CN102719417B - High-temperature resistance arabinfuranosidease Abf51B8, as well as gene and application thereof - Google Patents
High-temperature resistance arabinfuranosidease Abf51B8, as well as gene and application thereof Download PDFInfo
- Publication number
- CN102719417B CN102719417B CN201210223320.4A CN201210223320A CN102719417B CN 102719417 B CN102719417 B CN 102719417B CN 201210223320 A CN201210223320 A CN 201210223320A CN 102719417 B CN102719417 B CN 102719417B
- Authority
- CN
- China
- Prior art keywords
- abf51b8
- arabinofuranosidase
- gene
- high temperature
- temperature resistant
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
Images
Landscapes
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Enzymes And Modification Thereof (AREA)
Abstract
The invention relates to the field of gene engineering, and in particular relates to high-temperature resistance arabinfuranosidease Abf51B8, as well as a gene and an application thereof. The invention provides the arabinfuranosidease Abf51B8 coming from Alicyclobacillussp.B8 with an amino acid sequence shown as SEQ ID NO.1, and a coding gene abf51B8 for coding the arabinfuranosidease. The arabinfuranosidease has the characteristics of optimal pH of 6.0, optimal temperature of 60 DEG C and good thermal stability at 70 DEG C, and can be widely applied to feeds, foods, energy industries and the like serving as a novel enzyme preparation.
Description
Technical field
The present invention relates to genetically engineered field, particularly, the present invention relates to a kind of high temperature resistant arabinofuranosidase Abf51B8 and gene and application.
Background technology
Xylan is a class material the abundantest in hemicellulose, is extensively present in hardwood (15-30%), cork (7-10%) and draft class plant (being less than 30%).The basic sugar unit of xylan is D-xylopyranose, its main chain by wood sugar with β-1,4 glycosidic links are connected to form, on side chain, by various substituting group, modified, simultaneously, these side substitution groups are crosslinked mutually by chemical bond, form complicated structure (Collins et al.FEMS Microbiology Reviews.2005,29:3-23.).The degraded of xylan needs the synergy of main chain lytic enzyme and side chain lytic enzyme, and main chain enzyme comprises β-Isosorbide-5-Nitrae-zytase and xylobiase, and side chain hydrolysis needs α-l-arabfuranglycosidase, α-glucose aldehydic acid, the coenzyme such as acetyl xylan esterase.Wherein, arabinofuranosidase (α-L-arabinofuranosidase, EC 3.2.1.55) can be from the polymer that contains pectinose residue as a pectinose molecule of non-reduced end hydrolysis generation of arabinan, araboxylan, arabogalactan etc.At present, people have carried out the α-l-arabfuranglycosidase of bacterium, fungi and plant origin separation and purification or by after gene clone, heterogenous expression, have furtherd investigate the various character of enzyme.The optimal reaction pH that derives from the arabinofuranosidase of microorganism is acid to (pH 3.0-7.0) between neutrality, and optimal reactive temperature is between 40-70 ℃.
As one of hemicellulose degradation enzyme system, α-l-arabfuranglycosidase participates in the recycling of agricultural-food residue at a low price, produces the monose and other byproducts that can be used for fermentation generation alcohol fuel.At cellulose fermentation, produce in the process of alcohol fuel, 70% the starting material of having an appointment can not be completely degraded generation monose, and suitable Mierocrystalline cellulose preprocessing process can strengthen cellulosic utilization ratio.Utilize the pretreated method of enzyme to reduce the generation of these problems.Arabinofuranosidase is the side chain degrading enzyme of hemicellulose, and it can promote the degradable of hemicellulose.In addition, Arabinofuranosidases, as a kind of fodder additives, has been removed arabinose side chains on xylan, promotes the degraded of xylan, is easy to be digested and assimilated by animal.Arabinofuranosidase is also widely used in food service industry, and L-arabinose can replace traditional sucrose as a kind of sweeting agent of low intake, is suitable for the elderly and hyperglycemic patients edible.Arabinofuranosidase can also increase the concentration of terpenol in wine brewing process, improves the fragrance of wine, increases the clarity of fruit juice, and is applied to juice production industry.Therefore, the generation of arabinofuranosidase, purifying, nature and characteristic and the application in fields such as feed processing, wine industry, fruit juice processing and the energy thereof deepen continuously.
