CN100445300C - GLP-1 fusion protein and its preparation method and medicinal uses - Google Patents
GLP-1 fusion protein and its preparation method and medicinal uses Download PDFInfo
- Publication number
- CN100445300C CN100445300C CNB2005100171754A CN200510017175A CN100445300C CN 100445300 C CN100445300 C CN 100445300C CN B2005100171754 A CNB2005100171754 A CN B2005100171754A CN 200510017175 A CN200510017175 A CN 200510017175A CN 100445300 C CN100445300 C CN 100445300C
- Authority
- CN
- China
- Prior art keywords
- xaa
- gly
- leu
- val
- misc
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Fee Related
Links
Images
Abstract
The present invention provides a GLP-1 fusion protein and a preparing method thereof. The fusion protein can be used for treating insulin non-independent type diabetes, obesity, etc.
Description
Technical field
The present invention discloses a kind of GLP-1 fusion rotein and preparation method thereof, relate to the preparation of the fusion rotein of GLP-1 (7-37) and some polypeptide, the present invention also provides the medicinal use of these fusion roteins in disease treatments such as Regular Insulin non-insulin dependent diabetes and obesity, belongs to technical field of biological genetic engineering.
Background technology
The GLP-1 that the present invention relates to (glucagon-like peptide-1, hereinafter to be referred as: GLP-1) mainly by a kind of 37 polypeptide that amino acid is formed of small intestine L-emiocytosis, its activity form is GLP-1 (7-37) OH and GLP-1 (7-36) NH2 (Mojsov S, J ClinInvest.1987Feb; 79 (2): 616-9).
The GLP-1 analogue is the new class medicine for the treatment of type ii diabetes now.In April, 2005, united States food and drug administration has ratified exenatide, the medicine that can inject, sell with trade(brand)name Byetta, adjuvant therapy medicaments as the type ii diabetes patient, Byetta is the GLP-1 analogue that comes from lizard saliva, is developed by Eli Lilly and Amylin pharmaceuticals.GLP-1 has obvious reduction patient at the blood sugar of using after the meal, can stimulate the production of Regular Insulin, and it can also play certain fat-reducing effect simultaneously, and can not cause hypoglycemia (Drucker DJ, Diabetes.1998 Feb; 47 (2): 159-69.).Recent research shows that also GLP-1 has regeneration (Drucker DJ, Endocrinology.2003Dec to pancreas; 144 (12): 5145-8.).Because the N-of natural GLP-1 holds the 2nd Ala very fast in vivo by two acyltransferase polypeptide peptase IV (DPP-IV) degraded, has limited its clinical application greatly.In order to prolong biological half-life in its body,, must develop long-acting GLP-1 analogue or class jljl with antienzyme degraded so that it better is applied to as medicine is clinical.
Hyperglycemic-glycogenolytic factor is the 29 amino acid whose polypeptide that produced by pancreas A-cell, and it is opposite with insulin action, can increase blood sugar, suppresses the production of Regular Insulin.Studies show that in the type ii diabetes people, the blood hyperglycemic-glycogenolytic factor is obviously higher, use obviously lowering blood glucose (Shah P, J Clin EndocrinolMetab.2000 Nov of hyperglycemic-glycogenolytic factor antagonist or anti-hyperglycemic-glycogenolytic factor antibody; 85 (11): 4053-9; And Johnson DG, Science.1982Feb 26; 215 (4536): 1115-6).Therefore, development hyperglycemic-glycogenolytic factor antagonist has certain prospect (Djuric SW, Curr Opin InvestigDrugs.2002 Nov as the new drug of treatment II paradiabetes; 3 (11): 1617-23).
Summary of the invention
The invention provides a kind of GLP-1 fusion rotein, is any polypeptide receptor and human normal immunoglobulin Fc part, the segmental fusion rotein of immunoglobulin Fc part in GLP-1 and human glucagon receptor or the hyperglycemic-glycogenolytic factor family.The C-terminal of GLP-1 can be directly or the N-terminal by peptide linker and immunoglobulin Fc part or Porcine glucagon family receptors merge.
The invention discloses the preparation method of GLP-1 fusion rotein.
The present invention also provides GLP-1 and hyperglycemic-glycogenolytic factor family receptors or immunoglobulin Fc meromixis joint together, and this joint is made up of several amino acid that can freely stretch, and can make the albumen that is merged folding better.
GLP-1 fusion rotein of the present invention comprises two polypeptide, and wherein, first polypeptide is the GLP-1 compound, and second is the hyperglycemic-glycogenolytic factor family receptors, and the hyperglycemic-glycogenolytic factor family receptors is selected from:
(1) whole glucagon receptor sequence;
(2) glucagon receptor functional zone-1 mainly add that by the glucagon receptor first film outer ring film district of striding at its two ends forms;
(3) functional zone-1 of any polypeptide receptor in the hyperglycemic-glycogenolytic factor family, mainly the first film outer ring by acceptor adds that the film district of striding at its two ends forms;
(4) functional zone-2 of any polypeptide receptor in the hyperglycemic-glycogenolytic factor family, mainly the 2nd film outer ring by acceptor adds that the film district of striding at its two ends forms;
(5) functional zone-3 of any polypeptide receptor in the hyperglycemic-glycogenolytic factor family, mainly the 3rd film outer ring by acceptor adds that the film district of striding at its two ends forms;
(6) GLP-1, GLP-2 or glucose rely on the acceptor that Regular Insulin nutrition polypeptide etc. belongs to the hyperglycemic-glycogenolytic factor family polypeptides.
Wherein the C of first polypeptide end merges with the N end of second polypeptide or is connected by peptide linker.
Peptide linker preferably from:
(1) peptide that has (Gly-Thr-Gly) n, wherein n is 1,2,3,4,5,6;
(2) peptide that has (Gly-Ala-Pro) n, wherein n is 1,2,3,4,5,6;
(3) peptide that has (Gly-Pro-Gly) n, wherein n is 1,2,3,4,5,6;
(4) peptide that has (Gly-Gly-Gly-Gly-Ser) n.Wherein n is 1,2,3,4,5,6.
Fusion rotein of the present invention can also be the fusion of GLP-1 compound and human normal immunoglobulin Fc section, and wherein, human normal immunoglobulin Fc section is selected from:
(1) the Fc part of human normal immunoglobulin;
(2) analogue of the Fc of human normal immunoglobulin part;
(3) fragment of the Fc of human normal immunoglobulin part.
The fusion of above-mentioned two polypeptide can merge with the N end of second polypeptide for the C end of first polypeptide or be connected by peptide linker.Peptide linker preferably from:
(1) peptide that has (Gly-Thr-Gly) n, wherein n is 1,2,3,4,5,6;
(2) peptide that has (Gly-Ala-Pro) n, wherein n is 1,2,3,4,5,6;
(3) peptide that has (Gly-Pro-Gly) n, wherein n is 1,2,3,4,5,6;
(4) peptide of n Gly-Gly-Gly-Gly-Ser).Wherein n is 1,2,3,4,5,6.
Fusion rotein of the present invention also can be that three polypeptide merge, wherein, first polypeptide is the GLP-1 compound, the Fc section that second polypeptide is human normal immunoglobulin or the fragment of Fc section, and the 3rd polypeptide is the acceptor of any polypeptide in human glucagon receptor or the hyperglycemic-glycogenolytic factor family.
Wherein three polypeptide directly link to each other or connect by intermediate head, intermediate head preferably from:
(1) peptide that has (Gly-Thr-Gly) n, wherein n is 1,2,3,4,5,6;
(2) peptide that has (Gly-Ala-Pro) n, wherein n is 1,2,3,4,5,6;
(3) peptide that has (Gly-Pro-Gly) n, wherein n is 1,2,3,4,5,6;
(4) peptide that has (Gly-Gly-Gly-Gly-Ser) n.Wherein n is 1,2,3,4,5,6.
As the GLP-1 of a fusion rotein part general preferred have be no more than 6 and be different from GLP-1 (7-37) OH, the corresponding amino acid whose amino acid among GLP-1 (7-36) OH or the Exendin-4.GLP-1 compound even more preferably have and be no more than 5 and be different from GLP-1 (7-37) OH, the corresponding amino acid whose amino acid among GLP-1 (7-36) OH or the Exendin-4.The GLP-1 compound most preferably has and is no more than 4,3 or 2 and is different from GLP-1 (7-37) OH, the corresponding amino acid whose amino acid among GLP-1 (7-36) OH or the Exendin-4.
GLP-1 fusion rotein of the present invention can obtain by following preparation method: gene recombination technology or solid phase protein synthesis technology.
The concrete technical solution of recombination method production fusion rotein of the present invention is as follows:
One, makes up the recombinant vectors of code book invention fusion rotein
(1) angling of GLP-1 got
According to disclosed GLP-1 sequences Design PCR primer, with the cDNA of expressing human GLP-1, as pancreas, small intestine, cerebral tissue cDNA are template, obtain the GLP-1cDNA sequence through pcr amplification.
(2) glucagon receptor and angling of other acceptor of family thereof are got
The glucagon receptor part can human liver tissue cDNA be a template in the fusion rotein, uses the primer of corresponding acceptor, obtains through pcr amplification, is cloned into TOPO TA carrier (Invitrogen) then, and the carrier of reorganization is cut and the sequential analysis evaluation through Eco RI enzyme.The plasmid that is obtained is called TOPO TA-glucagon receptor at this.
Glucagon receptor N-terminal membrane ectodomain; Functional zone-1; Functional zone-2; Functional zone-3 fragment can above-mentioned TOPO TA-glucagon receptor be a template, with corresponding primer, obtains through pcr amplification.
Other acceptor of hyperglycemic-glycogenolytic factor family can angle with the method identical with glucagon receptor and get.
Have no progeny having obtained the said gene sheet, available ligase enzyme connects corresponding gene, and also available overlapping PCR method merges it, is cloned into expression vector then.
(3) angling of human IgG1 Fc section got
Being template with people's tissue cDNA of expressing IgG angles the CH2 that gets coding human IgG1 hypotype and the cDNA sequence of CH3 functional zone through pcr amplification, it is cloned into pV05 carrier (Fig. 6), the plasmid called after pV05-human IgG1 Fc that is obtained.
(4) structure of recombinant expression vector
Make up the gene of encoding fusion protein by the DNA of the DNA of connection coding GLP-1 in the frame and encode immunoglobulin Fc part or hyperglycemic-glycogenolytic factor and analogue acceptor thereof.Also can be by the gene of connection coding GLP-1 gene in the gene frame of coding joint peptide with coding immunoglobulin Fc part or hyperglycemic-glycogenolytic factor and analogue acceptor thereof.
Encoding wild type GLP-1, hyperglycemic-glycogenolytic factor and analogue acceptor thereof, Fc polypeptide and segmental DNA can be before being connected or suddenling change in the scope of the cDNA of the whole fusion rotein of coding.Multiple induced-mutation technique is well known in the art.For example, utilize the overlapping extension of chain to be used for changing the mutagenesis PCR method of particular bases sudden change of the specific amino acids sequence of corresponding protein with preparation.
When with the mammalian cell expression fusion rotein, signal peptide must be arranged, so that the fusion rotein of expressing can be secreted into endochylema, signal peptide is excised automatically.The signal peptide of hyperglycemic-glycogenolytic factor also can use other signal peptide before the present invention used, as: the signal peptide of preceding parathryoid hormone (Wiren, KM etc.The J of Bio.Chem.263 (36): 19771-19777 (1988), or the signal peptide of human IgG1 Fc.
When with the bacterial expression fusion rotein, can adopt bacterium expressing fusion protein method, add proteolytic enzyme point of contact and HA or 6HIS label at the N end and be used for adsorption and purification, the fusion rotein of expression obtains containing the fusion rotein in correct excision site after the proteolytic enzyme enzyme is cut.Also can use up-to-date IMPACT bacterial expression system (New England, BioLabs Inc.).This IMPACT albumen merges and purification system is to utilize self lytic activity of derivable engineered protein shearing elements to carry out protein purification and processing.Come purifying protein by pH and temperature-induced cracking: use the pTWIN carrier, this intein label is to merge at the N-of target protein end.Be released by pH and thermoinducible cracking after this target protein.
In case produced the gene of the complete fusion rotein of encoding, it can be cloned into suitable expression.
Two, express the general method of fusion rotein of the present invention
With expression vector transfection described herein or transformed host cell, be used to produce fusion rotein, this host cell can be eucaryon or prokaryotic organism host cell.Technology with recombinant DNA carrier conversion or transfectional cell is a technology well known in the art.
Three, reclaim the also protein of purification of Recombinant generation
Can be by coming the fusion rotein of purifying expression with corresponding column chromatography at the sequence label of N-end or the adding of C-end or the characteristic of fusion rotein.
Four, the activity of fusion rotein detects
(1) fusion rotein is external in conjunction with determination of activity
With
125The commercial GLP-1 (7-36) of I mark combines the GLP-1 acceptor with fusion rotein competition of the present invention, and the result shows that fusion rotein of the present invention is active in commercial people GLP-1 (7-36) with combining of GLP-1 acceptor.
(2) fusion rotein is in external influence to the cAMP level
The recombinant vectors transfection that will contain the GLP-1 receptor cdna is measured cAMP (Wei and Mojsov by the described method of document to Chinese hamster ovary celI after 48 hours, 1996), the result shows that fusion rotein of the present invention is basic identical at external influence and commercial people GLP-1 (7-36) to the cAMP level.
(3) pharmacokinetics of fusion rotein detects
Give injection fusion rotein (50nM) in the C57BL/6 mouse vein, respectively at injection back 0min, 1hr, 6hr, 12hr, 24hr, 36hr, 48hr takes a blood sample in the tail vein behind 60hr and the 72hr.4 ℃ of centrifugal separation plasmas detect the fusion rotein level with the ELISA method.The result shows that the biological half-life of fusion rotein of the present invention, more simple GLP-1 obviously prolonged.
(4) fusion rotein is to the influence of the anti-sugared ability of mouse
Give fusion rotein (the 4 μ g/kg of mouse (C57BL/6) the subcutaneous injection various dose that spend the night (16-18h) go on a hunger strike, 16 μ g/kg, 80 μ g/kg and 1mg/kg) or physiological saline, behind injection 30min and the 24h, press 1.5mg/g body weight abdominal injection glucose, and respectively at injection back 0,10,20,30,60,90 and 120min after take blood sample from the tail point.Detect glucose level in the blood with the glucose table by the glucolase method.The result shows and to give that the anti-sugared ability of mouse obviously improves behind the fusion rotein of the present invention, give 0.07nmol/kg fusion rotein of the present invention and promptly have the obvious functions of blood sugar effect, and the concentration of its function of polysaccharide and fusion rotein is proportionate, when fusion rotein was increased to 18nmol/kg, it is more obvious that its function of blood sugar reduction becomes.
To sum up, the interior biologic activity detected result of external and body shows that the fusion rotein that the present invention prepares not only has the normal biologic activity of GLP-1, and its biological half-life, more independent GLP-1 polypeptide obviously prolonged.
Fusion rotein pharmaceutical composition and purposes
Fusion rotein of the present invention can be used for treating katabolism change after Regular Insulin non-insulin dependent diabetes, insulin-dependent diabetes mellitus, palsy, myocardial infarction, obesity, the operation, functional dyspepsia and irritable bowel syndrome.Also comprise the patient that need utilize the GLP-1 compound to carry out preventative processing, as have the patient that Regular Insulin non-insulin dependent diabetes danger takes place: unusual or unusual experimenter, the body weight of fasting glucose of glucose tolerance exceeds experimenter with respect to the normal type 25% of patient's height and physique, carried out the experimenter of part pancreas resection operation, suffers from the experimenter of gestational diabetes and suffer from urgency or the experimenter of chronic pancreatitis.Fusion rotein of the present invention had both kept the biologic activity of GLP-1, had prolonged GLP-1 biological half-life in vivo again simultaneously, and therefore fusion rotein of the present invention can be used for above treatment of diseases.
The present invention also provides a kind of pharmaceutical composition, and it comprises above-mentioned fusion rotein or the pharmaceutically acceptable carrier or the thinner of significant quantity.
Activeconstituents dosage in the present composition can be different, but the amount of activeconstituents must can obtain suitable formulation.Selected dosage changes according to required result of treatment, route of administration and treatment cycle.In general, the significant quantity of activeconstituents of the present invention is 1 * 10
-7-200mg/kg/ days, 1 * 10
-4-100mg/kg/ days, can single dose administration or be divided into multiple dose administration.
Fusion rotein of the present invention can oral administration, parenteral (as muscle, intraperitoneal, intravenously, subcutaneous injection or implantation), nasal cavity, vagina, rectum, the hypogloeeis or partial route of administration are carried out administration, and can be prepared the formulation that is suitable for each route of administration to provide with pharmaceutically acceptable carrier.
Oral solid dosage comprises capsule, tablet, pill, pulvis and granule.In these solid dosages, active compound is mixed with at least a pharmaceutically acceptable inert support, this carrier is sucrose, lactose or starch for example.These formulations can normally be used other material that also can comprise except that inert diluent, and lubricant for example is as Magnesium Stearate.In capsule, tablet and pill, these formulations also can comprise buffer reagent.Tablet and pill can prepare with casing in addition.
That oral liquid dosage form comprises is pharmaceutically acceptable, contain the normally used inert diluent in this area, as emulsion, solution, suspension, the syrup of water.Except these inert diluents, composition also can comprise auxiliary, for example wetting agent, emulsifying agent, suspension agent, sweeting agent, seasonings and flavouring agent.
The preparation that the present invention is used for parenterai administration comprises aseptic aqueous solution or non-aqueous solution, suspension or emulsion.Non-aqueous solvent or vehicle, for example propylene glycol, polyoxyethylene glycol, vegetables oil (as sweet oil and Semen Maydis oil), gelatin, injectable organic ester (as ethyl oleate).These formulations also can comprise the auxiliary such as sanitas, wetting agent, emulsifying agent and dispersion agent.Can sterilize by the following method, for example retain strainer and filter, in composition, add disinfectant, irradiation composition or heating combination through bacterium.Also they can be made the form of aseptic solid composite, immediately it is dissolved in sterilized water or other the injectable sterile media before the use.
The preferred suppository of the composition of rectum or vagina administration, except active substance, it can comprise vehicle, for example theobroma oil or suppository wax.
Also available standard excipients well known in the art prepares the composition of nasal cavity or sublingual administration.In addition, the present composition can be with the form administration of sustained-release composition.
Positively effect of the present invention is: GLP-1 can keep its natural function in the fusion rotein, hyperglycemic-glycogenolytic factor family receptors part and human IgG Fc fragment part then can prolong the GLP-1 transformation period, and the hyperglycemic-glycogenolytic factor family receptors have in and the effect of hyperglycemic-glycogenolytic factor, can play dual hypoglycemic effect; Human IgG Fc fragment part then helps the purifying of fusion rotein.
Partly to prolong the reason of GLP-1 transformation period as follows for the hyperglycemic-glycogenolytic factor family receptors among the present invention:
The the 1st and the 3rd film outer ring of glucagon receptor can combine with the N-end of hyperglycemic-glycogenolytic factor.The N-end of GLP-1 and hyperglycemic-glycogenolytic factor are much at one; therefore GLP-1 can with faint combination of glucagon receptor (or acceptor of other polypeptide of hyperglycemic-glycogenolytic factor family); this faint combination can protect GLP-1 to exempt from the degraded of DPPIV to a certain extent, so can prolong the transformation period of GLP-1.Equally; when with GLP-1 and GLP-1 acceptor or when partly functional zone merge; GLP-1 will with the partly faint combination of the acceptor that is attached thereto; with protection GLP-1; when fusion rotein meets natural receptor; its bonding force is stronger than the acceptor portion of fusion rotein, so GLP-1 tends to combine with natural receptor in the fusion rotein, brings into play its biological effect.
Except as otherwise noted, the implication of all technology used herein and scientific terminology and those skilled in the art's common sense is identical.
Description of drawings
Fig. 1 has shown fusion rotein PPS 601 immunoblotting results
Fig. 2 a has shown the GLP-1 receptor sequence
Fig. 2 b shows the result that combines of fusion rotein PPS601 and people GLP-1 (7-37) acceptor
Fig. 3 has shown the influence of 601 pairs of cAMP levels of fusion rotein PPS
Fig. 4 has shown the interior pharmacokinetics result of the body of fusion rotein PPS 601
Fig. 5 has shown the influence of 601 pairs of anti-sugared abilities of mouse of fusion rotein PPS
Fig. 6 has shown pV05 carrier figure
Fig. 7 has shown PPS 601 recombinant vectors figure
Embodiment:
The following example is in order to help to describe how to implement various embodiments of the present invention.These embodiment illustrate for example, rather than limit scope of the present invention by any way.
The structure of fusion rotein carrier
The cDNA that GLP-1 part can any expressing human GLP-1 in the fusion rotein, as pancreas, small intestine, cerebral tissue cDNA are template, obtain through pcr amplification.Mouse has identical GLP-1 aminoacid sequence with the people, so can replace people cDNA.
Can comprise the DNA of the method preparation coding GLP-1 of the present invention of above-mentioned cloning process and chemical synthesising DNA by various method.
The glucagon receptor part can human liver tissue cDNA be a template in the fusion rotein, and primer is 5 '-ATGCCCCCCTGCCAGCCACAG-3 ' and 5 '-TCAGAAGGGGCTCTCAGCCAATC-3 ', obtains through pcr amplification.The glucagon receptor that is increased is 1431bp, and it is cloned into TOPO TA carrier (Invitrogen), and the carrier of reorganization is cut and the sequential analysis evaluation through the EcoRI enzyme.The plasmid that is obtained is called TOPO TA-glucagon receptor at this.
Glucagon receptor N-terminal membrane ectodomain; Functional zone-1; Functional zone-2; Functional zone-3 fragment can above-mentioned TOPO TA-glucagon receptor be a template, with corresponding primer, obtains through pcr amplification.Have no progeny having obtained the said gene sheet, can corresponding gene be connected the preparation fusion rotein through ligase, also available overlapping PCR method merges it.Be cloned into expression vector then.
The GLP-1 acceptor can human liver tissue cDNA be a template in the fusion rotein, uses primer 5 '-ATGGCCGGCGCCCCCGGC-3 ' and 5 '-TCAGCTGTAGGAGGCCTGGC-3 ', obtains through pcr amplification.The GLP-1 acceptor that is increased is 1392bp, and it is cloned into TOPO TA carrier (Invitrogen), and the carrier of reorganization is cut and the sequential analysis evaluation through the EcoRI enzyme.The plasmid that is obtained is called TOPO TA-GLP-1 acceptor at this.
GLP-1 acceptor N-terminal membrane ectodomain; Functional zone-1; Functional zone-2; Functional zone-3 fragment can above-mentioned TOPO TA-GLP-1 acceptor be a template, with corresponding primer, obtains through pcr amplification.Have no progeny having obtained the said gene sheet, can corresponding gene be connected the preparation fusion rotein through ligase, also available overlapping PCR method merges it.Be cloned into expression vector then.
The GLP-2 acceptor can human liver tissue cDNA be a template in the fusion rotein, uses primer 5 '-ATGAAGCTGGGATCGAGCAG-3 ' and 5 '-CTAGATCTCACTCTCTTCCAG-3 ', obtains through pcr amplification.The GLP-2 acceptor that is increased is 1162bp, and it is cloned into TOPO TA carrier (Invitrogen), and the carrier of reorganization is cut and the sequential analysis evaluation through the EcoRI enzyme.The plasmid that is obtained is called TOPO TA-GLP-2 acceptor at this.
GLP-2 acceptor N-terminal membrane ectodomain; Functional zone-1; Functional zone-2; Functional zone-3 fragment can above-mentioned TOPO TA-GLP-2 acceptor be a template, with corresponding primer, obtains through pcr amplification.Have no progeny having obtained the said gene sheet, can corresponding gene be connected the preparation fusion rotein through ligase, also available overlapping PCR method merges it.Be cloned into expression vector then.
The Fc section of immunoglobulin G while 1 can use and anyly have people's tissue cDNA of expression to obtain through pcr amplification in the fusion rotein.(GIBCO angles in BRL) and gets people the encode CH2 of IgG1 hypotype and the cDNA sequence of CH3 functional zone from the human cDNA library.The primer is:
5 '-AAAAGGCCCGGGCGACAAAACTCACACATGC-3 ' (containing the SrfI restriction enzyme site)
With 5 '-ATTTCGCCGGCGTTATTTACCCGGAGACAGGG-3 ' (containing the NotI restriction enzyme site)
This is to primer be used to the to increase 214-467bp zone of IgG1 heavy chain coding region, and it comprises hinge area, CH2 and CH3 functional zone (Strausberg, R.L.etc.Proc.Natl.Acad.Sci.U.S.A.99 (26), 16899-16903 (2002)).The Fc of the immunoglobulin G while 1 that obtains is 759bp, contain intermediate head GGCCCGGGC (SrfI restriction enzyme site) at its 5 '-end, contain TAA terminator codon and NotI restriction enzyme site at its 3 '-end, it is cloned into pV05 carrier (Fig. 6), the plasmid called after pV05-people immune protein G1Fc that is obtained.
When with the mammalian cell expression fusion rotein, signal peptide must be arranged, so that the fusion rotein of expressing can be secreted into endochylema, signal peptide is excised automatically.The signal peptide of hyperglycemic-glycogenolytic factor also can use other signal peptide before the present invention used, as: the signal peptide of preceding parathryoid hormone (Wiren, KM etc.The J of Bio.Chem.263 (36): 19771-19777 (1988), or the signal peptide of human IgG1 Fc.
When with the bacterial expression fusion rotein, can adopt bacterium expressing fusion protein method, add proteolytic enzyme point of contact and HA or 6HIS TAG at the N end and be used for adsorption and purification, the fusion rotein of expression obtains containing the fusion rotein in correct excision site after the proteolytic enzyme enzyme is cut.Also can use up-to-date IMPACT bacterial expression system (New England, BioLabs Inc.).This IMPACT albumen merges and purification system is to utilize self lytic activity of derivable engineered protein shearing elements to carry out protein purification and processing.Come purifying protein by pH and temperature-induced cracking: use the pTWIN carrier, this intein label is to merge at the N-of target protein end.Be released by pH and thermoinducible cracking after this target protein.
Embodiment 1a
The structure of fusion rotein (the 2nd G replaces A) GLP-1-intermediate head-glucagon receptor N-terminal membrane ectodomain-people's immune protein G1Fc recombinant vectors:
With the mouse brain tissue cDNA is template, uses following primer:
(a)5’-CCCAAGCTT?ATGAAGACCATTTACTTTGT-3’
(b)5’-GGTCCCTTCAGCATGCTGCCAGCTGCCTTGCAC-3’
(c)5’-CATGCTGAAGGGACCTTTAC-3’
(d)5’-AAAAGGCGCGCCTTCCTCGGCCTTTCACCAGCC-3’
Pcr amplification can obtain Proglucagon signal peptide and GLP-1 encoding sequence respectively.3 ' end of institute's picked up signal peptide inserts 15bp GLP-15 ' terminal sequence through primer, with primer (a), (d) through overlapping PCR signal peptide and GLP-1 is merged again.At primer (b) and (c) Ala is become Gly (GAA becomes GCT), ' and 3 ' end inserts HindIII respectively and the AscI restriction enzyme site is used for the clone for the fragment 5 that is obtained.
With TOPO TA-glucagon receptor is template, uses following primer:
(e)5’-AAGGCGCGCCTGCTCAGGTGATGGACTTC-3’
(f)5’-AAAAGCCCGGGCCCTGGAAGCTGCTGTACATC-3’
Obtain glucagon receptor N-terminal membrane ectodomain through pcr amplification, its 5 '-end contains GGCGCGCCT (AscI restriction enzyme site), and 3 '-end contains GCCCGGGCC (SrfI restriction enzyme site).
After obtaining above-mentioned two fragments, it can be cloned among the Fc of the carrier pV05-people immune protein G1 that HindIII and SrfI enzyme cut, be transformed into HB10D competent cell (invitrogen) then.Recombinant plasmid is through HindIII and the NotI enzyme is cut and sequential analysis is identified entirely true.
The fusion rotein sequence of expressing is [serial ID NO:35]:
HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-GAP-AQVMDFLFEKWKLYGDQCHHNL
SLLPPPTELV
CNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPW
RDASQCQMDGEEI?EVQKEVAKMYSSFQ-GPG-DKTHTCPPCPAPELLGGPSVFLFPPK
PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS
VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ
VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG
NVFSCSVMHEALHNHYTQKSLSLSPGK
Embodiment 1b
The structure of the recombinant vectors of fusion rotein (the 2nd G replaces A) GLP-1-intermediate head-glucagon receptor functional zone-1-intermediate head-people's immune protein G1Fc
Signal peptide-(the 2nd G replaces A) pulsating preparation of GLP-1 is identical with method 1a.
Glucagon receptor functional zone-1 can use following primer to obtain through pcr amplification:
Amplification glucagon receptor functional zone-1 primer is:
5 '-CCGGCGCGCCTGTCATTGATGGGCTGCTCAG-3 ' (containing Asc I restriction enzyme site) and 5 '-AAAAGCCCGGGCCAGCCACCGCTCCATCACT-3 ' (containing Srf I restriction enzyme site).
The fragment that above-mentioned PCR is obtained is cut rear clone with HindIII and SrfI enzyme and is gone among the Fc of the carrier pV05-immunoglobulin G while 1 that HindIII and SrfI enzyme cut.The insertion sequence of recombinant plasmid identifies that through nucleotide sequencing its sequence is entirely true.
Embodiment 1c
The structure of the recombinant vectors of fusion rotein (the 2nd G replaces A) GLP-1-intermediate head-glucagon receptor functional zone-3-intermediate head-people's immune protein G1Fc
Signal peptide-(the 2nd G replaces A) pulsating preparation of GLP-1 is identical with method 1a.
Glucagon receptor functional zone-3 can use following primer to obtain through pcr amplification:
Amplification glucagon receptor functional zone-3 primer is:
5 '-CCGGCGCGCCTGACGAGCACGCCCAGGGC-3 ' (containing Asc I restriction enzyme site)
5 '-AAAAGCCCGGGCCGAGGTCGAAGAAGAGCTT-3 ' (containing Srf I restriction enzyme site)
The fragment that above-mentioned PCR is obtained is cut rear clone with HindIII and SrfI enzyme and is gone among the Fc of the carrier pV05-immunoglobulin G while 1 that HindIII and SrfI enzyme cut.The insertion sequence of recombinant plasmid identifies that through nucleotide sequencing its sequence is entirely true.
Embodiment 1d
The structure of the recombinant vectors of fusion rotein (the 2nd G replaces A) GLP-1-intermediate head-glucagon receptor functional zone-1-intermediate head-glucagon receptor functional zone-3-intermediate head-people's immune protein G1Fc:
Signal peptide-(the 2nd G replaces A) pulsating preparation of GLP-1 is identical with method 1a.
Glucagon receptor functional zone-1 and functional zone-3 can use following primer to obtain respectively through pcr amplification:
Amplification glucagon receptor functional zone-1 primer is:
5 '-CCGGCGCGCCTGTC ATT GAT GGG CTG CTC AG-3 ' (containing Asc I restriction enzyme site) and 5 ' ACTTCCACCTCCGCCAGCCACCGCTCCATCACT-3 ' (containing the ACTTCCACCTCCGCC intermediate head).
Amplification glucagon receptor functional zone-3 primer is:
5 '-GGCGGAGGTGGAAGTGACGAGCACGCCCAGGGC-3 ' and 5 '-AAAAGCCCGGGCCGAGGTCGAAGAAGAGCTT-3 ' (containing Srf I restriction enzyme site)
Two fragments that above-mentioned PCR is obtained merge through overlapping PCR, cut rear clone with HindIII and SrfI enzyme and go among the Fc of the carrier pV05-immunoglobulin G while 1 that HindIII and SrfI enzyme cut, the insertion sequence of recombinant plasmid identifies that through nucleotide sequencing its sequence is entirely true.
The fusion rotein sequence of expressing is [serial ID NO:36]:
HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-
GAP-VIDGLLRTRYSQKIGDDLSVSTWLSDGAVAG
-GGGS-DEHAQGTLRSAKLFFDL-GPG-DKTHTCPPCPAPELLGGPSVFLFPPKPK
DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT
LPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG
SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Embodiment 1e
The structure of fusion rotein (the 2nd G replaces A) GLP-1-intermediate head-people's immune protein G1Fc:
Signal peptide-(G8 replaces A) pulsating preparation of GLP-1 is identical with embodiment 1a.Just replace AscI with SrfI in the primer (d).After the acquisition it is cloned among the Fc of the carrier pV05-people immune protein G1 that HindIII and SrfI enzyme cut.The insertion sequence of recombinant plasmid identifies that through nucleotide sequencing its sequence is entirely true.
The fusion rotein sequence of expressing is [serial ID NO:37]:
HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-GAP-DKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ
PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Embodiment 1f
The structure of fusion rotein (the 2nd G replaces A) GLP-1-intermediate head-GLP-1 acceptor-immunoglobulin G while 1Fc recombinant vectors
With the mouse brain tissue cDNA is template, uses following primer:
(a)5’-CCCAAGCTT?ATGAAGACCATTTACTTTGT-3’
(b)5’-GGTCCCTTCAGCATGCTGCCAGCTGCCTTGCAC-3’
(c)5’-CATGCTGAAGGGACCTTTAC-3’
(d)5’-AAAAGGCGCGCCTTCCTCGGCCTTTCACCAGCC-3’
Pcr amplification can obtain Proglucagon signal peptide and GLP-1 encoding sequence respectively.3 ' end of institute's picked up signal peptide inserts 15bp GLP-15 ' terminal sequence through primer, with primer (a), (d) through overlapping PCR signal peptide and GLP-1 is merged again.At primer (b) and (c) Ala is become Gly (GAA becomes GCT), ' and 3 ' end inserts HindIII respectively and the AscI restriction enzyme site is used for the clone for the fragment 5 that is obtained.
With TOPO TA-GLP-1 acceptor is template, uses following primer:
(e)5’-AAGGCGCGCCTCGCCCCCAGGGTGCCAC-3’
(f)5’-AAAAGCCCGGGCCGCTGCAGGAGGCCTG-3’
Obtain the GLP-1 acceptor through pcr amplification, its 5 '-end contains GGCGCGCCT (Asc I restriction enzyme site), and 3 '-end contains GCCCGGGCC (SrfI restriction enzyme site).
After obtaining above-mentioned two fragments, it can be cloned among the Fc of the carrier pV05-people immune protein G1 that HindIII and SrfI enzyme cut, be transformed into HB10D competent cell (invitrogen) then.Recombinant plasmid is through HindIII and the NotI enzyme is cut and sequential analysis identifies that its sequence is entirely true.
Embodiment 1g
The structure of fusion rotein (the 2nd G replaces A) GLP-1-intermediate head-GLP-1 acceptor N-terminal membrane ectodomain-immunoglobulin G while 1Fc recombinant vectors
With the mouse brain tissue cDNA is template, uses following primer:
(a)5’-CCCAAGCTT?ATGAAGACCATTTACTTTGT-3’
(b)5’-GGTCCCTTCAGCATGCTGCCAGCTGCCTTGCAC-3’
(c)5’-CATGCTGAAGGGACCTTTAC-3’
(d)5’-AAAAGGCGCGCCTTCCTCGGCCTTTCACCAGCC-3’
Pcr amplification can obtain Proglucagon signal peptide and GLP-1 encoding sequence respectively.3 ' end of institute's picked up signal peptide inserts 15bp GLP-15 ' terminal sequence through primer, with primer (a), (d) through overlapping PCR signal peptide and GLP-1 is merged again.At primer (b) and (c) Ala is become Gly (GAA becomes GCT), ' and 3 ' end inserts HindIII respectively and the AscI restriction enzyme site is used for the clone for the fragment 5 that is obtained.
