CA2650197A1 - Nanofiber structures on asperities for sequestering, carrying and transferring substances - Google Patents
Nanofiber structures on asperities for sequestering, carrying and transferring substances Download PDFInfo
- Publication number
- CA2650197A1 CA2650197A1 CA002650197A CA2650197A CA2650197A1 CA 2650197 A1 CA2650197 A1 CA 2650197A1 CA 002650197 A CA002650197 A CA 002650197A CA 2650197 A CA2650197 A CA 2650197A CA 2650197 A1 CA2650197 A1 CA 2650197A1
- Authority
- CA
- Canada
- Prior art keywords
- fragment
- toxin
- microneedles
- present
- polymer
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 239000002121 nanofiber Substances 0.000 title claims abstract description 129
- 239000000126 substance Substances 0.000 title claims description 83
- 230000014759 maintenance of location Effects 0.000 title description 3
- 239000000463 material Substances 0.000 claims abstract description 128
- 239000000758 substrate Substances 0.000 claims abstract description 94
- 239000013543 active substance Substances 0.000 claims abstract description 33
- 229920000642 polymer Polymers 0.000 claims description 147
- 231100000765 toxin Toxicity 0.000 claims description 128
- 239000003053 toxin Substances 0.000 claims description 127
- 229940088597 hormone Drugs 0.000 claims description 112
- 239000005556 hormone Substances 0.000 claims description 112
- 238000000034 method Methods 0.000 claims description 111
- 108090000623 proteins and genes Proteins 0.000 claims description 96
- 102000004169 proteins and genes Human genes 0.000 claims description 69
- 239000003795 chemical substances by application Substances 0.000 claims description 37
- 229920000036 polyvinylpyrrolidone Polymers 0.000 claims description 27
- 229960002235 anthrax antigen Drugs 0.000 claims description 20
- 241000193403 Clostridium Species 0.000 claims description 18
- 239000001863 hydroxypropyl cellulose Substances 0.000 claims description 12
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 claims description 12
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 claims description 11
- 102000004127 Cytokines Human genes 0.000 claims description 10
- 108090000695 Cytokines Proteins 0.000 claims description 10
- 229920003169 water-soluble polymer Polymers 0.000 claims description 9
- 229920001661 Chitosan Polymers 0.000 claims description 8
- 229920000663 Hydroxyethyl cellulose Polymers 0.000 claims description 7
- 239000004354 Hydroxyethyl cellulose Substances 0.000 claims description 7
- 235000019447 hydroxyethyl cellulose Nutrition 0.000 claims description 7
- 230000001225 therapeutic effect Effects 0.000 claims description 7
- 229920002134 Carboxymethyl cellulose Polymers 0.000 claims description 6
- 235000010443 alginic acid Nutrition 0.000 claims description 6
- 229920000615 alginic acid Polymers 0.000 claims description 6
- 239000001768 carboxy methyl cellulose Substances 0.000 claims description 6
- 235000010948 carboxy methyl cellulose Nutrition 0.000 claims description 6
- 239000008112 carboxymethyl-cellulose Substances 0.000 claims description 6
- 239000000783 alginic acid Substances 0.000 claims description 5
- 229960001126 alginic acid Drugs 0.000 claims description 5
- 150000004781 alginic acids Chemical class 0.000 claims description 5
- 239000012876 carrier material Substances 0.000 claims 1
- 239000003814 drug Substances 0.000 abstract description 58
- 230000037317 transdermal delivery Effects 0.000 abstract description 11
- 239000012634 fragment Substances 0.000 description 193
- 238000002360 preparation method Methods 0.000 description 174
- 108700012359 toxins Proteins 0.000 description 137
- 239000000203 mixture Substances 0.000 description 128
- 239000000427 antigen Substances 0.000 description 127
- 108091007433 antigens Proteins 0.000 description 127
- 102000036639 antigens Human genes 0.000 description 127
- -1 poly(ethylene glycol) Polymers 0.000 description 119
- 239000000835 fiber Substances 0.000 description 115
- 101710194807 Protective antigen Proteins 0.000 description 104
- 238000009472 formulation Methods 0.000 description 86
- 210000003491 skin Anatomy 0.000 description 78
- 235000018102 proteins Nutrition 0.000 description 68
- 241000193155 Clostridium botulinum Species 0.000 description 59
- 229960005486 vaccine Drugs 0.000 description 57
- 108020001507 fusion proteins Proteins 0.000 description 53
- 102000037865 fusion proteins Human genes 0.000 description 53
- 229940079593 drug Drugs 0.000 description 48
- 241000282414 Homo sapiens Species 0.000 description 45
- 239000000243 solution Substances 0.000 description 44
- 150000001875 compounds Chemical class 0.000 description 43
- 239000000017 hydrogel Substances 0.000 description 42
- 102000003982 Parathyroid hormone Human genes 0.000 description 36
- 108090000445 Parathyroid hormone Proteins 0.000 description 36
- 239000000199 parathyroid hormone Substances 0.000 description 36
- 210000004027 cell Anatomy 0.000 description 33
- 238000001523 electrospinning Methods 0.000 description 32
- 239000010410 layer Substances 0.000 description 31
- 239000007787 solid Substances 0.000 description 31
- 241000193738 Bacillus anthracis Species 0.000 description 29
- 229960001319 parathyroid hormone Drugs 0.000 description 29
- 241000193163 Clostridioides difficile Species 0.000 description 27
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 26
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 26
- 150000001413 amino acids Chemical group 0.000 description 25
- 230000000670 limiting effect Effects 0.000 description 25
- 241001509421 Clostridium botulinum C Species 0.000 description 24
- 206010052428 Wound Diseases 0.000 description 24
- 208000027418 Wounds and injury Diseases 0.000 description 24
- 239000013598 vector Substances 0.000 description 24
- 108090000765 processed proteins & peptides Proteins 0.000 description 22
- 238000000576 coating method Methods 0.000 description 21
- 230000008569 process Effects 0.000 description 21
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 20
- 239000012620 biological material Substances 0.000 description 20
- 208000015181 infectious disease Diseases 0.000 description 20
- 208000031729 Bacteremia Diseases 0.000 description 19
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 19
- 230000000694 effects Effects 0.000 description 19
- 239000007788 liquid Substances 0.000 description 19
- 101710084578 Short neurotoxin 1 Proteins 0.000 description 18
- 101710182532 Toxin a Proteins 0.000 description 18
- 239000013612 plasmid Substances 0.000 description 18
- 229920002643 polyglutamic acid Polymers 0.000 description 18
- 150000002500 ions Chemical class 0.000 description 17
- 102000004196 processed proteins & peptides Human genes 0.000 description 17
- 229920000049 Carbon (fiber) Polymers 0.000 description 16
- 239000004917 carbon fiber Substances 0.000 description 16
- 201000010099 disease Diseases 0.000 description 16
- 230000004927 fusion Effects 0.000 description 16
- 210000003205 muscle Anatomy 0.000 description 16
- 239000003981 vehicle Substances 0.000 description 16
- 241000607479 Yersinia pestis Species 0.000 description 15
- 230000000975 bioactive effect Effects 0.000 description 15
- 239000011248 coating agent Substances 0.000 description 15
- 239000003102 growth factor Substances 0.000 description 15
- OGBMKVWORPGQRR-UMXFMPSGSA-N teriparatide Chemical compound C([C@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H](N)CO)C(C)C)[C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CNC=N1 OGBMKVWORPGQRR-UMXFMPSGSA-N 0.000 description 15
- 241001465754 Metazoa Species 0.000 description 14
- 230000014509 gene expression Effects 0.000 description 14
- 108030001720 Bontoxilysin Proteins 0.000 description 13
- 108010020346 Polyglutamic Acid Proteins 0.000 description 13
- 238000004519 manufacturing process Methods 0.000 description 13
- 239000002904 solvent Substances 0.000 description 13
- 238000011282 treatment Methods 0.000 description 13
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 12
- 208000003508 Botulism Diseases 0.000 description 12
- 241000588724 Escherichia coli Species 0.000 description 12
- 101710138657 Neurotoxin Proteins 0.000 description 12
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 12
- 238000000151 deposition Methods 0.000 description 12
- 239000012528 membrane Substances 0.000 description 12
- VNWKTOKETHGBQD-UHFFFAOYSA-N methane Chemical class C VNWKTOKETHGBQD-UHFFFAOYSA-N 0.000 description 12
- 239000002581 neurotoxin Substances 0.000 description 12
- 231100000618 neurotoxin Toxicity 0.000 description 12
- 241000282412 Homo Species 0.000 description 11
- XUIMIQQOPSSXEZ-UHFFFAOYSA-N Silicon Chemical compound [Si] XUIMIQQOPSSXEZ-UHFFFAOYSA-N 0.000 description 11
- 230000001147 anti-toxic effect Effects 0.000 description 11
- 238000003491 array Methods 0.000 description 11
- 239000007933 dermal patch Substances 0.000 description 11
- 229940071676 hydroxypropylcellulose Drugs 0.000 description 11
- 238000002156 mixing Methods 0.000 description 11
- 230000035772 mutation Effects 0.000 description 11
- 239000011148 porous material Substances 0.000 description 11
- 231100000419 toxicity Toxicity 0.000 description 11
- 230000001988 toxicity Effects 0.000 description 11
- 239000004971 Cross linker Substances 0.000 description 10
- 208000001132 Osteoporosis Diseases 0.000 description 10
- 229940024606 amino acid Drugs 0.000 description 10
- 235000001014 amino acid Nutrition 0.000 description 10