Industrial production needs enzyme to carry out Short-Term High Temperature processing, and current most arabinofuranosidase optimum temperutures are 50 ℃ of left and right, but poor heat stable property can not meet feed granulating, brewages the high temperature production requirement of the industry such as processing.Therefore the enzyme that obtains good heat stability can reduce production costs, and meets the requirement of different industry to enzymatic property.
The arabinofuranosidase Abf51B8 that derives from alicyclic acid genus bacillus Alicyclobacillus sp.B8 in the present invention has following character: optimal pH 6.0, and in the scope of pH5.0～8.0, there is more than 40% enzyme activity, there is good pH stability, at 37 ℃, act on after 1h, between pH 4.0 – 11.0, residual enzyme activity is all more than 80%.60 ℃ of optimum temperutures, still have more than 50% activity at 80 ℃, good thermostability, and 70 ℃ have good stability, the enzyme loss hardly of living after insulation 60min.The characteristics such as good pH and thermostability make it at feed, have very large potentiality in food industry applications.
Summary of the invention
The object of this invention is to provide a kind of high temperature resistant arabinofuranosidase Abf51B8 of energy efficient application.
A further object of the present invention is to provide the gene of the above-mentioned high temperature resistant arabinofuranosidase of coding.
Another object of the present invention is to provide the recombinant vectors that comprises said gene.
Another object of the present invention is to provide the recombinant bacterial strain that comprises said gene.
Another object of the present invention is to provide a kind of gene engineering method of preparing above-mentioned high temperature resistant arabinofuranosidase.
Another object of the present invention provides the application of above-mentioned high temperature resistant arabinofuranosidase.
The present invention separates and obtains a kind of new high temperature resistant arabinofuranosidase Abf51B8 from alicyclic acid genus bacillus Alicyclobacillus sp.B8.
The invention provides a kind of high temperature resistant arabinofuranosidase Abf51B8, its aminoacid sequence is as shown in SEQ ID NO.1.
SEQ?ID?NO.1：
MSKSIARMTIDPQYQLADVDPRLFGSFIEHLGRAVYGGIYEPDHPSADEMGFRQDVLELVRELQVPIVRYPGGNFVSGYRWEDGVGPLASRPAQLDLAWRSLEPNRVGVNEFVEWAKRANSEVMMAVNLGTRGIDEAKQIVEYCNHPGGSYWSDLRKSHGYEQPHGIKVWCLGNEMDGPWQIGHKTAEEYGRIAEEAAKVMKWVDPSIELVACGSSGSKMPTFPDWERIVLEHTYDHVEYISMHSYYGNRENDLATYLAQSLDMDHFIRSVIATCDYVKAKKRSKKTINISFDEWNVWFHSNEADKQVAPWQVGPPLLEDVYTVEDALVVGCLLITLLRHADRVKMACLAQLVNVIAPIMTENGGVSWKQTIYYPFLHASRYGRGKVMHCSLQSPKYDCKEFTDVPLVESVAVWNQDIGELTIFAVNRSQDGGIELECDIRGFAQASVIEHTVLVHSDLKAANTKEEPQEVIPQHAQGAKVDGGLLFAPLPKLSWNVIRLRV
Wherein, this enzyme comprises 502 amino acid, no signal peptide sequence.
The present invention screens alicyclic acid genus bacillus Alicyclobacillus sp.B8, it produces arabinofuranosidase Abf51B8, the thermostability that this enzyme has had simultaneously, in neutral scope, all there is at normal temperatures high reactivity, its optimum pH is 6.0, maintains more than 60% enzymic activity in the scope of pH5.0～7.0; Optimum temperuture is 60 ℃, at 40～80 ℃ of enzyme activities that still have more than 50%.