With TOPO TA-GLP-1 acceptor is template, uses following primer:
(e)5’-AAGGCGCGCCTCGCCCCCAGGGTGCCAC-3’
(f)5’-AAAAGCCCGGGCCGTAGAGGAACAGGAGCTG-3’
Obtain GLP-1 acceptor N-terminal membrane ectodomain through pcr amplification, its 5 '-end contains GGCGCGCCT (AscI restriction enzyme site), and 3 '-end contains GCCCGGGCC (SrfI restriction enzyme site).After obtaining above-mentioned two fragments, it can be cloned among the Fc of the carrier pV05-people immune protein G1 that HindIII and SrfI enzyme cut, be transformed into HB10D competent cell (invitrogen) then.Recombinant plasmid is through HindIII and the NotI enzyme is cut and sequential analysis identifies that its sequence is entirely true.
Embodiment 1h
The structure of the recombinant vectors of fusion rotein (the 2nd G replaces A) GLP-1-intermediate head-GLP-1 receptor functional domain-1-intermediate head-immunoglobulin G while 1Fc
Signal peptide-(the 2nd G replaces A) pulsating preparation of GLP-1 is identical with method 1a.
GLP-1 receptor functional domain-1 can use following primer to obtain through pcr amplification:
Amplification GLP-1 receptor functional domain-1 primer is:
5 '-CCGGCGCGCCTAACTACATCCACCTGAAC-3 ' (containing Asc I restriction enzyme site) and 5 '-AAAAGCCCGGGCCCAGGTACACGCCCTCCAC-3 ' (containing Srf I restriction enzyme site).
The fragment that above-mentioned PCR is obtained is cut rear clone with HindIII and SrfI enzyme and is gone among the Fc of the carrier pV05-immunoglobulin G while 1 that HindIII and SrfI enzyme cut, and the insertion sequence of recombinant plasmid identifies that through nucleotide sequencing its sequence is entirely true.
Embodiment 1i
The structure of the recombinant vectors of fusion rotein (the 2nd G replaces A) GLP-1-intermediate head-GLP-1 receptor functional domain-2-intermediate head immunoglobulin G while 1Fc
Signal peptide-(the 2nd G replaces A) pulsating preparation of GLP-1 is identical with method 1a.GLP-1 receptor functional domain-2 can use following primer to obtain through pcr amplification:
Amplification GLP-1 receptor functional domain-2 primer is:
5 '-CCGGCGCGCCTTTCAGGCTCTACGTGAGC-3 ' (containing Asc I restriction enzyme site) and 5 '-AAAAGCCCGGGCCGCAGATGACCCGAACAAAG-3 ' (containing Srf I restriction enzyme site).
The fragment that above-mentioned PCR is obtained is cut rear clone through HindIII and SrfI enzyme and is gone among the Fc of the carrier pV05-immunoglobulin G while 1 that HindIII and SrfI enzyme cut.The insertion sequence of recombinant plasmid identifies that through nucleotide sequencing its sequence is entirely true.
Embodiment 1j
The structure of the recombinant vectors of fusion rotein (the 2nd G replaces A) GLP-1-intermediate head-GLP-1 receptor functional domain-3-intermediate head-immunoglobulin G while 1Fc
Signal peptide-(the 2nd G replaces A) pulsating preparation of GLP-1 is identical with method 1a.
GLP-1 receptor functional domain-3 can use following primer to obtain through pcr amplification:
Amplification GLP-1 receptor functional domain-3 primer is:
5 '-CCGGCGCGCCTTCCACGCTGACACTCATC-3 ' (containing Asc I restriction enzyme site) and 5 '-AAAAGCCCGGGCCCTCATTGTTGACAAAGC-3 ' (containing Srf I restriction enzyme site)
The fragment that above-mentioned PCR is obtained is cut rear clone with HindIII and SrfI enzyme and is gone among the Fc of the carrier pV05-immunoglobulin G while 1 that HindIII and SrfI enzyme cut.The insertion sequence of recombinant plasmid identifies that through nucleotide sequencing its sequence is entirely true.
Embodiment 1k
The structure of the recombinant vectors of fusion rotein (the 2nd G replaces A) GLP-1-intermediate head-GLP-1 receptor functional domain-1-intermediate head-GLP-1 receptor functional domain-3-intermediate head-immunoglobulin G while 1Fc
Signal peptide-(the 2nd G replaces A) pulsating preparation of GLP-1 is identical with method 1a.
GLP-1 receptor functional domain-1 and functional zone-3 can use following primer to obtain respectively through pcr amplification:
Amplification GLP-1 receptor functional domain-1 primer is:
5 '-CCGGCGCGCCTAACTACATCCACCTGAAC-3 ' (containing Asc I restriction enzyme site) and 5 ' ACTTCCACCTCCGCCCAGGTACACGCCCTCCAC-3 ' (containing the ACTTCCACCTCCGCC intermediate head).
Amplification GLP-1 receptor functional domain-3 primer is:
5 '-GGCGGAGGTGGAAGTTCCACGCTGACACTCATC-3 ' and 5 '-AAAAGCCCGGGCCCTCATTGTTGACAAAGC-3 ' (containing Srf I restriction enzyme site)
Two fragments that above-mentioned PCR is obtained merge through overlapping PCR, cut rear clone with HindIII and SrfI enzyme and go among the Fc of the carrier pV05-immunoglobulin G while 1 that HindIII and SrfI enzyme cut.The insertion sequence of recombinant plasmid identifies that through nucleotide sequencing its sequence is entirely true.
Embodiment 2
Expression of Fusion Protein
Expression of Fusion Protein in the constructed recombinant vectors can adopt transient transfection CHO method among the embodiment 1.Inoculation Chinese hamster ovary celI 10 in the 10cm culture dish
6Individual, cultivate and carry out transfection after 24 hours.With lipofectamine (Invitrogen), OptiMEM and plasmid mixed after; room temperature kept 30 minutes; join then in the washed Chinese hamster ovary celI of serum-free OptiMEM; after the co-cultivation 5 hours; add CHO-S-SFMII media (Gibco cat#31033-020)+1X glutaminate (Gibco cat#25030-081)+10mM Na butyrates (Sigma cat#B5887); cultivated 48 hours in the 37 degree incubators, collect the supernatant liquor that contains expressing protein.
Embodiment 3
The purifying of fusion rotein
The above-mentioned CHO supernatant liquor that contains expressing protein, after the 10K filtering membrane concentrates 10 times, use the Protein G post to remove to catch the fusion rotein that contains Fc, with 50mM citric acid (pH 3.3) wash-out, collect eluate (0.5ml), add among the 100 μ l 1M Tris pH 8.0 and acidity.After OD280nm measures protein content, merge all protein-contg collection tubes, dialyse 2 times in PBS (pH7.4) through the 10K dialysis membrane.
Embodiment 4
The immunoblotting of fusion rotein is identified
Purified material with PPS601 and serum sample under the no inductor inductive condition of PBS dilution that contains 1%SDS and 2mg tetrabromophenol sulfonphthalein.After boiling sex change, get 20 μ l samples and add on the SDS-PAGE glue, behind the electrophoresis, albumen is gone on the nitrocellulose filter.Film is sealed 2hr with 5% skim-milk room temperature, (Sigma USA), uses the luminous colour developing of ECL test kit (Amersham Pharmacia Biotech to the goat anti-human igg of adding HRP mark then, USA), result's fusion rotein of the present invention has as shown in Figure 1 obtained expressing preferably.
Fusion rotein external in conjunction with determination of activity
Use pcr amplification obtain the GLP-1 receptor cdna (Fig. 2 a), with it be cloned into pcDNA3.1 (Invitrogen, USA).The transfection of GLP-1 receptor cdna is at war with in conjunction with test (Wei and Mojsov, 1996) by method shown in the document after 48 hours to Chinese hamster ovary celI.With Chinese hamster ovary celI with
125I-GLP-1 (7-36) (USA) (USA) or under the GLP-1 fusion rotein situation about existing, hatched 15-18 hour for 4 ℃ at the little peptide of the hGLP-1 that increases concentration (pM-uM) gradually (7-37) for 2200Ci/mmol, New England Nuclear by anaSPEC.Be reflected at and contain 20mMHEPES, pH7.4 carries out in Hank ' the s balanced salt solution of 0.5%BSA and 0.1mM phenylmethylsulfonyl-fluoride (PMSF).After hatching cell is washed twice with ice-cold PBS, use the 1NNaOH cracking, detect radioactivity with the γ calculating instrument, result's fusion rotein of the present invention shown in Fig. 2 b is active in commercial people GLP-1 (7-36) with combining of GLP-1 acceptor.
Fusion rotein is in external influence to the cAMP level
The recombinant vectors transfection that will contain the GLP-1 receptor cdna is measured cAMP (Wei and Mojsov, 1996) by the described method of document to Chinese hamster ovary celI after 48 hours.Cell was cultivated 24 hours on 24 orifice plates by renewed vaccination, used damping fluid (Macy ' s 5A pH 7.4,20mM HEPES, 0.5%BSA, 0.5mM IBMX) to hatch then.This cell without any little peptide or contain the hGLP-1 of different concns or the condition of GLP-1 fusion rotein (pM is to μ M) under, cultivated 45 minutes for 37 ℃.Each the experiment in all with forskolin (10 μ M, Sigma, USA) positive contrast.Discard nutrient solution, cell is washed twice with PBS, ethanol cracking with 95%, centrifugal 3 minutes of 13000rpm, to dissolve with 0.05M acetate buffer solution (0.5ml) after the supernatant vacuum-drying, (Amersham USA) detects the cAMP level, and result's fusion rotein of the present invention as shown in Figure 3 is basic identical at external influence and commercial people GLP-1 (7-36) to the cAMP level with the cAMPBiotrak spa system.
Pharmacokinetics in the body of fusion rotein
Pharmacokinetics in the body of fusion rotein: give injection fusion rotein (50nM) in the C57BL/6 mouse vein, respectively at injection back 0min, 1hr, 6hr, 12hr, 24hr, 36hr, 48hr takes a blood sample in the tail vein behind 60hr and the 72hr.4 ℃ of centrifugal separation plasmas detect the PPS601 level with the ELISA method.Pharmacokinetics the results are shown in Figure 4 in the body of fusion rotein (the 2nd G replaces A) GLP-1-intermediate head-glucagon receptor functional zone-1-intermediate head-glucagon receptor functional zone-3-intermediate head-human IgG1 Fc (PPS 601), and the fusion rotein of the present invention transformation period in vivo, more independent GLP-1 obviously prolonged.
The ELISA method detects the concentration of fusion rotein in the mouse blood plasma
Identify the concentration of total fusion rotein in the mouse blood plasma with the ELISA method.With the antibody of the special affinity extraction of anti-human IgG gamma chain of PBS dilution (Sigma, USA) 100 μ l (2 μ g/ml) bag is by 96 hole enzyme plate (Nunc-Immunoplate Maxisorp; Nalge NuncInternational, Demark), 4 ℃ are spent the night.After washing 4 times, with 1%BSA-PBS 300 μ l room temperatures sealing 2hr.PPS601 standard substance and serum that adding is diluted with 0.5%BSA-PBS, room temperature effect 2hr.After washing four times, (JacksonImmunoResearch, USA), room temperature effect 1hr adds TMB to the goat anti-human igg of adding HRP mark then, room temperature effect 20 minutes.With measuring the 450-570nm value after the sulfuric acid stopped reaction.
Fusion rotein is to the influence of the anti-sugared ability of mouse
Give the mouse of fusion rotein anti-sugar experiment: the fusion rotein (4ug/kg that gives mouse (C57BL/6) the subcutaneous injection various dose that spend the night (16-18h) go on a hunger strike, 16ug/kg, 80ug/kg and 1mg/kg) or physiological saline, behind injection 30min and the 24h, press 1.5mg/g body weight abdominal injection glucose, and respectively at injection back 0,10,20,30,60,90 and 120min after take blood sample from the tail point.Detect glucose level in the blood with the glucose table by the glucolase method.The anti-sugared experimental result of mouse that gives fusion rotein PPS 601 is seen Fig. 5, give fusion rotein of the present invention after, the anti-sugared ability of mouse obviously strengthens.
Sequence table
<110〉Northeast Normal University
<120〉GLP-1 fusion rotein and preparation method thereof and medicinal use
<130>GLP-1
<160>37
<170>PatentIn?version?3.3
<210>1
<211>31
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(2)..(2)
<223〉the 2nd Xaa is Ala, Gly, Ser or Thr;
<220>
<221>misc_feature
<222>(3)..(3)
<223〉the 3rd Xaa is Glu, Asp, Gln or Asn;
<220>
<221>misc_feature
<222>(5)..(5)
<223〉the 5th Xaa is Thr, Arg or Ile;
<220>
<221>misc_feature
<222>(6)..(6)
<223〉the 6th Xaa is Phe, Tyr or Leu;
<220>
<221>misc_feature
<222>(8)..(8)
<223〉the 8th Xaa is Ser or Asn;
<220>
<221>misc_feature
<222>(9)..(9)
<223〉the 9th Xaa is Asp or Asn;
<220>
<221>misc_feature
<222>(10)..(10)
<223〉the 10th Xaa is Val, Ile, Met or Ala;
<220>
<221>misc_feature
<222>(11)..(11)
<223〉the 11st Xaa is Ser, Thr, Ala or Asp;
<220>
<221>misc_feature
<222>(12)..(12)
<223〉the 12nd Xaa is Ser, Gln, Glu, Asn or Thr;
<220>
<221>misc_feature
<222>(13)..(13)
<223〉the 13rd Xaa is Tyr, Phe, Gln, His or Leu;
<220>
<221>misc_feature
<222>(14)..(14)
<223〉the 14th Xaa is Leu, Thr or Ser;
<220>
<221>misc_feature
<222>(15)..(15)
<223〉the 15th Xaa is Glu, Gln, Asn, Asp, Arg or Lys;
<220>
<221>misc_feature
<222>(16)..(16)
<223〉the 16th Xaa is Gly, Glu, Asp, Gln, Asn, Arg or Lys;
<220>
<221>misc_feature
<222>(17)..(17)
<223〉the 17th Xaa is Gln, Lys, Leu or Phe;
<220>
<221>misc_feature
<222>(18)..(18)
<223〉the 18th Xaa is Ala or Lys;
<220>
<221>misc_feature
<222>(19)..(19)
<223〉the 19th Xaa is Ala, Thr, Ile or Ser;
<220>
<221>misc_feature
<222>(20)..(20)
<223〉the 20th Xaa is Lys, Arg or Gln;
<220>
<221>misc_feature
<222>(21)..(21)
<223〉the 21st Xaa is Glu, Asp, Asn, Ala, Ser, Lys or Arg;
<220>
<221>misc_feature
<222>(23)..(23)
<223〉the 23rd Xaa is Ile or Val;
<220>
<221>misc_feature
<222>(24)..(24)
<223〉the 24th Xaa is Ala, Ser, Asp, Glu, Gly or Thr;
<220>
<221>misc_feature
<222>(25)..(25)
<223〉the 25th Xaa is Trp, Arg, Lys or Ser;
<220>
<221>misc_feature
<222>(26)..(26)
<223〉the 26th Xaa is Val, Lys, Ile, Ser or Ala;
<220>
<221>misc_feature
<222>(28)..(28)
<223〉the 28th Xaa is Lys, Arg, Asn, Gln, Ser, Ala or Thr;
<220>
<221>misc_feature
<222>(29)..(29)
<223〉the 29th Xaa is Gly, Tyr or Ser;
<220>
<221>misc_feature
<222>(30)..(30)
<223〉the 30th Xaa is Arg, Lys, Gln, Asp, Asn, Gly, Ala or Pro;
<220>
<221>misc_feature
<222>(31)..(31)
<223〉the 31st Xaa is Gly, Pro, Val, Arg, Lys or Ala or be removed;
<400>1
His?Xaa?Xaa?Gly?Xaa?Xaa?Thr?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa
1 5 10 15
Xaa?Xaa?Xaa?Xaa?Xaa?Phe?Xaa?Xaa?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Xaa
20 25 30
<210>2
<211>452
<212>PRT
<213〉people
<400>2
Ala?Gln?Val?Met?Asp?Phe?Leu?Phe?Glu?Lys?Trp?Lys?Leu?Tyr?Gly?Asp
1 5 10 15
Gln?Cys?His?His?Asn?Leu?Ser?Leu?Leu?Pro?Pro?Pro?Thr?Glu?Leu?Val
20 25 30
Cys?Asn?Arg?Thr?Phe?Asp?Lys?Tyr?Ser?Cys?Trp?Pro?Asp?Thr?Pro?Ala
35 40 45
Asn?Thr?Thr?Ala?Asn?Ile?Ser?Cys?Pro?Trp?Tyr?Leu?Pro?Trp?His?His
50 55 60
Lys?Val?Gln?His?Arg?Phe?Val?Phe?Lys?Arg?Cys?Gly?Pro?Asp?Gly?Gln
65 70 75 80
Trp?Val?Arg?Gly?Pro?Arg?Gly?Gln?Pro?Trp?Arg?Asp?Ala?Ser?Gln?Cys
85 90 95
Gln?Met?Asp?Gly?Glu?Glu?Ile?Glu?Val?Gln?Lys?Glu?Val?Ala?Lys?Met
100 105 110
Tyr?Ser?Ser?Phe?Gln?Val?Met?Tyr?Thr?Val?Gly?Tyr?Ser?Leu?Ser?Leu
115 120 125
Gly?Ala?Leu?Leu?Leu?Ala?Leu?Ala?Ile?Leu?Gly?Gly?Leu?Ser?Lys?Leu
130 135 140
His?Cys?Thr?Arg?Asn?Ala?Ile?His?Ala?Asn?Leu?Phe?Ala?Ser?Phe?Val
145 150 155 160
Leu?Lys?Ala?Ser?Ser?Val?Leu?Val?Ile?Asp?Gly?Leu?Leu?Arg?Thr?Arg
165 170 175
Tyr?Ser?Gln?Lys?Ile?Gly?Asp?Asp?Leu?Ser?Val?Ser?Thr?Trp?Leu?Ser
180 185 190
Asp?Gly?Ala?Val?Ala?Gly?Cys?Arg?Val?Ala?Ala?Val?Phe?Met?Gln?Tyr
195 200 205
Gly?Ile?Val?Ala?Asn?Tyr?Cys?Trp?Leu?Leu?Val?Glu?Gly?Leu?Tyr?Leu
210 215 220
His?Asn?Leu?Leu?Gly?Leu?Ala?Thr?Leu?Pro?Glu?Arg?Ser?Phe?Phe?Ser
225 230 235 240
Leu?Tyr?Leu?Gly?Ile?Gly?Trp?Gly?Ala?Pro?Met?Leu?Phe?Val?Val?Pro
245 250 255
Trp?Ala?Val?Val?Lys?Cys?Leu?Phe?Glu?Asn?Val?Gln?Cys?Trp?Thr?Ser
260 265 270
Asn?Asp?Asn?Met?Gly?Phe?Trp?Trp?Ile?Leu?Arg?Phe?Pro?Val?Phe?Leu
275 280 285
Ala?Ile?Leu?Ile?Asn?Phe?Phe?Ile?Phe?Val?Arg?Ile?Val?Gln?Leu?Leu
290 295 300
Val?Ala?Lys?Leu?Arg?Ala?Arg?Gln?Met?His?His?Thr?Asp?Tyr?Lys?Phe
305 310 315 320
Arg?Leu?Ala?Lys?Ser?Thr?Leu?Thr?Leu?Ile?Pro?Leu?Leu?Gly?Val?His
325 330 335
Glu?Val?Val?Phe?Ala?Phe?Val?Thr?Asp?Glu?His?Ala?Gln?Gly?Thr?Leu
340 345 350
Arg?Ser?Ala?Lys?Leu?Phe?Phe?Asp?Leu?Phe?Leu?Ser?Ser?Phe?Gln?Gly
355 360 365
Leu?Leu?Val?Ala?Val?Leu?Tyr?Cys?Phe?Leu?Asn?Lys?Glu?Val?Gln?Ser
370 375 380
Glu?Leu?Arg?Arg?Arg?Trp?His?Arg?Trp?Arg?Leu?Gly?Lys?Val?Leu?Trp
385 390 395 400
Glu?Glu?Arg?Asn?Thr?Ser?Asn?His?Arg?Ala?Ser?Ser?Ser?Pro?Gly?His
405 410 415
Gly?Pro?Pro?Ser?Lys?Glu?Leu?Gln?Phe?Gly?Arg?Gly?Gly?Gly?Ser?Gln
420 425 430
Asp?Ser?Ser?Ala?Glu?Thr?Pro?Leu?Ala?Gly?Gly?Leu?Pro?Arg?Leu?Ala
435 440 445
Glu?Ser?Pro?Phe
450
<210>3
<211>117
<212>PRT
<213〉people
<400>3
Ala?Gln?Val?Met?Asp?Phe?Leu?Phe?Glu?Lys?Trp?Lys?Leu?Tyr?Gly?Asp
1 5 10 15
Gln?Cys?His?His?Asn?Leu?Ser?Leu?Leu?Pro?Pro?Pro?Thr?Glu?Leu?Val
20 25 30
Cys?Asn?Arg?Thr?Phe?Asp?Lys?Tyr?Ser?Cys?Trp?Pro?Asp?Thr?Pro?Ala
35 40 45
Asn?Thr?Thr?Ala?Asn?Ile?Ser?Cys?Pro?Trp?Tyr?Leu?Pro?Trp?His?His
50 55 60
Lys?Val?Gln?His?Arg?Phe?Val?Phe?Lys?Arg?Cys?Gly?Pro?Asp?Gly?Gln
65 70 75 80
Trp?ValArg?Gly?Pro?Arg?Gly?Gln?Pro?Trp?Arg?Asp?Ala?Ser?Gln?Cys
85 90 95
Gln?Met?Asp?Gly?Glu?Glu?Ile?Glu?Val?Gln?Lys?Glu?Val?Ala?Lys?Met
100 105 110
Tyr?Ser?Ser?Phe?Gln
115
<210>4
<211>32
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(1)..(1)
<223〉the 1st Xaa is Asn Ala Ile His Ala Asn Leu Phe Ala Ser Phe Val Leu LysAla Ser
Ser Val Leu Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(32)..(32)
<223〉the 32nd Xaa is Cys Arg Val Ala Ala Val Phe Met Gln Tyr Gly Ile Val AlaAsn Tyr
Cys Trp Leu Leu Val Glu Gly Leu Tyr Leu, from the C-end, all amino acid can be removed one by one;
<400>4
Xaa?Ile?Asp?Gly?Leu?Leu?Arg?Thr?Arg?Tyr?Ser?Gln?Lys?Ile?Gly?Asp
1 5 10 15
Asp?Leu?Ser?Val?Ser?Thr?Trp?Leu?Ser?Asp?Gly?Ala?Val?Ala?Gly?Xaa
20 25 30
<210>5
<211>20
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(1)..(1)
<223〉the 1st Xaa is Phe Ser Leu Tyr Leu Gly Ile Gly Trp Gly Ala Pro Met LeuPhe Val
Val Pro Trp Ala Val Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(20)..(20)
<223〉the 20th Xaa is Trp Trp Ile Leu Arg Phe Pro Val Phe Leu Ala Ile Leu IleAsn Phe
Phe Ile Phe Val Arg Ile Val, from the C-end, all amino acid can be removed one by one;
<400>5
Xaa?Lys?Cys?Leu?Phe?Glu?Asn?Val?Gln?Cys?Trp?Thr?Ser?Asn?Asp?Asn
1 5 10 15
Met?Gly?Phe?Xaa
20
<210>6
<211>20
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(1)..(1)
<223〉the 1st Xaa is Thr Leu Thr Leu Ile Pro Leu Leu Gly Val His Glu Val Val PheAla
Phe Val Thr, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(20)..(20)
<223〉the 20th Xaa is Leu Phe Leu Ser Ser Phe Gln Gly Leu Leu Val Ala Val LeuTyr Cys
Phe Leu Asn, from the C-end, all amino acid can be removed one by one;
<400>6
Xaa?Lys?Cys?Leu?Phe?Glu?Asn?Val?Gln?Cys?Trp?Thr?Ser?Asn?Asp?Asn
1 5 10 15
Met?Gly?Phe?Xaa
20
<210>7
<211>55
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(1)..(1)
<223〉the 1st Xaa is Asn Ala Ile His Ala Asn Leu Phe Ala Ser Phe Val Leu Lys AlaSer
Ser Val Leu Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(32)..(32)
<223〉the 32nd Xaa is Cys Arg Val Ala Ala Val Phe Met Gln Tyr Gly Ile Val AlaAsn Tyr
Cys Trp Leu Leu Val Glu Gly Leu Tyr Leu, from the C-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(33)..(33)
<223〉the 33rd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer
<220>
<221>misc_feature
<222>(34)..(34)
<223〉the 34th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed
<220>
<221>misc_feature
<222>(35)..(35)
<223〉the 35th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed
<220>
<221>misc_feature
<222>(36)..(36)
<223〉the 36th Xaa is Phe Ser Leu Tyr Leu Gly Ile Gly Trp Gly Ala Pro Met LeuPhe Val
Val Pro Trp Ala Val Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(55)..(55)
<223〉the 55th Xaa is Trp Trp Ile Leu Arg Phe Pro Val Phe Leu Ala Ile Leu IleAsn Phe
Phe Ile Phe Val Arg Ile Val, from the C-end, all amino acid can be removed one by one;
<400>7
Xaa?Ile?Asp?Gly?Leu?Leu?Arg?Thr?Arg?Tyr?Ser?Gln?Lys?Ile?Gly?Asp
1 5 10 15
Asp?Leu?Ser?Val?Ser?Thr?Trp?Leu?Ser?Asp?Gly?Ala?Val?Ala?Gly?Xaa
20 25 30
Xaa?Xaa?Xaa?Xaa?Lys?Cys?Leu?Phe?Glu?Asn?Val?Gln?Cys?Trp?Thr?Ser
35 40 45
Asn?Asp?Asn?Met?Gly?Phe?Xaa
50 55
<210>8
<211>53
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(1)..(1)
<223〉the 1st Xaa is Asn Ala Ile His Ala Asn Leu Phe Ala Ser Phe Val Leu Lys AlaSer
Ser Val Leu Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(32)..(32)
<223〉the 32nd Xaa is Cys Arg Val Ala Ala Val Phe Met Gln Tyr Gly Ile Val AlaAsn Tyr
Cys Trp Leu Leu Val Glu Gly Leu Tyr Leu, from the C-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(33)..(33)
<223〉the 33rd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer
<220>
<221>misc_feature
<222>(34)..(34)
<223〉the 34th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed
<220>
<221>misc_feature
<222>(35)..(35)
<223〉the 35th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed
<220>
<221>misc_feature
<222>(36)..(36)
<223〉the 36th Xaa is Phe Ser Leu Tyr Leu Gly Ile Gly Trp Gly Ala Pro Met LeuPhe Val
Val Pro Trp Ala Val Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(53)..(53)
<223〉the 53rd Xaa is Trp Trp Ile Leu Arg Phe Pro Val Phe Leu Ala Ile Leu IleAsn Phe
Phe Ile Phe Val Arg Ile Val, from the C-end, all amino acid can be removed one by one;
<400>8
Xaa?Ile?Asp?Gly?Leu?Leu?Arg?Thr?Arg?Tyr?Ser?Gln?Lys?Ile?Gly?Asp
1 5 10 15
Asp?Leu?Ser?Val?Ser?Thr?Trp?Leu?Ser?Asp?Gly?Ala?Val?Ala?Gly?Xaa
20 25 30
Xaa?Xaa?Xaa?Xaa?Asp?Glu?His?Ala?Gln?Gly?Thr?Leu?Arg?Ser?Ala?Lys
35 40 45
Leu?Phe?Phe?Asp?Xaa
50
<210>9
<211>41
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(1)..(1)
<223〉the 1st Xaa is Phe Ser Leu Tyr Leu Gly Ile Gly Trp Gly Ala Pro Met Leu PheVal
Val Pro Trp Ala Val Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(20)..(20)
<223〉the 20th Xaa is Trp Trp Ile Leu Arg Phe Pro Val Phe Leu Ala Ile Leu IleAsn Phe
Phe Ile Phe Val Arg Ile Val, from the C-end, all nitrogen base acid can be removed one by one;
<220>
<221>misc_feature
<222>(21)..(21)
<223〉the 21st Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(22)..(22)
<223〉the 22nd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(23)..(23)
<223〉the 23rd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(24)..(24)
<223〉the 24th Xaa is Phe Ser Leu Tyr Leu Gly Ile Gly Trp Gly Ala Pro Met LeuPhe Val
Val Pro Trp Ala Val Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(41)..(41)
<223〉the 41st Xaa is Trp Trp Ile Leu Arg Phe Pro Val Phe Leu Ala Ile Leu IleAsn Phe
Phe Ile Phe Val Arg Ile Val, from the C-end, all amino acid can be removed one by one;
<400>9
Xaa?Lys?Cys?Leu?Phe?Glu?Asn?Val?Gln?Cys?Trp?Thr?Ser?Asn?Asp?Asn
1 5 10 15
Met?Gly?Phe?Xaa?Xaa?Xaa?Xaa?Xaa?Asp?Glu?His?Ala?Gln?Gly?Thr?Leu
20 25 30
Arg?Ser?Ala?Lys?Leu?Phe?Phe?Asp?Xaa
35 40
<210>10
<211>76
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(1)..(1)
<223〉the 1st Xaa is Asn Ala Ile His Ala Asn Leu Phe Ala Ser Phe Val Leu LysAla Ser
Ser Val Leu Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(32)..(32)
<223〉the 32nd Xaa is Cys Arg Val Ala Ala Val Phe Met Gln Tyr Gly Ile Val AlaAsn Tyr
Cys Trp Leu Leu Val Glu Gly Leu Tyr Leu, from the C-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(33)..(33)
<223〉the 33rd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(34)..(34)
<223〉the 34th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(35)..(35)
<223〉the 35th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(36)..(36)
<223〉the 36th Xaa is Phe Ser Leu Tyr Leu Gly Ile Gly Trp Gly Ala Pro Met LeuPhe Val
Val Pro Trp Ala Val Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(55)..(55)
<223〉the 55th Xaa is Trp Trp Ile Leu Arg Phe Pro Val Phe Leu Ala Ile Leu IleAsn Phe
Phe Ile Phe Val Arg Ile Val, from the C-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(56)..(56)
<223〉the 56th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(57)..(57)
<223〉the 57th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(58)..(58)
<223〉the 58th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(59)..(59)
<223〉the 59th Xaa is Phe Ser Leu Tyr Leu Gly Ile Gly Trp Gly Ala Pro Met LeuPhe Val
Val Pro Trp Ala Val Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(76)..(76)
<223〉the 76th Xaa is Trp Trp Ile Leu Arg Phe Pro Val Phe Leu Ala Ile Leu IleAsn Phe
Phe Ile Phe Val Arg Ile Val, from the C-end, all amino acid can be removed one by one;
<400>10
Xaa?Ile?Asp?Gly?Leu?Leu?Arg?Thr?Arg?Tyr?Ser?Gln?Lys?Ile?Gly?Asp
1 5 10 15
Asp?Leu?Ser?Val?Ser?Thr?Trp?Leu?Ser?Asp?Gly?Ala?Val?Ala?Gly?Xaa
20 25 30
Xaa?Xaa?Xaa?Xaa?Lys?Cys?Leu?Phe?Glu?Asn?Val?Gln?Cys?Trp?Thr?Ser
35 40 45
Asn?Asp?Asn?Met?Gly?Phe?Xaa?Xaa?Xaa?Xaa?Xaa?Asp?Glu?His?Ala?Gln