- 238000010276 construction Methods 0.000 description 10
- 238000004132 cross linking Methods 0.000 description 10
- 230000001665 lethal effect Effects 0.000 description 10
- 239000002502 liposome Substances 0.000 description 10
- 229910052710 silicon Inorganic materials 0.000 description 10
- 239000010703 silicon Substances 0.000 description 10
- 210000001519 tissue Anatomy 0.000 description 10
- 101500000960 Bacillus anthracis Protective antigen PA-63 Proteins 0.000 description 9
- 108020004414 DNA Proteins 0.000 description 9
- 241000589602 Francisella tularensis Species 0.000 description 9
- 201000000628 Gas Gangrene Diseases 0.000 description 9
- 230000028993 immune response Effects 0.000 description 9
- 230000036039 immunity Effects 0.000 description 9
- 231100000518 lethal Toxicity 0.000 description 9
- 239000002773 nucleotide Substances 0.000 description 9
- 125000003729 nucleotide group Chemical group 0.000 description 9
- 229920000867 polyelectrolyte Polymers 0.000 description 9
- 238000006467 substitution reaction Methods 0.000 description 9
- 238000012360 testing method Methods 0.000 description 9
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 9
- 241000196324 Embryophyta Species 0.000 description 8
- 206010062255 Soft tissue infection Diseases 0.000 description 8
- 239000002671 adjuvant Substances 0.000 description 8
- 230000000712 assembly Effects 0.000 description 8
- 238000000429 assembly Methods 0.000 description 8
- JUFFVKRROAPVBI-PVOYSMBESA-N chembl1210015 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N[C@H]1[C@@H]([C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO[C@]3(O[C@@H](C[C@H](O)[C@H](O)CO)[C@H](NC(C)=O)[C@@H](O)C3)C(O)=O)O2)O)[C@@H](CO)O1)NC(C)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 JUFFVKRROAPVBI-PVOYSMBESA-N 0.000 description 8
- 239000002537 cosmetic Substances 0.000 description 8
- 230000029087 digestion Effects 0.000 description 8
- 239000012530 fluid Substances 0.000 description 8
- 230000003053 immunization Effects 0.000 description 8
- 238000002649 immunization Methods 0.000 description 8
- 230000001771 impaired effect Effects 0.000 description 8
- 230000000149 penetrating effect Effects 0.000 description 8
- 229920001184 polypeptide Polymers 0.000 description 8
- 150000003839 salts Chemical class 0.000 description 8
- 241000894007 species Species 0.000 description 8
- 208000010392 Bone Fractures Diseases 0.000 description 7
- 241000283707 Capra Species 0.000 description 7
- 102000004594 DNA Polymerase I Human genes 0.000 description 7
- 108010017826 DNA Polymerase I Proteins 0.000 description 7
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 7
- 108010011459 Exenatide Proteins 0.000 description 7
- 206010000269 abscess Diseases 0.000 description 7
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 7
- 239000008199 coating composition Substances 0.000 description 7
- 229920001577 copolymer Polymers 0.000 description 7
- 238000013461 design Methods 0.000 description 7
- 229960001519 exenatide Drugs 0.000 description 7
- 238000002474 experimental method Methods 0.000 description 7
- 239000013604 expression vector Substances 0.000 description 7
- 210000001061 forehead Anatomy 0.000 description 7
- 230000002163 immunogen Effects 0.000 description 7
- 238000002347 injection Methods 0.000 description 7
- 239000007924 injection Substances 0.000 description 7
- 239000000047 product Substances 0.000 description 7
- 230000001681 protective effect Effects 0.000 description 7
- 238000007920 subcutaneous administration Methods 0.000 description 7
- 241000894006 Bacteria Species 0.000 description 6
- 241000283690 Bos taurus Species 0.000 description 6
- 108091006146 Channels Proteins 0.000 description 6
- 206010017076 Fracture Diseases 0.000 description 6
- 206010030113 Oedema Diseases 0.000 description 6
- 108010049264 Teriparatide Proteins 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 229940053031 botulinum toxin Drugs 0.000 description 6
- 239000002775 capsule Substances 0.000 description 6
- 239000002134 carbon nanofiber Substances 0.000 description 6
- 239000000412 dendrimer Substances 0.000 description 6
- 229920000736 dendritic polymer Polymers 0.000 description 6
- 239000002158 endotoxin Substances 0.000 description 6
- 230000002255 enzymatic effect Effects 0.000 description 6
- 210000002615 epidermis Anatomy 0.000 description 6
- 230000001815 facial effect Effects 0.000 description 6
- 229940071826 hydroxyethyl cellulose Drugs 0.000 description 6
- 230000002401 inhibitory effect Effects 0.000 description 6
- 230000007246 mechanism Effects 0.000 description 6
- 239000002609 medium Substances 0.000 description 6
- 239000003658 microfiber Substances 0.000 description 6
- 239000002088 nanocapsule Substances 0.000 description 6
- 239000002077 nanosphere Substances 0.000 description 6
- 239000000813 peptide hormone Substances 0.000 description 6
- 102000005962 receptors Human genes 0.000 description 6
- 108020003175 receptors Proteins 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- 239000011734 sodium Substances 0.000 description 6
- 238000004528 spin coating Methods 0.000 description 6
- 238000005507 spraying Methods 0.000 description 6
- 210000000434 stratum corneum Anatomy 0.000 description 6
- LYTCVQQGCSNFJU-LKGYBJPKSA-N α-bungarotoxin Chemical compound C(/[C@H]1O[C@H]2C[C@H]3O[C@@H](CC(=C)C=O)C[C@H](O)[C@]3(C)O[C@@H]2C[C@@H]1O[C@@H]1C2)=C/C[C@]1(C)O[C@H]1[C@@]2(C)O[C@]2(C)CC[C@@H]3O[C@@H]4C[C@]5(C)O[C@@H]6C(C)=CC(=O)O[C@H]6C[C@H]5O[C@H]4C[C@@H](C)[C@H]3O[C@H]2C1 LYTCVQQGCSNFJU-LKGYBJPKSA-N 0.000 description 6
- 101710195183 Alpha-bungarotoxin Proteins 0.000 description 5
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 5
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 5
- 241000193449 Clostridium tetani Species 0.000 description 5
- ZZZCUOFIHGPKAK-UHFFFAOYSA-N D-erythro-ascorbic acid Natural products OCC1OC(=O)C(O)=C1O ZZZCUOFIHGPKAK-UHFFFAOYSA-N 0.000 description 5
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 5
- 229920001410 Microfiber Polymers 0.000 description 5
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 5
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 5
- 229930003268 Vitamin C Natural products 0.000 description 5
- 125000000539 amino acid group Chemical group 0.000 description 5
- 239000012867 bioactive agent Substances 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 5
- 230000006378 damage Effects 0.000 description 5
- 230000034994 death Effects 0.000 description 5
- 238000007598 dipping method Methods 0.000 description 5
- 230000002500 effect on skin Effects 0.000 description 5
- 239000000284 extract Substances 0.000 description 5
- 239000000499 gel Substances 0.000 description 5
- 229960002989 glutamic acid Drugs 0.000 description 5
- XLTANAWLDBYGFU-UHFFFAOYSA-N methyllycaconitine hydrochloride Natural products C1CC(OC)C2(C3C4OC)C5CC(C(C6)OC)C(OC)C5C6(O)C4(O)C2N(CC)CC31COC(=O)C1=CC=CC=C1N1C(=O)CC(C)C1=O XLTANAWLDBYGFU-UHFFFAOYSA-N 0.000 description 5
- 239000000693 micelle Substances 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 239000002071 nanotube Substances 0.000 description 5
- 239000002245 particle Substances 0.000 description 5
- 206010034674 peritonitis Diseases 0.000 description 5
- 230000000144 pharmacologic effect Effects 0.000 description 5
- 229920000728 polyester Polymers 0.000 description 5
- 229920001223 polyethylene glycol Polymers 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- 229920005989 resin Polymers 0.000 description 5
- 239000011347 resin Substances 0.000 description 5
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 5
- 230000003637 steroidlike Effects 0.000 description 5
- 238000002560 therapeutic procedure Methods 0.000 description 5
- 238000013334 tissue model Methods 0.000 description 5
- 235000019154 vitamin C Nutrition 0.000 description 5
- 239000011718 vitamin C Substances 0.000 description 5
- 206010003011 Appendicitis Diseases 0.000 description 4
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 4
- WHUUTDBJXJRKMK-GSVOUGTGSA-N D-glutamic acid Chemical compound OC(=O)[C@H](N)CCC(O)=O WHUUTDBJXJRKMK-GSVOUGTGSA-N 0.000 description 4
- 102100023266 Dual specificity mitogen-activated protein kinase kinase 2 Human genes 0.000 description 4
- 101710146529 Dual specificity mitogen-activated protein kinase kinase 2 Proteins 0.000 description 4
- 102000004190 Enzymes Human genes 0.000 description 4
- 108090000790 Enzymes Proteins 0.000 description 4
- 101710198884 GATA-type zinc finger protein 1 Proteins 0.000 description 4
- DTHNMHAUYICORS-KTKZVXAJSA-N Glucagon-like peptide 1 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 DTHNMHAUYICORS-KTKZVXAJSA-N 0.000 description 4
- 102000005720 Glutathione transferase Human genes 0.000 description 4
- 108010070675 Glutathione transferase Proteins 0.000 description 4
- 108091005804 Peptidases Proteins 0.000 description 4
- 102100040918 Pro-glucagon Human genes 0.000 description 4
- 239000004365 Protease Substances 0.000 description 4
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 4
- 244000269722 Thea sinensis Species 0.000 description 4
- 108010057266 Type A Botulinum Toxins Proteins 0.000 description 4
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 4
- 229910052782 aluminium Inorganic materials 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 230000003110 anti-inflammatory effect Effects 0.000 description 4