The invention provides the gene abf51B8 of the above-mentioned high temperature resistant arabinofuranosidase of coding.Particularly, the genome sequence of this gene is as shown in SEQ IDNO.2:
atgtccaagtcgattgcacgtatgacgattgatccgcagtaccagctcgccgatgtcgatccaaggttgttcgggtcgttcatcgagcatctcgggcgcgccgtatatgggggtatttacgagcctgatcacccgtctgccgacgaaatgggtttccgtcaggacgtcctcgaactggtgcgcgaactccaggtgcccatcgtgcgctacccgggaggcaactttgtgtcaggttaccgttgggaagacggggtggggccgcttgcgtccaggcccgcccaactcgatctcgcttggcgaagcttggaacccaatcgtgtaggtgtcaacgaatttgtcgagtgggccaagcgggcaaactccgaagtcatgatggctgtcaatctcggcacgcgtggtatcgacgaagcgaagcagattgtcgagtactgcaatcatcctggcggcagttattggagcgatctacgaaaatcgcatggctatgaacagccgcacggcatcaaggtgtggtgcctgggcaacgagatggatggcccgtggcaaattgggcacaaaacggccgaagaatacggccgaatcgctgaagaagcggctaaggtcatgaaatgggtcgatccgtcgatagagcttgtcgcatgcggtagctccggctcgaaaatgcctacgtttcccgattgggaacgaattgtcctcgaacacacatacgatcacgtcgagtacatttccatgcacagctactacggaaatcgcgagaatgacctcgcgacgtaccttgctcaatcgctcgatatggaccatttcatccgttcggtgattgcgacatgtgactatgtcaaagcgaaaaaacgcagcaagaaaaccatcaacatctcgtttgacgagtggaatgtgtggtttcactcaaacgaagcggacaaacaagttgcaccgtggcaggttggcccgccgttgcttgaggacgtatatacggtcgaagatgcgcttgttgtcgggtgtttgttgatcacgcttttgcgccatgcggatcgggtgaagatggcgtgtcttgctcagttggtcaatgtgattgcgcccatcatgacggagaacggcggggtgtcctggaaacagaccatttactatccctttttgcacgcttcgcggtacggtagagggaaagtgatgcactgctcgctacaatcgccgaagtacgattgtaaggaatttaccgacgtgccgctggtcgagagcgttgcagtgtggaatcaggatatcggagagttgaccatttttgcggtcaaccgttcgcaagatggcggcatcgagttggaatgtgacatccgcgggtttgctcaagccagcgtgatcgagcatacggtgcttgtgcattcggatttgaaagcggcgaacacgaaagaagagccacaggaagtgattccgcagcatgcacaaggcgcaaaggtcgatgggggcttgctcttcgctccattacccaaactgtcttggaacgtcattcgattgcgcgtgtaa
According to a particular embodiment of the invention, the method separating clone by PCR arabinofuranosidase abf51B8, DNA complete sequence analysis result shows, arabinofuranosidase gene abf51B8 total length 1509bp.Maturation protein theoretical molecular is 56.6kDa, arabinofuranosidase abf51B8 sequence and the aminoacid sequence derived are carried out to BLAST comparison in GenBank, and this gene is 68% with the arabinofuranosidase sequence identity that derives from Geobacillus Stearothermophilus T6.Illustrate that Abf51B8 is a kind of new arabinofuranosidase.
The present invention also provides the recombinant vectors that comprises above-mentioned arabinofuranosidase abf51B8, is preferably pPET-abf51B8.Arabinofuranosidase gene of the present invention is inserted between the restriction enzyme site that expression vector is suitable, makes that its nucleotide sequence is exercisable to be connected with expression regulation sequence.As the most preferred embodiment of the present invention, be preferably arabinofuranosidase gene of the present invention is inserted between the Nde I and Not I restriction enzyme site on plasmid pPET-30a (+), obtain expression of recombinant yeast plasmid pPET-abf51B8.