50 55 60
Gly?Thr?Leu?Arg?Ser?Ala?Lys?Leu?Phe?Phe?Asp?Xaa
65 70 75
<210>11
<211>152
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(118)..(118)
<223〉the 118th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(119)..(119)
<223〉the 119th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(120)..(120)
<223〉the 120th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(121)..(121)
<223〉the 121st Xaa is Asn Ala Ile His Ala Asn Leu Phe Ala Ser Phe Val Leu LysAla Ser
Ser Val Leu Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(152)..(152)
<223〉the 152nd Xaa is Cys Arg Val Ala Ala Val Phe Met Gln Tyr Gly Ile Val AlaAsn Tyr
Cys Trp Leu Leu Val Glu Gly Leu Tyr Leu, from the C-end, all amino acid can be removed one by one;
<400>11
Ala?Gln?Val?Met?Asp?Phe?Leu?Phe?Glu?Lys?Trp?Lys?Leu?Tyr?Gly?Asp
1 5 10 15
Gln?Cys?His?His?Asn?Leu?Ser?Leu?Leu?Pro?Pro?Pro?Thr?Glu?Leu?Val
20 25 30
Cys?Asn?Arg?Thr?Phe?Asp?Lys?Tyr?Ser?Cys?Trp?Pro?Asp?Thr?Pro?Ala
35 40 45
Asn?Thr?Thr?Ala?Asn?Ile?Ser?Cys?Pro?Trp?Tyr?Leu?Pro?Trp?His?His
50 55 60
Lys?Val?Gln?His?Arg?Phe?Val?Phe?Lys?Arg?Cys?Gly?Pro?Asp?Gly?Gln
65 70 75 80
Trp?Val?Arg?Gly?Pro?Arg?Gly?Gln?Pro?Trp?Arg?Asp?Ala?Ser?Gln?Cys
85 90 95
Gln?Met?Asp?Gly?Glu?Glu?Ile?Glu?Val?Gln?Lys?Glu?Val?Ala?Lys?Met
100 105 110
Tyr?Ser?Ser?Phe?Gln?Xaa?Xaa?Xaa?Xaa?Ile?Asp?Gly?Leu?Leu?Arg?Thr
115 120 125
Arg?Tyr?Ser?Gln?Lys?Ile?Gly?Asp?Asp?Leu?Ser?Val?Ser?Thr?Trp?Leu
130 135 140
Ser?Asp?Gly?Ala?Val?Ala?Gly?Xaa
145 150
<210>12
<211>140
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(118)..(118)
<223〉the 118th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(119)..(119)
<223〉the 119th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(120)..(120)
<223〉the 120th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(121)..(121)
<223〉the 121st Xaa is Phe Ser Leu Tyr Leu Gly Ile Gly Trp Gly Ala Pro Met LeuPhe Val
Val Pro Trp Ala Val Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(140)..(140)
<223〉the 140th Xaa is Trp Trp Ile Leu Arg Phe Pro Val Phe Leu Ala Ile Leu IleAsn Phe
Phe Ile Phe Val Arg Ile Val, from the C-end, all amino acid can be removed one by one;
<400>12
Ala?Gln?Val?Met?Asp?Phe?Leu?Phe?Glu?Lys?Trp?Lys?Leu?Tyr?Gly?Asp
1 5 10 15
Gln?Cys?His?His?Asn?Leu?Ser?Leu?Leu?Pro?Pro?Pro?Thr?Glu?Leu?Val
20 25 30
Cys?Asn?Arg?Thr?Phe?Asp?Lys?Tyr?Ser?Cys?Trp?Pro?Asp?Thr?Pro?Ala
35 40 45
Asn?Thr?Thr?Ala?Asn?Ile?Ser?Cys?Pro?Trp?Tyr?Leu?Pro?Trp?His?His
50 55 60
Lys?Val?Gln?His?Arg?Phe?Val?Phe?Lys?Arg?Cys?Gly?Pro?Asp?Gly?Gln
65 70 75 80
Trp?Val?Arg?Gly?Pro?Arg?Gly?Gln?Pro?Trp?Arg?Asp?Ala?Ser?Gln?Cys
85 90 95
Gln?Met?Asp?Gly?Glu?Glu?Ile?Glu?Val?Gln?Lys?Glu?Val?Ala?Lys?Met
100 105 110
Tyr?Ser?Ser?Phe?Gln?Xaa?Xaa?Xaa?Xaa?Lys?Cys?Leu?Phe?Glu?Asn?Val
115 120 125
Gln?Cys?Trp?Thr?Ser?Asn?Asp?Asn?Met?Gly?Phe?Xaa
130 135 140
<210>13
<211>138
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(118)..(118)
<223〉the 118th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(119)..(119)
<223〉the 119th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(120)..(120)
<223〉the 120th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(121)..(121)
<223〉the 121st Xaa is Phe Ser Leu Tyr Leu Gly Ile Gly Trp Gly Ala Pro Met LeuPhe Val
Val Pro Trp Ala Val Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(138)..(138)
<223〉the 138th Xaa is Trp Trp Ile Leu Arg Phe Pro Val Phe Leu Ala Ile Leu IleAsn Phe
Phe Ile Phe Val Arg Ile Val, from the C-end, all amino acid can be removed one by one;
<400>13
Ala?Gln?Val?Met?Asp?Phe?Leu?Phe?Glu?Lys?Trp?Lys?Leu?Tyr?Gly?Asp
1 5 10 15
Gln?Cys?His?His?Asn?Leu?Ser?Leu?Leu?Pro?Pro?Pro?Thr?Glu?Leu?Val
20 25 30
Cys?Asn?Arg?Thr?Phe?Asp?Lys?Tyr?Ser?Cys?Trp?Pro?Asp?Thr?Pro?Ala
35 40 45
Asn?Thr?Thr?Ala?Asn?Ile?Ser?Cys?Pro?Trp?Tyr?Leu?Pro?Trp?His?His
50 55 60
Lys?Val?Gln?His?Arg?Phe?Val?Phe?Lys?Arg?Cys?Gly?Pro?Asp?Gly?Gln
65 70 75 80
Trp?Val?Arg?Gly?Pro?Arg?Gly?Gln?Pro?Trp?Arg?Asp?Ala?Ser?Gln?Cys
85 90 95
Gln?Met?Asp?Gly?Glu?Glu?Ile?Glu?Val?Gln?Lys?Glu?Val?Ala?Lys?Met
100 105 110
Tyr?Ser?Ser?Phe?Gln?Xaa?Xaa?Xaa?Xaa?Asp?Glu?His?Ala?Gln?Gly?Thr
115 120 125
Leu?Arg?Ser?Ala?Lys?Leu?Phe?Phe?Asp?Xaa
130 135
<210>14
<211>175
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(118)..(118)
<223〉the 118th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(119)..(119)
<223〉the 119th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(120)..(120)
<223〉the 120th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(121)..(121)
<223〉the 121st Xaa is Asn Ala Ile His Ala Asn Leu Phe Ala Ser Phe Val Leu LysAla Ser
Ser Val Leu Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(152)..(152)
<223〉the 152nd Xaa is Cys Arg Val Ala Ala Val Phe Met Gln Tyr Gly Ile Val AlaAsn Tyr
Cys Trp Leu Leu Val Glu Gly Leu Tyr Leu, from the C-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(153)..(153)
<223〉the 153rd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(154)..(154)
<223〉the 154th Xaa is Gly Thr Gly, Gly Ala Pro, Gly ProGly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(155)..(155)
<223〉the 155th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(156)..(156)
<223〉the 156th Xaa is Phe Ser Leu Tyr Leu Gly Ile Gly Trp Gly Ala Pro Met LeuPhe Val
Val Pro Trp Ala Val Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(175)..(175)
<223〉the 175th Xaa is Trp Trp Ile Leu Arg Phe Pro Val Phe Leu Ala Ile Leu IleAsn Phe
Phe Ile Phe Val Arg Ile Val, from the C-end, all amino acid can be removed one by one;
<400>14
Ala?Gln?Val?Met?Asp?Phe?Leu?Phe?Glu?Lys?Trp?Lys?Leu?Tyr?Gly?Asp
1 5 10 15
Gln?Cys?His?His?Asn?Leu?Ser?Leu?Leu?Pro?Pro?Pro?Thr?Glu?Leu?Val
20 25 30
Cys?Asn?Arg?Thr?Phe?Asp?Lys?Tyr?Ser?Cys?Trp?Pro?Asp?Thr?Pro?Ala
35 40 45
Asn?Thr?Thr?Ala?Asn?Ile?Ser?Cys?Pro?Trp?Tyr?Leu?Pro?Trp?His?His
50 55 60
Lys?Val?Gln?His?Arg?Phe?Val?Phe?Lys?Arg?Cys?Gly?Pro?Asp?Gly?Gln
65 70 75 80
Trp?Val?Arg?Gly?Pro?Arg?Gly?Gln?Pro?Trp?Arg?Asp?Ala?Ser?Gln?Cys
85 90 95
Gln?Met?Asp?Gly?Glu?Glu?Ile?Glu?Val?Gln?Lys?Glu?Val?Ala?Lys?Met
100 105 110
Tyr?Ser?Ser?Phe?Gln?Xaa?Xaa?Xaa?Xaa?Ile?Asp?Gly?Leu?Leu?Arg?Thr
115 120 125
Arg?Tyr?Ser?Gln?Lys?Ile?Gly?Asp?Asp?Leu?Ser?Val?Ser?Thr?Trp?Leu
130 135 140
Ser?Asp?Gly?Ala?Val?Ala?Gly?Xaa?Xaa?Xaa?Xaa?Xaa?Lys?Cys?Leu?Phe
145 150 155 160
Glu?Asn?Val?Gln?Cys?Trp?Thr?Ser?Asn?Asp?Asn?Met?Gly?Phe?Xaa
165 170 175
<210>15
<211>173
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(118)..(118)
<223〉the 118th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(119)..(119)
<223〉the 119th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(120)..(120)
<223〉the 120th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(121)..(121)
<223〉the 121st Xaa is Asn Ala Ile His Ala Asn Leu Phe Ala Ser Phe Val Leu LysAla Ser
Ser Val Leu Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(152)..(152)
<223〉the 152nd Xaa is Cys Arg Val Ala Ala Val Phe Met Gln Tyr Gly Ile Val AlaAsn Tyr
Cys Trp Leu Leu Val Glu Gly Leu Tyr Leu, from the C-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(153)..(153)
<223〉the 153rd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(154)..(154)
<223〉the 154th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or GlyGly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(155)..(155)
<223〉the 155th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(156)..(156)
<223〉the 156th Xaa is Phe Ser Leu Tyr Leu Gly Ile Gly Trp Gly Ala Pro Met LeuPhe Val
Val Pro Trp Ala Val Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(173)..(173)
<223〉the 173rd Xaa is Trp Trp Ile Leu Arg Phe Pro Val Phe Leu Ala Ile Leu IleAsn Phe
Phe Ile Phe Val Arg Ile Val, from the C-end, all amino acid can be removed one by one;
<400>15
Ala?Gln?Val?Met?Asp?Phe?Leu?Phe?Glu?Lys?Trp?Lys?Leu?Tyr?Gly?Asp
1 5 10 15
Gln?Cys?His?His?Asn?Leu?Ser?Leu?Leu?Pro?Pro?Pro?Thr?Glu?Leu?Val
20 25 30
Cys?Asn?Arg?Thr?Phe?Asp?Lys?Tyr?Ser?Cys?Trp?Pro?Asp?Thr?Pro?Ala
35 40 45
Asn?Thr?Thr?Ala?Asn?Ile?Ser?Cys?Pro?Trp?Tyr?Leu?Pro?Trp?His?His
50 55 60
Lys?Val?Gln?His?Arg?Phe?Val?Phe?Lys?Arg?Cys?Gly?Pro?Asp?Gly?Gln
65 70 75 80
Trp?Val?Arg?Gly?Pro?Arg?Gly?Gln?Pro?Trp?Arg?Asp?Ala?Ser?Gln?Cys
85 90 95
Gln?Met?Asp?Gly?Glu?Glu?Ile?Glu?Val?Gln?Lys?Glu?Val?Ala?Lys?Met
100 105 110
Tyr?Ser?Ser?Phe?Gln?Xaa?Xaa?Xaa?Xaa?Ile?Asp?Gly?Leu?Leu?Arg?Thr
115 120 125
Arg?Tyr?Ser?Gln?Lys?Ile?Gly?Asp?Asp?Leu?Ser?Val?Ser?Thr?Trp?Leu
130 135 140
Ser?Asp?Gly?Ala?Val?Ala?Gly?Xaa?Xaa?Xaa?Xaa?Xaa?Asp?Glu?His?Ala
145 150 155 160
Gln?Gly?Thr?Leu?Arg?Ser?Ala?Lys?Leu?Phe?Phe?Asp?Xaa
165 170
<210>16
<211>161
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(118)..(118)
<223〉the 118th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(119)..(119)
<223〉the 119th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(120)..(120)
<223〉the 120th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(121)..(121)
<223〉the 121st Xaa is Phe Ser Leu Tyr Leu Gly Ile Gly Trp Gly Ala Pro Met LeuPhe Val
Val Pro Trp Ala Val Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(140)..(140)
<223〉the 140th Xaa is Trp Trp Ile Leu Arg Phe Pro Val Phe Leu Ala Ile Leu IleAsn Phe
Phe Ile Phe Val Arg Ile Val, from the C-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(141)..(141)
<223〉the 141st Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(142)..(142)
<223〉the 142nd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(143)..(143)
<223〉the 143rd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(144)..(144)
<223〉the 144th Xaa is Phe Ser Leu Tyr Leu Gly Ile Gly Trp Gly Ala Pro Met LeuPhe Val
Val Pro Trp Ala Val Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(161)..(161)
<223〉the 161st Xaa is Trp Trp Ile Leu Arg Phe Pro Val Phe Leu Ala Ile Leu IleAsn Phe
Phe Ile Phe Val Arg Ile Val, from the C-end, all amino acid can be removed one by one;
<400>16
Ala?Gln?Val?Met?Asp?Phe?Leu?Phe?Glu?Lys?Trp?Lys?Leu?Tyr?Gly?Asp
1 5 10 15
Gln?Cys?His?His?Asn?Leu?Ser?Leu?Leu?Pro?Pro?Pro?Thr?Glu?Leu?Val
20 25 30
Cys?Asn?Arg?Thr?Phe?Asp?Lys?Tyr?Ser?Cys?Trp?Pro?Asp?Thr?Pro?Ala
35 40 45
Asn?Thr?Thr?Ala?Asn?Ile?Ser?Cys?Pro?Trp?Tyr?Leu?Pro?Trp?His?His
50 55 60
Lys?Val?Gln?His?Arg?Phe?Val?Phe?Lys?Arg?Cys?Gly?Pro?Asp?Gly?Gln
65 70 75 80
Trp?Val?Arg?Gly?Pro?Arg?Gly?Gln?Pro?Trp?Arg?Asp?Ala?Ser?Gln?Cys
85 90 95
Gln?Met?Asp?Gly?Glu?Glu?Ile?Glu?Val?Gln?Lys?Glu?Val?Ala?Lys?Met
100 105 110
Tyr?Ser?Ser?Phe?Gln?Xaa?Xaa?Xaa?Xaa?Lys?Cys?Leu?Phe?Glu?Asn?Val
115 120 125
Gln?Cys?Trp?Thr?Ser?Asn?Asp?Asn?Met?Gly?Phe?Xaa?Xaa?Xaa?Xaa?Xaa
130 135 140
Asp?Glu?His?Ala?Gln?Gly?Thr?Leu?Arg?Ser?Ala?Lys?Leu?Phe?Phe?Asp
145 150 155 160
Xaa
<210>17
<211>196
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(118)..(118)
<223〉the 118th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(119)..(119)
<223〉the 119th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(120)..(120)
<223〉the 120th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(121)..(121)
<223〉the 121st Xaa is Asn Ala Ile His Ala Asn Leu Phe Ala Ser Phe Val Leu LysAla Ser
Ser Val Leu Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(152)..(152)
<223〉the 152nd Xaa is Cys Arg Val Ala Ala Val Phe Met Gln Tyr Gly Ile Val AlaAsn Tyr
Cys Trp Leu Leu Val Glu Gly Leu Tyr Leu, from the C-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(153)..(153)
<223〉the 153rd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(154)..(154)
<223〉the 154th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(155)..(155)
<223〉the 155th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(156)..(156)
<223〉the 156th Xaa is Phe Ser Leu Tyr Leu Gly Ile Gly Trp Gly Ala Pro Met LeuPhe Val
Val Pro Trp Ala Val Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(175)..(175)
<223〉the 175th Xaa is Trp Trp Ile Leu Arg Phe Pro Val Phe Leu Ala Ile Leu IleAsn Phe
Phe Ile Phe Val Arg Ile Val, from the C-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(176)..(176)
<223〉the 176th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(177)..(177)
<223〉the 177th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(178)..(178)
<223〉the 178th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(179)..(179)
<223〉the 179th Xaa is Phe Ser Leu Tyr Leu Gly Ile Gly Trp Gly Ala Pro Met LeuPhe Val
Val Pro Trp Ala Val Val, from the N-end, all amino acid can be removed one by one;
<220>
<221>misc_feature
<222>(196)..(196)
<223〉the 196th Xaa is Trp Trp Ile Leu Arg Phe Pro Val Phe Leu Ala Ile Leu IleAsn Phe
Phe Ile Phe Val Arg Ile Val, from the C-end, all amino acid can be removed one by one;
<400>17
Ala?Gln?Val?Met?Asp?Phe?Leu?Phe?Glu?Lys?Trp?Lys?Leu?Tyr?Gly?Asp
1 5 10 15
Gln?Cys?His?His?Asn?Leu?Ser?Leu?Leu?Pro?Pro?Pro?Thr?Glu?Leu?Val
20 25 30
Cys?Asn?Arg?Thr?Phe?Asp?Lys?Tyr?Ser?Cys?Trp?Pro?Asp?Thr?Pro?Ala
35 40 45
Asn?Thr?Thr?Ala?Asn?Ile?Ser?Cys?Pro?Trp?Tyr?Leu?Pro?Trp?His?His
50 55 60
Lys?Val?Gln?His?Arg?Phe?Val?Phe?Lys?Arg?Cys?Gly?Pro?Asp?Gly?Gln
65 70 75 80
Trp?Val?Arg?Gly?Pro?Arg?Gly?Gln?Pro?Trp?Arg?Asp?Ala?Ser?Gln?Cys
85 90 95
ln?Met?Asp?Gly?Glu?Glu?Ile?Glu?Val?Gln?Lys?Glu?Val?Ala?Lys?Met
100 105 110
Tyr?Ser?Ser?Phe?Gln?Xaa?Xaa?Xaa?Xaa?Ile?Asp?Gly?Leu?Leu?Arg?Thr
115 120 125
Arg?Tyr?Ser?Gln?Lys?Ile?Gly?Asp?Asp?Leu?Ser?Val?Ser?Thr?Trp?Leu
130 135 140
Ser?Asp?Gly?Ala?Val?Ala?Gly?Xaa?Xaa?Xaa?Xaa?Xaa?Lys?Cys?Leu?Phe
145 150 155 160
Glu?Asn?Val?Gln?Cys?Trp?Thr?Ser?Asn?Asp?Asn?Met?Gly?Phe?Xaa?Xaa
165 170 175
Xaa?Xaa?Xaa?Asp?Glu?His?Ala?Gln?Gly?Thr?Leu?Arg?Ser?Ala?Lys?Leu
180 185 190
Phe?Phe?Asp?Xaa
195
<210>18
<211>440
<212>PRT
<213〉people
<400>18
Arg?Pro?Gln?Gly?Ala?Thr?Val?Ser?Leu?Trp?Glu?Thr?Val?Gln?Lys?Trp
1 5 10 15
Arg?Glu?Tyr?Arg?Arg?Gln?Cys?Gln?Arg?Ser?Leu?Thr?Glu?Asp?Pro?Pro
20 25 30
Pro?Ala?Thr?Asp?Leu?Phe?Cys?Asn?Arg?Thr?Phe?Asp?Glu?Tyr?Ala?Cys
35 40 45
Trp?Pro?Asp?Gly?Glu?Pro?Gly?Ser?Phe?Val?Asn?Val?Ser?Cys?Pro?Trp
50 55 60
Tyr?Leu?Pro?Trp?Ala?Ser?Ser?Val?Pro?Gln?Gly?His?Val?Tyr?Arg?Phe
65 70 75 80
Cys?Thr?Ala?Glu?Gly?Leu?Trp?Leu?Gln?Lys?Asp?Asn?Ser?Ser?Leu?Pro
85 90 95
Trp?Arg?Asp?Leu?Ser?Glu?Cys?Glu?Glu?Ser?Lys?Arg?Gly?Glu?Arg?Ser
100 105 110
Ser?Pro?Glu?Glu?Gln?Leu?Leu?Phe?Leu?Tyr?Ile?Ile?Tyr?Thr?Val?Gly
115 120 125
Tyr?Ala?Leu?Ser?Phe?Ser?Ala?Leu?Val?Ile?Ala?Ser?Ala?Ile?Leu?Leu
130 135 140
Gly?Phe?Arg?His?Leu?His?Cys?Thr?Arg?Asn?Tyr?Ile?His?Leu?Asn?Leu
145 150 155 160
Phe?Ala?Ser?Phe?Ile?Leu?Arg?Ala?Leu?Ser?Val?Phe?Ile?Lys?Asp?Ala
165 170 175
Ala?Leu?Lys?Trp?Met?Tyr?Ser?Thr?Ala?Ala?Gln?Gln?His?Gln?Trp?Asp
180 185 190
Gly?Leu?Leu?Ser?Tyr?Gln?Asp?Ser?Leu?Ser?Cys?Arg?Leu?Val?Phe?Leu
195 200 205
Leu?Met?Gln?Tyr?Cys?Val?Ala?Ala?Asn?Tyr?Tyr?Trp?Leu?Leu?Val?Glu
210 215 220
Gly?Val?Tyr?Leu?Tyr?Thr?Leu?Leu?Ala?Phe?Ser?Val?Phe?Ser?Glu?Gln
225 230 235 240
Trp?Ile?Phe?Arg?Leu?Tyr?Val?Ser?Ile?Gly?Trp?Gly?Val?Pro?Leu?Leu
245 250 255
Phe?Val?Val?Pro?Trp?Gly?Ile?Val?Lys?Tyr?Leu?Tyr?Glu?Asp?Glu?Gly
260 265 270
Cys?Trp?Thr?Arg?Asn?Ser?Asn?Met?Asn?Tyr?Trp?Leu?Ile?Ile?Arg?Leu
275 280 285
Pro?Ile?Leu?Phe?Ala?Ile?Gly?Val?Asn?Phe?Leu?Ile?Phe?Val?Arg?Val
290 295 300
Ile?Cys?Ile?Val?Val?Ser?Lys?Leu?Lys?Ala?Asn?Leu?Met?Cys?Lys?Thr
305 310 315 320
Asp?Ile?Lys?Cys?Arg?Leu?Ala?Lys?Ser?Thr?Leu?Thr?Leu?Ile?Pro?Leu
325 330 335
Leu?Gly?Thr?His?Glu?Val?Ile?Phe?Ala?Phe?Val?Met?Asp?Glu?His?Ala
340 345 350
Arg?Gly?Thr?Leu?Arg?Phe?Ile?Lys?Leu?Phe?Thr?Glu?Leu?Ser?Phe?Thr
355 360 365
Ser?Phe?Gln?Gly?Leu?Met?Val?Ala?Ile?Leu?Tyr?Cys?Phe?Val?Asn?Asn
370 375 380
Glu?Val?Gln?Leu?Glu?Phe?Arg?Lys?Ser?Trp?Glu?Arg?Trp?Arg?Leu?Glu
385 390 395 400
His?Leu?His?Ile?Gln?Arg?Asp?Ser?Ser?Met?Lys?Pro?Leu?Lys?Cys?Pro
405 410 415
Thr?Ser?Ser?Leu?Ser?Ser?Gly?Ala?Thr?Ala?Gly?Ser?Ser?Met?Tyr?Thr
420 425 430
Ala?Thr?Cys?Gln?Ala?Ser?Cys?Ser
435 440
<210>19
<211>122
<212>PRT
<213〉people
<400>19
Arg?Pro?Gln?Gly?Ala?Thr?Val?Ser?Leu?Trp?Glu?Thr?Val?Gln?Lys?Trp
1 5 10 15
Arg?Glu?Tyr?Arg?Arg?Gln?Cys?Gln?Arg?Ser?Leu?Thr?Glu?Asp?Pro?Pro
20 25 30
Pro?Ala?Thr?Asp?Leu?Phe?Cys?Asn?Arg?Thr?Phe?Asp?Glu?Tyr?Ala?Cys
35 40 45
Trp?Pro?Asp?Gly?Glu?Pro?Gly?Ser?Phe?Val?Asn?Val?Ser?Cys?Pro?Trp
50 55 60
yr?Leu?Pro?Trp?Ala?Ser?Ser?Val?Pro?Gln?Gly?His?Val?Tyr?Arg?Phe
65 70 75 80
Cys?Thr?Ala?Glu?Gly?Leu?Trp?Leu?Gln?Lys?Asp?Asn?Ser?Ser?Leu?Pro
85 90 95
Trp?Arg?Asp?Leu?Ser?Glu?Cys?Glu?Glu?Ser?Lys?Arg?Gly?Glu?Arg?Ser
100 105 110
Ser?Pro?Glu?Glu?Gln?Leu?Leu?Phe?Leu?Tyr
115 120
<210>20
<211>78
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(2)..(2)
<223〉the 2nd Xaa is Tyr, Ala or be removed;
<220>
<221>misc_feature
<222>(5)..(5)
<223〉the 5th Xaa is Leu, Ala, Met or be removed;
<220>
<221>misc_feature
<222>(9)..(9)
<223〉the 9th Xaa is Ala, Gly or be removed;
<220>
<221>misc_feature
<222>(12)..(12)
<223〉the 12nd Xaa is Ile, Val, Met or be removed;
<220>
<221>misc_feature
<222>(14)..(14)
<223〉the 14th Xaa is Leu, Val or be removed;
<220>
<221>misc_feature
<222>(15)..(15)
<223〉the 15th Xaa is Arg, Lys or be removed;
<220>
<221>misc_feature
<222>(16)..(16)
<223〉the 16th Xaa is Ala, Ser or be removed;
<220>
<221>misc_feature
<222>(17)..(17)
<223〉the 17th Xaa is Leu, Ser or be removed;
<220>
<221>misc_feature
<222>(19)..(19)
<223〉the 19th Xaa is Val, Leu or be removed;
<220>
<221>misc_feature
<222>(20)..(20)
<223〉the 20th Xaa is Phe, Leu or be removed;
<220>
<221>misc_feature
<222>(21)..(21)
<223〉the 21st Xaa is Ile, Val or be removed;
<220>
<221>misc_feature
<222>(22)..(22)
<223〉the 22nd Xaa is Lys, Arg, Gln, Asp, Glu, Asn or Ile;
<220>
<221>misc_feature
<222>(24)..(24)
<223〉the 24th Xaa is Ala, Gly, Thr, Trp, Val, Arg or Ile;
<220>
<221>misc_feature
<222>(25)..(25)
<223〉the 25th Xaa is Ala, Leu or Val;
<220>
<221>misc_feature
<222>(27)..(27)
<223〉the 27th Xaa is Lys, Arg or Asp;
<220>
<221>misc_feature
<222>(28)..(28)
<223〉the 28th Xaa is Trp, Thr, Gln or Asn;
<220>
<221>misc_feature
<222>(29)..(29)
<223〉the 29th Xaa is Met, Arg or Ser;
<220>
<221>misc_feature
<222>(30)..(30)
<223〉the 30th Xaa is Tyr or Asn;
<220>
<221>misc_feature
<222>(31)..(31)
<223〉the 31st Xaa is Ser or Arg;
<220>
<221>misc_feature
<222>(32)..(32)
<223〉the 32nd Xaa is Thr, Gln or Ala;
<220>
<221>misc_feature
<222>(33)..(33)
<223〉the 33rd Xaa is Lys, Arg or removal;
<220>
<221>misc_feature
<222>(34)..(34)
<223〉the 34th Xaa is Ala, Ile or Ser;
<220>
<221>misc_feature
<222>(35)..(35)
<223〉the 35th Xaa is Ala, Gly or Ile;
<220>
<221>misc_feature
<222>(36)..(36)
<223〉the 36th Xaa is Gln, Asp, Pro, Glu or Ile;
<220>
<221>misc_feature
<222>(37)..(37)
<223〉the 37th Xaa is Gln, Asp, Glu, Ser or Asn;
<220>
<221>misc_feature
<222>(38)..(38)
<223〉the 38th Xaa is His or Leu;
<220>
<221>misc_feature
<222>(39)..(39)
<223〉the 39th Xaa is Gln, Ser, Tyr or Glu;
<220>
<221>misc_feature
<222>(40)..(40)
<223〉the 40th Xaa is Trp, Val or Gln;
<220>
<221>misc_feature
<222>(41)..(41)
<223〉the 41st Xaa is Asp or Ser;
<220>
<221>misc_feature
<222>(42)..(42)
<223〉the 42nd Xaa is Gly, Thr, Val, Ser or Ala;
<220>
<221>misc_feature
<222>(43)..(43)
<223〉the 43rd Xaa is Arg or removal;
<220>
<221>misc_feature
<222>(44)..(44)
<223〉the 44th Xaa is Leu, Trp, Arg, Thr or Tyr;
<220>
<221>misc_feature
<222>(46)..(46)
<223〉the 46th Xaa is Ser or Asp;
<220>
<221>misc_feature
<222>(47)..(47)
<223〉the 47th Xaa is Tyr, Asp or Thr;
<220>
<221>misc_feature
<222>(48)..(48)
<223〉the 48th Xaa is Gln, Glu or Gly;
<220>
<221>misc_feature
<222>(49)..(49)
<223〉the 49th Xaa is Asp, Ala or Thr;
<220>
<221>misc_feature
<222>(50)..(50)
<223〉the 50th Xaa is Ser, Val, Leu or Met;
<220>
<221>misc_feature
<222>(51)..(51)
<223〉the 51st Xaa is Leu, Ala, Thr or Val;
<220>
<221>misc_feature
<222>(52)..(52)
<223〉the 52nd Xaa is Ser, Gly or Ala;
<220>
<221>misc_feature
<222>(53)..(53)
<223〉the 53rd Xaa is Cys or is removed;
<220>
<221>misc_feature
<222>(54)..(54)
<223〉the 54th Xaa is Arg or is removed;
<220>
<221>misc_feature
<222>(55)..(55)
<223〉the 55th Xaa is Leu, Val, Ala, Ser or be removed;
<220>
<221>misc_feature
<222>(56)..(56)
<223〉the 56th Xaa is Val, Ala or be removed;
<220>
<221>misc_feature
<222>(57)..(57)
<223〉the 57th Xaa is Phe, Ala, Thr, Met or be removed;
<220>
<221>misc_feature
<222>(58)..(58)
<223〉the 58th Xaa is Leu, Val or be removed;
<220>
<221>misc_feature
<222>(59)..(59)
<223〉the 59th Xaa is Leu, Phe, Met or be removed;
<220>
<221>misc_feature
<222>(63)..(63)
<223〉the 63rd Xaa is Cys, Gly, Ser or be removed;
<220>
<221>misc_feature
<222>(64)..(64)
<223〉the 64th Xaa is Val, Ile, Met or be removed;
<220>
<221>misc_feature
<222>(65)..(65)
<223〉the 65th Xaa is Ala, Val, Met, Ile or be removed;
<220>
<221>misc_feature
<222>(69)..(69)
<223〉the 69th Xaa is Tyr, Cys or be removed;
<220>
<221>misc_feature
<222>(76)..(76)
<223〉the 76th Xaa is Val or Leu or is removed;
<400>20
Asn?Xaa?Ile?His?Xaa?Asn?Leu?Phe?Xaa?Ser?Phe?Xaa?Leu?Xaa?Xaa?Xaa
1 5 10 15
Xaa?Ser?Xaa?Xaa?Xaa?Xaa?Asp?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa
20 25 30
Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Xaa?Xaa?Xaa
35 40 45
Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Met?Gln?Tyr?Xaa?Xaa
50 55 60
Xaa?Ala?Asn?Tyr?Xaa?Trp?Leu?Leu?Val?Glu?Gly?Xaa?Tyr?Leu
65 70 75
<210>21
<211>64
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(2)..(2)
<223〉the 2nd Xaa is Arg or Ser or is removed;
<220>
<221>misc_feature
<222>(5)..(5)
<223〉the 5th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(6)..(6)
<223〉the 6th Xaa is Ser, Gly or Cys or be removed;
<220>
<221>misc_feature
<222>(11)..(11)
<223〉the 11st Xaa is Val or Ala or is removed;
<220>
<221>misc_feature
<222>(13)..(13)
<223〉the 13rd Xaa is Leu or Met or is removed;
<220>
<221>misc_feature
<222>(17)..(17)
<223〉the 17th Xaa is Val, Leu or Ile or be removed;
<220>
<221>misc_feature
<222>(20)..(20)
<223〉the 20th Xaa is Gly, Ala, Met or Val or be removed;
<220>
<221>misc_feature
<222>(21)..(21)
<223〉the 21st Xaa is Ile, Val, Thr or Ala or be removed;
<220>
<221>misc_feature
<222>(22)..(22)
<223〉the 22nd Xaa is Val or is removed;
<220>
<221>misc_feature
<222>(23)..(23)
<223〉the 23rd Xaa is Lys or is removed;
<220>
<221>misc_feature
<222>(24)..(24)
<222〉the 24th Xaa is Tyr or Cys;
<220>
<221>misc_feature
<222>(26)..(26)
<223〉the 26th Xaa is Tyr or Phe;
<220>
<221>misc_feature
<222>(28)..(28)
<223〉the 28th Xaa is Asp or Asn;
<220>
<221>misc_feature
<222>(29)..(29)
<223〉the 29th Xaa is Glu or Val;
<220>
<221>misc_feature
<222>(30)..(30)
<223〉the 30th Xaa is Gly, Gln, Glu or Asp;
<220>
<221>misc_feature
<222>(33)..(33)
<223〉the 33rd Xaa is Thr, Glu or Ser;
<220>
<221>misc_feature
<222>(34)..(34)
<223〉the 34th Xaa is Arg or Ser;
<220>
<221>misc_feature
<222>(36)..(36)
<223〉the 36th Xaa is Ser, Asp, Asn or Met;
<220>
<221>misc_feature
<222>(39)..(39)
<223〉the 39th Xaa is Asn or Gly or is removed;
<220>
<221>misc_feature
<222>(40)..(40)
<223〉the 40th Xaa is Tyr or Phe or is removed;
<220>
<221>misc_feature
<222>(42)..(42)
<223〉the 42nd Xaa is Leu or Trp or is removed;
<220>
<221>misc_feature
<222>(44)..(44)
<223〉the 44th Xaa is Ile or Leu or is removed;
<220>
<221>misc_feature
<222>(46)..(46)
<223〉the 46th Xaa is Leu, Phe, Ile or Ser or be removed;
<220>
<221>misc_feature
<222>(48)..(48)
<223〉the 48th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(49)..(49)
<223〉the 49th Xaa is Leu or Phe or is removed;
<220>
<221>misc_feature
<222>(50)..(50)
<223〉the 50th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(53)..(53)
<223〉the 53rd Xaa is Gly or Leu or is removed;
<220>
<221>misc_feature
<222>(54)..(54)
<223〉the 54th Xaa is Val or Ile or is removed;
<220>
<221>misc_feature
<222>(57)..(57)
<223〉the 57th Xaa is Leu, Phe or Ile or be removed;
<220>
<221>misc_feature
<222>(62)..(62)
<223〉the 62nd Xaa is Val or Ile or is removed;
<220>
<221>misc_feature
<222>(63)..(63)
<223〉the 63rd Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(64)..(64)
<223〉the 64th Xaa is Gln or Cys or is removed;
<400>21
Phe?Xaa?Leu?Tyr?Xaa?Xaa?Ile?Gly?Trp?Gly?Xaa?Pro?Xaa?Leu?Phe?Val
1 5 10 15
Xaa?Pro?Trp?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Xaa?Glu?Xaa?Xaa?Xaa?Cys?Trp
20 25 30
Xaa?Xaa?Asn?Xaa?Asn?Met?Xaa?Xaa?Trp?Xaa?Ile?Xaa?Arg?Xaa?Pro?Xaa
35 40 45
Xaa?Xaa?Ala?Ile?Xaa?Xaa?Asn?Phe?Xaa?Ile?Phe?Val?Arg?Xaa?Xaa?Xaa
50 55 60
<210>22
<211>57
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(11)..(11)
<223〉the 11st Xaa is Thr, Val or Ile or be removed;
<220>
<221>misc_feature
<222>(15)..(15)
<223〉the 15th Xaa is Ile, Val, Leu or Ala or be removed;
<220>
<221>misc_feature
<222>(20)..(20)
<223〉the 20th Xaa is Met, Thr, Ile, Ala or be removed;
<220>
<221>misc_feature
<222>(23)..(23)