- 229940088710 antibiotic agent Drugs 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 210000000988 bone and bone Anatomy 0.000 description 4
- 229910052799 carbon Inorganic materials 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 239000004020 conductor Substances 0.000 description 4
- 230000021615 conjugation Effects 0.000 description 4
- 210000000172 cytosol Anatomy 0.000 description 4
- 230000008021 deposition Effects 0.000 description 4
- 238000012377 drug delivery Methods 0.000 description 4
- 235000013305 food Nutrition 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 4
- 230000001939 inductive effect Effects 0.000 description 4
- 238000003780 insertion Methods 0.000 description 4
- 230000037431 insertion Effects 0.000 description 4
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 4
- 238000007918 intramuscular administration Methods 0.000 description 4
- 239000011159 matrix material Substances 0.000 description 4
- 229910052751 metal Inorganic materials 0.000 description 4
- 239000002184 metal Substances 0.000 description 4
- 239000003960 organic solvent Substances 0.000 description 4
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 4
- 229920002338 polyhydroxyethylmethacrylate Polymers 0.000 description 4
- 229920002451 polyvinyl alcohol Polymers 0.000 description 4
- 108091008146 restriction endonucleases Proteins 0.000 description 4
- 230000000717 retained effect Effects 0.000 description 4
- 229910052708 sodium Inorganic materials 0.000 description 4
- ATHGHQPFGPMSJY-UHFFFAOYSA-N spermidine Chemical compound NCCCCNCCCN ATHGHQPFGPMSJY-UHFFFAOYSA-N 0.000 description 4
- PFNFFQXMRSDOHW-UHFFFAOYSA-N spermine Chemical compound NCCCNCCCCNCCCN PFNFFQXMRSDOHW-UHFFFAOYSA-N 0.000 description 4
- 238000009987 spinning Methods 0.000 description 4
- 229960005460 teriparatide Drugs 0.000 description 4
- 229930003231 vitamin Natural products 0.000 description 4
- 235000013343 vitamin Nutrition 0.000 description 4
- 239000011782 vitamin Substances 0.000 description 4
- 229940088594 vitamin Drugs 0.000 description 4
- RJZNPROJTJSYLC-LLINQDLYSA-N (4s)-4-acetamido-5-[[(2s)-1-[[(2s)-1-[[(2s)-5-amino-1-[[(2s)-1-[[(2s)-1-amino-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-4-methylsulfanyl-1-oxobutan-2-yl]amino]-4-car Chemical compound OC(=O)CC[C@H](NC(C)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O RJZNPROJTJSYLC-LLINQDLYSA-N 0.000 description 3
- 229920000856 Amylose Polymers 0.000 description 3
- XFTWUNOVBCHBJR-UHFFFAOYSA-N Aspergillomarasmine A Chemical group OC(=O)C(N)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O XFTWUNOVBCHBJR-UHFFFAOYSA-N 0.000 description 3
- 231100000699 Bacterial toxin Toxicity 0.000 description 3
- UHOVQNZJYSORNB-UHFFFAOYSA-N Benzene Chemical compound C1=CC=CC=C1 UHOVQNZJYSORNB-UHFFFAOYSA-N 0.000 description 3
- 206010065687 Bone loss Diseases 0.000 description 3
- 244000248349 Citrus limon Species 0.000 description 3
- 102000008186 Collagen Human genes 0.000 description 3
- 108010035532 Collagen Proteins 0.000 description 3
- 206010014568 Empyema Diseases 0.000 description 3
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 235000010469 Glycine max Nutrition 0.000 description 3
- 241000725303 Human immunodeficiency virus Species 0.000 description 3
- 101000963974 Hydrophis stokesii Alpha-elapitoxin-Ast2b Proteins 0.000 description 3
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 3
- 208000008238 Muscle Spasticity Diseases 0.000 description 3
- 101000964025 Naja naja Long neurotoxin 3 Proteins 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- 101710116435 Outer membrane protein Proteins 0.000 description 3
- 229920002732 Polyanhydride Polymers 0.000 description 3
- 229920000954 Polyglycolide Polymers 0.000 description 3
- 229920000331 Polyhydroxybutyrate Polymers 0.000 description 3
- 229920001710 Polyorthoester Polymers 0.000 description 3
- 108010029485 Protein Isoforms Proteins 0.000 description 3
- 102000001708 Protein Isoforms Human genes 0.000 description 3
- 108010006338 acetyl-glutamyl-glutamyl-methionyl-glutaminyl-arginyl-argininamide Proteins 0.000 description 3
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 3
- 230000000202 analgesic effect Effects 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 230000000843 anti-fungal effect Effects 0.000 description 3
- 229940121363 anti-inflammatory agent Drugs 0.000 description 3
- 239000002260 anti-inflammatory agent Substances 0.000 description 3
- 230000000340 anti-metabolite Effects 0.000 description 3
- 230000000840 anti-viral effect Effects 0.000 description 3
- 239000000935 antidepressant agent Substances 0.000 description 3
- 229940005513 antidepressants Drugs 0.000 description 3
- 229940100197 antimetabolite Drugs 0.000 description 3
- 239000002256 antimetabolite Substances 0.000 description 3
- 239000002246 antineoplastic agent Substances 0.000 description 3
- 239000002249 anxiolytic agent Substances 0.000 description 3
- 239000000688 bacterial toxin Substances 0.000 description 3
- 238000005452 bending Methods 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000003115 biocidal effect Effects 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 229940098773 bovine serum albumin Drugs 0.000 description 3
- 239000011575 calcium Substances 0.000 description 3
- 229910052791 calcium Inorganic materials 0.000 description 3
- 229940105329 carboxymethylcellulose Drugs 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 229940045110 chitosan Drugs 0.000 description 3
- 231100001102 clostridial toxin Toxicity 0.000 description 3
- 229920001436 collagen Polymers 0.000 description 3
- 239000002131 composite material Substances 0.000 description 3
- 238000011109 contamination Methods 0.000 description 3
- 239000003431 cross linking reagent Substances 0.000 description 3
- 239000013078 crystal Substances 0.000 description 3
- 230000007547 defect Effects 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 238000004090 dissolution Methods 0.000 description 3
- 238000001378 electrochemiluminescence detection Methods 0.000 description 3
- 230000008921 facial expression Effects 0.000 description 3
- 210000001097 facial muscle Anatomy 0.000 description 3
- 239000011888 foil Substances 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 210000001035 gastrointestinal tract Anatomy 0.000 description 3
- 239000004220 glutamic acid Substances 0.000 description 3
- 230000035876 healing Effects 0.000 description 3
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 3
- 229920001477 hydrophilic polymer Polymers 0.000 description 3
- 229920001600 hydrophobic polymer Polymers 0.000 description 3
- 238000003119 immunoblot Methods 0.000 description 3
- 210000003000 inclusion body Anatomy 0.000 description 3
- 201000011422 infant botulism Diseases 0.000 description 3
- 230000002458 infectious effect Effects 0.000 description 3
- 230000035987 intoxication Effects 0.000 description 3
- 231100000566 intoxication Toxicity 0.000 description 3
- 238000007912 intraperitoneal administration Methods 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 230000003902 lesion Effects 0.000 description 3
- 238000011068 loading method Methods 0.000 description 3
- 238000013507 mapping Methods 0.000 description 3
- 229940031348 multivalent vaccine Drugs 0.000 description 3
- 231100000350 mutagenesis Toxicity 0.000 description 3
- 238000002703 mutagenesis Methods 0.000 description 3
- 230000035515 penetration Effects 0.000 description 3
- 239000005015 poly(hydroxybutyrate) Substances 0.000 description 3
- 229920000218 poly(hydroxyvalerate) Polymers 0.000 description 3
- 239000002745 poly(ortho ester) Substances 0.000 description 3
- 229920002463 poly(p-dioxanone) polymer Polymers 0.000 description 3
- 229920002239 polyacrylonitrile Polymers 0.000 description 3
- 229920001610 polycaprolactone Polymers 0.000 description 3
- 239000004632 polycaprolactone Substances 0.000 description 3
- 239000000622 polydioxanone Substances 0.000 description 3
- 229920001282 polysaccharide Polymers 0.000 description 3
- 239000005017 polysaccharide Substances 0.000 description 3
- 150000004804 polysaccharides Chemical class 0.000 description 3
- 238000004321 preservation Methods 0.000 description 3
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 3
- 230000000069 prophylactic effect Effects 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- 238000010254 subcutaneous injection Methods 0.000 description 3
- 239000007929 subcutaneous injection Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 230000035900 sweating Effects 0.000 description 3
- 230000009885 systemic effect Effects 0.000 description 3
- 230000009466 transformation Effects 0.000 description 3
- 230000005945 translocation Effects 0.000 description 3
- 238000002255 vaccination Methods 0.000 description 3
- GVJHHUAWPYXKBD-UHFFFAOYSA-N (±)-α-Tocopherol Chemical compound OC1=C(C)C(C)=C2OC(CCCC(C)CCCC(C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-UHFFFAOYSA-N 0.000 description 2
- 206010056519 Abdominal infection Diseases 0.000 description 2
- 240000000073 Achillea millefolium Species 0.000 description 2
- 235000007754 Achillea millefolium Nutrition 0.000 description 2
- 235000009434 Actinidia chinensis Nutrition 0.000 description 2
- 244000298715 Actinidia chinensis Species 0.000 description 2
- 244000056974 Adansonia digitata Species 0.000 description 2
- 235000003320 Adansonia digitata Nutrition 0.000 description 2
- 235000002961 Aloe barbadensis Nutrition 0.000 description 2