The present invention also provides the recombinant bacterial strain that comprises above-mentioned high temperature resistant arabinofuranosidase Abf51B8, and preferred described bacterial strain is intestinal bacteria, yeast, genus bacillus or lactobacillus, is preferably recombinant bacterial strain BL21/abf51B8.
The present invention also provides a kind of method of preparing high temperature resistant arabinofuranosidase Abf51B8, comprises the following steps:
1) with above-mentioned recombinant vectors transformed host cell, obtain recombinant bacterial strain;
2) cultivate recombinant bacterial strain, induction restructuring arabinofuranosidase is expressed; And
3) reclaim the also expressed arabinofuranosidase Abf51B8 of purifying.
Wherein, preferred described host cell is Bacillus coli cells, preferably, by recombined pronucleus expression plasmid transformation escherichia coli BL21 (DE3), obtains recombinant bacterial strain BL21/abf51B8.
The present invention also provides the application of above-mentioned arabinofuranosidase Abf51B8.
The present invention's technical problem first to be solved is to overcome the deficiencies in the prior art, provide a kind of character good, be suitable at feed, wine brewing, arabinofuranosidase that Applications in Food Industry is new.Arabinofuranosidase optimal pH of the present invention is 6.0, has higher enzymic activity in pH5.0～7.0; PH good stability.Its high-temperature stability, can make it in the industrial production of demand hot environment, apply.Arabinofuranosidase of the present invention is applicable to fodder industry, can act synergistically with zytase, and effectively eliminating or reducing increases the anti-oxidant action causing because of viscosity.In wine industry, the araboxylan of solubility and the insolubility of can effectively degrading, the viscosity that effectively reduces wort improves filtration efficiency clarifying beer.In addition, in the brewageing of white wine, pure mellow wine, contribute to increase wine brewing process in the concentration of terpenol, tart up.Therefore, the application of this arabinofuranosidase in foodstuffs industry demonstrates its huge potentiality.
Accompanying drawing explanation
The recombinate optimal pH of arabinofuranosidase of Fig. 1.
The recombinate pH stability of arabinofuranosidase of Fig. 2.
The recombinate optimum temperuture of arabinofuranosidase of Fig. 3.
The recombinate thermostability of arabinofuranosidase of Fig. 4.
Embodiment
Test materials and reagent
1, bacterial strain and carrier: the present invention separates and obtains a kind of new high temperature resistant arabinofuranosidase Abf51B8 from alicyclic acid genus bacillus Alicyclobacillus sp.B8.Coli expression carrier pPET-30 (a) and bacterial strain EcoliBL21 (DE3) are purchased from Invitrogen company.
2, enzyme and other biochemical reagents: restriction endonuclease is purchased from TaKaRa company, and ligase enzyme is purchased from Invitrogen company.P-nitrophenyl-a-L-arabionfuranoside (pNPAf) is purchased from Sigma company, and other is all domestic reagent (all can buy and obtain from common biochemical reagents company).
3, substratum:
(1) Alicyclobacillus sp.B8 substratum is MEA substratum: malt extract, 17.0g/l; Peptone, 3.0g/l; Agar.By the citric acid of 1:1 (w/w), adjusting pH value is 3.5
(2) Escherichia coli culture medium LB (1% peptone, 0.5% yeast extract, 1%NaCl, pH7.0).
Illustrate: the experimental methods of molecular biology that in following examples, work illustrates, all with reference to listed concrete grammar in < < molecular cloning experiment guide > > (third edition) J. Pehanorm Brooker one book, carry out, or carry out according to test kit and product description.