<223〉the 23rd Xaa is His, Pro, Gln or Thr;
<220>
<221>misc_feature
<222>(24)..(24)
<223〉the 24th Xaa is Ala, Lys, Val or Thr;
<220>
<221>misc_feature
<222>(25)..(25)
<223〉the 25th Xaa is Arg, Lys, Gln or Glu;
<220>
<221>misc_feature
<222>(26)..(26)
<223〉the 26th Xaa is Gly or Ser;
<220>
<221>misc_feature
<222>(27)..(27)
<223〉the 27th Xaa is Thr, Leu, Phe or Ala;
<220>
<221>misc_feature
<222>(30)..(30)
<223〉the 30th Xaa is Phe, Ser or Leu;
<220>
<221>misc_feature
<222>(31)..(31)
<223〉the 31st Xaa is Ile, Ala, Val or Thr;
<220>
<221>misc_feature
<222>(32)..(32)
<223〉the 32nd Xaa is Lys or Arg;
<220>
<221>misc_feature
<222>(35)..(35)
<223〉the 35th Xaa is Thr, Phe, Tyr or Ile;
<220>
<221>misc_feature
<222>(36)..(36)
<223〉the 36th Xaa is Glu, Asp, Gln or Asn;
<220>
<221>misc_feature
<222>(38)..(38)
<223〉the 38th Xaa is Ser, Phe or Leu or removal Leu;
<220>
<221>misc_feature
<222>(39)..(39)
<223〉the 39th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(40)..(40)
<223〉the 40th Xaa is Thr, Ser or Gly or be removed;
<220>
<221>misc_feature
<222>(45)..(45)
<223〉the 45th Xaa is Leu or Met or is removed;
<220>
<221>misc_feature
<222>(46)..(46)
<223〉the 46th Xaa is Met or Leu or is removed;
<220>
<221>misc_feature
<222>(49)..(49)
<223〉the 49th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(54)..(54)
<223〉the 54th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(56)..(56)
<223〉the 56th Xaa is Asn or Lys or is removed;
<400>22
Ser?Thr?Leu?Thr?Leu?Ile?Pro?Leu?Leu?Gly?Xaa?His?Glu?Val?Xaa?Phe
1 5 10 15
Ala?Phe?Val?Xaa?Asp?Glu?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Arg?Xaa?Xaa?Xaa
20 25 30
Leu?Phe?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Ser?Phe?Gln?Gly?Xaa?Xaa?Val?Ala
35 40 45
Xaa?Leu?Tyr?Cys?Phe?Xaa?Asn?Xaa?Glu
50 55
<210>23
<211>145
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(2)..(2)
<223〉the 2nd Xaa is Tyr or Ala or is removed;
<220>
<221>misc_feature
<222>(5)..(5)
<223〉the 5th Xaa is Leu, Ala or Met or be removed;
<220>
<221>misc_feature
<222>(9)..(9)
<223〉the 9th Xaa is Ala or Gly or is removed;
<220>
<221>misc_feature
<222>(12)..(12)
<223〉the 12nd Xaa is Ile, Val or Met or be removed;
<220>
<221>misc_feature
<222>(14)..(14)
<223〉the 14th Xaa is Leu or Val or is removed;
<220>
<221>misc_feature
<222>(15)..(15)
<223〉the 15th Xaa is Arg or Lys or is removed;
<220>
<221>misc_feature
<222>(16)..(16)
<223〉the 16th Xaa is Ala or Ser or is removed;
<220>
<221>misc_feature
<222>(17)..(17)
<223〉the 17th Xaa is Leu or Ser or is removed;
<220>
<221>misc_feature
<222>(19)..(19)
<223〉the 19th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(20)..(20)
<223〉the 20th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(21)..(21)
<223〉the 21st Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(22)..(22)
<223〉the 22nd Xaa is Lys, Arg, Gln, Asp, Glu, Asn or Ile;
<220>
<221>misc_feature
<222>(24)..(24)
<223〉the 24th Xaa is Ala, Gly, Thr, Trp, Val, Arg or Ile;
<220>
<221>misc_feature
<222>(25)..(25)
<223〉the 25th Xaa is Ala, Leu or Val;
<220>
<221>misc_feature
<222>(27)..(27)
<223〉the 27th Xaa is Lys, Arg or Asp;
<220>
<221>misc_feature
<222>(28)..(28)
<223〉the 28th Xaa is Trp, Thr, Gln or Asn;
<220>
<221>misc_feature
<222>(29)..(29)
<223〉the 29th Xaa is Met, Arg or Ser;
<220>
<221>misc_feature
<222>(30)..(30)
<223〉the 30th Xaa is Tyr or Asn;
<220>
<221>misc_feature
<222>(31)..(31)
<223〉the 31st Xaa is Ser or Arg;
<220>
<221>misc_feature
<222>(32)..(32)
<223〉the 32nd Xaa is Thr, Gln or Ala;
<220>
<221>misc_feature
<222>(33)..(33)
<223〉the 33rd Xaa is Lys or Arg or skips;
<220>
<221>misc_feature
<222>(34)..(34)
<223〉the 34th Xaa is Ala, Ile or Ser;
<220>
<221>misc_feature
<222>(35)..(35)
<223〉the 35th Xaa is Ala, Gly or Ile;
<220>
<221>misc_feature
<222>(36)..(36)
<223〉the 36th Xaa is Gln, Asp, Pro, Glu or Ile;
<220>
<221>misc_feature
<222>(37)..(37)
<223〉the 37th Xaa is Gln, Asp, Glu, Ser or Asn;
<220>
<221>misc_feature
<222>(38)..(38)
<223〉the 38th Xaa is His or Leu;
<220>
<221>misc_feature
<222>(39)..(39)
<223〉the 39th Xaa is Gln, Ser, Tyr or Glu;
<220>
<221>misc_feature
<222>(40)..(40)
<223〉the 40th Xaa is Trp, Val or Gln;
<220>
<221>misc_feature
<222>(41)..(41)
<223〉the 41st Xaa is Asp or Ser;
<220>
<221>misc_feature
<222>(42)..(42)
<223〉the 42nd Xaa is Gly, Thr, Val, Ser or Ala;
<220>
<221>misc_feature
<222>(43)..(43)
<223〉the 43rd Xaa is Arg or skips;
<220>
<221>misc_feature
<222>(44)..(44)
<223〉the 44th Xaa is Leu, Trp, Arg, Thr or Tyr;
<220>
<221>misc_feature
<222>(46)..(46)
<223〉the 46th Xaa is Ser or Asp;
<220>
<221>misc_feature
<222>(47)..(47)
<223〉the 47th Xaa is Tyr, Asp or Thr;
<220>
<221>misc_feature
<222>(48)..(48)
<223〉the 48th Xaa is Gln, Glu or Gly;
<220>
<221>misc_feature
<222>(49)..(49)
<223〉the 49th Xaa is Asp, Ala or Thr;
<220>
<221>misc_feature
<222>(50)..(50)
<223〉the 50th Xaa is Ser, Val, Leu or Met;
<220>
<221>misc_feature
<222>(51)..(51)
<223〉the 51st Xaa is Leu, Ala, Thr or Val;
<220>
<221>misc_feature
<222>(52)..(52)
<223〉the 52nd Xaa is Ser, Gly or Ala;
<220>
<221>misc_feature
<222>(53)..(53)
<223〉the 53rd Xaa is Cys or is removed;
<220>
<221>misc_feature
<222>(54)..(54)
<223〉the 54th Xaa is Arg or is removed;
<220>
<221>misc_feature
<222>(55)..(55)
<223〉the 55th Xaa is Leu, Val, Ala or Ser or be removed;
<220>
<221>misc_feature
<222>(56)..(56)
<223〉the 56th Xaa is Val or Ala or is removed;
<220>
<221>misc_feature
<222>(57)..(57)
<223〉the 57th Xaa is Phe, Ala, Thr or Met or be removed;
<220>
<221>misc_feature
<222>(58)..(58)
<223〉the 58th Xaa is Leu or Val or is removed;
<220>
<221>misc_feature
<222>(59)..(59)
<223〉the 59th Xaa is Leu, Phe or Met or be removed;
<220>
<221>misc_feature
<222>(63)..(63)
<223〉the 63rd Xaa is Cys, Gly or Ser or be removed;
<220>
<221>misc_feature
<222>(64)..(64)
<223〉the 64th Xaa is Val, Ile or Met or be removed;
<220>
<221>misc_feature
<222>(65)..(65)
<223〉the 65th Xaa is Ala, Val, Met or Ile or be removed;
<220>
<221>misc_feature
<222>(69)..(69)
<223〉the 69th Xaa is Tyr or Cys or is removed;
<220>
<221>misc_feature
<222>(76)..(76)
<223〉the 76th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(79)..(79)
<223〉the 79th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(80)..(80)
<223〉the 80th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(81)..(81)
<223〉the 81st Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(83)..(83)
<223〉the 83rd Xaa is Arg or Ser or is removed;
<220>
<221>misc_feature
<222>(86)..(86)
<223〉the 86th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(87)..(87)
<223〉the 87th Xaa is Ser, Gly or Cys or be removed;
<220>
<221>misc_feature
<222>(92)..(92)
<223〉the 92nd Xaa is Val or Ala or is removed;
<220>
<221>misc_feature
<222>(94)..(94)
<223〉the 94th Xaa is Leu or Met or is removed;
<220>
<221>misc_feature
<222>(98)..(98)
<223〉the 98th Xaa is Val, Leu or Ile or be removed;
<220>
<221>misc_feature
<222>(101)..(101)
<223〉the 101st Xaa is Gly, Ala, Met or Val or be removed;
<220>
<221>misc_feature
<222>(102)..(102)
<223〉the 102nd Xaa is Ile, Val, Thr or Ala or be removed;
<220>
<221>misc_feature
<222>(103)..(103)
<223〉the 103rd Xaa is Val or is removed;
<220>
<221>misc_feature
<222>(104)..(104)
<223〉the 104th Xaa is Lys or is removed;
<220>
<221>misc_feature
<222>(105)..(105)
<223〉the 105th Xaa is Tyr or Cys;
<220>
<221>misc_feature
<222>(107)..(107)
<223〉the 107th Xaa is Tyr or Phe;
<220>
<221>misc_feature
<222>(109)..(109)
<223〉the 109th Xaa is Asp or Asn;
<220>
<221>misc_feature
<222>(110)..(110)
<223〉the 110th Xaa is Glu or Val;
<220>
<221>misc_feature
<222>(111)..(111)
<223〉the 111st Xaa is Gly, Gln, Glu or Asp;
<220>
<221>misc_feature
<222>(114)..(114)
<223〉the 114th Xaa is Thr, Glu or Ser;
<220>
<221>misc_feature
<222>(115)..(115)
<223〉the 115th Xaa is Arg or Ser;
<220>
<221>misc_feature
<222>(117)..(117)
<223〉the 117th Xaa is Ser, Asp, Asn or Met;
<220>
<221>misc_feature
<222>(120)..(120)
<223〉the 120th Xaa is Asn or Gly or is removed;
<220>
<221>misc_feature
<222>(121)..(121)
<223〉the 121st Xaa is Tyr or Phe or is removed;
<220>
<221>misc_feature
<222>(123)..(123)
<223〉the 123rd Xaa is Leu or Trp or is removed;
<220>
<221>misc_feature
<222>(125)..(125)
<223〉the 125th Xaa is Ile or Leu or is removed;
<220>
<221>misc_feature
<222>(127)..(127)
<223〉the 127th Xaa is Leu, Phe, Ile or Ser or be removed;
<220>
<221>misc_feature
<222>(129)..(129)
<223〉the 129th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(130)..(130)
<223〉the 130th Xaa is Leu or Phe or is removed;
<220>
<221>misc_feature
<222>(131)..(131)
<223〉the 131st Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(134)..(134)
<223〉the 134th Xaa is Gly or Leu or is removed;
<220>
<221>misc_feature
<222>(135)..(135)
<223〉the 135th Xaa is Val or Ile or is removed;
<220>
<221>misc_feature
<222>(138)..(138)
<223〉the 138th Xaa is Leu, Phe or Ile or be removed;
<220>
<221>misc_feature
<222>(143)..(143)
<223〉the 143rd Xaa is Val or Ile or is removed;
<220>
<221>misc_feature
<222>(144)..(144)
<223〉the 144th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(145)..(145)
<223〉the 145th Xaa is Gln or Cys or is removed;
<400>23
Asn?Xaa?Ile?His?Xaa?Asn?Leu?Phe?Xaa?Ser?Phe?Xaa?Leu?Xaa?Xaa?Xaa
1 5 10 15
Xaa?Ser?Xaa?Xaa?Xaa?Xaa?Asp?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa
20 25 30
Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Xaa?Xaa?Xaa
35 40 45
Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Met?Gln?Tyr?Xaa?Xaa
50 55 60
Xaa?Ala?Asn?Tyr?Xaa?Trp?Leu?Leu?Val?Glu?Gly?Xaa?Tyr?Leu?Xaa?Xaa
65 70 75 80
Xaa?Phe?Xaa?Leu?Tyr?Xaa?Xaa?Ile?Gly?Trp?Gly?Xaa?Pro?Xaa?Leu?Phe
85 90 95
Val?Xaa?Pro?Trp?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Xaa?Glu?Xaa?Xaa?Xaa?Cys
100 105 110
Trp?Xaa?Xaa?Asn?Xaa?Asn?Met?Xaa?Xaa?Trp?Xaa?Ile?Xaa?Arg?Xaa?Pro
115 120 125
Xaa?Xaa?Xaa?Ala?Ile?Xaa?Xaa?Asn?Phe?Xaa?Ile?Phe?Val?Arg?Xaa?Xaa
130 135 140
Xaa
145
<210>24
<211>138
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(2)..(2)
<223〉the 2nd Xaa is Tyr or Ala or is removed;
<220>
<221>misc_feature
<222>(5)..(5)
<223〉the 5th Xaa is Leu, Ala or Met or be removed;
<220>
<221>misc_feature
<222>(9)..(9)
<223〉the 9th Xaa is Ala or Gly or is removed;
<220>
<221>misc_feature
<222>(12)..(12)
<223〉the 12nd Xaa is Ile, Val or Met or be removed;
<220>
<221>misc_feature
<222>(14)..(14)
<223〉the 14th Xaa is Leu or Val or is removed;
<220>
<221>misc_feature
<222>(15)..(15)
<223〉the 15th Xaa is Arg or Lys or is removed;
<220>
<221>misc_feature
<222>(16)..(16)
<223〉the 16th Xaa is Ala or Ser or is removed;
<220>
<221>misc_feature
<222>(17)..(17)
<223〉the 17th Xaa is Leu or Ser or is removed;
<220>
<221>misc_feature
<222>(19)..(19)
<223〉the 19th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(20)..(20)
<223〉the 20th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(21)..(21)
<223〉the 21st Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(22)..(22)
<223〉the 22nd Xaa is Lys, Arg, Gln, Asp, Glu, Asn or Ile;
<220>
<221>misc_feature
<222>(24)..(24)
<223〉the 24th Xaa is Ala, Gly, Thr, Trp, Val, Arg or Ile;
<220>
<221>misc_feature
<222>(25)..(25)
<223〉the 25th Xaa is Ala, Leu or Val;
<220>
<221>misc_feature
<222>(27)..(27)
<223〉the 27th Xaa is Lys, Arg or Asp;
<220>
<221>misc_feature
<222>(28)..(28)
<223〉the 28th Xaa is Trp, Thr, Gln or Asn;
<220>
<221>misc_feature
<222>(29)..(29)
<223〉the 29th Xaa is Met, Arg or Ser;
<220>
<221>misc_feature
<222>(30)..(30)
<223〉the 30th Xaa is Tyr or Asn;
<220>
<221>misc_feature
<222>(31)..(31)
<223〉the 31st Xaa is Ser or Arg;
<220>
<221>misc_feature
<222>(32)..(32)
<223〉the 32nd Xaa is Thr, Gln or Ala;
<220>
<221>misc_feature
<222>(33)..(33)
<223〉the 33rd Xaa is Lys or Arg or skips;
<220>
<221>misc_feature
<222>(34)..(34)
<223〉the 34th Xaa is Ala, Ile or Ser;
<220>
<221>misc_feature
<222>(35)..(35)
<223〉the 35th Xaa is Ala, Gly or Ile;
<220>
<221>misc_feature
<222>(36)..(36)
<223〉the 36th Xaa is Gln, Asp, Pro, Glu or Ile;
<220>
<221>misc_feature
<222>(37)..(37)
<223〉the 37th Xaa is Gln, Asp, Glu, Ser or Asn;
<220>
<221>misc_feature
<222>(38)..(38)
<223〉the 38th Xaa is His or Leu;
<220>
<221>misc_feature
<222>(39)..(39)
<223〉the 39th Xaa is Gln, Ser, Tyr or Glu;
<220>
<221>misc_feature
<222>(40)..(40)
<223〉the 40th Xaa is Trp, Val or Gln;
<220>
<221>misc_feature
<222>(41)..(41)
<223〉the 41st Xaa is Asp or Ser;
<220>
<221>misc_feature
<222>(42)..(42)
<223〉the 42nd Xaa is Gly, Thr, Val, Ser or Ala;
<220>
<221>misc_feature
<222>(43)..(43)
<223〉the 43rd Xaa is Arg or skips;
<220>
<221>misc_feature
<222>(44)..(44)
<223〉the 44th Xaa is Leu, Trp, Arg, Thr or Tyr;
<220>
<221>misc_feature
<222>(46)..(46)
<223〉the 46th Xaa is Ser or Asp;
<220>
<221>misc_feature
<222>(47)..(47)
<223〉the 47th Xaa is Tyr, Asp or Thr;
<220>
<221>misc_feature
<222>(48)..(48)
<223〉the 48th Xaa is Gln, Glu or Gly;
<220>
<221>misc_feature
<222>(49)..(49)
<223〉the 49th Xaa is Asp, Ala or Thr;
<220>
<221>misc_feature
<222>(50)..(50)
<223〉the 50th Xaa is Ser, Val, Leu or Met;
<220>
<221>misc_feature
<222>(51)..(51)
<223〉the 51st Xaa is Leu, Ala, Thr or Val;
<220>
<221>misc_feature
<222>(52)..(52)
<223〉the 52nd Xaa is Ser, Gly or Ala;
<220>
<221>misc_feature
<222>(53)..(53)
<223〉the 53rd Xaa is Cys or is removed;
<220>
<221>misc_feature
<222>(54)..(54)
<223〉the 54th Xaa is Arg or is removed;
<220>
<221>misc_feature
<222>(55)..(55)
<223〉the 55th Xaa is Leu, Val, Ala or Ser or be removed;
<220>
<221>misc_feature
<222>(56)..(56)
<223〉the 56th Xaa is Val or Ala or is removed;
<220>
<221>misc_feature
<222>(57)..(57)
<223〉the 57th Xaa is Phe, Ala, Thr or Met or be removed;
<220>
<221>misc_feature
<222>(58)..(58)
<223〉the 58th Xaa is Leu or Val or is removed;
<220>
<221>misc_feature
<222>(59)..(59)
<223〉the 59th Xaa is Leu, Phe or Met or be removed;
<220>
<221>misc_feature
<222>(63)..(63)
<223〉the 63rd Xaa is Cys, Gly or Ser or be removed;
<220>
<221>misc_feature
<222>(64)..(64)
<223〉the 64th Xaa is Val, Ile or Met or be removed;
<220>
<221>misc_feature
<222>(65)..(65)
<223〉the 65th Xaa is Ala, Val, Met or Ile or be removed;
<220>
<221>misc_feature
<222>(69)..(69)
<223〉the 69th Xaa is Tyr or Cys or is removed;
<220>
<221>misc_feature
<222>(76)..(76)
<223〉the 76th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(79)..(79)
<223〉the 79th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(80)..(80)
<223〉the 80th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(81)..(81)
<223〉the 81st Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(92)..(92)
<223〉the 92nd Xaa is Thr, Val or Ile or be removed;
<220>
<221>misc_feature
<222>(96)..(96)
<223〉the 96th Xaa is Ile, Val, Leu or Ala or be removed;
<220>
<221>misc_feature
<222>(101)..(101)
<223〉the 101st Xaa is Met, Thr, Ile or Ala or be removed;
<220>
<221>misc_feature
<222>(104)..(104)
<223〉the 104th Xaa is His, Pro, Gln or Thr;
<220>
<221>misc_feature
<222>(105)..(105)
<223〉the 105th Xaa is Ala, Lys, Val or Thr;
<220>
<221>misc_feature
<222>(106)..(106)
<223〉the 106th Xaa is Arg, Lys, Gln or Glu;
<220>
<221>misc_feature
<222>(107)..(107)
<223〉the 107th Xaa is Gly or Ser;
<220>
<221>misc_feature
<222>(108)..(108)
<223〉the 108th Xaa is Thr, Leu, Phe or Ala;
<220>
<221>misc_feature
<222>(111)..(111)
<223〉Xaa of 11l position is Phe, Ser or Leu;
<220>
<221>misc_feature
<222>(112)..(112)
<223〉the 112nd Xaa is Ile, Ala, Val or Thr;
<220>
<221>misc_feature
<222>(113)..(113)
<223〉the 113rd Xaa is Lys or Arg;
<220>
<221>misc_feature
<222>(116)..(116)
<223〉the 116th Xaa is Thr, Phe, Tyr or Ile;
<220>
<221>misc_feature
<222>(117)..(117)
<223〉the 117th Xaa is Glu, Asp, Gln or Asn;
<220>
<221>misc_feature
<222>(119)..(119)
<223〉the 119th Xaa is Ser, Phe or Leu or removal Leu;
<220>
<221>misc_feature
<222>(120)..(120)
<223〉the 120th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(121)..(121)
<223〉the 121st Xaa is Thr, Ser or Gly or be removed;
<220>
<221>misc_feature
<222>(126)..(126)
<223〉the 126th Xaa is Leu or Met or is removed;
<220>
<221>misc_feature
<222>(127)..(127)
<223〉the 127th Xaa is Met or Leu or is removed;
<220>
<221>misc_feature
<222>(130)..(130)
<223〉the 130th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(135)..(135)
<223〉the 135th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(137)..(137)
<223〉the 137th Xaa is Asn or Lys or is removed;
<400>24
Asn?Xaa?Ile?His?Xaa?Asn?Leu?Phe?Xaa?Ser?Phe?Xaa?Leu?Xaa?Xaa?Xaa
1 5 10 15
Xaa?Ser?Xaa?Xaa?Xaa?Xaa?Asp?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa
20 25 30
Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Xaa?Xaa?Xaa
35 40 45
Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Met?Gln?Tyr?Xaa?Xaa
50 55 60
Xaa?Ala?Asn?Tyr?Xaa?Trp?Leu?Leu?Val?Glu?Gly?Xaa?Tyr?Leu?Xaa?Xaa
65 70 75 80
Xaa?Ser?Thr?Leu?Thr?Leu?Ile?Pro?Leu?Leu?Gly?Xaa?His?Glu?Val?Xaa
85 90 95
Phe?Ala?Phe?Val?Xaa?Asp?Glu?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Arg?Xaa?Xaa
100 105 110
Xaa?Leu?Phe?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Ser?Phe?Gln?Gly?Xaa?Xaa?Val
115 120 125
Ala?Xaa?Leu?Tyr?Cys?Phe?Xaa?Asn?Xaa?Glu
130 135
<210>25
<211>124
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(2)..(2)
<223〉the 2nd Xaa is Arg or Ser or is removed;
<220>
<221>misc_feature
<222>(5)..(5)
<223〉the 5th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(6)..(6)
<223〉the 6th Xaa is Ser, Gly or Cys or be removed;
<220>
<221>misc_feature
<222>(11)..(11)
<223〉the 11st Xaa is Val or Ala or is removed;
<220>
<221>misc_feature
<222>(13)..(13)
<223〉the 13rd Xaa is Leu or Met or is removed;
<220>
<221>misc_feature
<222>(17)..(17)
<223〉the 17th Xaa is Val, Leu or Ile or be removed;
<220>
<221>misc_feature
<222>(20)..(20)
<223〉the 20th Xaa is Gly, Ala, Met or Val or be removed;
<220>
<221>misc_feature
<222>(21)..(21)
<223〉the 21st Xaa is Ile, Val, Thr or Ala or be removed;
<220>
<221>misc_feature
<222>(22)..(22)
<223〉the 22nd Xaa is Val or is removed;
<220>
<221>misc_feature
<222>(23)..(23)
<223〉the 23rd Xaa is Lys or is removed;
<220>
<221>misc_feature
<222>(24)..(24)
<223〉the 24th Xaa is Tyr or Cys;
<220>
<221>misc_feature
<222>(26)..(26)
<223〉the 26th Xaa is Tyr or Phe;
<220>
<221>misc_feature
<222>(28)..(28)
<223〉the 28th Xaa is Asp or Asn;
<220>
<221>misc_feature
<222>(29)..(29)
<223〉the 29th Xaa is Glu or Val;
<220>
<221>misc_feature
<222>(30)..(30)
<223〉the 30th Xaa is Gly, Gln, Glu or Asp;
<220>
<221>misc_feature
<222>(33)..(33)
<223〉the 33rd Xaa is Thr, Glu or Ser;
<220>
<221>misc_feature
<222>(34)..(34)
<223〉the 34th Xaa is Arg or Ser;
<220>
<221>misc_feature
<222>(36)..(36)
<223〉the 36th Xaa is Ser, Asp, Asn or Met;
<220>
<221>misc_feature
<222>(39)..(39)
<223〉the 39th Xaa is Asn or Gly or is removed;
<220>
<221>misc_feature
<222>(40)..(40)
<223〉the 40th Xaa is Tyr or Phe or is removed;
<220>
<221>misc_feature
<222>(42)..(42)
<223〉the 42nd Xaa is Leu or Trp or is removed;
<220>
<221>misc_feature
<222>(44)..(44)
<223〉the 44th Xaa is Ile or Leu or is removed;
<220>
<221>misc_feature
<222>(46)..(46)
<223〉the 46th Xaa is Leu, Phe, Ile or Ser or be removed;
<220>
<221>misc_feature
<222>(48)..(48)
<223〉the 48th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(49)..(49)
<223〉the 49th Xaa is Leu or Phe or is removed;
<220>
<221>misc_feature
<222>(50)..(50)
<223〉the 50th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(53)..(53)
<223〉the 53rd Xaa is Gly or Leu or is removed;
<220>
<221>misc_feature
<222>(54)..(54)
<223〉the 54th Xaa is Val or Ile or is removed;
<220>
<221>misc_feature
<222>(57)..(57)
<223〉the 57th Xaa is Leu, Phe or Ile or be removed;
<220>
<221>misc_feature
<222>(62)..(62)
<223〉the 62nd Xaa is Val or Ile or is removed;
<220>
<221>misc_feature
<222>(63)..(63)
<223〉the 63rd Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(64)..(64)
<223〉the 64th Xaa is Gln or Cys or is removed;
<220>
<221>misc_feature
<222>(65)..(65)
<223〉the 65th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(66)..(66)
<223〉the 66th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(67)..(67)
<223〉the 67th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(78)..(78)
<223〉the 78th Xaa is Thr, Val or Ile or be removed;
<220>
<221>misc_feature
<222>(82)..(82)
<223〉the 82nd Xaa is Ile, Val, Leu or Ala or be removed;
<220>
<221>misc_feature
<222>(87)..(87)
<223〉the 87th Xaa is Met, Thr, Ile or Ala or be removed;
<220>
<221>misc_feature
<222>(90)..(90)
<223〉the 90th Xaa is His, Pro, Gln or Thr;
<220>
<221>misc_feature
<222>(91)..(91)
<223〉the 91st Xaa is Ala, Lys, Val or Thr;
<220>
<221>misc_feature
<222>(92)..(92)
<223〉the 92nd Xaa is Arg, Lys, Gln or Glu;
<220>
<221>misc_feature
<222>(93)..(93)
<223〉the 93rd Xaa is Gly or Ser;
<220>
<221>misc_feature
<222>(94)..(94)
<223〉the 94th Xaa is Thr, Leu, Phe or Ala;
<220>
<221>misc_feature
<222>(97)..(97)
<223〉the 97th Xaa is Phe, Ser or Leu;
<220>
<221>misc_feature
<222>(98)..(98)
<223〉the 98th Xaa is Ile, Ala, Val or Thr;
<220>
<221>misc_feature
<222>(99)..(99)
<223〉the 99th Xaa is Lys or Arg;
<220>
<221>misc_feature
<222>(102)..(102)
<223〉the 102nd Xaa is Thr, Phe, Tyr or Ile;
<220>
<221>misc_feature
<222>(103)..(103)
<223〉the 103rd Xaa is Glu, Asp, Gln or Asn;
<220>
<221>misc_feature
<222>(105)..(105)
<223〉the 105th Xaa is Ser, Phe or Leu or removal Leu;
<220>
<221>misc_feature
<222>(106)..(106)
<223〉the 106th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(107)..(107)
<223〉the 107th Xaa is Thr, Ser or Gly or be removed;
<220>
<221>misc_feature
<222>(112)..(112)
<223〉the 112nd Xaa is Leu or Met or is removed;
<220>
<221>misc_feature
<222>(113)..(113)
<223〉the 113rd Xaa is Met or Leu or is removed;
<220>
<221>misc_feature
<222>(116)..(116)
<223〉the 116th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(121)..(121)
<223〉the 121st Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(123)..(123)
<223〉the 123rd Xaa is Asn or Lys or is removed;
<400>25
Phe?Xaa?Leu?Tyr?Xaa?Xaa?Ile?Gly?Trp?Gly?Xaa?Pro?Xaa?Leu?Phe?Val
1 5 10 15
Xaa?Pro?Trp?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Xaa?Glu?Xaa?Xaa?Xaa?Cys?Trp
20 25 30
Xaa?Xaa?Asn?Xaa?Asn?Met?Xaa?Xaa?Trp?Xaa?Ile?Xaa?Arg?Xaa?Pro?Xaa
35 40 45
Xaa?Xaa?Ala?Ile?Xaa?Xaa?Asn?Phe?Xaa?Ile?Phe?Val?Arg?Xaa?Xaa?Xaa
50 55 60
Xaa?Xaa?Xaa?Ser?Thr?Leu?Thr?Leu?Ile?Pro?Leu?Leu?Gly?Xaa?His?Glu
65 70 75 80
Val?Xaa?Phe?Ala?Phe?Val?Xaa?Asp?Glu?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Arg
85 90 95
Xaa?Xaa?Xaa?Leu?Phe?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Ser?Phe?Gln?Gly?Xaa
100 105 110
Xaa?Val?Ala?Xaa?Leu?Tyr?Cys?Phe?Xaa?Asn?Xaa?Glu
115 120
<210>26
<211>205
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(2)..(2)
<223〉the 2nd Xaa is Tyr or Ala or is removed;
<220>
<221>misc_feature
<222>(5)..(5)
<223〉the 5th Xaa is Leu, Ala or Met or be removed;
<220>
<221>misc_feature
<222>(9)..(9)
<223〉the 9th Xaa is Ala or Gly or is removed;
<220>
<221>misc_feature
<222>(12)..(12)
<223〉the 12nd Xaa is Ile, Val or Met or be removed;
<220>
<221>misc_feature
<222>(14)..(14)
<223〉the 14th Xaa is Leu or Val or is removed;
<220>
<221>misc_feature
<222>(15)..(15)
<223〉the 15th Xaa is Arg or Lys or is removed;
<220>
<221>misc_feature
<222>(16)..(16)
<223〉the 16th Xaa is Ala or Ser or is removed;
<220>
<221>misc_feature
<222>(17)..(17)
<223〉the 17th Xaa is Leu or Ser or is removed;
<220>
<221>misc_feature
<222>(19)..(19)
<223〉the 19th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(20)..(20)
<223〉the 20th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(21)..(21)
<223〉the 21st Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(22)..(22)
<223〉the 22nd Xaa is Lys, Arg, Gln, Asp, Glu, Asn or Ile;
<220>
<221>misc_feature
<222>(24)..(24)
<223〉the 24th Xaa is Ala, Gly, Thr, Trp, Val, Arg or Ile;
<220>
<221>misc_feature
<222>(25)..(25)
<223〉the 25th Xaa is Ala, Leu or Val;
<220>
<221>misc_feature
<222>(27)..(27)
<223〉the 27th Xaa is Lys, Arg or Asp;
<220>
<221>misc_feature
<222>(28)..(28)
<223〉the 28th Xaa is Trp, Thr, Gln or Asn;
<220>
<221>misc_feature
<222>(29)..(29)
<223〉the 29th Xaa is Met, Arg or Ser;
<220>
<221>misc_feature
<222>(30)..(30)
<223〉the 30th Xaa is Tyr or Asn;
<220>
<221>misc_feature
<222>(31)..(31)
<223〉the 31st Xaa is Ser or Arg;
<220>
<221>misc_feature
<222>(32)..(32)
<223〉the 32nd Xaa is Thr, Gln or Ala;
<220>
<221>misc_feature
<222>(33)..(33)
<223〉the 33rd Xaa is Lys or Arg or skips;
<220>
<221>misc_feature
<222>(34)..(34)
