will be peeled off totally, is laid in and dissects on plate.

7. the high-definition digital camera is taken pictures, and application Image-Pro Plus software carries out quantitative analysis.

Embodiment 6: the TIPE2 adenovirus of the restructuring that embodiment 2 obtains can be realized expressing in the atheromatous plaque forming part and the formation of atheromatous plaque being played to effective preventive and therapeutic action.

By the section of embodiment 5 at the fluorescence microscopy Microscopic observation, the experimental group of discovery embodiment 3 and embodiment 4 and matched group aortic root (seeing Fig. 7, Figure 13) and carotid artery section (seeing Figure 17) all have stronger green fluorescence, illustrate that the recombinant adenovirus that embodiment 2 obtains can be good at infecting mouse atheromatous plaque happening part.

Embodiment 5HE colouring method and oil red O stain are found, the target protein TIPE2 that pADxsi-GFP-CMV-TIPE2 gives expression to can effectively prevent the formation of the atherosclerotic plaque of embodiment 3 (to see Fig. 4, Fig. 6), and the established speckle of embodiment 4 is had to therapeutical effect (see Figure 10, Figure 12), the atheromatous plaque area that is embodied in TIPE2 treatment group mice significantly is less than matched group (seeing Fig. 5, Figure 11), and statistical analysis atheromatous plaque area result is: the plaque area of the TIPE2 prevention group mice of embodiment 3 is 318.1 ± 38.37 * 10 ³μ m ², significantly be less than matched group 603.7 ± 52.92 * 10 ³μ m ², P=0.0072(Fig. 5); The TIPE2 treatment group mouse aorta root plaque area of embodiment 4 also significantly is less than matched group (371.9 ± 103.5vs.760.6 ± 92.85, P=0.0382, Figure 11), the plaque area formed after TIPE2 treatment carotid artery sleeve pipe also significantly is less than matched group plaque area (Figure 16).

Embodiment 5 oil red O stain results substantially proves that target protein TIPE2 that pADxsi-GFP-CMV-TIPE2 gives expression to can effectively prevent and treat the formation (seeing Fig. 8 and Figure 14) of atheromatous plaque too, be embodied in: aortic arch, the ventral aorta atheromatous plaque area of the TIPE2 prevention group mice of embodiment 3 significantly are less than the matched group (see figure 8), statistical analysis atherosclerotic plaque area and aortic arch, ventral aorta area ratio result are 6.887 ± 0.8573%, significantly be less than matched group 18.74 ± 4.064%, P=0.0463(is shown in Fig. 9); Similarly, the aortic arch of the TIPE2 treatment group mice of embodiment 4, ventral aorta atheromatous plaque area significantly be less than matched group (9.014 ± 3.115%vs.30.20 ± 6.383%, P<0.05, Figure 15).

The experimental data statistical procedures: above-mentioned experimental data adopts meansigma methods ± standard error to mean, through non-paired t test, P ﹤ 0.05 thinks that difference has statistical significance.

By above-mentioned experiment and result, can draw the following conclusions:

The TIPE2 recombinant adenovirus can be realized at ApoE ^-/-high efficiency stable expression in Mice Body, the TIPE2 Antiinflammatory protein of expressing plays effective prevention and treatment by the formation that suppresses atherosclerotic plaque to atherosclerosis, experimental result is opened up a new way that application prospect is boundless for the control of the diseases such as the acute coronary syndrome that causes because of atherosclerosis clinically, angina pectoris, apoplexy, thrombosis, vascular occlusion, cerebral ischemia, provides new direction and foundation for the new drug development that forms the relevant disease of pathologic basis with atheromatous plaque simultaneously.

Claims

1. the application of Antiinflammatory protein TIPE2 in the medicine of preparation treatment atherosclerosis.

2. application according to claim 1 is characterized in that: described atherosclerosis is to form the cardiovascular and cerebrovascular disease of pathologic basis with atheromatous plaque.

3. application according to claim 1 and 2 is characterized in that: described atherosclerosis comprises the diseases such as acute coronary syndrome, angina pectoris, apoplexy, thrombosis, vascular occlusion, cerebral ischemia.

4. a recombinant adenovirus of expressing TIPE2 is characterized in that: by following preparation method, obtain:

BamH I and Xho I double digestion pRK5-TIPE2 plasmid and pShuttle-GFP-CMV shuttle plasmid, reclaim TIPE2 purpose fragment and shuttle vector, and enzyme is successively win to obtain the pShuttle-GFP-CMV-TIPE2 plasmid; Use afterwards restricted enzyme I-Ceu I and I-Sce I double digestion pADxsi skeleton plasmid and pShuttle-GFP-CMV-TIPE2 plasmid, and purpose fragment and pADxsi enzyme are connected, product transforms DH5 α and carries out homologous recombination in antibacterial, and the positive colony after screening increases in a large number and obtains the pADxsi-GFP-CMV-TIPE2 recombinant adenovirus plasmid;

After Pac I linearization for enzyme restriction recombinant adenovirus plasmid, the incasing cells HEK293 cell by Lipofectamine 2000 liposome transfection coverage rates 80%, after 3-5d, obvious plaque occurs; When cytopathy appears in the cell until 90%, the collecting cell supernatant, 3 later centrifugal collection supernatants of multigelation, continue to infect the HEK293 cell, and amplicon virus is preserved in liquid nitrogen after collection virus liquid purification.

5. claim is with the preparation method of the recombinant adenovirus of 4 described expression TIPE2, and it is characterized in that: step is as follows:

After Pac I linearization for enzyme restriction recombinant adenovirus plasmid, incasing cells HEK 293 cells by Lipofectamine 2000 liposome transfection coverage rates 80%, after 3-5d, obvious plaque occurs; When cytopathy appears in the cell until 90%, the collecting cell supernatant, 3 later centrifugal collection supernatants of multigelation, continue to infect HEK 293 cells, and amplicon virus is preserved in liquid nitrogen after collection virus liquid purification.

6. claim is with the application of recombinant adenovirus in the medicine for preparing prevention of arterial atherosclerotic disease of 4 described expression TIPE2.

7. claim is with the application of recombinant adenovirus in the medicine of preparation treatment atherosclerosis of 4 described expression TIPE2.

8. claim is with the application of recombinant adenovirus in the medicine of preparation control cardiovascular and cerebrovascular disease of 4 described expression TIPE2.

9. the recombinant adenovirus of expression claimed in claim 4 TIPE2 of take is basic TIPE2 albumen, a series of peptides that derived by TIPE2, the application of gene outcome in the medicine of preparation control cardiovascular and cerebrovascular disease.

10. take the application of recombinant adenovirus in basic TIPE2 albumen, a series of peptides that derived by TIPE2, gene outcome form pathologic basis in preparation treatment cardiovascular and cerebrovascular disease with atheromatous plaque of expression claimed in claim 4 TIPE2.