The clone of embodiment 1 alicyclic acid genus bacillus Alicyclobacillus sp.B8 arabinofuranosidase encoding gene abf51B8
Extract Saksenaea vasiformis Alicyclobacillus sp.B8 genomic dna:
After centrifugal the liquid culture thalline of 3 days, put into mortar, add 2mL extracting solution, grind 5min, then lapping liquid is placed in to 50mL centrifuge tube, 65 ℃ of water-bath cracking 20min, mix once every 10min, the centrifugal 5min of 10000rpm at 4 ℃.Get supernatant extrct foreigh protein removing in phenol/chloroform, then get supernatant and add equal-volume Virahol, after the standing 5min of room temperature, the centrifugal 10min of 10000rpm at 4 ℃.Abandon supernatant, 70% washing with alcohol twice for precipitation, vacuum-drying, adds appropriate TE dissolving, be placed in-20 ℃ standby.
According to conservative (GNEMDG and DEWNVW) sequences Design of the 51st family's arabinofuranosidase gene, degenerated primer P1, P2 have been synthesized
P1:5'-GGNAAYGARATGGAYGG-3'；
P2:5'-CCANACRTTCCAYTCRTC-3')。
Take the total DNA of Alicyclobacillus sp.B8 as template, carry out pcr amplification.PCR reaction parameter is: 94 ℃ of sex change 5min; Then 94 ℃ of sex change 30sec, 50 ℃ of annealing 30sec, 72 ℃ are extended 1min, 30 rear 72 ℃ of insulation 10min of circulation.Obtain an about 378bp fragment, after this fragment is reclaimed, be connected with pEASY-T3 carrier and send the order-checking of three rich Bioisystech Co., Ltd.
The nucleotide sequence obtaining according to order-checking, each three the TAIL-PCR Auele Specific Primers of design upstream and downstream: design direction is the zone of ignorance direction that needs amplification, and the Position Design of sp2 is in the inner side of sp1, and sp3 is positioned at the inner side of sp2.Distance between every two primers does not have strict regulation, the general 22～30nt of primer length, and annealing temperature is at 60～65 ℃.And by they difference called after usp1, usp2, usp3 (upstream Auele Specific Primer), dsp1, dsp2, dsp3 (downstream Auele Specific Primer) is in Table 1.
Table 1. arabinofuranosidase Abf51B8TAIL-PCR Auele Specific Primer
By reverse TAIL-PCR, obtain the flanking sequence of known sequence, amplification obtains product and reclaims the order-checking of Hou Songsanbo Bioisystech Co., Ltd.Arabinofuranosidase Abf51B8 full length gene 1509bp after splicing, encode 502 amino acid and a terminator codon.With SignalP (http://www.cbs.dtu.dk/services/SignalP), analyze and show this gene no signal peptide.The theoretical molecular of predicting the maturation protein of this coded by said gene is 56.6kDa.
The recombinate preparation of arabinofuranosidase of embodiment 2
Expression vector pPET-30a is carried out to double digestion (Nde I+Not I), simultaneously by the gene abf51B8 double digestion (Nde I+Not I) of coding arabinofuranosidase, the gene fragment that cuts out encoding mature arabinofuranosidase is connected with expression vector pPET-30a, the recombinant plasmid pPET-abf51B8 that acquisition contains arabinofuranosidase gene abf51B8 also transforms e. coli bl21 (DE3), obtains recombinant pichia yeast strain BL21/abf51B8.
Get the BL21 bacterial strain that contains recombinant plasmid, be inoculated in 300mL LB nutrient solution, after 37 ℃ of 227rpm shaking culture 2h, add final concentration 0.6mM IPTG to induce 4h at 30 ℃.Restructuring arabinofuranosidase expression amount is 5.6U/mL.SDS-PAGE result shows, restructuring arabinofuranosidase has obtained expression in intestinal bacteria.The specific activity of Scrimber glycan is 98.8U/mg.