<223〉the 34th Xaa is Ala, Ile or Ser;
<220>
<221>misc_feature
<222>(35)..(35)
<223〉the 35th Xaa is Ala, Gly or Ile;
<220>
<221>misc_feature
<222>(36)..(36)
<223〉the 36th Xaa is Gln, Asp, Pro, Glu or Ile;
<220>
<221>misc_feature
<222>(37)..(37)
<223〉the 37th Xaa is Gln, Asp, Glu, Ser or Asn;
<220>
<221>misc_feature
<222>(38)..(38)
<223〉the 38th Xaa is His or Leu;
<220>
<221>misc_feature
<222>(39)..(39)
<223〉the 39th Xaa is Gln, Ser, Tyr or Glu;
<220>
<221>misc_feature
<222>(40)..(40)
<223〉the 40th Xaa is Trp, Val or Gln;
<220>
<221>misc_feature
<222>(41)..(41)
<223〉the 41st Xaa is Asp or Ser;
<220>
<221>misc_feature
<222>(42)..(42)
<223〉the 42nd Xaa is Gly, Thr, Val, Ser or Ala;
<220>
<221>misc_feature
<222>(43)..(43)
<223〉the 43rd Xaa is Arg or skips;
<220>
<221>misc_feature
<222>(44)..(44)
<223〉the 44th Xaa is Leu, Trp, Arg, Thr or Tyr;
<220>
<221>misc_feature
<222>(46)..(46)
<223〉the 46th Xaa is Ser or Asp;
<220>
<221>misc_feature
<222>(47)..(47)
<223〉the 47th Xaa is Tyr, Asp or Thr;
<220>
<221>misc_feature
<222>(48)..(48)
<223〉the 48th Xaa is Gln, Glu or Gly;
<220>
<221>misc_feature
<222>(49)..(49)
<223〉the 49th Xaa is Asp, Ala or Thr;
<220>
<221>misc_feature
<222>(50)..(50)
<223〉the 50th Xaa is Ser, Val, Leu or Met;
<220>
<221>misc_feature
<222>(51)..(51)
<223〉the 51st Xaa is Leu, Ala, Thr or Val;
<220>
<221>misc_feature
<222>(52)..(52)
<223〉the 52nd Xaa is Ser, Gly or Ala;
<220>
<221>misc_feature
<222>(53)..(53)
<223〉the 53rd Xaa is Cys or is removed;
<220>
<221>misc_feature
<222>(54)..(54)
<223〉the 54th Xaa is Arg or is removed;
<220>
<221>misc_feature
<222>(55)..(55)
<223〉the 55th Xaa is Leu, Val, Ala or Ser or be removed;
<220>
<221>misc_feature
<222>(56)..(56)
<223〉the 56th Xaa is Val or Ala or is removed;
<220>
<221>misc_feature
<222>(57)..(57)
<223〉the 57th Xaa is Phe, Ala, Thr or Met or be removed;
<220>
<221>misc_feature
<222>(58)..(58)
<223〉the 58th Xaa is Leu or Val or is removed;
<220>
<221>misc_feature
<222>(59)..(59)
<223〉the 59th Xaa is Leu, Phe or Met or be removed;
<220>
<221>misc_feature
<222>(63)..(63)
<223〉the 63rd Xaa is Cys, Gly or Ser or be removed;
<220>
<221>misc_feature
<222>(64)..(64)
<223〉the 64th Xaa is Val, Ile or Met or be removed;
<220>
<221>misc_feature
<222>(65)..(65)
<223〉the 65th Xaa is Ala, Val, Met or Ile or be removed;
<220>
<221>misc_feature
<222>(69)..(69)
<223〉the 69th Xaa is Tyr or Cys or is removed;
<220>
<221>misc_feature
<222>(76)..(76)
<223〉the 76th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(79)..(79)
<223〉the 79th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(80)..(80)
<223〉the 80th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(81)..(81)
<223〉the 81st Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(83)..(83)
<223〉the 83rd Xaa is Arg or Ser or is removed;
<220>
<221>misc_feature
<222>(86)..(86)
<223〉the 86th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(87)..(87)
<223〉the 87th Xaa is Ser, Gly or Cys or be removed;
<220>
<221>misc_feature
<222>(92)..(92)
<223〉the 92nd Xaa is Val or Ala or is removed;
<220>
<221>misc_feature
<222>(94)..(94)
<223〉the 94th Xaa is Leu or Met or is removed;
<220>
<221>misc_feature
<222>(98)..(98)
<223〉the 98th Xaa is Val, Leu or Ile or be removed;
<220>
<221>misc_feature
<222>(101)..(101)
<223〉the 101st Xaa is Gly, Ala, Met or Val or be removed;
<220>
<221>misc_feature
<222>(102)..(102)
<223〉the 102nd Xaa is Ile, Val, Thr or Ala or be removed;
<220>
<221>misc_feature
<222>(103)..(103)
<223〉the 103rd Xaa is Val or is removed;
<220>
<221>misc_feature
<222>(104)..(104)
<223〉the 104th Xaa is Lys or is removed;
<220>
<221>misc_feature
<222>(105)..(105)
<223〉the 105th Xaa is Tyr or Cys;
<220>
<221>misc_feature
<222>(107)..(107)
<223〉the 107th Xaa is Tyr or Phe;
<220>
<221>misc_feature
<222>(109)..(109)
<223〉the 109th Xaa is Asp or Asn;
<220>
<221>misc_feature
<222>(110)..(110)
<223〉the 110th Xaa is Glu or Val;
<220>
<221>misc_feature
<222>(111)..(111)
<223〉the 111st Xaa is Gly, Gln, Glu or Asp;
<220>
<221>misc_feature
<222>(114)..(114)
<223〉the 114th Xaa is Thr, Glu or Ser;
<220>
<221>misc_feature
<222>(115)..(115)
<223〉the 115th Xaa is Arg or Ser;
<220>
<221>misc_feature
<222>(117)..(117)
<223〉the 117th Xaa is Ser, Asp, Asn or Met;
<220>
<221>misc_feature
<222>(120)..(120)
<223〉the 120th Xaa is Asn or Gly or is removed;
<220>
<221>misc_feature
<222>(121)..(121)
<223〉the 121st Xaa is Tyr or Phe or is removed;
<220>
<221>misc_feature
<222>(123)..(123)
<223〉the 123rd Xaa is Leu or Trp or is removed;
<220>
<221>misc_feature
<222>(125)..(125)
<223〉the 125th Xaa is Ile or Leu or is removed;
<220>
<221>misc_feature
<222>(127)..(127)
<223〉the 127th Xaa is Leu, Phe, Ile or Ser or be removed;
<220>
<221>misc_feature
<222>(129)..(129)
<223〉the 129th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(130)..(130)
<223〉the 130th Xaa is Leu or Phe or is removed;
<220>
<221>misc_feature
<222>(131)..(131)
<223〉the 131st Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(134)..(134)
<223〉the 134th Xaa is Gly or Leu or is removed;
<220>
<221>misc_feature
<222>(135)..(135)
<223〉the 135th Xaa is Val or Ile or is removed;
<220>
<221>misc_feature
<222>(138)..(138)
<223〉the 138th Xaa is Leu, Phe or Ile or be removed;
<220>
<221>misc_feature
<222>(143)..(143)
<223〉the 143rd Xaa is Val or Ile or is removed;
<220>
<221>misc_feature
<222>(144)..(144)
<223〉the 144th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(145)..(145)
<223〉the 145th Xaa is Gln or Cys or is removed;
<220>
<221>misc_feature
<222>(146)..(146)
<223〉the 146th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(147)..(147)
<223〉the 147th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(148)..(148)
<223〉the 148th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(159)..(159)
<223〉the 159th Xaa is Thr, Val or Ile or be removed;
<220>
<221>misc_feature
<222>(163)..(163)
<223〉the 163rd Xaa is Ile, Val, Leu or Ala or be removed;
<220>
<221>misc_feature
<222>(168)..(168)
<223〉the 168th Xaa is Met, Thr, Ile or Ala or be removed;
<220>
<221>misc_feature
<222>(171)..(171)
<223〉the 171st Xaa is His, Pro, Gln or Thr;
<220>
<221>misc_feature
<222>(172)..(172)
<223〉the 172nd Xaa is Ala, Lys, Val or Thr;
<220>
<221>misc_feature
<222>(173)..(173)
<223〉the 173rd Xaa is Arg, Lys, Gln or Glu;
<220>
<221>misc_feature
<222>(174)..(174)
<223〉the 174th Xaa is Gly or Ser;
<220>
<221>misc_feature
<222>(175)..(175)
<223〉the 175th Xaa is Thr, Leu, Phe or Ala;
<220>
<221>misc_feature
<222>(178)..(178)
<223〉the 178th Xaa is Phe, Ser or Leu;
<220>
<221>misc_feature
<222>(179)..(179)
<223〉the 179th Xaa is Ile, Ala, Val or Thr;
<220>
<221>misc_feature
<222>(180)..(180)
<223〉the 180th Xaa is Lys or Arg;
<220>
<221>misc_feature
<222>(183)..(183)
<223〉the 183rd Xaa is Thr, Phe, Tyr or Ile;
<220>
<221>misc_feature
<222>(184)..(184)
<223〉the 184th Xaa is Glu, Asp, Gln or Asn;
<220>
<221>misc_feature
<222>(186)..(186)
<223〉the 186th Xaa is Ser, Phe or Leu or removal Leu;
<220>
<221>misc_feature
<222>(187)..(187)
<223〉the 187th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(188)..(188)
<223〉the 188th Xaa is Thr, Ser or Gly or be removed;
<220>
<221>misc_feature
<222>(193)..(193)
<223〉the 193rd Xaa is Leu or Met or is removed;
<220>
<221>misc_feature
<222>(194)..(194)
<223〉the 194th Xaa is Met or Leu or is removed;
<220>
<221>misc_feature
<222>(197)..(197)
<223〉the 197th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(202)..(202)
<223〉the 202nd Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(204)..(204)
<223〉the 204th Xaa is Asn or Lys or is removed;
<400>26
Asn?Xaa?Ile?His?Xaa?Asn?Leu?Phe?Xaa?Ser?Phe?Xaa?Leu?Xaa?Xaa?Xaa
1 5 10 15
Xaa?Ser?Xaa?Xaa?Xaa?Xaa?Asp?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa
20 25 30
Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Xaa?Xaa?Xaa
35 40 45
Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Met?Gln?Tyr?Xaa?Xaa
50 55 60
Xaa?Ala?Asn?Tyr?Xaa?Trp?Leu?Leu?Val?Glu?Gly?Xaa?Tyr?Leu?Xaa?Xaa
65 70 75 80
Xaa?Phe?Xaa?Leu?Tyr?Xaa?Xaa?Ile?Gly?Trp?Gly?Xaa?Pro?Xaa?Leu?Phe
85 90 95
Val?Xaa?Pro?Trp?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Xaa?Glu?Xaa?Xaa?Xaa?Cys
100 105 110
Trp?Xaa?Xaa?Asn?Xaa?Asn?Met?Xaa?Xaa?Trp?Xaa?Ile?Xaa?Arg?Xaa?Pro
115 120 125
Xaa?Xaa?Xaa?Ala?Ile?Xaa?Xaa?Asn?Phe?Xaa?Ile?Phe?Val?Arg?Xaa?Xaa
130 135 140
Xaa?Xaa?Xaa?Xaa?Ser?Thr?Leu?Thr?Leu?Ile?Pro?Leu?Leu?Gly?Xaa?His
145 150 155 160
Glu?Val?Xaa?Phe?Ala?Phe?Val?Xaa?Asp?Glu?Xaa?Xaa?Xaa?Xaa?Xaa?Leu
165 170 175
Arg?Xaa?Xaa?Xaa?Leu?Phe?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Ser?Phe?Gln?Gly
180 185 190
Xaa?Xaa?Val?Ala?Xaa?Leu?Tyr?Cys?Phe?Xaa?Asn?Xaa?Glu
195 200 205
<210>27
<211>203
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(123)..(123)
<223〉the 123rd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(124)..(124)
<223〉the 124th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(125)..(125)
<223〉the 125th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(127)..(127)
<223〉the 127th Xaa is Tyr or Ala or is removed;
<220>
<221>misc_feature
<222>(130)..(130)
<223〉the 130th Xaa is Leu, Ala or Met or be removed;
<220>
<221>misc_feature
<222>(134)..(134)
<223〉the 134th Xaa is Ala or Gly or is removed;
<220>
<221>misc_feature
<222>(137)..(137)
<223〉the 137th Xaa is Ile, Val or Met or be removed;
<220>
<221>misc_feature
<222>(139)..(139)
<223〉the 139th Xaa is Leu or Val or is removed;
<220>
<221>misc_feature
<222>(140)..(140)
<223〉the 140th Xaa is Arg or Lys or is removed;
<220>
<221>misc_feature
<222>(141)..(141)
<223〉the 141st Xaa is Ala or Ser or is removed;
<220>
<221>misc_feature
<222>(142)..(142)
<223〉the 142nd Xaa is Leu or Ser or is removed;
<220>
<221>misc_feature
<222>(144)..(144)
<223〉the 144th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(145)..(145)
<223〉the 145th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(146)..(146)
<223〉the 146th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(147)..(147)
<223〉the 147th Xaa is Lys, Arg, Gln, Asp, Glu, Asn or Ile;
<220>
<221>misc_feature
<222>(149)..(149)
<223〉the 149th Xaa is Ala, Gly, Thr, Trp, Val, Arg or Ile;
<220>
<221>misc_feature
<222>(150)..(150)
<223〉the 150th Xaa is Ala, Leu or Val;
<220>
<221>misc_feature
<222>(152)..(152)
<223〉the 152nd Xaa is Lys, Arg or Asp;
<220>
<221>misc_feature
<222>(153)..(153)
<223〉the 153rd Xaa is Trp, Thr, Gln or Asn;
<220>
<221>misc_feature
<222>(154)..(154)
<223〉the 154th Xaa is Met, Arg or Ser;
<220>
<221>misc_feature
<222>(155)..(155)
<223〉the 155th Xaa is Tyr or Asn;
<220>
<221>misc_feature
<222>(156)..(156)
<223〉the 156th Xaa is Ser or Arg;
<220>
<221>misc_feature
<222>(157)..(157)
<223〉the 157th Xaa is Thr, Gln or Ala;
<220>
<221>misc_feature
<222>(158)..(158)
<223〉the 158th Xaa is Lys or Arg or skips;
<220>
<221>misc_feature
<222>(159)..(159)
<223〉the 159th Xaa is Ala, Ile or Ser;
<220>
<221>misc_feature
<222>(160)..(160)
<223〉the 160th Xaa is Ala, Gly or Ile;
<220>
<221>misc_feature
<222>(161)..(161)
<223〉the 161st Xaa is Gln, Asp, Pro, Glu or Ile;
<220>
<221>misc_feature
<222>(162)..(162)
<223〉the 162nd Xaa is Gln, Asp, Glu, Ser or Asn;
<220>
<221>misc_feature
<222>(163)..(163)
<223〉the 163rd Xaa is His or Leu;
<220>
<221>misc_feature
<222>(164)..(164)
<223〉the 164th Xaa is Gln, Ser, Tyr or Glu;
<220>
<221>misc_feature
<222>(165)..(165)
<223〉the 165th Xaa is Trp, Val or Gln;
<220>
<221>misc_feature
<222>(166)..(166)
<223〉the 166th Xaa is Asp or Ser;
<220>
<221>misc_feature
<222>(167)..(167)
<223〉the 167th Xaa is Gly, Thr, Val, Ser or Ala;
<220>
<221>misc_feature
<222>(168)..(168)
<223〉the 168th Xaa is Arg or skips;
<220>
<221>misc_feature
<222>(169)..(169)
<223〉the 169th Xaa is Leu, Trp, Arg, Thr or Tyr;
<220>
<221>misc_feature
<222>(171)..(171)
<223〉the 171st Xaa is Ser or Asp;
<220>
<221>misc_feature
<222>(172)..(172)
<223〉the 172nd Xaa is Tyr, Asp or Thr;
<220>
<221>misc_feature
<222>(173)..(173)
<223〉the 173rd Xaa is Gln, Glu or Gly;
<220>
<221>misc_feature
<222>(174)..(174)
<223〉the 174th Xaa is Asp, Ala or Thr;
<220>
<221>misc_feature
<222>(175)..(175)
<223〉the 175th Xaa is Ser, Val, Leu or Met;
<220>
<221>misc_feature
<222>(176)..(176)
<223〉the 176th Xaa is Leu, Ala, Thr or Val;
<220>
<221>misc_feature
<222>(177)..(177)
<223〉the 177th Xaa is Ser, Gly or Ala;
<220>
<221>misc_feature
<222>(178)..(178)
<223〉the 178th Xaa is Cys or is removed;
<220>
<221>misc_feature
<222>(179)..(179)
<223〉the 179th Xaa is Arg or is removed;
<220>
<221>misc_feature
<222>(180)..(180)
<223〉the 180th Xaa is Leu, Val, Ala or Ser or be removed;
<220>
<221>misc_feature
<222>(181)..(181)
<223〉the 181st Xaa is Val or Ala or is removed;
<220>
<221>misc_feature
<222>(182)..(182)
<223〉the 182nd Xaa is Phe, Ala, Thr or Met or be removed;
<220>
<221>misc_feature
<222>(183)..(183)
<223〉the 183rd Xaa is Leu or Val or is removed;
<220>
<221>misc_feature
<222>(184)..(184)
<223〉the 184th Xaa is Leu, Phe or Met or be removed;
<220>
<221>misc_feature
<222>(188)..(188)
<223〉the 188th Xaa is Cys, Gly or Ser or be removed;
<220>
<221>misc_feature
<222>(189)..(189)
<223〉the 189th Xaa is Val, Ile or Met or be removed;
<220>
<221>misc_feature
<222>(190)..(190)
<223〉the 190th Xaa is Ala, Val, Met or Ile or be removed;
<220>
<221>misc_feature
<222>(194)..(194)
<223〉the 194th Xaa is Tyr or Cys or is removed;
<220>
<221>misc_feature
<222>(201)..(201)
<223〉the 102nd Xaa is Val or Leu or is removed;
<400>27
Arg?Pro?Gln?Gly?Ala?Thr?Val?Ser?Leu?Trp?Glu?Thr?Val?Gln?Lys?Trp
1 5 10 15
Arg?Glu?Tyr?Arg?Arg?Gln?Cys?Gln?Arg?Ser?Leu?Thr?Glu?Asp?Pro?Pro
20 25 30
Pro?Ala?Thr?Asp?Leu?Phe?Cys?Asn?Arg?Thr?Phe?Asp?Glu?Tyr?Ala?Cys
35 40 45
Trp?Pro?Asp?Gly?Glu?Pro?Gly?Ser?Phe?Val?Asn?Val?Ser?Cys?Pro?Trp
50 55 60
Tyr?Leu?Pro?Trp?Ala?Ser?Ser?Val?Pro?Gln?Gly?His?Val?Tyr?Arg?Phe
65 70 75 80
Cys?Thr?Ala?Glu?Gly?Leu?Trp?Leu?Gln?Lys?Asp?Asn?Ser?Ser?Leu?Pro
85 90 95
Trp?Arg?Asp?Leu?Ser?Glu?Cys?Glu?Glu?Ser?Lys?Arg?Gly?Glu?Arg?Ser
100 105 110
Ser?Pro?Glu?Glu?Gln?Leu?Leu?Phe?Leu?Tyr?Xaa?Xaa?Xaa?Asn?Xaa?Ile
115 120 125
His?Xaa?Asn?Leu?Phe?Xaa?Ser?Phe?Xaa?Leu?Xaa?Xaa?Xaa?Xaa?Ser?Xaa
130 135 140
Xaa?Xaa?Xaa?Asp?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa
145 150 155 160
Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa
165 170 175
Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Met?Gln?Tyr?Xaa?Xaa?Xaa?Ala?Asn
180 185 190
Tyr?Xaa?Trp?Leu?Leu?Val?Glu?Gly?Xaa?Tyr?Leu
195 200
<210>28
<211>189
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(123)..(123)
<223〉the 123rd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(124)..(124)
<223〉the 124th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(125)..(125)
<223〉the 125th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(127)..(127)
<223〉the 127th Xaa is Arg or Ser or is removed;
<220>
<221>misc_feature
<222>(130)..(130)
<223〉the 130th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(131)..(131)
<223〉the 131st Xaa is Ser, Gly or Cys or be removed;
<220>
<221>misc_feature
<222>(136)..(136)
<223〉the 136th Xaa is Val or Ala or is removed;
<220>
<221>misc_feature
<222>(138)..(138)
<223〉the 138th Xaa is Leu or Met or is removed;
<220>
<221>misc_feature
<222>(142)..(142)
<223〉the 142nd Xaa is Val, Leu or Ile or be removed;
<220>
<221>misc_feature
<222>(145)..(145)
<223〉the 145th Xaa is Gly, Ala, Met or Val or be removed;
<220>
<221>misc_feature
<222>(146)..(146)
<223〉the 146th Xaa is Ile, Val, Thr or Ala or be removed;
<220>
<221>misc_feature
<222>(147)..(147)
<223〉the 147th Xaa is Val or is removed;
<220>
<221>misc_feature
<222>(148)..(148)
<223〉the 148th Xaa is Lys or is removed;
<220>
<221>misc_feature
<222>(149)..(149)
<223〉the 149th Xaa is Tyr or Cys;
<220>
<221>misc_feature
<222>(151)..(151)
<223〉the 151st Xaa is Tyr or Phe;
<220>
<221>misc_feature
<222>(153)..(153)
<223〉the 153rd Xaa is Asp or Asn;
<220>
<221>misc_feature
<222>(154)..(154)
<223〉the 154th Xaa is Glu or Val;
<220>
<221>misc_feature
<222>(155)..(155)
<223〉the 155th Xaa is Gly, Gln, Glu or Asp;
<220>
<221>misc_feature
<222>(158)..(158)
<223〉the 158th Xaa is Thr, Glu or Ser;
<220>
<221>misc_feature
<222>(159)..(159)
<223〉the 159th Xaa is Arg or Ser;
<220>
<221>misc_feature
<222>(161)..(161)
<223〉the 161st Xaa is Ser, Asp, Asn or Met;
<220>
<221>misc_feature
<222>(164)..(164)
<223〉the 164th Xaa is Asn or Gly or is removed;
<220>
<221>misc_feature
<222>(165)..(165)
<223〉the 165th Xaa is Tyr or Phe or is removed;
<220>
<221>misc_feature
<222>(167)..(167)
<223〉the 167th Xaa is Leu or Trp or is removed;
<220>
<221>misc_feature
<222>(169)..(169)
<223〉the 169th Xaa is Ile or Leu or is removed;
<220>
<221>misc_feature
<222>(171)..(171)
<223〉the 171st Xaa is Leu, Phe, Ile or Ser or be removed;
<220>
<221>misc_feature
<222>(173)..(173)
<223〉the 173rd Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(174)..(174)
<223〉the 174th Xaa is Leu or Phe or is removed;
<220>
<221>misc_feature
<222>(175)..(175)
<223〉the 175th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(178)..(178)
<223〉the 178th Xaa is Gly or Leu or is removed;
<220>
<221>misc_feature
<222>(179)..(179)
<223〉the 179th Xaa is Val or Ile or is removed;
<220>
<221>misc_feature
<222>(182)..(182)
<223〉the 182nd Xaa is Leu, Phe or Ile or be removed;
<220>
<221>misc_feature
<222>(187)..(187)
<223〉the 187th Xaa is Val or Ile or is removed;
<220>
<221>misc_feature
<222>(188)..(188)
<223〉the 188th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(189)..(189)
<223〉the 189th Xaa is Gln or Cys or is removed;
<400>28
Arg?Pro?Gln?Gly?Ala?Thr?Val?Ser?Leu?Trp?Glu?Thr?Val?Gln?Lys?Trp
1 5 10 15
Arg?Glu?Tyr?Arg?Arg?Gln?Cys?Gln?Arg?Ser?Leu?Thr?Glu?Asp?Pro?Pro
20 25 30
ro?Ala?Thr?Asp?Leu?Phe?Cys?Asn?Arg?Thr?Phe?Asp?Glu?Tyr?Ala?Cys
35 40 45
Trp?Pro?Asp?Gly?Glu?Pro?Gly?Ser?Phe?Val?Asn?Val?Ser?Cys?Pro?Trp
50 55 60
Tyr?Leu?Pro?Trp?Ala?Ser?Ser?Val?Pro?Gln?Gly?His?Val?Tyr?Arg?Phe
65 70 75 80
Cys?Thr?Ala?Glu?Gly?Leu?Trp?Leu?Gln?Lys?Asp?Asn?Ser?Ser?Leu?Pro
85 90 95
Trp?Arg?Asp?Leu?Ser?Glu?Cys?Glu?Glu?Ser?Lys?Arg?Gly?Glu?Arg?Ser
100 105 110
Ser?Pro?Glu?Glu?Gln?Leu?Leu?Phe?Leu?Tyr?Xaa?Xaa?Xaa?Phe?Xaa?Leu
115 120 125
Tyr?Xaa?Xaa?Ile?Gly?Trp?Gly?Xaa?Pro?Xaa?Leu?Phe?Val?Xaa?Pro?Trp
130 135 140
Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Xaa?Glu?Xaa?Xaa?Xaa?Cys?Trp?Xaa?Xaa?Asn
145 150 155 160
Xaa?Asn?Met?Xaa?Xaa?Trp?Xaa?Ile?Xaa?Arg?Xaa?Pro?Xaa?Xaa?Xaa?Ala
165 170 175
Ile?Xaa?Xaa?Asn?Phe?Xaa?Ile?Phe?Val?Arg?Xaa?Xaa?Xaa
180 185
<210>29
<211>182
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(123)..(123)
<223〉the 123rd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(124)..(124)
<223〉the 124th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(125)..(125)
<223〉the 125th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(136)..(136)
<223〉the 136th Xaa is Thr, Val or Ile or be removed;
<220>
<221>misc_feature
<222>(140)..(140)
<223〉the 140th Xaa is Ile, Val, Leu or Ala or be removed;
<220>
<221>misc_feature
<222>(145)..(145)
<223〉the 145th Xaa is Met, Thr, Ile or Ala or be removed;
<220>
<221>misc_feature
<222>(148)..(148)
<223〉the 148th Xaa is His, Pro, Gln or Thr;
<220>
<221>misc_feature
<222>(149)..(149)
<223〉the 149th Xaa is Ala, Lys, Val or Thr;
<220>
<221>misc_feature
<222>(150)..(150)
<223〉the 150th Xaa is Arg, Lys, Gln or Glu;
<220>
<221>misc_feature
<222>(151)..(151)
<223〉the 151st Xaa is Gly or Ser;
<220>
<221>misc_feature
<222>(152)..(152)
<223〉the 152nd Xaa is Thr, Leu, Phe or Ala;
<220>
<221>misc_feature
<222>(155)..(155)
<223〉the 155th Xaa is Phe, Ser or Leu;
<220>
<221>misc_feature
<222>(156)..(156)
<223〉the 156th Xaa is Ile, Ala, Val or Thr;
<220>
<221>misc_feature
<222>(157)..(157)
<223〉the 157th Xaa is Lys or Arg;
<220>
<221>misc_feature
<222>(160)..(160)
<223〉the 160th Xaa is Thr, Phe, Tyr or Ile;
<220>
<221>misc_feature
<222>(161)..(161)
<223〉the 161st Xaa is Glu, Asp, Gln or Asn;
<220>
<221>misc_feature
<222>(163)..(163)
<223〉the 163rd Xaa is Ser, Phe or Leu or removal Leu;
<220>
<221>misc_feature
<222>(164)..(164)
<223〉the 164th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(165)..(165)
<223〉the 165th Xaa is Thr, Ser or Gly or be removed;
<220>
<221>misc_feature
<222>(170)..(170)
<223〉the 170th Xaa is Leu or Met or is removed;
<220>
<221>misc_feature
<222>(171)..(171)
<223〉the 171st Xaa is Met or Leu or is removed;
<220>
<221>misc_feature
<222>(174)..(174)
<223〉the 174th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(179)..(179)
<223〉the 179th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(181)..(181)
<223〉the 181st Xaa is Asn or Lys or is removed;
<400>29
Arg?Pro?Gln?Gly?Ala?Thr?Val?Ser?Leu?Trp?Glu?Thr?Val?Gln?Lys?Trp
1 5 10 15
Arg?Glu?Tyr?Arg?Arg?Gln?Cys?Gln?Arg?Ser?Leu?Thr?Glu?Asp?Pro?Pro
20 25 30
Pro?Ala?Thr?Asp?Leu?Phe?Cys?Asn?Arg?Thr?Phe?Asp?Glu?Tyr?Ala?Cys
35 40 45
Trp?Pro?Asp?Gly?Glu?Pro?Gly?Ser?Phe?Val?Asn?Val?Ser?Cys?Pro?Trp
50 55 60
Tyr?Leu?Pro?Trp?Ala?Ser?Ser?Val?Pro?Gln?Gly?His?Val?Tyr?Arg?Phe
65 70 75 80
Cys?Thr?Ala?Glu?Gly?Leu?Trp?Leu?Gln?Lys?Asp?Asn?Ser?Ser?Leu?Pro
85 90 95
Trp?Arg?Asp?Leu?Ser?Glu?Cys?Glu?Glu?Ser?Lys?Arg?Gly?Glu?Arg?Ser
100 105 110
Ser?Pro?Glu?Glu?Gln?Leu?Leu?Phe?Leu?Tyr?Xaa?Xaa?Xaa?Ser?Thr?Leu
115 120 125
Thr?Leu?Ile?Pro?Leu?Leu?Gly?Xaa?His?Glu?Val?Xaa?Phe?Ala?Phe?Val
130 135 140
Xaa?Asp?Glu?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Arg?Xaa?Xaa?Xaa?Leu?Phe?Xaa
145 150 155 160
Xaa?Leu?Xaa?Xaa?Xaa?Ser?Phe?Gln?Gly?Xaa?Xaa?Val?Ala?Xaa?Leu?Tyr
165 170 175
Cys?Phe?Xaa?Asn?Xaa?Glu
180
<210>30
<211>270
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(123)..(123)
<223〉the 123rd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(124)..(124)
<223〉the 124th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(125)..(125)
<223〉the 125th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(127)..(127)
<223〉the 127th Xaa is Tyr or Ala or is removed;
<220>
<221>misc_feature
<222>(130)..(130)
<223〉the 130th Xaa is Leu, Ala or Met or be removed;
<220>
<221>misc_feature
<222>(134)..(134)
<223〉the 134th Xaa is Ala or Gly or is removed;
<220>
<221>misc_feature
<222>(137)..(137)
<223〉the 137th Xaa is Ile, Val or Met or be removed;
<220>
<221>misc_feature
<222>(139)..(139)
<223〉the 139th Xaa is Leu or Val or is removed;
<220>
<221>misc_feature
<222>(140)..(140)
<223〉the 140th Xaa is Arg or Lys or is removed;
<220>
<221>misc_feature
<222>(141)..(141)
<223〉the 141st Xaa is Ala or Ser or is removed;
<220>
<221>misc_feature
<222>(142)..(142)
<223〉the 142nd Xaa is Leu or Ser or is removed;
<220>
<221>misc_feature
<222>(144)..(144)
<223〉the 144th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(145)..(145)
<223〉the 145th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(146)..(146)
<223〉the 146th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(147)..(147)
<223〉the 147th Xaa is Lys, Arg, Gln, Asp, Glu, Asn or Ile;
<220>
<221>misc_feature
<222>(149)..(149)
<223〉the 149th Xaa is Ala, Gly, Thr, Trp, Val, Arg or Ile;
<220>
<221>misc_feature
<222>(150)..(150)
<223〉the 150th Xaa is Ala, Leu or Val;
<220>
<221>misc_feature
<222>(152)..(152)
<223〉the 152nd Xaa is Lys, Arg or Asp;
<220>
<221>misc_feature
<222>(153)..(153)
<223〉the 153rd Xaa is Trp, Thr, Gln or Asn;
<220>
<221>misc_feature
<222>(154)..(154)
<223〉the 154th Xaa is Met, Arg or Ser;
<220>
<221>misc_feature
<222>(155)..(155)
<223〉the 155th Xaa is Tyr or Asn;
<220>
<221>misc_feature
<222>(156)..(156)
<223〉the 156th Xaa is Ser or Arg;
<220>
<221>misc_feature
<222>(157)..(157)
<223〉the 157th Xaa is Thr, Gln or Ala;
<220>
<221>misc_feature
<222>(158)..(158)
<223〉the 158th Xaa is Lys or Arg or skips;
<220>
<221>misc_feature
<222>(159)..(159)
<223〉the 159th Xaa is Ala, Ile or Ser;
<220>
<221>misc_feature
<222>(160)..(160)
<223〉the 160th Xaa is Ala, Gly or Ile;
<220>
<221>misc_feature
<222>(161)..(161)
<223〉the 161st Xaa is Gln, Asp, Pro, Glu or Ile;
<220>
<221>misc_feature
<222>(162)..(162)
<223〉the 162nd Xaa is Gln, Asp, Glu, Ser or Asn;
<220>
<221>misc_feature
<222>(163)..(163)
<223〉the 163rd Xaa is His or Leu;
<220>
<221>misc_feature
<222>(164)..(164)
<223〉the 164th Xaa is Gln, Ser, Tyr or Glu;
<220>
<221>misc_feature
<222>(165)..(165)
<223〉the 165th Xaa is Trp, Val or Gln;
<220>
<221>misc_feature
<222>(166)..(166)
<223〉the 166th Xaa is Asp or Ser;
<220>
<221>misc_feature
<222>(167)..(167)
<223〉the 167th Xaa is Gly, Thr, Val, Ser or Ala;
<220>
<221>misc_feature