- 244000144927 Aloe barbadensis Species 0.000 description 2
- 244000144725 Amygdalus communis Species 0.000 description 2
- 235000011437 Amygdalus communis Nutrition 0.000 description 2
- 240000005528 Arctium lappa Species 0.000 description 2
- 235000003130 Arctium lappa Nutrition 0.000 description 2
- 241000972773 Aulopiformes Species 0.000 description 2
- 244000075850 Avena orientalis Species 0.000 description 2
- 235000007319 Avena orientalis Nutrition 0.000 description 2
- 101500000959 Bacillus anthracis Protective antigen PA-20 Proteins 0.000 description 2
- 201000004538 Bacteriuria Diseases 0.000 description 2
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 2
- 235000005881 Calendula officinalis Nutrition 0.000 description 2
- 240000001432 Calendula officinalis Species 0.000 description 2
- 241001112695 Clostridiales Species 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 240000007154 Coffea arabica Species 0.000 description 2
- 240000008067 Cucumis sativus Species 0.000 description 2
- 229930182847 D-glutamic acid Natural products 0.000 description 2
- XUIIKFGFIJCVMT-GFCCVEGCSA-N D-thyroxine Chemical compound IC1=CC(C[C@@H](N)C(O)=O)=CC(I)=C1OC1=CC(I)=C(O)C(I)=C1 XUIIKFGFIJCVMT-GFCCVEGCSA-N 0.000 description 2
- 206010012735 Diarrhoea Diseases 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 108010049047 Echinocandins Proteins 0.000 description 2
- 208000004145 Endometritis Diseases 0.000 description 2
- 231100000948 EpiDerm Skin Irritation Test Toxicity 0.000 description 2
- 241000283073 Equus caballus Species 0.000 description 2
- ULGZDMOVFRHVEP-RWJQBGPGSA-N Erythromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=O)[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 ULGZDMOVFRHVEP-RWJQBGPGSA-N 0.000 description 2
- 239000001859 Ethyl hydroxyethyl cellulose Substances 0.000 description 2
- 102000018389 Exopeptidases Human genes 0.000 description 2
- 108010091443 Exopeptidases Proteins 0.000 description 2
- OHCQJHSOBUTRHG-KGGHGJDLSA-N FORSKOLIN Chemical compound O=C([C@@]12O)C[C@](C)(C=C)O[C@]1(C)[C@@H](OC(=O)C)[C@@H](O)[C@@H]1[C@]2(C)[C@@H](O)CCC1(C)C OHCQJHSOBUTRHG-KGGHGJDLSA-N 0.000 description 2
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 2
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 2
- 235000016622 Filipendula ulmaria Nutrition 0.000 description 2
- 244000308505 Filipendula ulmaria Species 0.000 description 2
- 206010016952 Food poisoning Diseases 0.000 description 2
- 208000019331 Foodborne disease Diseases 0.000 description 2
- 235000008100 Ginkgo biloba Nutrition 0.000 description 2
- 244000194101 Ginkgo biloba Species 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 235000006200 Glycyrrhiza glabra Nutrition 0.000 description 2
- 244000303040 Glycyrrhiza glabra Species 0.000 description 2
- 239000012981 Hank's balanced salt solution Substances 0.000 description 2
- 240000008669 Hedera helix Species 0.000 description 2
- NTYJJOPFIAHURM-UHFFFAOYSA-N Histamine Chemical compound NCCC1=CN=CN1 NTYJJOPFIAHURM-UHFFFAOYSA-N 0.000 description 2
- 108091006905 Human Serum Albumin Proteins 0.000 description 2
- 102000008100 Human Serum Albumin Human genes 0.000 description 2
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 2
- 229920001479 Hydroxyethyl methyl cellulose Polymers 0.000 description 2
- 235000017309 Hypericum perforatum Nutrition 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 102000004877 Insulin Human genes 0.000 description 2
- 108090001061 Insulin Proteins 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 244000131360 Morinda citrifolia Species 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- HSHXDCVZWHOWCS-UHFFFAOYSA-N N'-hexadecylthiophene-2-carbohydrazide Chemical compound CCCCCCCCCCCCCCCCNNC(=O)c1cccs1 HSHXDCVZWHOWCS-UHFFFAOYSA-N 0.000 description 2
- 235000017879 Nasturtium officinale Nutrition 0.000 description 2
- 240000005407 Nasturtium officinale Species 0.000 description 2
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 2
- 102000019315 Nicotinic acetylcholine receptors Human genes 0.000 description 2
- 108050006807 Nicotinic acetylcholine receptors Proteins 0.000 description 2
- MWUXSHHQAYIFBG-UHFFFAOYSA-N Nitric oxide Chemical compound O=[N] MWUXSHHQAYIFBG-UHFFFAOYSA-N 0.000 description 2
- 239000000020 Nitrocellulose Substances 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 206010031252 Osteomyelitis Diseases 0.000 description 2
- 208000001164 Osteoporotic Fractures Diseases 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 229930040373 Paraformaldehyde Natural products 0.000 description 2
- 244000025272 Persea americana Species 0.000 description 2
- 235000008673 Persea americana Nutrition 0.000 description 2
- 235000003406 Polymnia sonchifolia Nutrition 0.000 description 2
- 244000134540 Polymnia sonchifolia Species 0.000 description 2
- 239000004793 Polystyrene Substances 0.000 description 2
- 239000004372 Polyvinyl alcohol Substances 0.000 description 2
- 229920001328 Polyvinylidene chloride Polymers 0.000 description 2
- LCTONWCANYUPML-UHFFFAOYSA-M Pyruvate Chemical compound CC(=O)C([O-])=O LCTONWCANYUPML-UHFFFAOYSA-M 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- BUGBHKTXTAQXES-UHFFFAOYSA-N Selenium Chemical compound [Se] BUGBHKTXTAQXES-UHFFFAOYSA-N 0.000 description 2
- 244000044822 Simmondsia californica Species 0.000 description 2
- 235000004433 Simmondsia californica Nutrition 0.000 description 2
- MUMGGOZAMZWBJJ-DYKIIFRCSA-N Testostosterone Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 MUMGGOZAMZWBJJ-DYKIIFRCSA-N 0.000 description 2
- 206010043376 Tetanus Diseases 0.000 description 2
- 235000006468 Thea sinensis Nutrition 0.000 description 2
- 206010062233 Uterine infection Diseases 0.000 description 2
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 2
- 244000225942 Viola tricolor Species 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 229930003316 Vitamin D Natural products 0.000 description 2
- QYSXJUFSXHHAJI-XFEUOLMDSA-N Vitamin D3 Natural products C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C/C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-XFEUOLMDSA-N 0.000 description 2
- 206010048038 Wound infection Diseases 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- 230000003187 abdominal effect Effects 0.000 description 2
- 239000002535 acidifier Substances 0.000 description 2
- 229940095602 acidifiers Drugs 0.000 description 2
- 239000002390 adhesive tape Substances 0.000 description 2
- IBVAQQYNSHJXBV-UHFFFAOYSA-N adipic acid dihydrazide Chemical compound NNC(=O)CCCCC(=O)NN IBVAQQYNSHJXBV-UHFFFAOYSA-N 0.000 description 2
- 238000001261 affinity purification Methods 0.000 description 2
- 230000032683 aging Effects 0.000 description 2
- 235000011399 aloe vera Nutrition 0.000 description 2
- 150000001408 amides Chemical class 0.000 description 2
- 239000002269 analeptic agent Substances 0.000 description 2
- 229940035676 analgesics Drugs 0.000 description 2
- 239000000730 antalgic agent Substances 0.000 description 2
- 230000001430 anti-depressive effect Effects 0.000 description 2
- 230000001384 anti-glaucoma Effects 0.000 description 2
- 230000000118 anti-neoplastic effect Effects 0.000 description 2
- 230000001028 anti-proliverative effect Effects 0.000 description 2
- 230000002682 anti-psoriatic effect Effects 0.000 description 2
- 230000000561 anti-psychotic effect Effects 0.000 description 2
- 229940121375 antifungal agent Drugs 0.000 description 2
- 229940034982 antineoplastic agent Drugs 0.000 description 2
- 230000000949 anxiolytic effect Effects 0.000 description 2
- 229920006187 aquazol Polymers 0.000 description 2
- 230000002146 bilateral effect Effects 0.000 description 2
- 210000003445 biliary tract Anatomy 0.000 description 2
- 230000000740 bleeding effect Effects 0.000 description 2
- 210000001124 body fluid Anatomy 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- RYYVLZVUVIJVGH-UHFFFAOYSA-N caffeine Chemical compound CN1C(=O)N(C)C(=O)C2=C1N=CN2C RYYVLZVUVIJVGH-UHFFFAOYSA-N 0.000 description 2
- 239000001110 calcium chloride Substances 0.000 description 2
- 229910001628 calcium chloride Inorganic materials 0.000 description 2
- 229910001424 calcium ion Inorganic materials 0.000 description 2
- 159000000007 calcium salts Chemical class 0.000 description 2
- 239000002327 cardiovascular agent Substances 0.000 description 2
- 229940125692 cardiovascular agent Drugs 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 239000013592 cell lysate Substances 0.000 description 2
- 230000004656 cell transport Effects 0.000 description 2
- 229920002678 cellulose Polymers 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 239000000919 ceramic Substances 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 230000002281 colonystimulating effect Effects 0.000 description 2
- 230000001268 conjugating effect Effects 0.000 description 2
- 239000003246 corticosteroid Substances 0.000 description 2
- 229960001334 corticosteroids Drugs 0.000 description 2
- 229920006037 cross link polymer Polymers 0.000 description 2
- 239000012228 culture supernatant Substances 0.000 description 2
- 238000005520 cutting process Methods 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 230000002638 denervation Effects 0.000 description 2
- 238000001784 detoxification Methods 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- OSVXSBDYLRYLIG-UHFFFAOYSA-N dioxidochlorine(.) Chemical compound O=Cl=O OSVXSBDYLRYLIG-UHFFFAOYSA-N 0.000 description 2