The recombinate activation analysis of arabinofuranosidase of embodiment 3
The mensuration of arabinofuranosidase activity: the amount of measuring the product p-nitrophenol of enzymic hydrolysis substrate pNPAf generation under 405nm.Reactions steps: 250 μ L 2mM pNPAf substrates and 150 μ L damping fluids mix, adds the suitably enzyme liquid of dilution of 100 μ L, in 40 ℃ of reaction 10min, adds 1.5mL 1M Na
2cO
3termination reaction, measures OD value in 405nm place.
The recombinate property testing of arabinofuranosidase of embodiment 4
1, the optimal pH of restructuring arabinofuranosidase Abf51B8 and the measuring method of pH stability are as follows:
The restructuring arabinofuranosidase of purifying is carried out to enzymatic reaction to measure its optimal pH under different pH.Substrate xylan is with carrying out vitality test in 0.1mol/L citric acid-Sodium phosphate dibasic damping fluid of different pH 60 ℃.Result (Fig. 1) shows, the optimal pH of recombinase Abf51B8 is 6.0, has more than 50% relative activity in pH5.0 ~ 7.0.Arabinofuranosidase is 37 ℃ of processing 60min in the damping fluid of above-mentioned various different pH, then at 60 ℃, measure enzymic activity in pH6.0 buffer solution system, with the pH patience of studying enzyme.Result (Fig. 2) shows that enzyme is all very stable between pH 4.0-11.0, within the scope of this pH, process 60min after residual enzyme activity more than 85%, this illustrates that this enzyme has good pH stability within the scope of wide in range pH.
2, the optimum temperuture of arabinofuranosidase and thermal stability determination method are as follows:
Enzymatic reaction is carried out in being determined as under citric acid-Sodium phosphate dibasic damping fluid (pH6.0) buffer solution system and differing temps of the optimum temperuture of arabinofuranosidase.Temperature tolerance is determined as arabinofuranosidase and processes different time under differing temps, then carries out enzyme assay at 60 ℃.Enzyme reaction optimum temperuture measurement result (Fig. 3) shows that its optimum temperuture is 60 ℃.The thermostability test of enzyme shows (Fig. 4), and Abf51B8 has good thermostability, incubation 1h at 60 ℃, and enzyme is lived and is lost hardly, and incubation 1h at 70 ℃ can keep more than 80% enzyme to live.
3, the K of arabinofuranosidase
mvalues determination method is as follows:
With the pNPAf of different concns be substrate, in citric acid-Sodium phosphate dibasic damping fluid (pH6.0) buffer solution system, measure enzymic activity at 60 ℃, calculate its K at 60 ℃
mvalue.After measured, K
mvalue is 0.5mg/mL, maximum reaction velocity V
maxbe 138.23 μ mol/minmg.
4, the impact that different metal ion chemistry reagent is lived on arabinofuranosidase enzyme is determined as follows:
In enzymatic reaction system, add different metal ions and the chemical reagent of different concns, study its impact on enzymic activity, various material final concentrations are 1mmol/L.Under 60 ℃, pH6.0 condition, measure enzymic activity.Result shows, recombinate when concentration the is 1mmol vigor of arabinofuranosidase of most of ions and chemical reagent beta-mercaptoethanol and EDTA does not have considerable change.But Ag
+, Hg
2+almost can suppress its vigor completely, and also its vigor of strongly inhibited of SDS.
Claims (8)
1. a high temperature resistant arabinofuranosidase Abf51B8, is characterized in that, its aminoacid sequence is as shown in SEQ ID NO.1.
2. a high temperature resistant arabinofuranosidase gene abf51B8, is characterized in that, high temperature resistant arabinofuranosidase Abf51B8 claimed in claim 1 encodes.
3. high temperature resistant arabinofuranosidase gene abf51B8 as claimed in claim 2, is characterized in that, its base sequence is as shown in SEQ ID NO.2.
4. comprise the recombinant vectors of high temperature resistant arabinofuranosidase gene abf51B8 described in claim 3.
5. comprise the recombinant vectors pPET-abf51B8 of high temperature resistant arabinofuranosidase gene abf51B8 described in claim 3.