<222>(168)..(168)
<223〉the 168th Xaa is Arg or skips;
<220>
<221>misc_feature
<222>(169)..(169)
<223〉the 169th Xaa is Leu, Trp, Arg, Thr or Tyr;
<220>
<221>misc_feature
<222>(171)..(171)
<223〉the 171st Xaa is Ser or Asp;
<220>
<221>misc_feature
<222>(172)..(172)
<223〉the 172nd Xaa is Tyr, Asp or Thr;
<220>
<221>misc_feature
<222>(173)..(173)
<223〉the 173rd Xaa is Gln, Glu or Gly;
<220>
<221>misc_feature
<222>(174)..(174)
<223〉the 174th Xaa is Asp, Ala or Thr;
<220>
<221>misc_feature
<222>(175)..(175)
<223〉the 175th Xaa is Ser, Val, Leu or Met;
<220>
<221>misc_feature
<222>(176)..(176)
<223〉the 176th Xaa is Leu, Ala, Thr or Val;
<220>
<221>misc_feature
<222>(177)..(177)
<223〉the 177th Xaa is Ser, Gly or Ala;
<220>
<221>misc_feature
<222>(178)..(178)
<223〉the 178th Xaa is Cys or is removed;
<220>
<221>misc_feature
<222>(179)..(179)
<223〉the 179th Xaa is Arg or is removed;
<220>
<221>misc_feature
<222>(180)..(180)
<223〉the 180th Xaa is Leu, Val, Ala or Ser or be removed;
<220>
<221>misc_feature
<222>(181)..(181)
<223〉the 181st Xaa is Val or Ala or is removed;
<220>
<221>misc_feature
<222>(182)..(182)
<223〉the 182nd Xaa is Phe, Ala, Thr or Met or be removed;
<220>
<221>misc_feature
<222>(183)..(183)
<223〉the 183rd Xaa is Leu or Val or is removed;
<220>
<221>misc_feature
<222>(184)..(184)
<223〉the 184th Xaa is Leu, Phe or Met or be removed;
<220>
<221>misc_feature
<222>(188)..(188)
<223〉the 188th Xaa is Cys, Gly or Ser or be removed;
<220>
<221>misc_feature
<222>(189)..(189)
<223〉the 189th Xaa is Val, Ile or Met or be removed;
<220>
<221>misc_feature
<222>(190)..(190)
<223〉the 190th Xaa is Ala, Val, Met or Ile or be removed;
<220>
<221>misc_feature
<222>(194)..(194)
<223〉the 194th Xaa is Tyr or Cys or is removed;
<220>
<221>misc_feature
<222>(201)..(201)
<223〉the 201st Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(204)..(204)
<223〉the 204th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(205)..(205)
<223〉the 205th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(206)..(206)
<223〉the 206th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(208)..(208)
<223〉the 208th Xaa is Arg or Ser or is removed;
<220>
<221>misc_feature
<222>(211)..(211)
<223〉the 211st Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(212)..(212)
<223〉the 212nd Xaa is Ser, Gly or Cys or be removed;
<220>
<221>misc_feature
<222>(217)..(217)
<223〉the 217th Xaa is Val or Ala or is removed;
<220>
<221>misc_feature
<222>(219)..(219)
<223〉the 219th Xaa is Leu or Met or is removed;
<220>
<221>misc_feature
<222>(223)..(223)
<223〉the 223rd Xaa is Val, Leu or Ile or be removed;
<220>
<221>misc_feature
<222>(226)..(226)
<223〉the 226th Xaa is Gly, Ala, Met or Val or be removed;
<220>
<221>misc_feature
<222>(227)..(227)
<223〉the 227th Xaa is Ile, Val, Thr or Ala or be removed;
<220>
<221>misc_feature
<222>(228)..(228)
<223〉the 228th Xaa is Val or is removed;
<220>
<221>misc_feature
<222>(229)..(229)
<223〉the 229th Xaa is Lys or is removed;
<220>
<221>misc_feature
<222>(230)..(230)
<223〉the 230th Xaa is Tyr or Cys;
<220>
<221>misc_feature
<222>(232)..(232)
<223〉the 232nd Xaa is Tyr or Phe;
<220>
<221>misc_feature
<222>(234)..(234)
<223〉the 234th Xaa is Asp or Asn;
<220>
<221>misc_feature
<222>(235)..(235)
<223〉the 235th Xaa is Glu or Val;
<220>
<221>misc_feature
<222>(236)..(236)
<223〉the 236th Xaa is Gly, Gln, Glu or Asp;
<220>
<221>misc_feature
<222>(239)..(239)
<223〉the 239th Xaa is Thr, Glu or Ser;
<220>
<221>misc_feature
<222>(240)..(240)
<223〉the 240th Xaa is Arg or Ser;
<220>
<221>misc_feature
<222>(242)..(242)
<223〉the 242nd Xaa is Ser, Asp, Asn or Met;
<220>
<221>misc_feature
<222>(245)..(245)
<223〉the 245th Xaa is Asn or Gly or is removed;
<220>
<221>misc_feature
<222>(246)..(246)
<223〉the 246th Xaa is Tyr or Phe or is removed;
<220>
<221>misc_feature
<222>(248)..(248)
<223〉the 248th Xaa is Leu or Trp or is removed;
<220>
<221>misc_feature
<222>(250)..(250)
<223〉the 250th Xaa is Ile or Leu or is removed;
<220>
<221>misc_feature
<222>(252)..(252)
<223〉the 252nd Xaa is Leu, Phe, Ile or Ser or be removed;
<220>
<221>misc_feature
<222>(254)..(254)
<223〉the 254th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(255)..(255)
<223〉the 255th Xaa is Leu or Phe or is removed;
<220>
<221>misc_feature
<222>(256)..(256)
<223〉the 256th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(259)..(259)
<223〉the 259th Xaa is Gly or Leu or is removed;
<220>
<221>misc_feature
<222>(260)..(260)
<223〉the 260th Xaa is Val or Ile or is removed;
<220>
<221>misc_feature
<222>(263)..(263)
<223〉the 263rd Xaa is Leu, Phe or Ile or be removed;
<220>
<221>misc_feature
<222>(268)..(268)
<223〉the 268th Xaa is Val or Ile or is removed;
<220>
<221>misc_feature
<222>(269)..(269)
<223〉the 269th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(270)..(270)
<223〉the 270th Xaa is Gln or Cys or is removed;
<400>30
Arg?Pro?Gln?Gly?Ala?Thr?Val?Ser?Leu?Trp?Glu?Thr?Val?Gln?Lys?Trp
1 5 10 15
Arg?Glu?Tyr?Arg?Arg?Gln?Cys?Gln?Arg?Ser?Leu?Thr?Glu?Asp?Pro?Pro
20 25 30
Pro?Ala?Thr?Asp?Leu?Phe?Cys?Asn?Arg?Thr?Phe?Asp?Glu?Tyr?Ala?Cys
35 40 45
Trp?Pro?Asp?Gly?Glu?Pro?Gly?Ser?Phe?Val?Asn?Val?Ser?Cys?Pro?Trp
50 55 60
Tyr?Leu?Pro?Trp?Ala?Ser?Ser?Val?Pro?Gln?Gly?His?Val?Tyr?Arg?Phe
65 70 75 80
Cys?Thr?Ala?Glu?Gly?Leu?Trp?Leu?Gln?Lys?Asp?Asn?Ser?Ser?Leu?Pro
85 90 95
Trp?Arg?Asp?Leu?Ser?Glu?Cys?Glu?Glu?Ser?Lys?Arg?Gly?Glu?Arg?Ser
100 105 110
Ser?Pro?Glu?Glu?Gln?Leu?Leu?Phe?Leu?Tyr?Xaa?Xaa?Xaa?Asn?Xaa?Ile
115 120 125
His?Xaa?Asn?Leu?Phe?Xaa?Ser?Phe?Xaa?Leu?Xaa?Xaa?Xaa?Xaa?Ser?Xaa
130 135 140
Xaa?Xaa?Xaa?Asp?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa
145 150 155 160
aa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa
165 170 175
Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Met?Gln?Tyr?Xaa?Xaa?Xaa?Ala?Asn
180 185 190
Tyr?Xaa?Trp?Leu?Leu?Val?Glu?Gly?Xaa?Tyr?Leu?Xaa?Xaa?Xaa?Phe?Xaa
195 200 205
Leu?Tyr?Xaa?Xaa?Ile?Gly?Trp?Gly?Xaa?Pro?Xaa?Leu?Phe?Val?Xaa?Pro
210 215 220
Trp?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Xaa?Glu?Xaa?Xaa?Xaa?Cys?Trp?Xaa?Xaa
225 230 235 240
Asn?Xaa?Asn?Met?Xaa?Xaa?Trp?Xaa?Ile?Xaa?Arg?Xaa?Pro?Xaa?Xaa?Xaa
245 250 255
Ala?Ile?Xaa?Xaa?Asn?Phe?Xaa?Ile?Phe?Val?Arg?Xaa?Xaa?Xaa
260 265 270
<210>31
<211>263
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(123)..(123)
<223〉the 123rd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(124)..(124)
<223〉the 124th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(125)..(125)
<223〉the 125th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(127)..(127)
<223〉the 127th Xaa is Tyr or Ala or is removed;
<220>
<221>misc_feature
<222>(130)..(130)
<223〉the 130th Xaa is Leu, Ala or Met or be removed;
<220>
<221>misc_feature
<222>(134)..(134)
<223〉the 134th Xaa is Ala or Gly or is removed;
<220>
<221>misc_feature
<222>(137)..(137)
<223〉the 137th Xaa is Ile, Val or Met or be removed;
<220>
<221>misc_feature
<222>(139)..(139)
<223〉the 139th Xaa is Leu or Val or is removed;
<220>
<221>misc_feature
<222>(140)..(140)
<223〉the 140th Xaa is Arg or Lys or is removed;
<220>
<221>misc_feature
<222>(141)..(141)
<223〉the 141st Xaa is Ala or Ser or is removed;
<220>
<221>misc_feature
<222>(142)..(142)
<223〉the 142nd Xaa is Leu or Ser or is removed;
<220>
<221>misc_feature
<222>(144)..(144)
<223〉the 144th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(145)..(145)
<223〉the 145th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(146)..(146)
<223〉the 146th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(147)..(147)
<223〉the 147th Xaa is Lys, Arg, Gln, Asp, Glu, Asn or Ile;
<220>
<221>misc_feature
<222>(149)..(149)
<223〉the 149th Xaa is Ala, Gly, Thr, Trp, Val, Arg or Ile;
<220>
<221>misc_feature
<222>(150)..(150)
<223〉the 150th Xaa is Ala, Leu or Val;
<220>
<221>misc_feature
<222>(152)..(152)
<223〉the 152nd Xaa is Lys, Arg or Asp;
<220>
<221>misc_feature
<222>(153)..(153)
<223〉the 153rd Xaa is Trp, Thr, Gln or Asn;
<220>
<221>misc_feature
<222>(154)..(154)
<223〉the 154th Xaa is Met, Arg or Ser;
<220>
<221>misc_feature
<222>(155)..(155)
<223〉the 155th Xaa is Tyr or Asn;
<220>
<221>misc_feature
<222>(156)..(156)
<223〉the 156th Xaa is Ser or Arg;
<220>
<221>misc_feature
<222>(157)..(157)
<223〉the 157th Xaa is Thr, Gln or Ala;
<220>
<221>misc_feature
<222>(158)..(158)
<223〉the 158th Xaa is Lys or Arg or skips;
<220>
<221>misc_feature
<222>(159)..(159)
<223〉the 159th Xaa is Ala, Ile or Ser;
<220>
<221>misc_feature
<222>(160)..(160)
<223〉the 160th Xaa is Ala, Gly or Ile;
<220>
<221>misc_feature
<222>(161)..(161)
<223〉the 161st Xaa is Gln, Asp, Pro, Glu or Ile;
<220>
<221>misc_feature
<222>(162)..(162)
<223〉the 162nd Xaa is Gln, Asp, Glu, Ser or Asn;
<220>
<221>misc_feature
<222>(163)..(163)
<223〉the 163rd Xaa is His or Leu;
<220>
<221>misc_feature
<222>(164)..(164)
<223〉the 164th Xaa is Gln, Ser, Tyr or Glu;
<220>
<221>misc_feature
<222>(165)..(165)
<223〉the 165th Xaa is Trp, Val or Gln;
<220>
<221>misc_feature
<222>(166)..(166)
<223〉the 166th Xaa is Asp or Ser;
<220>
<221>misc_feature
<222>(167)..(167)
<223〉the 167th Xaa is Gly, Thr, Val, Ser or Ala;
<220>
<221>misc_feature
<222>(168)..(168)
<223〉the 168th Xaa is Arg or skips;
<220>
<221>misc_feature
<222>(169)..(169)
<223〉the 169th Xaa is Leu, Trp, Arg, Thr or Tyr;
<220>
<221>misc_feature
<222>(171)..(171)
<223〉the 171st Xaa is Ser or Asp;
<220>
<221>misc_feature
<222>(172)..(172)
<223〉the 172nd Xaa is Tyr, Asp or Thr;
<220>
<221>misc_feature
<222>(173)..(173)
<223〉the 173rd Xaa is Gln, Glu or Gly;
<220>
<221>misc_feature
<222>(174)..(174)
<223〉the 174th Xaa is Asp, Ala or Thr;
<220>
<221>misc_feature
<222>(175)..(175)
<223〉the 175th Xaa is Ser, Val, Leu or Met;
<220>
<221>misc_feature
<222>(176)..(176)
<223〉the 176th Xaa is Leu, Ala, Thr or Val;
<220>
<221>misc_feature
<222>(177)..(177)
<223〉the 177th Xaa is Ser, Gly or Ala;
<220>
<221>misc_feature
<222>(178)..(178)
<223〉the 178th Xaa is Cys or is removed;
<220>
<221>misc_feature
<222>(179)..(179)
<223〉the 179th Xaa is Arg or is removed;
<220>
<221>misc_feature
<222>(180)..(180)
<223〉the 180th Xaa is Leu, Val, Ala or Ser or be removed;
<220>
<221>misc_feature
<222>(181)..(181)
<223〉the 181st Xaa is Val or Ala or is removed;
<220>
<221>misc_feature
<222>(182)..(182)
<223〉the 182nd Xaa is Phe, Ala, Thr or Met or be removed;
<220>
<221>misc_feature
<222>(183)..(183)
<223〉the 183rd Xaa is Leu or Val or is removed;
<220>
<221>misc_feature
<222>(184)..(184)
<223〉the 184th Xaa is Leu, Phe or Met or be removed;
<220>
<221>misc_feature
<222>(188)..(188)
<223〉the 188th Xaa is Cys, Gly or Ser or be removed;
<220>
<221>misc_feature
<222>(189)..(189)
<223〉the 189th Xaa is Val, Ile or Met or be removed;
<220>
<221>misc_feature
<222>(190)..(190)
<223〉the 190th Xaa is Ala, Val, Met or Ile or be removed;
<220>
<221>misc_feature
<222>(194)..(194)
<223〉the 194th Xaa is Tyr or Cys or is removed;
<220>
<221>misc_feature
<222>(201)..(201)
<223〉the 201st Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(204)..(204)
<223〉the 204th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(205)..(205)
<223〉the 205th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(206)..(206)
<223〉the 206th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(217)..(217)
<223〉the 217th Xaa is Thr, Val or Ile or be removed;
<220>
<221>misc_feature
<222>(221)..(221)
<223〉the 221st Xaa is Ile, Val, Leu or Ala or be removed;
<220>
<221>misc_feature
<222>(226)..(226)
<223〉the 226th Xaa is Met, Thr, Ile or Ala or be removed;
<220>
<221>misc_feature
<222>(229)..(229)
<223〉the 229th Xaa is His, Pro, Gln or Thr;
<220>
<221>misc_feature
<222>(230)..(230)
<223〉the 230th Xaa is Ala, Lys, Val or Thr;
<220>
<221>misc_feature
<222>(231)..(231)
<223〉the 231st Xaa is Arg, Lys, Gln or Glu;
<220>
<221>misc_feature
<222>(232)..(232)
<223〉the 232nd Xaa is Gly or Ser;
<220>
<221>misc_feature
<222>(233)..(233)
<223〉the 233rd Xaa is Thr, Leu, Phe or Ala;
<220>
<221>misc_feature
<222>(236)..(236)
<223〉the 236th Xaa is Phe, Ser or Leu;
<220>
<221>misc_feature
<222>(237)..(237)
<223〉the 237th Xaa is Ile, Ala, Val or Thr;
<220>
<221>misc_feature
<222>(238)..(238)
<223〉the 238th Xaa is Lys or Arg;
<220>
<221>misc_feature
<222>(241)..(241)
<223〉the 241st Xaa is Thr, Phe, Tyr or Ile;
<220>
<221>misc_feature
<222>(242)..(242)
<223〉the 242nd Xaa is Glu, Asp, Gln or Asn;
<220>
<221>misc_feature
<222>(244)..(244)
<223〉the 244th Xaa is Ser, Phe or Leu or removal Leu;
<220>
<221>misc_feature
<222>(245)..(245)
<223〉the 245th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(246)..(246)
<223〉the 246th Xaa is Thr, Ser or Gly or be removed;
<220>
<221>misc_feature
<222>(251)..(251)
<223〉the 251st Xaa is Leu or Met or is removed;
<220>
<221>misc_feature
<222>(252)..(252)
<223〉the 252nd Xaa is Met or Leu or is removed;
<220>
<221>misc_feature
<222>(255)..(255)
<223〉the 255th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(260)..(260)
<223〉the 260th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(262)..(262)
<223〉the 262nd Xaa is Asn or Lys or is removed;
<400>31
Arg?Pro?Gln?Gly?Ala?Thr?Val?Ser?Leu?Trp?Glu?Thr?Val?Gln?Lys?Trp
1 5 10 15
Arg?Glu?Tyr?Arg?Arg?Gln?Cys?Gln?Arg?Ser?Leu?Thr?Glu?Asp?Pro?Pro
20 25 30
Pro?Ala?Thr?Asp?Leu?Phe?Cys?Asn?Arg?Thr?Phe?Asp?Glu?Tyr?Ala?Cys
35 40 45
Trp?Pro?Asp?Gly?Glu?Pro?Gly?Ser?Phe?Val?Asn?Val?Ser?Cys?Pro?Trp
50 55 60
Tyr?Leu?Pro?Trp?Ala?Ser?Ser?Val?Pro?Gln?Gly?His?Val?Tyr?Arg?Phe
65 70 75 80
ys?Thr?Ala?Glu?Gly?Leu?Trp?Leu?Gln?Lys?Asp?Asn?Ser?Ser?Leu?Pro
85 90 95
Trp?Arg?Asp?Leu?Ser?Glu?Cys?Glu?Glu?Ser?Lys?Arg?Gly?Glu?Arg?Ser
100 105 110
Ser?Pro?Glu?Glu?Gln?Leu?Leu?Phe?Leu?Tyr?Xaa?Xaa?Xaa?Asn?Xaa?Ile
115 120 125
His?Xaa?Asn?Leu?Phe?Xaa?Ser?Phe?Xaa?Leu?Xaa?Xaa?Xaa?Xaa?Ser?Xaa
130 135 140
Xaa?Xaa?Xaa?Asp?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa
145 150 155 160
Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa
165 170 175
Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Met?Gln?Tyr?Xaa?Xaa?XaaAla?Asn
180 185 190
Tyr?Xaa?Trp?Leu?Leu?Val?Glu?Gly?Xaa?Tyr?Leu?Xaa?Xaa?Xaa?Ser?Thr
195 200 205
Leu?Thr?Leu?Ile?Pro?Leu?Leu?Gly?Xaa?His?Glu?Val?Xaa?Phe?Ala?Phe
210 215 220
Val?Xaa?Asp?Glu?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Arg?Xaa?Xaa?Xaa?Leu?Phe
225 230 235 240
Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Ser?Phe?Gln?Gly?Xaa?Xaa?Val?Ala?Xaa?Leu
245 250 255
Tyr?Cys?Phe?Xaa?Asn?Xaa?Glu
260
<210>32
<211>249
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(123)..(123)
<223〉the 123rd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(124)..(124)
<223〉the 124th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(125)..(125)
<223〉the 125th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(127)..(127)
<223〉the 127th Xaa is Arg or Ser or is removed;
<220>
<221>misc_feature
<222>(130)..(130)
<223〉the 130th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(131)..(131)
<223〉the 131st Xaa is Ser, Gly or Cys or be removed;
<220>
<221>misc_feature
<222>(136)..(136)
<223〉the 136th Xaa is Val or Ala or is removed;
<220>
<221>misc_feature
<222>(138)..(138)
<223〉the 138th Xaa is Leu or Met or is removed;
<220>
<221>misc_feature
<222>(142)..(142)
<223〉the 142nd Xaa is Val, Leu or Ile or be removed;
<220>
<221>misc_feature
<222>(145)..(145)
<223〉the 145th Xaa is Gly, Ala, Met or Val or be removed;
<220>
<221>misc_feature
<222>(146)..(146)
<223〉the 146th Xaa is Ile, Val, Thr or Ala or be removed;
<220>
<221>misc_feature
<222>(147)..(147)
<223〉the 147th Xaa is Val or is removed;
<220>
<221>misc_feature
<222>(148)..(148)
<223〉the 148th Xaa is Lys or is removed;
<220>
<221>misc_feature
<222>(149)..(149)
<223〉the 149th Xaa is Tyr or Cys;
<220>
<221>misc_feature
<222>(151)..(151)
<223〉the 151st Xaa is Tyr or Phe;
<220>
<221>misc_feature
<222>(153)..(153)
<223〉the 153rd Xaa is Asp or Asn;
<220>
<221>misc_feature
<222>(154)..(154)
<223〉the 154th Xaa is Glu or Val;
<220>
<221>misc_feature
<222>(155)..(155)
<223〉the 155th Xaa is Gly, Gln, Glu or Asp;
<220>
<221>misc_feature
<222>(158)..(158)
<223〉the 158th Xaa is Thr, Glu or Ser;
<220>
<221>misc_feature
<222>(159)..(159)
<223〉the 159th Xaa is Arg or Ser;
<220>
<221>misc_feature
<222>(161)..(161)
<223〉the 161st Xaa is Ser, Asp, Asn or Met;
<220>
<221>misc_feature
<222>(164)..(164)
<223〉the 164th Xaa is Asn or Gly or is removed;
<220>
<221>misc_feature
<222>(165)..(165)
<223〉the 165th Xaa is Tyr or Phe or is removed;
<220>
<221>misc_feature
<222>(167)..(167)
<223〉the 167th Xaa is Leu or Trp or is removed;
<220>
<221>misc_feature
<222>(169)..(169)
<223〉the 169th Xaa is Ile or Leu or is removed;
<220>
<221>misc_feature
<222>(171)..(171)
<223〉the 171st Xaa is Leu, Phe, Ile or Ser or be removed;
<220>
<221>misc_feature
<222>(173)..(173)
<223〉the 173rd Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(174)..(174)
<223〉the 174th Xaa is Leu or Phe or is removed;
<220>
<221>misc_feature
<222>(175)..(175)
<223〉the 175th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(178)..(178)
<223〉the 178th Xaa is Gly or Leu or is removed;
<220>
<221>misc_feature
<222>(179)..(179)
<223〉the 179th Xaa is Val or Ile or is removed;
<220>
<221>misc_feature
<222>(182)..(182)
<223〉the 182nd Xaa is Leu, Phe or Ile or be removed;
<220>
<221>misc_feature
<222>(187)..(187)
<223〉the 187th Xaa is Val or Ile or is removed;
<220>
<221>misc_feature
<222>(188)..(188)
<223〉the 188th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(189)..(189)
<223〉the 189th Xaa is Gln or Cys or is removed;
<220>
<221>misc_feature
<222>(190)..(190)
<223〉the 190th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(191)..(191)
<223〉the 191st Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(192)..(192)
<223〉the 192nd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(203)..(203)
<223〉the 203rd Xaa is Thr, Val or Ile or be removed;
<220>
<221>misc_feature
<222>(207)..(207)
<223〉the 207th Xaa is Ile, Val, Leu or Ala or be removed;
<220>
<221>misc_feature
<222>(212)..(212)
<223〉the 212nd Xaa is Met, Thr, Ile or Ala or be removed;
<220>
<221>misc_feature
<222>(215)..(215)
<223〉the 215th Xaa is His, Pro, Gln or Thr;
<220>
<221>misc_feature
<222>(216)..(216)
<223〉the 216th Xaa is Ala, Lys, Val or Thr;
<220>
<221>misc_feature
<222>(217)..(217)
<223〉the 217th Xaa is Arg, Lys, Gln or Glu;
<220>
<221>misc_feature
<222>(218)..(218)
<223〉the 218th Xaa is Gly or Ser;
<220>
<221>misc_feature
<222>(219)..(219)
<223〉the 219th Xaa is Thr, Leu, Phe or Ala;
<220>
<221>misc_feature
<222>(222)..(222)
<223〉the 222nd Xaa is Phe, Ser or Leu;
<220>
<221>misc_feature
<222>(223)..(223)
<223〉the 223rd Xaa is Ile, Ala, Val or Thr;
<220>
<221>misc_feature
<222>(224)..(224)
<223〉the 224th Xaa is Lys or Arg;
<220>
<221>misc_feature
<222>(227)..(227)
<223〉the 227th Xaa is Thr, Phe, Tyr or Ile;
<220>
<221>misc_feature
<222>(228)..(228)
<223〉the 228th Xaa is Glu, Asp, Gln or Asn;
<220>
<221>misc_feature
<222>(230)..(230)
<223〉the 230th Xaa is Ser, Phe or Leu or removal Leu;
<220>
<221>misc_feature
<222>(231)..(231)
<223〉the 231st Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(232)..(232)
<223〉the 232nd Xaa is Thr, Ser or Gly or be removed;
<220>
<221>misc_feature
<222>(237)..(237)
<223〉the 237th Xaa is Leu or Met or is removed;
<220>
<221>misc_feature
<222>(238)..(238)
<223〉the 238th Xaa is Met or Leu or is removed;
<220>
<221>misc_feature
<222>(241)..(241)
<223〉the 241st Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(246)..(246)
<223〉the 246th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(248)..(248)
<223〉the 248th Xaa is Asn or Lys or is removed;
<400>32
Arg?Pro?Gln?Gly?Ala?Thr?Val?Ser?Leu?Trp?Glu?Thr?Val?Gln?Lys?Trp
1 5 10 15
Arg?Glu?Tyr?Arg?Arg?Gln?Cys?Gln?Arg?Ser?Leu?Thr?Glu?Asp?Pro?Pro
20 25 30
Pro?Ala?Thr?Asp?Leu?Phe?Cys?Asn?Arg?Thr?Phe?Asp?Glu?Tyr?Ala?Cys
35 40 45
Trp?Pro?Asp?Gly?Glu?Pro?Gly?Ser?Phe?Val?Asn?Val?Ser?Cys?Pro?Trp
50 55 60
Tyr?Leu?Pro?Trp?Ala?Ser?Ser?Val?Pro?Gln?Gly?His?Val?Tyr?Arg?Phe
65 70 75 80
Cys?Thr?Ala?Glu?Gly?Leu?Trp?Leu?Gln?Lys?Asp?Asn?Ser?Ser?Leu?Pro
85 90 95
TrpArg?Asp?Leu?Ser?Glu?Cys?Glu?Glu?Ser?Lys?Arg?Gly?Glu?Arg?Ser
100 105 110
Ser?Pro?Glu?Glu?Gln?Leu?Leu?Phe?Leu?Tyr?Xaa?Xaa?Xaa?Phe?Xaa?Leu
115 120 125
Tyr?Xaa?Xaa?Ile?Gly?Trp?Gly?Xaa?Pro?Xaa?Leu?Phe?Val?Xaa?Pro?Trp
130 135 140
Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Xaa?Glu?Xaa?Xaa?Xaa?Cys?Trp?Xaa?Xaa?Asn
145 150 155 160
Xaa?Asn?Met?Xaa?Xaa?Trp?Xaa?Ile?Xaa?Arg?Xaa?Pro?Xaa?Xaa?Xaa?Ala
165 170 175
Ile?Xaa?Xaa?Asn?Phe?Xaa?Ile?Phe?Val?Arg?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa
180 185 190
Ser?Thr?Leu?Thr?Leu?Ile?Pro?Leu?Leu?Gly?Xaa?His?Glu?Val?Xaa?Phe
195 200 205
Ala?Phe?Val?Xaa?Asp?Glu?Xaa?Xaa?Xaa?Xaa?Xaa?LeuArg?Xaa?Xaa?Xaa
210 215 220
Leu?Phe?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Ser?Phe?Gln?Gly?Xaa?Xaa?Val?Ala
225 230 235 240
Xaa?Leu?Tyr?Cys?Phe?Xaa?Asn?Xaa?Glu
245
<210>33
<211>330
<212>PRT
<213〉artificial sequence
<220>
<221>misc_feature
<222>(123)..(123)
<223〉the 123rd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(124)..(124)
<223〉the 124th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(125)..(125)
<223〉the 125th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(127)..(127)
<223〉the 127th Xaa is Tyr or Ala or is removed;
<220>
<221>misc_feature
<222>(130)..(130)
<223〉the 130th Xaa is Leu, Ala or Met or be removed;
<220>
<221>misc_feature
<222>(134)..(134)
<223〉the 134th Xaa is Ala or Gly or is removed;
<220>
<221>misc_feature
<222>(137)..(137)
<223〉the 137th Xaa is Ile, Val or Met or be removed;
<220>
<221>misc_feature
<222>(139)..(139)
<223〉the 139th Xaa is Leu or Val or is removed;
<220>
<221>misc_feature
<222>(140)..(140)
<223〉the 140th Xaa is Arg or Lys or is removed;
<220>
<221>misc_feature
<222>(141)..(141)
<223〉the 141st Xaa is Ala or Ser or is removed;
<220>
<221>misc_feature
<222>(142)..(142)
<223〉the 142nd Xaa is Leu or Ser or is removed;
<220>
<221>misc_feature
<222>(144)..(144)
<223〉the 144th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(145)..(145)
<223〉the 145th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(146)..(146)
<223〉the 146th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(147)..(147)
<223〉the 147th Xaa is Lys, Arg, Gln, Asp, Glu, Asn or Ile;
<220>
<221>misc_feature
<222>(149)..(149)
<223〉the 149th Xaa is Ala, Gly, Thr, Trp, Val, Arg or Ile;
<220>
<221>misc_feature
<222>(150)..(150)
<223〉the 150th Xaa is Ala, Leu or Val;
<220>
<221>misc_feature
<222>(152)..(152)
<223〉the 152nd Xaa is Lys, Arg or Asp;
<220>
<221>misc_feature
<222>(153)..(153)
<223〉the 153rd Xaa is Trp, Thr, Gln or Asn;
<220>
<221>misc_feature
<222>(154)..(154)
<223〉the 154th Xaa is Met, Arg or Ser;
<220>
<221>misc_feature
<222>(155)..(155)
<223〉the 155th Xaa is Tyr or Asn;
<220>
<221>misc_feature
<222>(156)..(156)
<223〉the 156th Xaa is Ser or Arg;
<220>
<221>misc_feature
<222>(157)..(157)
<223〉the 157th Xaa is Thr, Gln or Ala;
<220>
<221>misc_feature
<222>(158)..(158)
<223〉the 158th Xaa is Lys or Arg or skips;
<220>
<221>misc_feature
<222>(159)..(159)
<223〉the 159th Xaa is Ala, Ile or Ser;
<220>
<221>misc_feature
<222>(160)..(160)
<223〉the 160th Xaa is Ala, Gly or Ile;
<220>
<221>misc_feature
<222>(161)..(161)
<223〉the 161st Xaa is Gln, Asp, Pro, Glu or Ile;
<220>
<221>misc_feature
<222>(162)..(162)
<223〉the 162nd Xaa is Gln, Asp, Glu, Ser or Asn;
<220>
<221>misc_feature
<222>(163)..(163)
<223〉the 163rd Xaa is His or Leu;
<220>
<221>misc_feature
<222>(164)..(164)
<223〉the 164th Xaa is Gln, Ser, Tyr or Glu;
<220>
<221>misc_feature
<222>(165)..(165)
<223〉the 165th Xaa is Trp, Val or Gln;
<220>
<221>misc_feature
<222>(166)..(166)
<223〉the 166th Xaa is Asp or Ser;
<220>
<221>misc_feature
<222>(167)..(167)
<223〉the 167th Xaa is Gly, Thr, Val, Ser or Ala;
<220>
<221>misc_feature
<222>(168)..(168)
<223〉the 168th Xaa is Arg or skips;
<220>
<221>misc_feature
<222>(169)..(169)
<223〉the 169th Xaa is Leu, Trp, Arg, Thr or Tyr;
<220>
<221>misc_feature
<222>(171)..(171)
<223〉the 171st Xaa is Ser or Asp;
<220>
<221>misc_feature
<222>(172)..(172)
<223〉the 172nd Xaa is Tyr, Asp or Thr;
<220>
<221>misc_feature
<222>(173)..(173)
<223〉the 173rd Xaa is Gln, Glu or Gly;
<220>
<221>misc_feature
<222>(174)..(174)
<223〉the 174th Xaa is Asp, Ala or Thr;
<220>
<221>misc_feature
<222>(175)..(175)
<223〉the 175th Xaa is Ser, Val, Leu or Met;
<220>
<221>misc_feature
<222>(176)..(176)