- 239000012153 distilled water Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 230000003628 erosive effect Effects 0.000 description 2
- 235000019326 ethyl hydroxyethyl cellulose Nutrition 0.000 description 2
- 229920003089 ethylhydroxy ethyl cellulose Polymers 0.000 description 2
- 238000001704 evaporation Methods 0.000 description 2
- 230000008020 evaporation Effects 0.000 description 2
- 239000003172 expectorant agent Substances 0.000 description 2
- 239000002871 fertility agent Substances 0.000 description 2
- 239000012091 fetal bovine serum Substances 0.000 description 2
- 229940126864 fibroblast growth factor Drugs 0.000 description 2
- 239000000446 fuel Substances 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 210000003714 granulocyte Anatomy 0.000 description 2
- 230000005484 gravity Effects 0.000 description 2
- 235000009569 green tea Nutrition 0.000 description 2
- 239000000122 growth hormone Substances 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 2
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 2
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 2
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 2
- 230000002519 immonomodulatory effect Effects 0.000 description 2
- 230000009851 immunogenic response Effects 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 229910052500 inorganic mineral Inorganic materials 0.000 description 2
- 229940125396 insulin Drugs 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 230000037427 ion transport Effects 0.000 description 2
- 125000003010 ionic group Chemical group 0.000 description 2
- VNYSSYRCGWBHLG-AMOLWHMGSA-N leukotriene B4 Chemical compound CCCCC\C=C/C[C@@H](O)\C=C\C=C\C=C/[C@@H](O)CCCC(O)=O VNYSSYRCGWBHLG-AMOLWHMGSA-N 0.000 description 2
- 150000002617 leukotrienes Chemical class 0.000 description 2
- 230000033001 locomotion Effects 0.000 description 2
- 238000005461 lubrication Methods 0.000 description 2
- 210000002540 macrophage Anatomy 0.000 description 2
- 239000002923 metal particle Substances 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 229920000609 methyl cellulose Polymers 0.000 description 2
- 239000001923 methylcellulose Substances 0.000 description 2
- 239000011707 mineral Substances 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 231100000219 mutagenic Toxicity 0.000 description 2
- 230000003505 mutagenic effect Effects 0.000 description 2
- 229920001220 nitrocellulos Polymers 0.000 description 2
- 235000017524 noni Nutrition 0.000 description 2
- 150000007523 nucleic acids Chemical class 0.000 description 2
- 238000006384 oligomerization reaction Methods 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 229920001308 poly(aminoacid) Polymers 0.000 description 2
- 229920001490 poly(butyl methacrylate) polymer Polymers 0.000 description 2
- 229920001483 poly(ethyl methacrylate) polymer Polymers 0.000 description 2
- 229920001849 poly(hydroxybutyrate-co-valerate) Polymers 0.000 description 2
- 229920001606 poly(lactic acid-co-glycolic acid) Polymers 0.000 description 2
- 229920002432 poly(vinyl methyl ether) polymer Polymers 0.000 description 2
- 229920000515 polycarbonate Polymers 0.000 description 2
- 239000004417 polycarbonate Substances 0.000 description 2
- 229920006324 polyoxymethylene Polymers 0.000 description 2
- 229920002223 polystyrene Polymers 0.000 description 2
- 229920000166 polytrimethylene carbonate Polymers 0.000 description 2
- 229920002635 polyurethane Polymers 0.000 description 2
- 239000004814 polyurethane Substances 0.000 description 2
- 235000019422 polyvinyl alcohol Nutrition 0.000 description 2
- 239000005033 polyvinylidene chloride Substances 0.000 description 2
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 230000000750 progressive effect Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 235000019515 salmon Nutrition 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 229910052711 selenium Inorganic materials 0.000 description 2
- 239000011669 selenium Substances 0.000 description 2
- 239000004065 semiconductor Substances 0.000 description 2
- QZAYGJVTTNCVMB-UHFFFAOYSA-N serotonin Chemical compound C1=C(O)C=C2C(CCN)=CNC2=C1 QZAYGJVTTNCVMB-UHFFFAOYSA-N 0.000 description 2
- 238000010008 shearing Methods 0.000 description 2
- 239000002210 silicon-based material Substances 0.000 description 2
- 229940063673 spermidine Drugs 0.000 description 2
- 229940063675 spermine Drugs 0.000 description 2
- 206010041569 spinal fracture Diseases 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- BDHFUVZGWQCTTF-UHFFFAOYSA-M sulfonate Chemical compound [O-]S(=O)=O BDHFUVZGWQCTTF-UHFFFAOYSA-M 0.000 description 2
- 230000000475 sunscreen effect Effects 0.000 description 2
- 239000000516 sunscreening agent Substances 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 238000013268 sustained release Methods 0.000 description 2
- 239000012730 sustained-release form Substances 0.000 description 2
- IMCGHZIGRANKHV-AJNGGQMLSA-N tert-butyl (3s,5s)-2-oxo-5-[(2s,4s)-5-oxo-4-propan-2-yloxolan-2-yl]-3-propan-2-ylpyrrolidine-1-carboxylate Chemical compound O1C(=O)[C@H](C(C)C)C[C@H]1[C@H]1N(C(=O)OC(C)(C)C)C(=O)[C@H](C(C)C)C1 IMCGHZIGRANKHV-AJNGGQMLSA-N 0.000 description 2
- 229940126585 therapeutic drug Drugs 0.000 description 2
- 229940034208 thyroxine Drugs 0.000 description 2
- XUIIKFGFIJCVMT-UHFFFAOYSA-N thyroxine-binding globulin Natural products IC1=CC(CC([NH3+])C([O-])=O)=CC(I)=C1OC1=CC(I)=C(O)C(I)=C1 XUIIKFGFIJCVMT-UHFFFAOYSA-N 0.000 description 2
- 239000003104 tissue culture media Substances 0.000 description 2
- OGIDPMRJRNCKJF-UHFFFAOYSA-N titanium oxide Inorganic materials [Ti]=O OGIDPMRJRNCKJF-UHFFFAOYSA-N 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 2
- 230000032258 transport Effects 0.000 description 2
- 230000002485 urinary effect Effects 0.000 description 2
- 210000001635 urinary tract Anatomy 0.000 description 2
- 230000035899 viability Effects 0.000 description 2
- 230000001018 virulence Effects 0.000 description 2
- 235000019166 vitamin D Nutrition 0.000 description 2
- 239000011710 vitamin D Substances 0.000 description 2
- 150000003710 vitamin D derivatives Chemical class 0.000 description 2
- 229940046008 vitamin d Drugs 0.000 description 2
- 230000037303 wrinkles Effects 0.000 description 2
- OZFAFGSSMRRTDW-UHFFFAOYSA-N (2,4-dichlorophenyl) benzenesulfonate Chemical compound ClC1=CC(Cl)=CC=C1OS(=O)(=O)C1=CC=CC=C1 OZFAFGSSMRRTDW-UHFFFAOYSA-N 0.000 description 1
- WWJFFVUVFNBJTN-UIBIZFFUSA-N (2S)-2-[[(2S,3S,4S)-2-amino-4-hydroxy-4-(5-hydroxypyridin-2-yl)-3-methylbutanoyl]amino]-2-[(2R,3S,4S,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]acetic acid Chemical class C[C@@H]([C@H](N)C(=O)N[C@@H]([C@H]1O[C@H]([C@@H](O)[C@@H]1O)n1ccc(=O)[nH]c1=O)C(O)=O)[C@H](O)c1ccc(O)cn1 WWJFFVUVFNBJTN-UIBIZFFUSA-N 0.000 description 1
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 1
- AJLNZWYOJAWBCR-OOPVGHQCSA-N (4s)-4-acetamido-5-[[(2s)-1-[[(2s)-1-[[(2s)-5-amino-1-[[(2s)-1-[[(2s)-1-amino-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-4-methylsulfanyl-1-oxobutan-2-yl]amino]-4-car Chemical group OC(=O)CC[C@H](NC(C)=O)C(=C)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCN=C(N)N)C(N)=O AJLNZWYOJAWBCR-OOPVGHQCSA-N 0.000 description 1
- FPIPGXGPPPQFEQ-UHFFFAOYSA-N 13-cis retinol Natural products OCC=C(C)C=CC=C(C)C=CC1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-UHFFFAOYSA-N 0.000 description 1
- 101710175181 17 kDa lipoprotein Proteins 0.000 description 1
- VOXZDWNPVJITMN-ZBRFXRBCSA-N 17β-estradiol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 VOXZDWNPVJITMN-ZBRFXRBCSA-N 0.000 description 1
- BWLBGMIXKSTLSX-UHFFFAOYSA-M 2-hydroxyisobutyrate Chemical compound CC(C)(O)C([O-])=O BWLBGMIXKSTLSX-UHFFFAOYSA-M 0.000 description 1
- OTYVBQZXUNBRTK-UHFFFAOYSA-N 3,3,6-trimethylhepta-1,5-dien-4-one Chemical compound CC(C)=CC(=O)C(C)(C)C=C OTYVBQZXUNBRTK-UHFFFAOYSA-N 0.000 description 1
- HVCOBJNICQPDBP-UHFFFAOYSA-N 3-[3-[3,5-dihydroxy-6-methyl-4-(3,4,5-trihydroxy-6-methyloxan-2-yl)oxyoxan-2-yl]oxydecanoyloxy]decanoic acid;hydrate Chemical compound O.OC1C(OC(CC(=O)OC(CCCCCCC)CC(O)=O)CCCCCCC)OC(C)C(O)C1OC1C(O)C(O)C(O)C(C)O1 HVCOBJNICQPDBP-UHFFFAOYSA-N 0.000 description 1
- DBXBTMSZEOQQDU-UHFFFAOYSA-N 3-hydroxyisobutyric acid Chemical compound OCC(C)C(O)=O DBXBTMSZEOQQDU-UHFFFAOYSA-N 0.000 description 1
- JOOXCMJARBKPKM-UHFFFAOYSA-M 4-oxopentanoate Chemical compound CC(=O)CCC([O-])=O JOOXCMJARBKPKM-UHFFFAOYSA-M 0.000 description 1
- LGZKGOGODCLQHG-CYBMUJFWSA-N 5-[(2r)-2-hydroxy-2-(3,4,5-trimethoxyphenyl)ethyl]-2-methoxyphenol Chemical compound C1=C(O)C(OC)=CC=C1C[C@@H](O)C1=CC(OC)=C(OC)C(OC)=C1 LGZKGOGODCLQHG-CYBMUJFWSA-N 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- 206010060921 Abdominal abscess Diseases 0.000 description 1
- 208000032484 Accidental exposure to product Diseases 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical group CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 1
- 208000002874 Acne Vulgaris Diseases 0.000 description 1
- NIXOWILDQLNWCW-UHFFFAOYSA-M Acrylate Chemical compound [O-]C(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-M 0.000 description 1
- 235000009436 Actinidia deliciosa Nutrition 0.000 description 1
- 241000251468 Actinopterygii Species 0.000 description 1
- 235000003319 Adansonia gregorii Nutrition 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- 235000001674 Agaricus brunnescens Nutrition 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 235000009051 Ambrosia paniculata var. peruviana Nutrition 0.000 description 1