6. comprise the recombinant bacterial strain of high temperature resistant arabinofuranosidase gene abf51B8 described in claim 3.
7. a method of preparing high temperature resistant arabinofuranosidase Abf51B8, is characterized in that, comprises the following steps:
1) with the recombinant vectors transformed host cell of claim 4, obtain recombinant bacterial strain;
2) cultivate recombinant bacterial strain, induce high temperature resistant arabinofuranosidase Abf51B8 to express;
3) reclaim the also expressed high temperature resistant arabinofuranosidase Abf51B8 of purifying.
Described in claim 1 high temperature resistant arabinofuranosidase Abf51B8 in fodder industry, application in wine industry.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201210223320.4A CN102719417B (en) | 2012-07-02 | 2012-07-02 | High-temperature resistance arabinfuranosidease Abf51B8, as well as gene and application thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201210223320.4A CN102719417B (en) | 2012-07-02 | 2012-07-02 | High-temperature resistance arabinfuranosidease Abf51B8, as well as gene and application thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN102719417A CN102719417A (en) | 2012-10-10 |
| CN102719417B true CN102719417B (en) | 2014-04-30 |
Family
ID=46945287
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201210223320.4A Active CN102719417B (en) | 2012-07-02 | 2012-07-02 | High-temperature resistance arabinfuranosidease Abf51B8, as well as gene and application thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN102719417B (en) |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN105779420B (en) * | 2016-05-16 | 2020-02-18 | 北京科为博生物科技有限公司 | High-temperature-resistant acid arabinofuranosidase AbfaHLB (AbfaHLB), gene and application thereof |
| CN109402089B (en) * | 2018-11-06 | 2021-10-12 | 江苏大学 | Thermostable arabinofuranosidase and application thereof |
| CN109517754A (en) * | 2018-11-20 | 2019-03-26 | 上海交通大学 | A method of high temperature bacterial strain is isolated and purified using common biochemical equipment |
| CN110982805B (en) * | 2019-12-31 | 2023-10-31 | 湖南利尔康生物股份有限公司 | alpha-L-arabinofuranosidase and related products |
| CN116179516B (en) * | 2022-12-29 | 2024-01-26 | 云南师范大学 | alpha-L-arabinofuranosidase and application thereof |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102392007B (en) * | 2011-12-05 | 2013-06-26 | 武汉新华扬生物股份有限公司 | High temperature alkaline xylanase XYN10A, gene thereof and application thereof |
-
2012
- 2012-07-02 CN CN201210223320.4A patent/CN102719417B/en active Active
Also Published As
| Publication number | Publication date |
|---|---|
| CN102719417A (en) | 2012-10-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN103275955B (en) | Xylosidase Xyl43B with high xylose tolerance, and gene and application thereof | |
| WO2017197546A1 (en) | Β-mannanase mrmman5a and encoding gene and application thereof | |
| CN102719417B (en) | High-temperature resistance arabinfuranosidease Abf51B8, as well as gene and application thereof | |
| CN107129976B (en) | Xylanase, coding gene thereof and application thereof | |
| CN109415745B (en) | Compositions and methods for producing gentiobiose or glucose | |
| CN116410960B (en) | Beta-xylosidase mutant D41G with cold and pH adaptability improved halophilic suitability and application thereof | |
| CN105779420B (en) | High-temperature-resistant acid arabinofuranosidase AbfaHLB (AbfaHLB), gene and application thereof | |
| CN101701214B (en) | Xylanase XYNA4 with wide pH applicability and gene and application thereof | |
| CN101701205A (en) | Alkali-resistant xylanase XynE2, genes thereof and application thereof | |