<223〉the 176th Xaa is Leu, Ala, Thr or Val;
<220>
<221>misc_feature
<222>(177)..(177)
<223〉the 177th Xaa is Ser, Gly or Ala;
<220>
<221>misc_feature
<222>(178)..(178)
<223〉the 178th Xaa is Cys or is removed;
<220>
<221>misc_feature
<222>(179)..(179)
<223〉the 179th Xaa is Arg or is removed;
<220>
<221>misc_feature
<222>(180)..(180)
<223〉the 180th Xaa is Leu, Val, Ala or Ser or be removed;
<220>
<221>misc_feature
<222>(181)..(181)
<223〉the 181st Xaa is Val or Ala or is removed;
<220>
<221>misc_feature
<222>(182)..(182)
<223〉the 182nd Xaa is Phe, Ala, Thr or Met or be removed;
<220>
<221>misc_feature
<222>(183)..(183)
<223〉the 183rd Xaa is Leu or Val or is removed;
<220>
<221>misc_feature
<222>(184)..(184)
<223〉the 184th Xaa is Leu, Phe or Met or be removed;
<220>
<221>misc_feature
<222>(188)..(188)
<223〉the 188th Xaa is Cys, Gly or Ser or be removed;
<220>
<221>misc_feature
<222>(189)..(189)
<223〉the 189th Xaa is Val, Ile or Met or be removed;
<220>
<221>misc_feature
<222>(190)..(190)
<223〉the 190th Xaa is Ala, Val, Met or Ile or be removed;
<220>
<221>misc_feature
<222>(194)..(194)
<223〉the 194th Xaa is Tyr or Cys or is removed;
<220>
<221>misc_feature
<222>(201)..(201)
<223〉the 201st Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(204)..(204)
<223〉the 204th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(205)..(205)
<223〉the 205th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(206)..(206)
<223〉the 206th Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(208)..(208)
<223〉the 208th Xaa is Arg or Ser or is removed;
<220>
<221>misc_feature
<222>(211)..(211)
<223〉the 211st Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(212)..(212)
<223〉the 212nd Xaa is Ser, Gly or Cys or be removed;
<220>
<221>misc_feature
<222>(217)..(217)
<223〉the 217th Xaa is Val or Ala or is removed;
<220>
<221>misc_feature
<222>(219)..(219)
<223〉the 219th Xaa is Leu or Met or is removed;
<220>
<221>misc_feature
<222>(223)..(223)
<223〉the 223rd Xaa is Val, Leu or Ile or be removed;
<220>
<221>misc_feature
<222>(226)..(226)
<223〉the 226th Xaa is Gly, Ala, Met or Val or be removed;
<220>
<221>misc_feature
<222>(227)..(227)
<223〉the 227th Xaa is Ile, Val, Thr or Ala or be removed;
<220>
<221>misc_feature
<222>(228)..(228)
<223〉the 228th Xaa is Val or is removed;
<220>
<221>misc_feature
<222>(229)..(229)
<223〉the 229th Xaa is Lys or is removed;
<220>
<221>misc_feature
<222>(230)..(230)
<223〉the 230th Xaa is Tyr or Cys;
<220>
<221>misc_feature
<222>(232)..(232)
<223〉the 232nd Xaa is Tyr or Phe;
<220>
<221>misc_feature
<222>(234)..(234)
<223〉the 234th Xaa is Asp or Asn;
<220>
<221>misc_feature
<222>(235)..(235)
<223〉the 235th Xaa is Glu or Val;
<220>
<221>misc_feature
<222>(236)..(236)
<223〉the 236th Xaa is Gly, Gln, Glu or Asp;
<220>
<221>misc_feature
<222>(239)..(239)
<223〉the 239th Xaa is Thr, Glu or Ser;
<220>
<221>misc_feature
<222>(240)..(240)
<223〉the 240th Xaa is Arg or Ser;
<220>
<221>misc_feature
<222>(242)..(242)
<223〉the 242nd Xaa is Ser, Asp, Asn or Met;
<220>
<221>misc_feature
<222>(245)..(245)
<223〉the 245th Xaa is Asn or Gly or is removed;
<220>
<221>misc_feature
<222>(246)..(246)
<223〉the 246th Xaa is Tyr or Phe or is removed;
<220>
<221>misc_feature
<222>(248)..(248)
<223〉the 248th Xaa is Leu or Trp or is removed;
<220>
<221>misc_feature
<222>(250)..(250)
<223〉the 250th Xaa is Ile or Leu or is removed;
<220>
<221>misc_feature
<222>(252)..(252)
<223〉the 252nd Xaa is Leu, Phe, Ile or Ser or be removed;
<220>
<221>misc_feature
<222>(254)..(254)
<223〉the 254th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(255)..(255)
<223〉the 255th Xaa is Leu or Phe or is removed;
<220>
<221>misc_feature
<222>(256)..(256)
<223〉the 256th Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(259)..(259)
<223〉the 259th Xaa is Gly or Leu or is removed;
<220>
<221>misc_feature
<222>(260)..(260)
<223〉the 260th Xaa is Val or Ile or is removed;
<220>
<221>misc_feature
<222>(263)..(263)
<223〉the 263rd Xaa is Leu, Phe or Ile or be removed;
<220>
<221>misc_feature
<222>(268)..(268)
<223〉the 268th Xaa is Val or Ile or is removed;
<220>
<221>misc_feature
<222>(269)..(269)
<223〉the 269th Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(270)..(270)
<223〉the 270th Xaa is Gln, Cys or be removed;
<220>
<221>misc_feature
<222>(271)..(271)
<223〉the 271st Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer;
<220>
<221>misc_feature
<222>(272)..(272)
<223〉the 272nd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(273)..(273)
<223〉the 273rd Xaa is Gly Thr Gly, Gly Ala Pro, Gly Pro Gly or Gly Gly Gly GlySer or be removed;
<220>
<221>misc_feature
<222>(284)..(284)
<223〉the 284th Xaa is Thr, Val or Ile or be removed;
<220>
<221>misc_feature
<222>(288)..(288)
<223〉the 288th Xaa is Ile, Val, Leu or Ala or be removed;
<220>
<221>misc_feature
<222>(293)..(293)
<223〉the 293rd Xaa is Met, Thr, Ile or Ala or be removed;
<220>
<221>misc_feature
<222>(296)..(296)
<223〉the 296th Xaa is His, Pro, Gln or Thr;
<220>
<221>misc_feature
<222>(297)..(297)
<223〉the 297th Xaa is Ala, Lys, Val or Thr;
<220>
<221>misc_feature
<222>(298)..(298)
<223〉the 298th Xaa is Arg, Lys, Gln or Glu;
<220>
<221>misc_feature
<222>(299)..(299)
<223〉the 299th Xaa is Gly or Ser;
<220>
<221>misc_feature
<222>(300)..(300)
<223〉the 300th Xaa is Thr, Leu, Phe or Ala;
<220>
<221>misc_feature
<222>(303)..(303)
<223〉the 303rd Xaa is Phe, Ser or Leu;
<220>
<221>misc_feature
<222>(304)..(304)
<223〉the 304th Xaa is Ile, Ala, Val or Thr;
<220>
<221>misc_feature
<222>(305)..(305)
<223〉the 305th Xaa is Lys or Arg;
<220>
<221>misc_feature
<222>(308)..(308)
<223〉the 308th Xaa is Thr, Phe, Tyr or Ile;
<220>
<221>misc_feature
<222>(309)..(309)
<223〉the 309th Xaa is Glu, Asp, Gln or Asn;
<220>
<221>misc_feature
<222>(311)..(311)
<223〉the 311st Xaa is Ser, Phe or Leu or removal Leu;
<220>
<221>misc_feature
<222>(312)..(312)
<223〉the 312nd Xaa is Phe or Leu or is removed;
<220>
<221>misc_feature
<222>(313)..(313)
<223〉the 313rd Xaa is Thr, Ser or Gly or be removed;
<220>
<221>misc_feature
<222>(318)..(318)
<223〉the 318th Xaa is Leu or Met or is removed;
<220>
<221>misc_feature
<222>(319)..(319)
<223〉the 319th Xaa is Met or Leu or is removed;
<220>
<221>misc_feature
<222>(322)..(322)
<223〉the 322nd Xaa is Ile or Val or is removed;
<220>
<221>misc_feature
<222>(327)..(327)
<223〉the 327th Xaa is Val or Leu or is removed;
<220>
<221>misc_feature
<222>(329)..(329)
<223〉the 329th Xaa is Asn or Lys or is removed;
<400>33
Arg?Pro?Gln?Gly?Ala?Thr?Val?Ser?Leu?Trp?Glu?Thr?Val?Gln?Lys?Trp
1 5 10 15
Arg?Glu?Tyr?Arg?Arg?Gln?Cys?Gln?Arg?Ser?Leu?Thr?Glu?Asp?Pro?Pro
20 25 30
Pro?Ala?Thr?Asp?Leu?Phe?Cys?Asn?Arg?Thr?Phe?Asp?Glu?Tyr?Ala?Cys
35 40 45
Trp?Pro?Asp?Gly?Glu?Pro?Gly?Ser?Phe?Val?Asn?Val?Ser?Cys?Pro?Trp
50 55 60
Tyr?Leu?Pro?Trp?Ala?Ser?Ser?Val?Pro?Gln?Gly?His?Val?Tyr?Arg?Phe
65 70 75 80
Cys?Thr?Ala?Glu?Gly?Leu?Trp?Leu?Gln?Lys?Asp?Asn?Ser?Ser?Leu?Pro
85 90 95
Trp?Arg?Asp?Leu?Ser?Glu?Cys?Glu?Glu?Ser?Lys?Arg?Gly?Glu?Arg?Ser
100 105 110
Ser?Pro?Glu?Glu?Gln?Leu?Leu?Phe?Leu?Tyr?Xaa?Xaa?Xaa?Asn?Xaa?Ile
115 120 125
His?Xaa?Asn?Leu?Phe?Xaa?Ser?Phe?Xaa?Leu?Xaa?Xaa?Xaa?Xaa?Ser?Xaa
130 135 140
Xaa?Xaa?Xaa?Asp?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa
145 150 155 160
Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa
165 170 175
Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Met?Gln?Tyr?Xaa?Xaa?Xaa?Ala?Asn
180 185 190
Tyr?Xaa?Trp?Leu?Leu?Val?Glu?Gly?Xaa?Tyr?Leu?Xaa?Xaa?Xaa?Phe?Xaa
195 200 205
Leu?Tyr?Xaa?Xaa?Ile?Gly?Trp?Gly?Xaa?Pro?Xaa?Leu?Phe?Val?Xaa?Pro
210 215 220
Trp?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Xaa?Glu?Xaa?Xaa?Xaa?Cys?Trp?Xaa?Xaa
225 230 235 240
Asn?Xaa?Asn?Met?Xaa?Xaa?Trp?Xaa?Ile?Xaa?Arg?Xaa?Pro?Xaa?Xaa?Xaa
245 250 255
Ala?Ile?Xaa?Xaa?Asn?Phe?Xaa?Ile?Phe?Val?Arg?Xaa?Xaa?Xaa?Xaa?Xaa
260 265 270
Xaa?Ser?Thr?Leu?Thr?Leu?Ile?Pro?Leu?Leu?Gly?Xaa?His?Glu?Val?Xaa
275 280 285
Phe?Ala?Phe?Val?Xaa?Asp?Glu?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Arg?Xaa?Xaa
290 295 300
Xaa?Leu?Phe?Xaa?Xaa?Leu?Xaa?Xaa?Xaa?Ser?Phe?Gln?Gly?Xaa?Xaa?Val
305 310 315 320
Ala?Xaa?Leu?Tyr?Cys?Phe?Xaa?Asn?Xaa?Glu
325 330
<210>34
<211>227
<212>PRT
<213〉people
<400>34
Asp?Lys?Thr?His?Thr?Cys?Pro?Pro?Cys?Pro?Ala?Pro?Glu?Leu?Leu?Gly
1 5 10 15
Gly?Pro?Ser?Val?Phe?Leu?Phe?Pro?Pro?Lys?Pro?Lys?Asp?Thr?Leu?Met
20 25 30
Ile?Ser?Arg?Thr?Pro?Glu?Val?Thr?Cys?Val?Val?Val?Asp?Val?Ser?His
35 40 45
Glu?Asp?Pro?Glu?Val?Lys?Phe?Asn?Trp?Tyr?Val?Asp?Gly?Val?Glu?Val
50 55 60
His?Asn?Ala?Lys?Thr?Lys?Pro?Arg?Glu?Glu?Gln?Tyr?Asn?Ser?Thr?Tyr
65 70 75 80
Arg?Val?Val?Ser?Val?Leu?Thr?Val?Leu?His?Gln?Asp?Trp?Leu?Asn?Gly
85 90 95
Lys?Glu?Tyr?Lys?Cys?Lys?Val?Ser?Asn?Lys?Ala?Leu?Pro?Ala?Pro?Ile
100 105 110
Glu?Lys?Thr?Ile?Ser?Lys?Ala?Lys?Gly?Gln?Pro?Arg?Glu?Pro?Gln?Val
115 120 125
Tyr?Thr?Leu?Pro?Pro?Ser?Arg?Asp?Glu?Leu?Thr?Lys?Asn?Gln?Val?Ser
130 135 140
Leu?Thr?Cys?Leu?Val?Lys?Gly?Phe?Tyr?Pro?Ser?Asp?Ile?Ala?Val?Glu
145 150 155 160
Trp?Glu?Ser?Asn?Gly?Gln?Pro?Glu?Asn?Asn?Tyr?Lys?Thr?Thr?Pro?Pro
165 170 175
Val?Leu?Asp?Ser?Asp?Gly?Ser?Phe?Phe?Leu?Tyr?Ser?Lys?Leu?Thr?Val
180 185 190
Asp?Lys?Ser?Arg?Trp?Gln?Gln?Gly?Asn?Val?Phe?Ser?Cys?Ser?Val?Met
195 200 205
His?Glu?Ala?Leu?His?Asn?His?Tyr?Thr?Gln?Lys?Ser?Leu?Ser?Leu?Ser
210 215 220
Pro?Gly?Lys
225
<210>35
<211>381
<212>PRT
<213〉artificial sequence
<400>35
His?Gly?Glu?Gly?Thr?Phe?Thr?Ser?Asp?Val?Ser?Ser?Tyr?Leu?Glu?Gly
1 5 10 15
Gln?Ala?Ala?Lys?Glu?Phe?Ile?Ala?Trp?Leu?Val?Lys?Gly?Arg?Gly?Gly
20 25 30
Ala?Pro?Ala?Gln?Val?Met?Asp?Phe?Leu?Phe?Glu?Lys?Trp?Lys?Leu?Tyr
35 40 45
Gly?Asp?Gln?Cys?His?His?Asn?Leu?Ser?Leu?Leu?Pro?Pro?Pro?Thr?Glu
50 55 60
Leu?Val?Cys?Asn?Arg?Thr?Phe?Asp?Lys?Tyr?Ser?Cys?Trp?Pro?Asp?Thr
65 70 75 80
Pro?Ala?Asn?Thr?Thr?Ala?Asn?Ile?Ser?Cys?Pro?Trp?Tyr?Leu?Pro?Trp
85 90 95
His?His?Lys?Val?Gln?His?Arg?Phe?Val?Phe?Lys?Arg?Cys?Gly?Pro?Asp
100 105 110
Gly?Gln?Trp?Val?Arg?Gly?Pro?Arg?Gly?Gln?Pro?Trp?Arg?Asp?Ala?Ser
115 120 125
Gln?Cys?Gln?Met?Asp?Gly?Glu?Glu?Ile?Glu?Val?Gln?Lys?Glu?Val?Ala
130 135 140
Lys?Met?Tyr?Ser?Ser?Phe?Gln?Gly?Pro?Gly?Asp?Lys?Thr?His?Thr?Cys
145 150 155 160
Pro?Pro?Cys?Pro?Ala?Pro?Glu?Leu?Leu?Gly?Gly?Pro?Ser?Val?Phe?Leu
165 170 175
Phe?Pro?Pro?Lys?Pro?Lys?Asp?Thr?Leu?Met?Ile?Ser?Arg?Thr?Pro?Glu
180 185 190
Val?Thr?Cys?Val?Val?Val?Asp?Val?Ser?His?Glu?Asp?Pro?Glu?Val?Lys
195 200 205
Phe?Asn?Trp?Tyr?Val?Asp?Gly?Val?Glu?Val?His?Asn?Ala?Lys?Thr?Lys
210 215 220
Pro?Arg?Glu?Glu?Gln?Tyr?Asn?Ser?Thr?Tyr?Arg?Val?Val?Ser?Val?Leu
225 230 235 240
Thr?Val?Leu?His?Gln?Asp?Trp?Leu?Asn?Gly?Lys?Glu?Tyr?Lys?Cys?Lys
245 250 255
Val?Ser?Asn?Lys?Ala?Leu?Pro?Ala?Pro?Ile?Glu?Lys?Thr?Ile?Ser?Lys
260 265 270
Ala?Lys?Gly?Gln?Pro?Arg?Glu?Pro?Gln?Val?Tyr?Thr?Leu?Pro?Pro?Ser
275 280 285
Arg?Asp?Glu?Leu?Thr?Lys?Asn?Gln?Val?Ser?Leu?Thr?Cys?Leu?Val?Lys
290 295 300
Gly?Phe?Tyr?Pro?Ser?Asp?Ile?Ala?Val?Glu?Trp?Glu?Ser?Asn?Gly?Gln
305 310 315 320
Pro?Glu?Asn?Asn?Tyr?Lys?Thr?Thr?Pro?Pro?Val?Leu?Asp?Ser?Asp?Gly
325 330 335
Ser?Phe?Phe?Leu?Tyr?Ser?Lys?Leu?Thr?Val?Asp?Lys?Ser?Arg?Trp?Gln
340 345 350
Gln?Gly?Asn?Val?Phe?Ser?Cys?Ser?Val?Met?His?Glu?Ala?Leu?His?Asn
355 360 365
His?Tyr?Thr?Gln?Lys?Ser?Leu?Ser?Leu?Ser?Pro?Gly?Lys
370 375 380
<210>36
<211>340
<212>PRT
<213〉artificial sequence
<400>36
His?Gly?Glu?Gly?Thr?Phe?Thr?Ser?Asp?Val?Ser?Ser?Tyr?Leu?Glu?Gly
1 5 10 15
Gln?Ala?Ala?Lys?Glu?Phe?Ile?Ala?Trp?Leu?Val?Lys?Gly?Arg?Gly?Gly
20 25 30
Ala?Pro?Asn?Ala?Ile?His?Ala?Asn?Leu?Phe?Ala?Ser?Phe?Val?Leu?Lys
35 40 45
Ala?Ser?Ser?Val?Leu?Val?Ile?Asp?Gly?Leu?Leu?Arg?Thr?Arg?Tyr?Ser
50 55 60
Gln?Lys?Ile?Gly?Asp?Asp?Leu?Ser?Val?Ser?Thr?Trp?Leu?Ser?Asp?Gly
65 70 75 80
Ala?Val?Ala?Gly?Cys?Arg?Val?Ala?Ala?Val?Phe?Met?Gln?Tyr?Gly?Ile
85 90 95
Val?Ala?Asn?Tyr?Cys?Trp?Leu?Leu?Val?Glu?Gly?Leu?Tyr?Leu?Gly?Pro
100 105 110
Gly?Asp?Lys?Thr?His?Thr?Cys?Pro?Pro?Cys?Pro?Ala?Pro?Glu?Leu?Leu
115 120 125
Gly?Gly?Pro?Ser?Val?Phe?Leu?Phe?Pro?Pro?Lys?Pro?Lys?Asp?Thr?Leu
130 135 140
Met?Ile?Ser?Arg?Thr?Pro?Glu?Val?Thr?Cys?Val?Val?Val?Asp?Val?Ser
145 150 155 160
His?Glu?Asp?Pro?Glu?Val?Lys?Phe?Asn?Trp?Tyr?Val?Asp?Gly?Val?Glu
165 170 175
Val?His?Asn?Ala?Lys?Thr?Lys?Pro?Arg?Glu?Glu?Gln?Tyr?Ash?Ser?Thr
180 185 190
Tyr?Arg?Val?Val?Ser?Val?Leu?Thr?Val?Leu?His?Gln?Asp?Trp?Leu?Asn
195 200 205
Gly?Lys?Glu?Tyr?Lys?Cys?Lys?Val?Ser?Asn?Lys?Ala?Leu?Pro?Ala?Pro
210 215 220
Ile?Glu?Lys?Thr?Ile?Ser?Lys?Ala?Lys?Gly?Gln?Pro?Arg?Glu?Pro?Gln
225 230 235 240
Val?Tyr?Thr?Leu?Pro?Pro?Ser?Arg?Asp?Glu?Leu?Thr?Lys?Asn?Gln?Val
245 250 255
Ser?Leu?Thr?Cys?Leu?Val?Lys?Gly?Phe?Tyr?Pro?Ser?Asp?Ile?Ala?Val
260 265 270
Glu?Trp?Glu?Ser?Asn?Gly?Gln?Pro?Glu?Asn?Asn?Tyr?Lys?Thr?Thr?Pro
275 280 285
Pro?Val?Leu?Asp?Ser?Asp?Gly?Ser?Phe?Phe?Leu?Tyr?Ser?Lys?Leu?Thr
290 295 300
Val?Asp?Lys?Ser?Arg?Trp?Gln?Gln?Gly?Asn?Val?Phe?Ser?Cys?Ser?Val
305 310 315 320
Met?His?Glu?Ala?Leu?His?Asn?His?Tyr?Thr?Gln?Lys?Ser?Leu?Ser?Leu
325 330 335
Ser?Pro?Gly?Lys
340
<210>37
<211>318
<212>PRT
<213〉artificial sequence
<400>37
His?Gly?Glu?Gly?Thr?Phe?Thr?Ser?Asp?Val?Ser?Ser?Tyr?Leu?Glu?Gly
1 5 10 15
Gln?Ala?Ala?Lys?Glu?Phe?Ile?Ala?Trp?Leu?Val?Lys?Gly?Arg?Gly?Gly
20 25 30
Ala?Pro?Thr?Leu?Thr?Leu?Ile?Pro?Leu?Leu?Gly?Val?His?Glu?Val?Val
35 40 45
Phe?Ala?Phe?Val?Thr?Asp?Glu?His?Ala?Gln?Gly?Thr?Leu?Arg?Ser?Ala
50 55 60
Lys?Leu?Phe?Phe?Asp?Leu?Phe?Leu?Ser?Ser?Phe?Gln?Gly?Leu?Leu?Val
65 70 75 80
Ala?Val?Leu?Tyr?Cys?Phe?Leu?Asn?Gly?Pro?Gly?Asp?Lys?Thr?His?Thr
85 90 95
Cys?Pro?Pro?Cys?Pro?Ala?Pro?Glu?Leu?Leu?Gly?Gly?Pro?Ser?Val?Phe
100 105 110
Leu?Phe?Pro?Pro?Lys?Pro?Lys?Asp?Thr?Leu?Met?Ile?Ser?Arg?Thr?Pro
115 120 125
Glu?Val?Thr?Cys?Val?Val?Val?Asp?Val?Ser?His?Glu?Asp?Pro?Glu?Val
130 135 140
Lys?Phe?Asn?Trp?Tyr?Val?Asp?Gly?Val?Glu?Val?His?Asn?Ala?Lys?Thr
145 150 155 160
Lys?Pro?Arg?Glu?Glu?Gln?Tyr?Asn?Ser?Thr?Tyr?Arg?Val?Val?Ser?Val
165 170 175
Leu?Thr?Val?Leu?His?Gln?Asp?Trp?Leu?Asn?Gly?Lys?Glu?Tyr?Lys?Cys
180 185 190
Lys?Val?Ser?Asn?Lys?Ala?Leu?Pro?Ala?Pro?Ile?Glu?Lys?Thr?Ile?Ser
195 200 205
Lys?Ala?Lys?Gly?Gln?Pro?Arg?Glu?Pro?Gln?Val?Tyr?Thr?Leu?Pro?Pro
210 215 220
Ser?Arg?Asp?Glu?Leu?Thr?Lys?Asn?Gln?Val?Ser?Leu?Thr?Cys?Leu?Val
225 230 235 240
Lys?Gly?Phe?Tyr?Pro?Ser?Asp?Ile?Ala?Val?Glu?Trp?Glu?Ser?Asn?Gly
245 250 255
Gln?Pro?Glu?Asn?Asn?Tyr?Lys?Thr?Thr?Pro?Pro?Val?Leu?Asp?Ser?Asp
260 265 270
Gly?Ser?Phe?Phe?Leu?Tyr?Ser?Lys?Leu?Thr?Val?Asp?Lys?Ser?Arg?Trp
275 280 285
Gln?Gln?Gly?Asn?Val?Phe?Ser?Cys?Ser?Val?Met?His?Glu?Ala?Leu?His
290 295 300
Asn?His?Tyr?Thr?Gln?Lys?Ser?Leu?Ser?Leu?Ser?Pro?Gly?Lys
305 310 315
<210>38
<211>316
<212>PRT
<213〉artificial sequence
<400>38
His?Gly?Glu?Gly?Thr?Phe?Thr?Ser?Asp?Val?Ser?Ser?Tyr?Leu?Glu?Gly
1 5 10 15
Gln?Ala?Ala?Lys?Glu?Phe?Ile?Ala?Trp?Leu?Val?Lys?Gly?Arg?Gly?Gly
20 25 30
Ala?Pro?Val?Ile?Asp?Gly?Leu?Leu?Arg?Thr?Arg?Tyr?Ser?Gln?Lys?Ile
35 40 45
Gly?Asp?Asp?Leu?Ser?Val?Ser?Thr?Trp?Leu?Ser?Asp?Gly?Ala?Val?Ala
50 55 60
Gly?Gly?Gly?Gly?Ser?Asp?Glu?His?Ala?Gln?Gly?Thr?Leu?Arg?Ser?Ala
65 70 75 80
Lys?Leu?Phe?Phe?Asp?Leu?Gly?Pro?Gly?Asp?Lys?Thr?His?Thr?Cys?Pro
85 90 95
Pro?Cys?Pro?Ala?Pro?Glu?Leu?Leu?Gly?Gly?Pro?Ser?Val?Phe?Leu?Phe
100 105 110
Pro?Pro?Lys?Pro?Lys?Asp?Thr?Leu?Met?Ile?Ser?Arg?Thr?Pro?Glu?Val
115 120 125
Thr?Cys?Val?Val?Val?Asp?Val?Ser?His?Glu?Asp?Pro?Glu?Val?Lys?Phe
130 135 140
Asn?Trp?Tyr?Val?Asp?Gly?Val?Glu?Val?His?Asn?Ala?Lys?Thr?Lys?Pro
145 150 155 160
Arg?Glu?Glu?Gln?Tyr?Asn?Ser?Thr?Tyr?Arg?Val?Val?Ser?Val?Leu?Thr
165 170 175
Val?Leu?His?Gln?Asp?Trp?Leu?Asn?Gly?Lys?Glu?Tyr?Lys?Cys?Lys?Val
180 185 190
Ser?Asn?Lys?Ala?Leu?Pro?Ala?Pro?Ile?Glu?Lys?Thr?Ile?Ser?Lys?Ala
195 200 205
Lys?Gly?Gln?Pro?Arg?Glu?Pro?Gln?Val?Tyr?Thr?Leu?Pro?Pro?Ser?Arg
210 215 220
Asp?Glu?Leu?Thr?Lys?Asn?Gln?Val?Ser?Leu?Thr?Cys?Leu?Val?Lys?Gly
225 230 235 240
Phe?Tyr?Pro?Ser?Asp?Ile?Ala?Val?Glu?Trp?Glu?Ser?Asn?Gly?Gln?Pro
245 250 255
Glu?Asn?Asn?Tyr?Lys?Thr?Thr?Pro?Pro?Val?Leu?Asp?Ser?Asp?Gly?Ser
260 265 270
Phe?Phe?Leu?Tyr?Ser?Lys?Leu?Thr?Val?Asp?Lys?Ser?Arg?Trp?Gln?Gln
275 280 285
Gly?Asn?Val?Phe?Ser?Cys?Ser?Val?Met?His?Glu?Ala?Leu?His?Asn?His
290 295 300
Tyr?Thr?Gln?Lys?Ser?Leu?Ser?Leu?Ser?Pro?Gly?Lys
305 310 315
<210>39
<211>261
<212>PRT
<213〉artificial sequence
<400>39
His?Gly?Glu?Gly?Thr?Phe?Thr?Ser?Asp?Val?Ser?Ser?Tyr?Leu?Glu?Gly
1 5 10 15
Gln?Ala?Ala?Lys?Glu?Phe?Ile?Ala?Trp?Leu?Val?Lys?Gly?Arg?Gly?Gly
20 25 30
Ala?Pro?Asp?Lys?Thr?His?Thr?Cys?Pro?Pro?Cys?Pro?Ala?Pro?Glu?Leu
35 40 45
Leu?Gly?Gly?Pro?Ser?Val?Phe?Leu?Phe?Pro?Pro?Lys?Pro?Lys?Asp?Thr
50 55 60
Leu?Met?Ile?Ser?Arg?Thr?Pro?Glu?Val?Thr?Cys?Val?Val?Val?Asp?Val
65 70 75 80
Ser?His?Glu?Asp?Pro?Glu?Val?Lys?Phe?Asn?Trp?Tyr?Val?Asp?Gly?Val
85 90 95
Glu?Val?His?Asn?Ala?Lys?Thr?Lys?Pro?Arg?Glu?Glu?Gln?Tyr?Asn?Ser
100 105 110
Thr?Tyr?Arg?Val?Val?Ser?Val?Leu?Thr?Val?Leu?His?Gln?Asp?Trp?Leu
115 120 125
Asn?Gly?Lys?Glu?Tyr?Lys?Cys?Lys?Val?Ser?Asn?Lys?Ala?Leu?Pro?Ala
130 135 140
Pro?Ile?Glu?Lys?Thr?Ile?Ser?Lys?Ala?Lys?Gly?Gln?Pro?Arg?Glu?Pro
145 150 155 160
Gln?Val?Tyr?Thr?Leu?Pro?Pro?Ser?Arg?Asp?Glu?Leu?Thr?Lys?Asn?Gln
165 170 175
Val?Ser?Leu?Thr?Cys?Leu?Val?Lys?Gly?Phe?Tyr?Pro?Ser?Asp?Ile?Ala
180 185 190
Val?Glu?Trp?Glu?Ser?Asn?Gly?Gln?Pro?Glu?Asn?Asn?Tyr?Lys?Thr?Thr
195 200 205
Pro?Pro?Val?Leu?Asp?Ser?Asp?Gly?Ser?Phe?Phe?Leu?Tyr?Ser?Lys?Leu
210 215 220
Thr?Val?Asp?Lys?Ser?Arg?Trp?Gln?Gln?Gly?Asn?Val?Phe?Ser?Cys?Ser
225 230 235 240
Val?Met?His?Glu?Ala?Leu?His?Asn?His?Tyr?Thr?Gln?Lys?Ser?Leu?Ser
245 250 255
Leu?Ser?Pro?Gly?Lys
260
<210>40
<211>704
<212>PRT
<213〉artificial sequence
<400>40
His?Gly?Glu?Gly?Thr?Phe?Thr?Ser?Asp?Val?Ser?Ser?Tyr?Leu?Glu?Gly
1 5 10 15
Gln?Ala?Ala?Lys?Glu?Phe?Ile?Ala?Trp?Leu?Val?Lys?Gly?Arg?Gly?Gly
20 25 30
Ala?Pro?Arg?Pro?Gln?Gly?Ala?Thr?Val?Ser?Leu?Trp?Glu?Thr?Val?Gln
35 40 45
Lys?Trp?Arg?Glu?Tyr?Arg?Arg?Gln?Cys?Gln?Arg?Ser?Leu?Thr?Glu?Asp
50 55 60
Pro?Pro?Pro?Ala?Thr?Asp?Leu?Phe?Cys?Asn?Arg?Thr?Phe?Asp?Glu?Tyr
65 70 75 80
Ala?Cys?Trp?Pro?Asp?Gly?Glu?Pro?Gly?Ser?Phe?Val?Asn?Val?Ser?Cys
85 90 95
Pro?Trp?Tyr?Leu?Pro?Trp?Ala?Ser?Ser?Val?Pro?Gln?Gly?His?Val?Tyr
100 105 110
Arg?Phe?Cys?Thr?Ala?Glu?Gly?Leu?Trp?Leu?Gln?Lys?Asp?Asn?Ser?Ser
115 120 125
Leu?Pro?Trp?Arg?Asp?Leu?Ser?Glu?Cys?Glu?Glu?Ser?Lys?Arg?Gly?Glu
130 135 140
Arg?Ser?Ser?Pro?Glu?Glu?Gln?Leu?Leu?Phe?Leu?Tyr?Ile?Ile?Tyr?Thr
145 150 155 160
Val?Gly?Tyr?Ala?Leu?Ser?Phe?Ser?Ala?Leu?Val?Ile?Ala?Ser?Ala?Ile
165 170 175
Leu?Leu?Gly?Phe?Arg?His?Leu?His?Cys?Thr?Arg?Asn?Tyr?Ile?His?Leu
180 185 190
Asn?Leu?Phe?Ala?Ser?Phe?Ile?Leu?Arg?Ala?Leu?Ser?Val?Phe?Ile?Lys
195 200 205
Asp?Ala?Ala?Leu?Lys?Trp?Met?Tyr?Ser?Thr?Ala?Ala?Gln?Gln?His?Gln
210 215 220
Trp?Asp?Gly?Leu?Leu?Ser?Tyr?Gln?Asp?Ser?Leu?Ser?Cys?Arg?Leu?Val
225 230 235 240
Phe?Leu?Leu?Met?Gln?Tyr?Cys?Val?Ala?Ala?Asn?Tyr?Tyr?Trp?Leu?Leu
245 250 255
Val?Glu?Gly?Val?Tyr?Leu?Tyr?Thr?Leu?Leu?Ala?Phe?Ser?Val?Phe?Ser
260 265 270
Glu?Gln?Trp?Ile?Phe?Arg?Leu?Tyr?Val?Ser?Ile?Gly?Trp?Gly?Val?Pro
275 280 285
Leu?Leu?Phe?Val?Val?Pro?Trp?Gly?Ile?Val?Lys?Tyr?Leu?Tyr?Glu?Asp
290 295 300
Glu?Gly?Cys?Trp?Thr?Arg?Asn?Ser?Asn?Met?Asn?Tyr?Trp?Leu?Ile?Ile
305 310 315 320
Arg?Leu?Pro?Ile?Leu?Phe?Ala?Ile?Gly?Val?Asn?Phe?Leu?Ile?Phe?Val
325 330 335
Arg?Val?Ile?Cys?Ile?Val?Val?Ser?Lys?Leu?Lys?Ala?Asn?Leu?Met?Cys
340 345 350
Lys?Thr?Asp?Ile?Lys?Cys?Arg?Leu?Ala?Lys?Ser?Thr?Leu?Thr?Leu?Ile
355 360 365
Pro?Leu?Leu?Gly?Thr?His?Glu?Val?Ile?Phe?Ala?Phe?Val?Met?Asp?Glu
370 375 380
His?Ala?Arg?Gly?Thr?Leu?Arg?Phe?Ile?Lys?Leu?Phe?Thr?Glu?Leu?Ser
385 390 395 400
Phe?Thr?Ser?Phe?Gln?Gly?Leu?Met?Val?Ala?Ile?Leu?Tyr?Cys?Phe?Val
405 410 415
Asn?Asn?Glu?Val?Gln?Leu?Glu?Phe?Arg?Lys?Ser?Trp?Glu?Arg?Trp?Arg
420 425 430
Leu?Glu?His?Leu?His?Ile?Gln?Arg?Asp?Ser?Ser?Met?Lys?Pro?Leu?Lys
435 440 445
Cys?Pro?Thr?Ser?Ser?Leu?Ser?Ser?Gly?Ala?Thr?Ala?Gly?Ser?Ser?Met
450 455 460
Tyr?Thr?Ala?Thr?Cys?Gln?Ala?Ser?Cys?Ser?Gly?Pro?Gly?Asp?Lys?Thr
465 470 475 480
His?Thr?Cys?Pro?Pro?Cys?Pro?Ala?Pro?Glu?Leu?Leu?Gly?Gly?Pro?Ser
485 490 495
Val?Phe?Leu?Phe?Pro?Pro?Lys?Pro?Lys?Asp?Thr?Leu?Met?Ile?Ser?Arg
500 505 510
Thr?Pro?Glu?Val?Thr?Cys?Val?Val?Val?Asp?Val?Ser?His?Glu?Asp?Pro
515 520 525
Glu?Val?Lys?Phe?Asn?Trp?Tyr?Val?Asp?Gly?Val?Glu?Val?His?Asn?Ala
530 535 540
Lys?Thr?Lys?Pro?Arg?Glu?Glu?Gln?Tyr?Asn?Ser?Thr?Tyr?Arg?Val?Val
545 550 555 560
Ser?Val?Leu?Thr?Val?Leu?His?Gln?Asp?Trp?Leu?Asn?Gly?Lys?Glu?Tyr
565 570 575
Lys?Cys?Lys?Val?Ser?Asn?Lys?Ala?Leu?Pro?Ala?Pro?Ile?Glu?Lys?Thr
580 585 590
Ile?Ser?Lys?Ala?Lys?Gly?Gln?Pro?Arg?Glu?Pro?Gln?Val?Tyr?Thr?Leu
595 600 605
Pro?Pro?Ser?Arg?Asp?Glu?Leu?Thr?Lys?Asn?Gln?Val?Ser?Leu?Thr?Cys
610 615 620
Leu?Val?Lys?Gly?Phe?Tyr?Pro?Ser?Asp?Ile?Ala?Val?Glu?Trp?Glu?Ser
625 630 635 640
Asn?Gly?Gln?Pro?Glu?Asn?Asn?Tyr?Lys?Thr?Thr?Pro?Pro?Val?Leu?Asp
645 650 655
Ser?Asp?Gly?Ser?Phe?Phe?Leu?Tyr?Ser?Lys?Leu?Thr?Val?Asp?Lys?Ser
660 665 670
Arg?Trp?Gln?Gln?Gly?Asn?Val?Phe?Ser?Cys?Ser?Val?Met?His?Glu?Ala
675 680 685
Leu?His?Asn?His?Tyr?Thr?Gln?Lys?Ser?Leu?Ser?Leu?Ser?Pro?Gly?Lys
690 695 700
<210>41
<211>386
<212>PRT
<213〉artificial sequence
<400>41
His?Gly?Glu?Gly?Thr?Phe?Thr?Ser?Asp?Val?Ser?Ser?Tyr?Leu?Glu?Gly
1 5 10 15
Gln?Ala?Ala?Lys?Glu?Phe?Ile?Ala?Trp?Leu?Val?Lys?Gly?Arg?Gly?Gly
20 25 30
Ala?Pro?Arg?Pro?Gln?Gly?Ala?Thr?Val?Ser?Leu?Trp?Glu?Thr?Val?Gln
35 40 45
Lys?Trp?Arg?Glu?Tyr?Arg?Arg?Gln?Cys?Gln?Arg?Ser?Leu?Thr?Glu?Asp
50 55 60
Pro?Pro?Pro?Ala?Thr?Asp?Leu?Phe?Cys?Asn?Arg?Thr?Phe?Asp?Glu?Tyr
65 70 75 80
Ala?Cys?Trp?Pro?Asp?Gly?Glu?Pro?Gly?Ser?Phe?Val?Asn?Val?Ser?Cys
85 90 95
Pro?Trp?Tyr?Leu?Pro?Trp?Ala?Ser?Ser?Val?Pro?Gln?Gly?His?Val?Tyr
100 105 110
Arg?Phe?Cys?Thr?Ala?Glu?Gly?Leu?Trp?Leu?Gln?Lys?Asp?Asn?Ser?Ser
115 120 125
Leu?Pro?Trp?Arg?Asp?Leu?Ser?Glu?Cys?Glu?Glu?Ser?Lys?Arg?Gly?Glu
130 135 140
Arg?Ser?Ser?Pro?Glu?Glu?Gln?Leu?Leu?Phe?Leu?Tyr?Gly?Pro?Gly?Asp
145 150 155 160
Lys?Thr?His?Thr?Cys?Pro?Pro?Cys?Pro?Ala?Pro?Glu?Leu?Leu?Gly?Gly
165 170 175
Pro?Ser?Val?Phe?Leu?Phe?Pro?Pro?Lys?Pro?Lys?Asp?Thr?Leu?Met?Ile
180 185 190
Ser?Arg?Thr?Pro?Glu?Val?Thr?Cys?Val?Val?Val?Asp?Val?Ser?His?Glu
195 200 205
Asp?Pro?Glu?Val?Lys?Phe?Asn?Trp?Tyr?Val?Asp?Gly?Val?Glu?Val?His
210 215 220
Asn?Ala?Lys?Thr?Lys?Pro?Arg?Glu?Glu?Gln?Tyr?Asn?Ser?Thr?Tyr?Arg
225 230 235 240
Val?Val?Ser?Val?Leu?Thr?Val?Leu?His?Gln?Asp?Trp?Leu?Asn?Gly?Lys
245 250 255
Glu?Tyr?Lys?Cys?Lys?Val?Ser?Asn?Lys?Ala?Leu?Pro?Ala?Pro?Ile?Glu
260 265 270
Lys?Thr?Ile?Ser?Lys?Ala?Lys?Gly?Gln?Pro?Arg?Glu?Pro?Gln?Val?Tyr
275 280 285
Thr?Leu?Pro?Pro?Ser?Arg?Asp?Glu?Leu?Thr?Lys?Asn?Gln?Val?Ser?Leu
290 295 300
Thr?Cys?Leu?Val?Lys?Gly?Phe?Tyr?Pro?Ser?Asp?Ile?Ala?Val?Glu?Trp
305 310 315 320
Glu?Ser?Asn?Gly?Gln?Pro?Glu?Asn?Asn?Tyr?Lys?Thr?Thr?Pro?Pro?Val
325 330 335
Leu?Asp?Ser?Asp?Gly?Ser?Phe?Phe?Leu?Tyr?Ser?Lys?Leu?Thr?Val?Asp
340 345 350
Lys?Ser?Arg?Trp?Gln?Gln?Gly?Asn?Val?Phe?Ser?Cys?Ser?Val?Met?His
355 360 365
Glu?Ala?Leu?His?Asn?His?Tyr?Thr?Gln?Lys?Ser?Leu?Ser?Leu?Ser?Pro
370 375 380
Gly?Lys
385
<210>42
<211>339
<212>PRT
<213〉artificial sequence
<400>42
His?Gly?Glu?Gly?Thr?Phe?Thr?Ser?Asp?Val?Ser?Ser?Tyr?Leu?Glu?Gly
1 5 10 15
Gln?Ala?Ala?Lys?Glu?Phe?Ile?Ala?Trp?Leu?Val?Lys?Gly?Arg?Gly?Gly
20 25 30
Ala?Pro?Asn?Tyr?Ile?His?Leu?Asn?Leu?Phe?Ala?Ser?Phe?Ile?Leu?Arg
35 40 45
Ala?Leu?Ser?Val?Phe?Ile?Lys?Asp?Ala?Ala?Leu?Lys?Trp?Met?Tyr?Ser
50 55 60
Thr?Ala?Ala?Gln?Gln?His?Gln?Trp?Asp?Gly?Leu?Leu?Ser?Tyr?Gln?Asp
65 70 75 80
Ser?Leu?Ser?Cys?Arg?Leu?Val?Phe?Leu?Leu?Met?Gln?Tyr?Cys?Val?Ala
85 90 95
Ala?Asn?Tyr?Tyr?Trp?Leu?Leu?Val?Glu?Gly?Val?Tyr?Leu?Gly?Pro?Gly
100 105 110
Asp?Lys?Thr?His?Thr?Cys?Pro?Pro?Cys?Pro?Ala?Pro?Glu?Leu?Leu?Gly
115 120 125
Gly?Pro?Ser?Val?Phe?Leu?Phe?Pro?Pro?Lys?Pro?Lys?Asp?Thr?Leu?Met
130 135 140
Ile?Ser?Arg?Thr?Pro?Glu?Val?Thr?Cys?Val?Val?Val?Asp?Val?Ser?His
145 150 155 160
Glu?Asp?Pro?Glu?Val?Lys?Phe?Asn?Trp?Tyr?Val?Asp?Gly?Val?Glu?Val
165 170 175
His?Asn?Ala?Lys?Thr?Lys?Pro?Arg?Glu?Glu?Gln?Tyr?Asn?Ser?Thr?Tyr
180 185 190
Arg?Val?Val?Ser?Val?Leu?Thr?Val?Leu?His?Gln?Asp?Trp?Leu?Asn?Gly
195 200 205
Lys?Glu?Tyr?Lys?Cys?Lys?Val?Ser?Asn?Lys?Ala?Leu?Pro?Ala?Pro?Ile
210 215 220
Glu?Lys?Thr?Ile?Ser?Lys?Ala?Lys?Gly?Gln?Pro?Arg?Glu?Pro?Gln?Val
225 230 235 240
Tyr?Thr?Leu?Pro?Pro?Ser?Arg?Asp?Glu?Leu?Thr?Lys?Asn?Gln?Val?Ser
245 250 255
Leu?Thr?Cys?Leu?Val?Lys?Gly?Phe?Tyr?Pro?Ser?Asp?Ile?Ala?Val?Glu
260 265 270
Trp?Glu?Ser?Asn?Gly?Gln?Pro?Glu?Asn?Asn?Tyr?Lys?Thr?Thr?Pro?Pro
275 280 285
Val?Leu?Asp?Ser?Asp?Gly?Ser?Phe?Phe?Leu?Tyr?Ser?Lys?Leu?Thr?Val
290 295 300
Asp?Lys?Ser?Arg?Trp?Gln?Gln?Gly?Asn?Val?Phe?Ser?Cys?Ser?Val?Met
305 310 315 320
His?Glu?Ala?Leu?His?Asn?His?Tyr?Thr?Gln?Lys?Ser?Leu?Ser?Leu?Ser
325 330 335
Pro?Gly?Lys