- 241000428352 Amma Species 0.000 description 1
- APKFDSVGJQXUKY-KKGHZKTASA-N Amphotericin-B Natural products O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1C=CC=CC=CC=CC=CC=CC=C[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-KKGHZKTASA-N 0.000 description 1
- 241000193457 Anaerocolumna aminovalerica Species 0.000 description 1
- 206010002198 Anaphylactic reaction Diseases 0.000 description 1
- 108010064733 Angiotensins Proteins 0.000 description 1
- 102000015427 Angiotensins Human genes 0.000 description 1
- 241000272517 Anseriformes Species 0.000 description 1
- 241000486679 Antitype Species 0.000 description 1
- 235000008078 Arctium minus Nutrition 0.000 description 1
- 235000012871 Arctostaphylos uva ursi Nutrition 0.000 description 1
- 244000139693 Arctostaphylos uva ursi Species 0.000 description 1
- 241000233788 Arecaceae Species 0.000 description 1
- 241000285470 Artemesia Species 0.000 description 1
- 235000003097 Artemisia absinthium Nutrition 0.000 description 1
- 240000001851 Artemisia dracunculus Species 0.000 description 1
- 235000017731 Artemisia dracunculus ssp. dracunculus Nutrition 0.000 description 1
- 235000003261 Artemisia vulgaris Nutrition 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 241000304886 Bacilli Species 0.000 description 1
- 108010077805 Bacterial Proteins Proteins 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 235000003932 Betula Nutrition 0.000 description 1
- 241000219429 Betula Species 0.000 description 1
- 235000018185 Betula X alpestris Nutrition 0.000 description 1
- 235000018212 Betula X uliginosa Nutrition 0.000 description 1
- 206010061695 Biliary tract infection Diseases 0.000 description 1
- LSNNMFCWUKXFEE-UHFFFAOYSA-M Bisulfite Chemical compound OS([O-])=O LSNNMFCWUKXFEE-UHFFFAOYSA-M 0.000 description 1
- 208000020084 Bone disease Diseases 0.000 description 1
- 208000004020 Brain Abscess Diseases 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-M Bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 1
- 241000272079 Bungarus multicinctus Species 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-M Butyrate Chemical compound CCCC([O-])=O FERIUCNNQQJTOY-UHFFFAOYSA-M 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butyric acid Natural products CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 1
- 102000055006 Calcitonin Human genes 0.000 description 1
- 108060001064 Calcitonin Proteins 0.000 description 1
- BHPQYMZQTOCNFJ-UHFFFAOYSA-N Calcium cation Chemical compound [Ca+2] BHPQYMZQTOCNFJ-UHFFFAOYSA-N 0.000 description 1
- 102000000584 Calmodulin Human genes 0.000 description 1
- 108010041952 Calmodulin Proteins 0.000 description 1
- 235000009590 Calophyllum inophyllum Nutrition 0.000 description 1
- 240000005589 Calophyllum inophyllum Species 0.000 description 1
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 108030002440 Catalase peroxidases Proteins 0.000 description 1
- 235000009024 Ceanothus sanguineus Nutrition 0.000 description 1
- 208000035484 Cellulite Diseases 0.000 description 1
- 235000004032 Centella asiatica Nutrition 0.000 description 1
- 244000146462 Centella asiatica Species 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- 239000004155 Chlorine dioxide Substances 0.000 description 1
- RAPBNVDSDCTNRC-UHFFFAOYSA-N Chlorobenzilate Chemical compound C=1C=C(Cl)C=CC=1C(O)(C(=O)OCC)C1=CC=C(Cl)C=C1 RAPBNVDSDCTNRC-UHFFFAOYSA-N 0.000 description 1
- 208000032544 Cicatrix Diseases 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 235000005979 Citrus limon Nutrition 0.000 description 1
- 241001112696 Clostridia Species 0.000 description 1
- 206010061043 Clostridial infection Diseases 0.000 description 1
- 241001147768 Clostridium argentinense Species 0.000 description 1
- 241000186542 Clostridium baratii Species 0.000 description 1
- 241000193171 Clostridium butyricum Species 0.000 description 1
- 241000193455 Clostridium cadaveris Species 0.000 description 1
- 241000186562 Clostridium carnis Species 0.000 description 1
- 241000206044 Clostridium chauvoei Species 0.000 description 1
- 241000193167 Clostridium cochlearium Species 0.000 description 1
- 241000186571 Clostridium fallax Species 0.000 description 1
- 241000186565 Clostridium malenominatum Species 0.000 description 1
- 241000186581 Clostridium novyi Species 0.000 description 1
- 241001147791 Clostridium paraputrificum Species 0.000 description 1
- 241000193468 Clostridium perfringens Species 0.000 description 1
- 241000408944 Clostridium putrefaciens Species 0.000 description 1
- 241001656793 Clostridium sartagoforme Species 0.000 description 1
- 241000193466 Clostridium septicum Species 0.000 description 1
- 241000193470 Clostridium sporogenes Species 0.000 description 1
- 241000186524 Clostridium subterminale Species 0.000 description 1
- 241000186528 Clostridium tertium Species 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- JJLJMEJHUUYSSY-UHFFFAOYSA-L Copper hydroxide Chemical compound [OH-].[OH-].[Cu+2] JJLJMEJHUUYSSY-UHFFFAOYSA-L 0.000 description 1
- 241000190633 Cordyceps Species 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 235000014493 Crataegus Nutrition 0.000 description 1
- 241001092040 Crataegus Species 0.000 description 1
- 235000009917 Crataegus X brevipes Nutrition 0.000 description 1
- 235000013204 Crataegus X haemacarpa Nutrition 0.000 description 1
- 235000009685 Crataegus X maligna Nutrition 0.000 description 1
- 235000009444 Crataegus X rubrocarnea Nutrition 0.000 description 1
- 235000009486 Crataegus bullatus Nutrition 0.000 description 1
- 235000017181 Crataegus chrysocarpa Nutrition 0.000 description 1
- 235000009682 Crataegus limnophila Nutrition 0.000 description 1
- 240000000171 Crataegus monogyna Species 0.000 description 1
- 235000004423 Crataegus monogyna Nutrition 0.000 description 1
- 235000002313 Crataegus paludosa Nutrition 0.000 description 1
- 235000009840 Crataegus x incaedua Nutrition 0.000 description 1
- 235000009849 Cucumis sativus Nutrition 0.000 description 1
- 235000010799 Cucumis sativus var sativus Nutrition 0.000 description 1
- 229920001651 Cyanoacrylate Polymers 0.000 description 1
- 150000008574 D-amino acids Chemical class 0.000 description 1
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 description 1
- AEMOLEFTQBMNLQ-AQKNRBDQSA-N D-glucopyranuronic acid Chemical compound OC1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]1O AEMOLEFTQBMNLQ-AQKNRBDQSA-N 0.000 description 1
- RBNPOMFGQQGHHO-UWTATZPHSA-N D-glyceric acid Chemical compound OC[C@@H](O)C(O)=O RBNPOMFGQQGHHO-UWTATZPHSA-N 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 229940123780 DNA topoisomerase I inhibitor Drugs 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 101710088194 Dehydrogenase Proteins 0.000 description 1
- SUZLHDUTVMZSEV-UHFFFAOYSA-N Deoxycoleonol Natural products C12C(=O)CC(C)(C=C)OC2(C)C(OC(=O)C)C(O)C2C1(C)C(O)CCC2(C)C SUZLHDUTVMZSEV-UHFFFAOYSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- 239000012591 Dulbecco’s Phosphate Buffered Saline Substances 0.000 description 1
- 102000016942 Elastin Human genes 0.000 description 1
- 108010014258 Elastin Proteins 0.000 description 1
- 235000015489 Emblica officinalis Nutrition 0.000 description 1
- 208000004232 Enteritis Diseases 0.000 description 1
- 108010092408 Eosinophil Peroxidase Proteins 0.000 description 1
- 102100028471 Eosinophil peroxidase Human genes 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000195950 Equisetum arvense Species 0.000 description 1
- 239000005768 Equisetum arvense L. Substances 0.000 description 1
- 241000195955 Equisetum hyemale Species 0.000 description 1
- 241000186588 Erysipelatoclostridium ramosum Species 0.000 description 1
- 208000004929 Facial Paralysis Diseases 0.000 description 1
- 241000186589 Faecalicatena orotica Species 0.000 description 1
- 102000009123 Fibrin Human genes 0.000 description 1
- 108010073385 Fibrin Proteins 0.000 description 1
- BWGVNKXGVNDBDI-UHFFFAOYSA-N Fibrin monomer Chemical compound CNC(=O)CNC(=O)CN BWGVNKXGVNDBDI-UHFFFAOYSA-N 0.000 description 1
- 108010049003 Fibrinogen Proteins 0.000 description 1
- 102000008946 Fibrinogen Human genes 0.000 description 1
- YCKRFDGAMUMZLT-UHFFFAOYSA-N Fluorine atom Chemical compound [F] YCKRFDGAMUMZLT-UHFFFAOYSA-N 0.000 description 1
- 102000012673 Follicle Stimulating Hormone Human genes 0.000 description 1
- 108010079345 Follicle Stimulating Hormone Proteins 0.000 description 1
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 1
- 102000004961 Furin Human genes 0.000 description 1
- 108090001126 Furin Proteins 0.000 description 1
- 241000173371 Garcinia indica Species 0.000 description 1
- 102400000921 Gastrin Human genes 0.000 description 1
- 108010052343 Gastrins Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 235000011201 Ginkgo Nutrition 0.000 description 1
- 102000051325 Glucagon Human genes 0.000 description 1
- 108060003199 Glucagon Proteins 0.000 description 1
- 108010088406 Glucagon-Like Peptides Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- AEMRFAOFKBGASW-UHFFFAOYSA-M Glycolate Chemical compound OCC([O-])=O AEMRFAOFKBGASW-UHFFFAOYSA-M 0.000 description 1
- 229930186217 Glycolipid Natural products 0.000 description 1
- 235000001453 Glycyrrhiza echinata Nutrition 0.000 description 1
- 235000017382 Glycyrrhiza lepidota Nutrition 0.000 description 1
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- 206010061991 Grimacing Diseases 0.000 description 1