| CN104388408A (en) | Acid glucanase GLU16-3 with high specific activity, gene for same and application of acid glucanase GLU16-3 | |
| CN103789283B (en) | A kind of neutral arabinofuranosidase Abf43 and gene thereof and application | |
| CN105420218B (en) | A kind of xyloside of low temperature/arabinofuranosidase glucosides bifunctional enzyme AX543 and its gene and application | |
| CN103695397B (en) | Mesophilic acidic xylanase XYN10L1 and gene and application thereof | |
| CN102154246B (en) | Acid glucanase CEL7G5 and gene and application thereof | |
| CN102154244B (en) | High-temperature acid cellulase EgG5 and gene and application thereof | |
| CN102978189B (en) | High specific activity xylosidase Xyl52B8 and gene and application thereof | |
| CN101892208B (en) | High-temperature acidic xylanase XYN10J88, gene and application thereof | |
| CN102952790B (en) | Multifunctional cellulose as well as expression gene and application thereof | |
| CN102586206B (en) | High temperature acidic xylanase XYN10C1 as well as gene and application thereof | |
| CN112574976A (en) | High-temperature-resistant acidic xylanase XYN10L2, and gene and application thereof | |
| CN103525791A (en) | High temperature resistant neutral cellulase Cel61P8 as well as gene and application thereof | |
| CN112195167B (en) | Beta-glucanase, coding gene IDSGH5-26 thereof and application thereof | |
| CN103131684B (en) | A kind of C of having holds the method for the zytase XynA of unnecessary sequence and gene thereof and purposes, raising zytase catalytic rate | |
| CN103074317B (en) | High temperature neutral xylanase XYNA used for brewing beer and gene and application thereof | |
| CN105176950A (en) | Acidic thermophilic xylanase TLXyn10A and genes and application thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C10 | Entry into substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| C14 | Grant of patent or utility model | ||
| GR01 | Patent grant | ||
| C41 | Transfer of patent application or patent right or utility model | ||
| TR01 | Transfer of patent right |
Effective date of registration: 20161012 Address after: 430074 Hubei city of Wuhan province East Lake New Technology Development Zone, Ling Shan Road No. 5 Patentee after: WUHAN SUNHY BIOLOGICAL Co.,Ltd. Patentee after: SUNHY TECHNOLOGY (HUBEI) CO.,LTD. Patentee after: HUBEI SHENZHOU CHEMICAL Co.,Ltd. Address before: 430074 Hubei city of Wuhan province East Lake New Technology Development Zone, Ling Shan Road No. 5 Patentee before: WUHAN SUNHY BIOLOGICAL Co.,Ltd. |
|
| CP02 | Change in the address of a patent holder |
Address after: No.98, guangguba Road, Donghu New Technology Development Zone, Wuhan City, Hubei Province Co-patentee after: SUNHY TECHNOLOGY (HUBEI) CO.,LTD. Patentee after: WUHAN SUNHY BIOLOGICAL Co.,Ltd. Co-patentee after: HUBEI SHENZHOU CHEMICAL Co.,Ltd. Address before: 430074, No. 5, Ling Nan Road, East Lake New Technology Development Zone, Wuhan, Hubei, China Co-patentee before: SUNHY TECHNOLOGY (HUBEI) CO.,LTD. Patentee before: WUHAN SUNHY BIOLOGICAL Co.,Ltd. Co-patentee before: HUBEI SHENZHOU CHEMICAL Co.,Ltd. |
|
| CP02 | Change in the address of a patent holder | ||
| TR01 | Transfer of patent right |
Effective date of registration: 20221101 Address after: 430206 No. 98, Guanggu 8th Road, Donghu New Technology Development Zone, Wuhan City, Hubei Province (Wuhan area of free trade zone) Patentee after: WUHAN SUNHY BIOLOGICAL Co.,Ltd. Address before: No.98, Guanggu 8th Road, Donghu New Technology Development Zone, Wuhan City, Hubei Province, 430074 Patentee before: WUHAN SUNHY BIOLOGICAL Co.,Ltd. Patentee before: SUNHY TECHNOLOGY (HUBEI) CO.,LTD. Patentee before: HUBEI SHENZHOU CHEMICAL Co.,Ltd. |
|
| TR01 | Transfer of patent right |