<210>43
<211>328
<212>PRT
<213〉artificial sequence
<400>43
His?Gly?Glu?Gly?Thr?Phe?Thr?Ser?Asp?Val?Ser?Ser?Tyr?Leu?Glu?Gly
1 5 10 15
Gln?Ala?Ala?Lys?Glu?Phe?Ile?Ala?Trp?Leu?Val?Lys?Gly?Arg?Gly?Gly
20 25 30
Ala?Pro?Phe?Arg?Leu?Tyr?Val?Ser?Ile?Gly?Trp?Gly?Val?Pro?Leu?Leu
35 40 45
Phe?Val?Val?Pro?Trp?Gly?Ile?Val?Lys?Tyr?Leu?Tyr?Glu?Asp?Glu?Gly
50 55 60
Cys?Trp?Thr?Arg?Asn?Ser?Asn?Met?Asn?Tyr?Trp?Leu?Ile?Ile?Arg?Leu
65 70 75 80
Pro?Ile?Leu?Phe?Gly?Ile?Gly?Val?Asn?Phe?Leu?Ile?Phe?Val?Arg?Val
85 90 95
Ile?Cys?Gly?Pro?Gly?Asp?Lys?Thr?His?Thr?Cys?Pro?Pro?Cys?Pro?Ala
100 105 110
Pro?Glu?Leu?Leu?Gly?Gly?Pro?Ser?Val?Phe?Leu?Phe?Pro?Pro?Lys?Pro
115 120 125
Lys?Asp?Thr?Leu?Met?Ile?Ser?Arg?Thr?Pro?Glu?Val?Thr?Cys?Val?Val
130 135 140
Val?Asp?Val?Ser?His?Glu?Asp?Pro?Glu?Val?Lys?Phe?Asn?Trp?Tyr?Val
145 150 155 160
Asp?Gly?Val?Glu?Val?His?Asn?Ala?Lys?Thr?Lys?Pro?Arg?Glu?Glu?Gln
165 170 175
Tyr?Asn?Ser?Thr?Tyr?Arg?Val?Val?Ser?Val?Leu?Thr?Val?Leu?His?Gln
180 185 190
Asp?Trp?Leu?Asn?Gly?Lys?Glu?Tyr?Lys?Cys?Lys?Val?Ser?Asn?Lys?Ala
195 200 205
Leu?Pro?Ala?Pro?Ile?Glu?Lys?Thr?Ile?Ser?Lys?Ala?Lys?Gly?Gln?Pro
210 215 220
Arg?Glu?Pro?Gln?Val?Tyr?Thr?Leu?Pro?Pro?Ser?Arg?Asp?Glu?Leu?Thr
225 230 235 240
Lys?Asn?Gln?Val?Ser?Leu?Thr?Cys?Leu?Val?Lys?Gly?Phe?Tyr?Pro?Ser
245 250 255
Asp?Ile?Ala?Val?Glu?Trp?Glu?Ser?Asn?Gly?Gln?Pro?Glu?Asn?Asn?Tyr
260 265 270
Lys?Thr?Thr?Pro?Pro?Val?Leu?Asp?Ser?Asp?Gly?Ser?Phe?Phe?Leu?Tyr
275 280 285
Ser?Lys?Leu?Thr?Val?Asp?Lys?Ser?Arg?Trp?Gln?Gln?Gly?Asn?Val?Phe
290 295 300
Ser?Cys?Ser?Val?Met?His?Glu?Ala?Leu?His?Asn?His?Tyr?Thr?Gln?Lys
305 310 315 320
Ser?Leu?Ser?Leu?Ser?Pro?Gly?Lys
325
<210>44
<211>321
<212>PRT
<213〉artificial sequence
<400>44
His?Gly?Glu?Gly?Thr?Phe?Thr?Ser?Asp?Val?Ser?Ser?Tyr?Leu?Glu?Gly
1 5 10 15
Gln?Ala?Ala?Lys?Glu?Phe?Ile?Ala?Trp?Leu?Val?Lys?Gly?Arg?Gly?Gly
20 25 30
Ala?Pro?Ser?Thr?Leu?Thr?Leu?Ile?Pro?Leu?Leu?Gly?Thr?His?Glu?Val
35 40 45
Ile?Phe?Ala?Phe?Val?Met?Asp?Glu?His?Ala?Arg?Gly?Thr?Leu?Arg?Phe
50 55 60
Ile?Lys?Leu?Phe?Thr?Glu?Leu?Ser?Phe?Thr?Ser?Phe?Gln?Gly?Leu?Met
65 70 75 80
Val?Ala?Ile?Leu?Tyr?Cys?Phe?Val?Asn?Asn?Glu?Gly?Pro?Gly?Asp?Lys
85 90 95
Thr?His?Thr?Cys?Pro?Pro?Cys?Pro?Ala?Pro?Glu?Leu?Leu?Gly?Gly?Pro
100 105 110
Ser?Val?Phe?Leu?Phe?Pro?Pro?Lys?Pro?Lys?Asp?Thr?Leu?Met?Ile?Ser
115 120 125
Arg?Thr?Pro?Glu?Val?Thr?Cys?Val?Val?Val?Asp?Val?Ser?His?Glu?Asp
130 135 140
Pro?Glu?Val?Lys?Phe?Asn?Trp?Tyr?Val?Asp?Gly?Val?Glu?Val?His?Asn
145 150 155 160
Ala?Lys?Thr?Lys?Pro?Arg?Glu?Glu?Gln?Tyr?Asn?Ser?Thr?Tyr?Arg?Val
165 170 175
Val?Ser?Val?Leu?Thr?Val?Leu?His?Gln?Asp?Trp?Leu?Asn?Gly?Lys?Glu
180 185 190
Tyr?Lys?Cys?Lys?Val?Ser?Asn?Lys?Ala?Leu?Pro?Ala?Pro?Ile?Glu?Lys
195 200 205
Thr?Ile?Ser?Lys?Ala?Lys?Gly?Gln?Pro?Arg?Glu?Pro?Gln?Val?Tyr?Thr
210 215 220
Leu?Pro?Pro?Ser?Arg?Asp?Glu?Leu?Thr?Lys?Asn?Gln?Val?Ser?Leu?Thr
225 230 235 240
Cys?Leu?Val?Lys?Gly?Phe?Tyr?Pro?Ser?Asp?Ile?Ala?Val?Glu?Trp?Glu
245 250 255
Ser?Asn?Gly?Gln?Pro?Glu?Asn?Asn?Tyr?Lys?Thr?Thr?Pro?Pro?Val?Leu
260 265 270
Asp?Ser?Asp?Gly?Ser?Phe?Phe?Leu?Tyr?Ser?Lys?Leu?Thr?Val?Asp?Lys
275 280 285
Ser?Arg?Trp?Gln?Gln?Gly?Asn?Val?Phe?Ser?Cys?Ser?Val?Met?His?Glu
290 295 300
Ala?Leu?His?Asn?His?Tyr?Thr?Gln?Lys?Ser?Leu?Ser?Leu?Ser?Pro?Gly
305 310 315 320
Lys
<210>45
<211>399
<212>PRT
<213〉artificial sequence
<400>45
His?Gly?Glu?Gly?Thr?Phe?Thr?Ser?Asp?Val?Ser?Ser?Tyr?Leu?Glu?Gly
1 5 10 15
Gln?Ala?Ala?Lys?Glu?Phe?Ile?Ala?Trp?Leu?Val?Lys?Gly?Arg?Gly?Gly
20 25 30
Ala?Pro?Asn?Tyr?Ile?His?Leu?Asn?Leu?Phe?Ala?Ser?Phe?Ile?Leu?Arg
35 40 45
Ala?Leu?Ser?Val?Phe?Ile?Lys?Asp?Ala?Ala?Leu?Lys?Trp?Met?Tyr?Ser
50 55 60
Thr?Ala?Ala?Gln?Gln?His?Gln?Trp?Asp?Gly?Leu?Leu?Ser?Tyr?Gln?Asp
65 70 75 80
Ser?Leu?Ser?Cys?Arg?Leu?Val?Phe?Leu?Leu?Met?Gln?Tyr?Cys?Val?Ala
85 90 95
Ala?Asn?Tyr?Tyr?Trp?Leu?Leu?Val?Glu?Gly?Val?Tyr?Leu?Gly?Pro?Gly
100 105 110
Ser?Thr?Leu?Thr?Leu?Ile?Pro?Leu?Leu?Gly?Thr?His?Glu?Val?Ile?Phe
115 120 125
Ala?Phe?Val?Met?Asp?Glu?His?Ala?Arg?Gly?Thr?Leu?Arg?Phe?Ile?Lys
130 135 140
Leu?Phe?Thr?Glu?Leu?Ser?Phe?Thr?Ser?Phe?Gln?Gly?Leu?Met?Val?Ala
145 150 155 160
Ile?Leu?Tyr?Cys?Phe?Val?Asn?Asn?Glu?Gly?Pro?Gly?Asp?Lys?Thr?His
165 170 175
Thr?Cys?Pro?Pro?Cys?Pro?Ala?Pro?Glu?Leu?Leu?Gly?Gly?Pro?Ser?Val
180 185 190
Phe?Leu?Phe?Pro?Pro?Lys?Pro?Lys?Asp?Thr?Leu?Met?Ile?Ser?Arg?Thr
195 200 205
Pro?Glu?Val?Thr?Cys?Val?Val?Val?Asp?Val?Ser?His?Glu?Asp?Pro?Glu
210 215 220
Val?Lys?Phe?Asn?Trp?Tyr?Val?Asp?Gly?Val?Glu?Val?His?Asn?Ala?Lys
225 230 235 240
Thr?Lys?Pro?Arg?Glu?Glu?Gln?Tyr?Asn?Ser?Thr?Tyr?Arg?Val?Val?Ser
245 250 255
Val?Leu?Thr?Val?Leu?His?Gln?Asp?Trp?Leu?Asn?Gly?Lys?Glu?Tyr?Lys
260 265 270
Cys?Lys?Val?Ser?Asn?Lys?Ala?Leu?Pro?Ala?Pro?Ile?Glu?Lys?Thr?Ile
275 280 285
Ser?Lys?Ala?Lys?Gly?Gln?Pro?Arg?Glu?Pro?Gln?Val?Tyr?Thr?Leu?Pro
290 295 300
Pro?Ser?Arg?Asp?Glu?Leu?Thr?Lys?Asn?Gln?Val?Ser?Leu?Thr?Cys?Leu
305 310 315 320
Val?Lys?Gly?Phe?Tyr?Pro?Ser?Asp?Ile?Ala?Val?Glu?Trp?Glu?Ser?Asn
325 330 335
Gly?Gln?Pro?Glu?Asn?Asn?Tyr?Lys?Thr?Thr?Pro?Pro?Val?Leu?Asp?Ser
340 345 350
Asp?Gly?Ser?Phe?Phe?Leu?Tyr?Ser?Lys?Leu?Thr?Val?Asp?Lys?Ser?Arg
355 360 365
Trp?Gln?Gln?Gly?Asn?Val?Phe?Ser?Cys?Ser?Val?Met?His?Glu?Ala?Leu
370 375 380
His?Asn?His?Tyr?Thr?Gln?Lys?Ser?Leu?Ser?Leu?Ser?Pro?Gly?Lys
385 390 395
Claims (6)
1. the fusion rotein of a hyperglycemic-glycogenolytic factor similar peptide-1 (GLP-1), its aminoacid sequence general formula is: polypeptide A-joint-polypeptide B, polypeptide A-joint-polypeptide B-joint-peptide C or polypeptide A-joint-peptide C-joint-polypeptide B; Wherein,
Polypeptide A is GLP-1 (7-37) [serial ID: N0:1], and its sequence is:
His-Xaa2-Xaa3-Gly-Xaa5-Xaa6-Thr-Xaa8-Xaa9-Xaa10-Xaa11-Xaa12-Xaa13-Xaa14-Xaa15-Xaa16-Xaa17-Xaa18-Xaa19-Xaa20-Xaa21-Phe-Xaa23-Xaa24-Xaa25-Xaa26-Leu-Xaa28-Xaa29-Xaa30-Xaa31
Xaa2 is in the formula: Ala, Gly, Ser, Thr; Xaa3 is: Glu, Asp, Gln, Asn; Xaa5 is: Thr, Arg, Ile; Xaa6 is: Phe, Tyr, Leu; Xaa8 is: Ser, Asn; Xaa9 is: Asp, Asn; Xaa10 is: Val, Ile, Met, Ala; Xaa11 is: Ser, Thr, Ala, Asp; Xaa12 is: Ser, Gln, Glu, Asn, Thr; Xaa13 is: Tyr, Phe, Gln, His, Leu; Xaa14 is: Leu, Thr, Ser; Xaa15 is: Glu, Gln, Asn, Asp, Arg, Lys; Xaa16 is: Gly, Glu, Asp, Gln, Asn, Arg, Lys; Xaa17 is: Gln, Lys, Leu, Phe; Xaa18 is: Ala, Lys; Xaa19 is: Ala, Thr, Ile, Ser; Xaa20 is: Lys, Arg, Gln; Xaa21 is: Glu, Asp, Asn, Ala, Ser, Lys, Arg; Xaa23 is: Ile, Val; Xaa24 is: Ala, Ser, Asp, Glu, Gly, Thr; Xaa25 is: Trp, Arg, Lys, Ser; Xaa27 is: Val, Lys, Ile, Ser, Ala; Xaa28 is: Lys, Arg, Asn, Gln, Ser, Ala, Thr; Xaa29 is: Gly, Tyr, Ser; Xaa30 is: Arg, Lys, Gln, Asp, Asn, Gly, Ala, Pro; Xaa31 is: Gly, Pro, Val, Arg, Lys, Ala or be removed;
Polypeptide B is the composite sequence of human glucagon receptor full length sequence, N terminal membrane ectodomain, glucagon receptor functional zone-1, glucagon receptor functional zone-2, glucagon receptor functional zone-3 or each functional zone of above-mentioned glucagon receptor;
Peptide C is the CH2-CH3 section of immunoglobulin G while 1Fc.
2. according to the fusion rotein of claim 1, it is characterized in that: polypeptide A, polypeptide B and peptide C intermediary joint are selected from:
(Gly-Thr-Gly) n, (Gly-Ala-Pro) n, (Gly-Pro-Gly) n or (GIy-Gly-Gly-Gly-Ser) n;
Wherein n is 1,2,3,4,5,6.
3, fusion rotein according to claim 1 is characterized in that glucagon receptor is any in the following sequence:
(1) whole glucagon receptor sequence [serial ID NO:2], its sequence is:
AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAIHANLFASFVLKASSVLVIDGLLRTRYSQKIGDDLSVSTWLSDGAVAGCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDNMGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGVHEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRLGKVLWEERNTSNHRASSSPGHGPPSKELQFGRGGGSQDSSAETPLAGGLPRLAESPF
(2) glucagon receptor N-terminal membrane ectodomain [serial ID NO:3], its sequence is:
AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSFQ
(3) glucagon receptor functional zone-1 mainly add that by the glucagon receptor first film outer ring film district of striding at its two ends forms [serial ID NO:4], and its sequence is:
Xaa1-IDGLLRTRYSQKIGDDLSVSTWLSDGAVAG-Xaa2
Xaa1 is following sequence: NAIHANLFASFVLKASSVLV in the formula
From Xaa1 N-end, all amino acid can be removed one by one;
Xaa2 is following sequence: CRVAAVFMQYGIVANYCWLLVEGLYL in the formula
From Xaa2 C-end, all amino acid can be removed one by one;
(4) glucagon receptor functional zone-2 mainly add that by glucagon receptor the 2nd film outer ring the film district of striding at its two ends forms [serial ID NO:5], and its sequence is:
Xaa3-KCLFENVQCWTSNDNMGF-Xaa4
Xaa3 is following sequence: FSLYLGIGWGAPMLFVVPWAVV in the formula
From Xaa3 N-end, all amino acid can be removed one by one;
Xaa4 is following sequence: WWILRFPVFLAILINFFIFVRIV in the formula
From Xaa4 C-end, all amino acid can be removed one by one;
(5) glucagon receptor functional zone-3 mainly add that by glucagon receptor the 3rd film outer ring the film district of striding at its two ends forms [serial ID NO:6], and its sequence is:
Xaa5-DEHAQGTLRSAKLFFD-Xaa6
Xaa5 is following sequence: TLTLIPLLGVHEVVFAFVT in the formula
From Xaa5 N-end, all amino acid can be removed one by one;
Xaa6 is following sequence: LFLSSFQGLLVAVLYCFLN in the formula
From Xaa6 C-end, all amino acid can be removed one by one;
(6) glucagon receptor functional zone 1-intermediate head-glucagon receptor functional zone 2, its sequential structure following [serial ID NO:7]:
Xaa1-IDGLLRTRYSQKIGDDLSVSTWLSDGAVAG-Xaa2-intermediate head-Xaa3-KCLFENVQCWTSNDNMGF-Xaa4
Xaa1 is following sequence: NAIHANLFASFVLKASSVLV in the formula
From Xaa1 N-end, all amino acid can be removed one by one;
Xaa2 is following sequence: CRVAAVFMQYGIVANYCWLLVEGLYL in the formula
From Xaa2 C-end, all amino acid can be removed one by one;
Xaa3 is following sequence: FSLYLGIGWGAPMLFVVPWAVV in the formula
From Xaa3 N-end, all amino acid can be removed one by one;
Xaa4 is following sequence: WWILRFPVFLAILINFFIFVRIV in the formula
From Xaa4 C-end, all amino acid can be removed one by one;
(7) glucagon receptor functional zone 1-intermediate head-glucagon receptor functional zone 3, its sequential structure following [serial ID NO:8]:
Xaa1-IDGLLRTRYSQKIGDDLSVSTWLSDGAVAG-Xaa2-intermediate head-Xaa5-DEHAQGTLRSAKLFFD-Xaa6
Xaa1 is following sequence: NAIHANLFASFVLKASSVLV in the formula
From Xaa1 N-end, all amino acid can be removed one by one;
Xaa2 is following sequence: CRVAAVFMQYGIVANYCWLLVEGLYL in the formula
From Xaa2 C-end, all amino acid can be removed one by one;
Xaa5 is following sequence: TLTLIPLLGVHEVVFAFVT in the formula
From Xaa5 N-end, all amino acid can be removed one by one;
Xaa6 is following sequence: LFLSSFQGLLVAVLYCFLN in the formula
From Xaa6 C-end, all amino acid can be removed one by one;
(8) glucagon receptor functional zone 2-intermediate head-glucagon receptor functional zone 3, its sequential structure following [serial ID NO:9]:
Xaa3-KCLFENVQCWTSNDNMGF-Xaa4-intermediate head-Xaa5-DEHAQGTLRSAKLFFD-Xaa6.
Xaa3 is following sequence: FSLYLGIGWGAPMLFVVPWAVV in the formula
From Xaa3 N-end, all amino acid can be removed one by one;
Xaa4 is following sequence: WWILRFPVFLAILINFFIFVRIV in the formula
From Xaa4 C-end, all amino acid can be removed one by one;
Xaa5 is following sequence: TLTLIPLLGVHEVVFAFVT in the formula
From Xaa5 N-end, all amino acid can be removed one by one;
Xaa6 is following sequence: LFLSSFQGLLVAVLYCFLN in the formula
From Xaa6 C-end, all amino acid can be removed one by one;
(9) glucagon receptor functional zone 1-intermediate head-glucagon receptor functional zone 2-intermediate head-glucagon receptor functional zone 3, its sequential structure following [serial ID NO:10]:
Xaa1-IDGLLRTRYSQKIGDDLSVSTWLSDGAVAG-Xaa2-intermediate head-Xaa3-KCLFENVQCWTSNDNMGF-Xaa4-intermediate head-Xaa5-DEHAQGTLRSAKLFFD-Xaa6
Xaa1 is following sequence: NAIHANLFASFVLKASSVLV in the formula
From Xaa1 N-end, all amino acid can be removed one by one;
Xaa2 is following sequence: CRVAAVFMQYGIVANYCWLLVEGLYL in the formula
From Xaa2 C-end, all amino acid can be removed one by one;
Xaa3 is following sequence: FSLYLGIGWGAPMLFVVPWAVV in the formula
From Xaa3 N-end, all amino acid can be removed one by one;
Xaa4 is following sequence: WWILRFPVFLAILINFFIFVRIV in the formula
From Xaa4 C-end, all amino acid can be removed one by one;
Xaa5 is following sequence: TLTLIPLLGVHEVVFAFVT in the formula
From Xaa5 N-end, all amino acid can be removed one by one;
Xaa6 is following sequence: LFLSSFQGLLVAVLYCFLN in the formula
From Xaa6 C-end, all amino acid can be removed one by one;
(10) glucagon receptor N terminal membrane ectodomain-intermediate head-glucagon receptor functional zone 1, its sequential structure following [serial ID NO:11]:
AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISC PWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKM YSSFQ-intermediate head-Xaa1-IDGLLRTRYSQKIGDDLSVSTWLSDGAVAG-Xaa2
Xaa1 is following sequence: NAIHANLFASFVLKASSVLV in the formula
From Xaa1 N-end, all amino acid can be removed one by one;
Xaa2 is following sequence: CRVAAVFMQYGIVANYCWLLVEGLYL in the formula
From Xaa2 C-end, all amino acid can be removed one by one;
(11) glucagon receptor N terminal membrane ectodomain-intermediate head-glucagon receptor functional zone 2, its sequential structure following [serial ID NO:12]:
AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISC PWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKM YSSFQ-intermediate head-Xaa3-KCLFENVQCWTSNDNMGF-Xaa4
Xaa3 is following sequence: FSLYLGIGWGAPMLFVVPWAVV in the formula
From Xaa3 N-end, all amino acid can be removed one by one;
Xaa4 is following sequence: WWILRFPVFLAILINFFIFVRIV in the formula
From Xaa4 C-end, all amino acid can be removed one by one;
(12) glucagon receptor N terminal membrane ectodomain-intermediate head-glucagon receptor functional zone 3, its sequential structure following [serial ID NO:13]:
AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISC PWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKM YSSFQ-intermediate head-Xaa5-DEHAQGTLRSAKLFFD-Xaa6
Xaa5 is following sequence: TLTLIPLLGVHEVVFAFVT in the formula
From Xaa5 N-end, all amino acid can be removed one by one;
Xaa6 is following sequence: LFLSSFQGLLVAVLYCFLN in the formula
From Xaa6 C-end, all amino acid can be removed one by one;
(13) glucagon receptor N terminal membrane ectodomain-intermediate head-glucagon receptor functional zone 1-intermediate head-glucagon receptor functional zone 2, its sequential structure following [serial ID NO:14]:
AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTAN I SCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVA KMYSSFQ-intermediate head-Xaa1-IDGLLRTRYSQKIGDDLSVSTWLSDGAVAG-Xaa2-intermediate head-Xaa3-KCLFENVQCWTSNDNMGF-Xaa4
Xaa1 is following sequence: NAIHANLFASFVLKASSVLV in the formula
From Xaa1 N-end, all amino acid can be removed one by one;
Xaa2 is following sequence: CRVAAVFMQYGIVANYCWLLVEGLYL in the formula
From Xaa2 C-end, all amino acid can be removed one by one;
Xaa3 is following sequence: FSLYLGIGWGAPMLFVVPWAVV in the formula
From Xaa3 N-end, all amino acid can be removed one by one;
Xaa4 is following sequence: WWILRFPVFLAILINFFIFVRIV in the formula
From Xaa4 C-end, all amino acid can be removed one by one;
(14) glucagon receptor N terminal membrane ectodomain-intermediate head-glucagon receptor functional zone 1-intermediate head-glucagon receptor functional zone 3, its sequential structure following [serial ID NO:15]:
AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISC PWYLPWHHKQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMY SSFQ-intermediate head-Xaa1-IDGLLRTRYSQKIGDDLSVSTWLSDGAVAG-Xaa2-intermediate head-Xaa5-DEHAQGTLRSAKLFFD-Xaa6.
Xaa1 is following sequence: NAIHANLFASFVLKASSVLV in the formula
From Xaa1 N-end, all amino acid can be removed one by one;
Xaa2 is following sequence: CRVAAVFMQYGIVANYCWLLVEGLYL in the formula
From Xaa2 C-end, all amino acid can be removed one by one;
Xaa5 is following sequence: TLTLIPLLGVHEVVFAFVT in the formula
From Xaa5 N-end, all amino acid can be removed one by one;
Xaa6 is following sequence: LFLSSFQGLLVAVLYCFLN in the formula
From Xaa6 C-end, all amino acid can be removed one by one;
(15) glucagon receptor N terminal membrane ectodomain-intermediate head-glucagon receptor functional zone 2-intermediate head-glucagon receptor functional zone 3, its sequential structure following [serial ID NO:16]:
AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISC PWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKM YSSFQ-intermediate head-Xaa3-KCLFENVQCWTSNDNMGF-Xaa4-intermediate head-Xaa5-DEHAQGTLRSAKLFFD-Xaa6
Xaa3 is following sequence: FSLYLGIGWGAPMLFVVPWAVV in the formula
From Xaa3 N-end, all amino acid can be removed one by one;
Xaa4 is following sequence: WWILRFPVFLAILINFFIFVRIV in the formula
From Xaa4 C-end, all amino acid can be removed one by one;
Xaa5 is following sequence: TLTLIPLLGVHEVVFAFVT in the formula
From Xaa5 N-end, all amino acid can be removed one by one;
Xaa6 is following sequence: LFLSSFQGLLVAVLYCFLN in the formula
From Xaa6 C-end, all amino acid can be removed one by one;
(16) glucagon receptor N terminal membrane ectodomain-intermediate head-glucagon receptor functional zone 1-intermediate head-glucagon receptor functional zone 2-intermediate head-glucagon receptor functional zone 3, its sequential structure following [serial ID NO:17]:
AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISC PWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKM YSSFQ-intermediate head-Xaa1-IDGLLRTRYSQKIGDDLSVSTWLSDGAVAG-Xaa2-intermediate head-Xaa3-KCLFENVQCWTSNDNMGF-Xaa4-intermediate head-Xaa5-DEHAQGTLRSAKLFFD-Xaa6.
Xaa1 is following sequence: NAIHANLFASFVLKASSVLV in the formula
From Xaa1 N-end, all amino acid can be removed one by one;
Xaa2 is following sequence: CRVAAVFMQYGIVANYCWLLVEGLYL in the formula
From Xaa2 C-end, all amino acid can be removed one by one;
Xaa3 is following sequence: FSLYLGIGWGAPMLFVVPWAVV in the formula
From Xaa3 N-end, all amino acid can be removed one by one;
Xaa4 is following sequence: WWILRFPVFLAILINFFIFVRIV in the formula
From Xaa4 C-end, all amino acid can be removed one by one;
Xaa5 is following sequence: TLTLIPLLGVHEVVFAFVT in the formula
From Xaa5 N-end, all amino acid can be removed one by one;
Xaa6 is following sequence: LFLSSFQGLLVAVLYCFLN in the formula
From Xaa6 C-end, all amino acid can be removed one by one;
4. the fusion rotein of GLP-1 according to claim 1, wherein, peptide C is the CH2-CH3 section of immunoglobulin G while 1Fc, its sequence following [serial ID NO:34]:
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK。
5. one kind is used for the treatment of non insulin dependent diabetes or fat pharmaceutical composition, contains any one fusion rotein among the claim 1-4.
6. the application of the fusion rotein of the GLP-1 described in the claim 1-4 in preparation treatment type i diabetes, type ii diabetes, obesity, cerebral apoplexy medicine.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CNB2005100171754A CN100445300C (en) | 2005-09-30 | 2005-09-30 | GLP-1 fusion protein and its preparation method and medicinal uses |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CNB2005100171754A CN100445300C (en) | 2005-09-30 | 2005-09-30 | GLP-1 fusion protein and its preparation method and medicinal uses |
Publications (2)
Publication Number | Publication Date |
---|---|
CN1765931A CN1765931A (en) | 2006-05-03 |
CN100445300C true CN100445300C (en) | 2008-12-24 |
Family
ID=36742066
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CNB2005100171754A Expired - Fee Related CN100445300C (en) | 2005-09-30 | 2005-09-30 | GLP-1 fusion protein and its preparation method and medicinal uses |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN100445300C (en) |
Families Citing this family (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN101294187B (en) * | 2008-06-06 | 2013-07-31 | 暨南大学 | Method for sustained-releasing polypeptide with biological activity and application thereof |
US20110245174A1 (en) * | 2008-08-21 | 2011-10-06 | Peter Artymiuk | Glp-1 fusion polypeptides |
CN102532323B (en) * | 2010-12-09 | 2014-07-23 | 天津药物研究院 | Polypeptide complex, pharmaceutical composition, as well as preparation method and application of polypeptide complex |
CN113573739A (en) * | 2019-03-08 | 2021-10-29 | 格纳西尼有限公司 | GLP-1 fusion proteins and uses thereof |
WO2023125881A1 (en) * | 2021-12-31 | 2023-07-06 | 广东东阳光药业有限公司 | Fusion protein of glp-1 and gdf15 and use thereof |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2004094461A2 (en) * | 2003-04-21 | 2004-11-04 | Bristol-Myers Squibb Company | Human glucagon-like-peptide-1 mimics and their use in the treatment of diabetes and related conditions |
CN1564829A (en) * | 2001-01-05 | 2005-01-12 | 辉瑞大药厂 | Antibodies to insulin-like growth factor I receptor |
-
2005
- 2005-09-30 CN CNB2005100171754A patent/CN100445300C/en not_active Expired - Fee Related
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN1564829A (en) * | 2001-01-05 | 2005-01-12 | 辉瑞大药厂 | Antibodies to insulin-like growth factor I receptor |
WO2004094461A2 (en) * | 2003-04-21 | 2004-11-04 | Bristol-Myers Squibb Company | Human glucagon-like-peptide-1 mimics and their use in the treatment of diabetes and related conditions |
Also Published As
Publication number | Publication date |
---|---|
CN1765931A (en) | 2006-05-03 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
JP7211712B2 (en) | glucagon receptor agonist | |
CN100445300C (en) | GLP-1 fusion protein and its preparation method and medicinal uses | |
JP6153206B2 (en) | Human insulin analogues and acylated derivatives thereof | |
US20140056893A1 (en) | Homodimeric Proteins | |
WO2005035761A1 (en) | Splice variants of preproglucagon, glucagon-like peptide-1 and oxyntomodulin | |
WO2018166468A1 (en) | Igg-like long-acting immune fusion protein and use thereof | |
EP3574004A1 (en) | Relaxin fusion polypeptides and uses thereof | |
CN102690352A (en) | Fusion protein containing GLP-1, and pharmaceutical compositions and applications thereof | |
JP2008546816A (en) | Exendin 4 polypeptide fragments and uses thereof | |
WO2020048494A1 (en) | Long-acting recombinant glp1-fc-cd47 protein, preparation method and use thereof | |
CN102443064A (en) | Thrombin activity based chimeric peptide with double targeting effects and application thereof | |
CN104645317B (en) | Application of polypeptide compound as polypeptide or protein drug carrier, method and fusion protein compound thereof | |
WO2007018879A2 (en) | Interferon-gamma antagonists and therapeutic uses thereof | |
JP6320973B2 (en) | B cell activator antagonist, preparation method and use thereof | |
WO2022117044A1 (en) | Glp-1/gcg dual receptor agonist polypeptide and fusion protein thereof | |
CN102453095A (en) | Fusion protein containing GLP (glucagon-like peptide)-1 and preparation method and application thereof | |
CN101665799A (en) | Recombination preparation method and application of Exendin-4 derivative | |
Hu et al. | Cloning and expression of earthworm fibrinolytic enzyme PM246 in Pichia pastoris | |
CN111217915B (en) | GLP-1 analogue Fc fusion polypeptide and application thereof | |
US10017555B2 (en) | Long-acting blood sugar decreasing fusion protein | |
CN106432471A (en) | Novel peptide conjugate of African clawed frog GLP-1 (glucagon like peptide-1), as well as application thereof | |
JPH09501054A (en) | Human glucagon-like 1 peptide receptor | |
CN113150172A (en) | GLP-1R/GIPR double-target agonist fusion protein and preparation method and application thereof | |
JP4683819B2 (en) | Proteins induced by allogeneic blood transfusion and DNA encoding the same | |
WO2024027553A1 (en) | Bifunctional fusion protein and use thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
C06 | Publication | ||
PB01 | Publication | ||
C10 | Entry into substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
C14 | Grant of patent or utility model | ||
GR01 | Patent grant | ||
CF01 | Termination of patent right due to non-payment of annual fee |
Granted publication date: 20081224 Termination date: 20150930 |
|
EXPY | Termination of patent right or utility model |