- 108010051696 Growth Hormone Proteins 0.000 description 1
- 241000606768 Haemophilus influenzae Species 0.000 description 1
- 241000193159 Hathewaya histolytica Species 0.000 description 1
- 241000186568 Hathewaya limosa Species 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 108091006054 His-tagged proteins Proteins 0.000 description 1
- 229920001612 Hydroxyethyl starch Polymers 0.000 description 1
- 241000546188 Hypericum Species 0.000 description 1
- 244000141009 Hypericum perforatum Species 0.000 description 1
- 208000029462 Immunodeficiency disease Diseases 0.000 description 1
- 208000015725 Inhalational botulism Diseases 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 102000003996 Interferon-beta Human genes 0.000 description 1
- 108090000467 Interferon-beta Proteins 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- LPHGQDQBBGAPDZ-UHFFFAOYSA-N Isocaffeine Natural products CN1C(=O)N(C)C(=O)C2=C1N(C)C=N2 LPHGQDQBBGAPDZ-UHFFFAOYSA-N 0.000 description 1
- 208000002260 Keloid Diseases 0.000 description 1
- 108010076876 Keratins Proteins 0.000 description 1
- 102000011782 Keratins Human genes 0.000 description 1
- 229940124091 Keratolytic Drugs 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- 208000034693 Laceration Diseases 0.000 description 1
- 102000004407 Lactalbumin Human genes 0.000 description 1
- 108090000942 Lactalbumin Proteins 0.000 description 1
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 1
- 102000010445 Lactoferrin Human genes 0.000 description 1
- 108010063045 Lactoferrin Proteins 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 235000019687 Lamb Nutrition 0.000 description 1
- 240000003553 Leptospermum scoparium Species 0.000 description 1
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical compound [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 description 1
- 206010024652 Liver abscess Diseases 0.000 description 1
- 206010024769 Local reaction Diseases 0.000 description 1
- 235000015459 Lycium barbarum Nutrition 0.000 description 1
- 102000043136 MAP kinase family Human genes 0.000 description 1
- 108091054455 MAP kinase family Proteins 0.000 description 1
- 101150028955 MBP gene Proteins 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-L Malonate Chemical compound [O-]C(=O)CC([O-])=O OFOBLEOULBTSOW-UHFFFAOYSA-L 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 229930126263 Maytansine Natural products 0.000 description 1
- 201000005505 Measles Diseases 0.000 description 1
- 241000366182 Melaleuca alternifolia Species 0.000 description 1
- YJPIGAIKUZMOQA-UHFFFAOYSA-N Melatonin Natural products COC1=CC=C2N(C(C)=O)C=C(CCN)C2=C1 YJPIGAIKUZMOQA-UHFFFAOYSA-N 0.000 description 1
- 201000009906 Meningitis Diseases 0.000 description 1
- CERQOIWHTDAKMF-UHFFFAOYSA-M Methacrylate Chemical compound CC(=C)C([O-])=O CERQOIWHTDAKMF-UHFFFAOYSA-M 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 102000004232 Mitogen-Activated Protein Kinase Kinases Human genes 0.000 description 1
- 108090000744 Mitogen-Activated Protein Kinase Kinases Proteins 0.000 description 1
- 235000008898 Morinda citrifolia Nutrition 0.000 description 1
- 235000008708 Morus alba Nutrition 0.000 description 1
- 240000000249 Morus alba Species 0.000 description 1
- 208000005647 Mumps Diseases 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 101100366282 Mus musculus Spats1 gene Proteins 0.000 description 1
- 101100518501 Mus musculus Spp1 gene Proteins 0.000 description 1
- 208000010428 Muscle Weakness Diseases 0.000 description 1
- 206010028372 Muscular weakness Diseases 0.000 description 1
- 229910002651 NO3 Inorganic materials 0.000 description 1
- 206010028851 Necrosis Diseases 0.000 description 1
- 206010051606 Necrotising colitis Diseases 0.000 description 1
- 208000005119 Necrotizing Pneumonia Diseases 0.000 description 1
- 241000772415 Neovison vison Species 0.000 description 1
- 229930184499 Nikkomycin Natural products 0.000 description 1
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 description 1
- IOVCWXUNBOPUCH-UHFFFAOYSA-M Nitrite anion Chemical compound [O-]N=O IOVCWXUNBOPUCH-UHFFFAOYSA-M 0.000 description 1
- 229920001007 Nylon 4 Polymers 0.000 description 1
- 240000007817 Olea europaea Species 0.000 description 1
- 235000002725 Olea europaea Nutrition 0.000 description 1
- 206010033078 Otitis media Diseases 0.000 description 1
- 241000193465 Paeniclostridium sordellii Species 0.000 description 1
- 241000193157 Paraclostridium bifermentans Species 0.000 description 1
- 206010033799 Paralysis Diseases 0.000 description 1
- 208000033952 Paralysis flaccid Diseases 0.000 description 1
- 208000027089 Parkinsonian disease Diseases 0.000 description 1
- 206010034010 Parkinsonism Diseases 0.000 description 1
- 206010049752 Peau d'orange Diseases 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 206010051246 Photodermatosis Diseases 0.000 description 1
- 240000009120 Phyllanthus emblica Species 0.000 description 1
- 102000001938 Plasminogen Activators Human genes 0.000 description 1
- 108010001014 Plasminogen Activators Proteins 0.000 description 1
- 208000000474 Poliomyelitis Diseases 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229920002367 Polyisobutene Polymers 0.000 description 1
- 108010039918 Polylysine Proteins 0.000 description 1
- 229930182764 Polyoxin Natural products 0.000 description 1
- NKSOSPOXQKNIKJ-CLFAGFIQSA-N Polyoxyethylene dioleate Polymers CCCCCCCC\C=C/CCCCCCCC(=O)OCCOC(=O)CCCCCCC\C=C/CCCCCCCC NKSOSPOXQKNIKJ-CLFAGFIQSA-N 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- 208000003100 Pseudomembranous Enterocolitis Diseases 0.000 description 1
- 206010037128 Pseudomembranous colitis Diseases 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 206010048947 Rectal abscess Diseases 0.000 description 1
- 208000004756 Respiratory Insufficiency Diseases 0.000 description 1
- 241000702670 Rotavirus Species 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 235000017276 Salvia Nutrition 0.000 description 1
- 240000007164 Salvia officinalis Species 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- 240000006661 Serenoa repens Species 0.000 description 1
- 235000005318 Serenoa repens Nutrition 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 241000862632 Soja Species 0.000 description 1
- 102100038803 Somatotropin Human genes 0.000 description 1
- 208000005392 Spasm Diseases 0.000 description 1
- 241000519995 Stachys sylvatica Species 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 229930182558 Sterol Natural products 0.000 description 1
- QTENRWWVYAAPBI-YZTFXSNBSA-N Streptomycin sulfate Chemical compound OS(O)(=O)=O.OS(O)(=O)=O.OS(O)(=O)=O.CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@H]1[C@H](N=C(N)N)[C@@H](O)[C@H](N=C(N)N)[C@@H](O)[C@@H]1O.CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@H]1[C@H](N=C(N)N)[C@@H](O)[C@H](N=C(N)N)[C@@H](O)[C@@H]1O QTENRWWVYAAPBI-YZTFXSNBSA-N 0.000 description 1
- 241000057736 Subramaniula flavipila Species 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 102000019197 Superoxide Dismutase Human genes 0.000 description 1
- 108010012715 Superoxide dismutase Proteins 0.000 description 1
- 239000000219 Sympatholytic Substances 0.000 description 1
- 239000000150 Sympathomimetic Substances 0.000 description 1
- 240000002299 Symphytum officinale Species 0.000 description 1
- 240000004390 Symphytum x uplandicum Species 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 229940123237 Taxane Drugs 0.000 description 1
- 239000004809 Teflon Substances 0.000 description 1
- 229920006362 Teflon® Polymers 0.000 description 1
- 241001509489 Terrisporobacter glycolicus Species 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 241000193446 Thermoanaerobacterium thermosaccharolyticum Species 0.000 description 1
- 102000011923 Thyrotropin Human genes 0.000 description 1
- 108010061174 Thyrotropin Proteins 0.000 description 1
- 241000167944 Tissierella praeacuta Species 0.000 description 1
- GWEVSGVZZGPLCZ-UHFFFAOYSA-N Titan oxide Chemical compound O=[Ti]=O GWEVSGVZZGPLCZ-UHFFFAOYSA-N 0.000 description 1
- 208000004188 Tooth Wear Diseases 0.000 description 1
- 239000000365 Topoisomerase I Inhibitor Substances 0.000 description 1
- 101710182223 Toxin B Proteins 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 206010064996 Ulcerative keratitis Diseases 0.000 description 1
- 208000003443 Unconsciousness Diseases 0.000 description 1
- 229940116731 Uricosuric agent Drugs 0.000 description 1
- 206010046914 Vaginal infection Diseases 0.000 description 1
- 108010059993 Vancomycin Proteins 0.000 description 1
- 240000004543 Vicia ervilia Species 0.000 description 1
- 235000002254 Viola papilionacea Nutrition 0.000 description 1
- 235000004031 Viola x wittrockiana Nutrition 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- FPIPGXGPPPQFEQ-BOOMUCAASA-N Vitamin A Natural products OC/C=C(/C)\C=C\C=C(\C)/C=C/C1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-BOOMUCAASA-N 0.000 description 1
- 229930003427 Vitamin E Natural products 0.000 description 1
- 239000005862 Whey Substances 0.000 description 1
- 102000007544 Whey Proteins Human genes 0.000 description 1
- 108010046377 Whey Proteins Proteins 0.000 description 1
- 241000186561 [Clostridium] clostridioforme Species 0.000 description 1
- 241000985249 [Clostridium] indolis Species 0.000 description 1
- 241000193462 [Clostridium] innocuum Species 0.000 description 1
- 241000186569 [Clostridium] leptum Species 0.000 description 1
- 241001147717 [Clostridium] sphenoides Species 0.000 description 1
- 241000193450 [Clostridium] symbiosum Species 0.000 description 1
- ONVGHWLOUOITNL-UHFFFAOYSA-N [Zn].[Bi] Chemical compound [Zn].[Bi] ONVGHWLOUOITNL-UHFFFAOYSA-N 0.000 description 1
- 210000000683 abdominal cavity Anatomy 0.000 description 1
- 238000005299 abrasion Methods 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 231100000818 accidental exposure Toxicity 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 125000004036 acetal group Chemical group 0.000 description 1
- 125000000218 acetic acid group Chemical group C(C)(=O)* 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 206010000496 acne Diseases 0.000 description 1
- NIXOWILDQLNWCW-UHFFFAOYSA-N acrylic acid group Chemical group C(C=C)(=O)O NIXOWILDQLNWCW-UHFFFAOYSA-N 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000011149 active material Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 108060000200 adenylate cyclase Proteins 0.000 description 1
- 102000030621 adenylate cyclase Human genes 0.000 description 1
- 239000000853 adhesive Substances 0.000 description 1
- 230000001070 adhesive effect Effects 0.000 description 1
- WNLRTRBMVRJNCN-UHFFFAOYSA-L adipate(2-) Chemical compound [O-]C(=O)CCCCC([O-])=O WNLRTRBMVRJNCN-UHFFFAOYSA-L 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- FPIPGXGPPPQFEQ-OVSJKPMPSA-N all-trans-retinol Chemical compound OC\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-OVSJKPMPSA-N 0.000 description 1
- 239000013566 allergen Substances 0.000 description 1
- 235000020224 almond Nutrition 0.000 description 1
- 229940037003 alum Drugs 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- 235000011126 aluminium potassium sulphate Nutrition 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 210000004381 amniotic fluid Anatomy 0.000 description 1
- 229940124323 amoebicide Drugs 0.000 description 1
- APKFDSVGJQXUKY-INPOYWNPSA-N amphotericin B Chemical compound O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1/C=C/C=C/C=C/C=C/C=C/C=C/C=C/[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-INPOYWNPSA-N 0.000 description 1
- 229960003942 amphotericin b Drugs 0.000 description 1
- 208000020936 anaerobic cellulitis Diseases 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 230000000954 anitussive effect Effects 0.000 description 1
- 230000000578 anorexic effect Effects 0.000 description 1
- 229940069428 antacid Drugs 0.000 description 1
- 239000003159 antacid agent Substances 0.000 description 1
- 230000000507 anthelmentic effect Effects 0.000 description 1
- 239000000921 anthelmintic agent Substances 0.000 description 1
- 230000002075 anti-alcohol Effects 0.000 description 1
- 230000002456 anti-arthritic effect Effects 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000001142 anti-diarrhea Effects 0.000 description 1
- 230000002686 anti-diuretic effect Effects 0.000 description 1
- 230000003510 anti-fibrotic effect Effects 0.000 description 1
- 230000002924 anti-infective effect Effects 0.000 description 1
- 230000000845 anti-microbial effect Effects 0.000 description 1
- 230000003579 anti-obesity Effects 0.000 description 1
- 230000003443 anti-oncogenic effect Effects 0.000 description 1
- 230000002141 anti-parasite Effects 0.000 description 1
- 229940035678 anti-parkinson drug Drugs 0.000 description 1
- 230000001139 anti-pruritic effect Effects 0.000 description 1
- 230000001754 anti-pyretic effect Effects 0.000 description 1
- 230000002421 anti-septic effect Effects 0.000 description 1
- 230000002921 anti-spasmodic effect Effects 0.000 description 1
- 239000000059 antiamebic agent Substances 0.000 description 1
- 239000003173 antianemic agent Substances 0.000 description 1
- 229940124346 antiarthritic agent Drugs 0.000 description 1
- 239000000924 antiasthmatic agent Substances 0.000 description 1
- 239000003146 anticoagulant agent Substances 0.000 description 1
- 229940127219 anticoagulant drug Drugs 0.000 description 1
- 229940125681 anticonvulsant agent Drugs 0.000 description 1
- 239000001961 anticonvulsive agent Substances 0.000 description 1
- 239000003472 antidiabetic agent Substances 0.000 description 1
- 229940125708 antidiabetic agent Drugs 0.000 description 1
- 229940125714 antidiarrheal agent Drugs 0.000 description 1
- 239000003793 antidiarrheal agent Substances 0.000 description 1
- 229940124538 antidiuretic agent Drugs 0.000 description 1
- 239000000504 antifibrinolytic agent Substances 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 229940125715 antihistaminic agent Drugs 0.000 description 1
- 239000000739 antihistaminic agent Substances 0.000 description 1
- 229960005475 antiinfective agent Drugs 0.000 description 1
- 239000003524 antilipemic agent Substances 0.000 description 1
- 239000003430 antimalarial agent Substances 0.000 description 1
- 229940033495 antimalarials Drugs 0.000 description 1
- 229940005486 antimigraine preparations Drugs 0.000 description 1
- 239000002579 antinauseant Substances 0.000 description 1
- 229940125687 antiparasitic agent Drugs 0.000 description 1
- 239000003096 antiparasitic agent Substances 0.000 description 1
- 239000003908 antipruritic agent Substances 0.000 description 1
- 239000002221 antipyretic Substances 0.000 description 1
- 229940125716 antipyretic agent Drugs 0.000 description 1
- 229940064004 antiseptic throat preparations Drugs 0.000 description 1
- 229940124575 antispasmodic agent Drugs 0.000 description 1
- 239000003716 antitrichomonal agent Substances 0.000 description 1
- 239000003434 antitussive agent Substances 0.000 description 1
- 229940124584 antitussives Drugs 0.000 description 1
- 239000003920 antivertigo agent Substances 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 239000012062 aqueous buffer Substances 0.000 description 1
- 239000001138 artemisia absinthium Substances 0.000 description 1
- 150000008378 aryl ethers Chemical class 0.000 description 1
- 229940072107 ascorbate Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 229940065181 bacillus anthracis Drugs 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 241000385736 bacterium B Species 0.000 description 1
- 229910052788 barium Inorganic materials 0.000 description 1
- DSAJWYNOEDNPEQ-UHFFFAOYSA-N barium atom Chemical compound [Ba] DSAJWYNOEDNPEQ-UHFFFAOYSA-N 0.000 description 1
- 230000006399 behavior Effects 0.000 description 1
- 229930184756 benanomicin Natural products 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 229920002988 biodegradable polymer Polymers 0.000 description 1
- 239000004621 biodegradable polymer Substances 0.000 description 1
- 239000003124 biologic agent Substances 0.000 description 1
- 239000003131 biological toxin Substances 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 229920001400 block copolymer Polymers 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 230000004097 bone metabolism Effects 0.000 description 1
- 231100001103 botulinum neurotoxin Toxicity 0.000 description 1
- 229940094657 botulinum toxin type a Drugs 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 229910052793 cadmium Inorganic materials 0.000 description 1
- BDOSMKKIYDKNTQ-UHFFFAOYSA-N cadmium atom Chemical compound [Cd] BDOSMKKIYDKNTQ-UHFFFAOYSA-N 0.000 description 1
- 229960001948 caffeine Drugs 0.000 description 1
- VJEONQKOZGKCAK-UHFFFAOYSA-N caffeine Natural products CN1C(=O)N(C)C(=O)C2=C1C=CN2C VJEONQKOZGKCAK-UHFFFAOYSA-N 0.000 description 1
- BBBFJLBPOGFECG-VJVYQDLKSA-N calcitonin Chemical group N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 BBBFJLBPOGFECG-VJVYQDLKSA-N 0.000 description 1
- 229960004015 calcitonin Drugs 0.000 description 1
- 235000020964 calcitriol Nutrition 0.000 description 1
- 239000011612 calcitriol Substances 0.000 description 1
- GMRQFYUYWCNGIN-NKMMMXOESA-N calcitriol Chemical compound C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@@H](CCCC(C)(C)O)C)=C\C=C1\C[C@@H](O)C[C@H](O)C1=C GMRQFYUYWCNGIN-NKMMMXOESA-N 0.000 description 1
- 229960005084 calcitriol Drugs 0.000 description 1
- 229940127093 camptothecin Drugs 0.000 description 1
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 1
- 238000005251 capillar electrophoresis Methods 0.000 description 1
- 150000001718 carbodiimides Chemical class 0.000 description 1
- 239000002041 carbon nanotube Substances 0.000 description 1
- 229910021393 carbon nanotube Inorganic materials 0.000 description 1
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 1
- 210000000845 cartilage Anatomy 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 239000003054 catalyst Substances 0.000 description 1
- 150000003943 catecholamines Chemical class 0.000 description 1
- 239000000799 cathartic agent Substances 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 238000000423 cell based assay Methods 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 230000036978 cell physiology Effects 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 230000036232 cellulite Effects 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 230000002490 cerebral effect Effects 0.000 description 1
- 239000013522 chelant Substances 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- AOXOCDRNSPFDPE-UKEONUMOSA-N chembl413654 Chemical compound C([C@H](C(=O)NCC(=O)N[C@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@H](CCSC)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](C)NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]1N(CCC1)C(=O)CNC(=O)[C@@H](N)CCC(O)=O)C1=CC=C(O)C=C1 AOXOCDRNSPFDPE-UKEONUMOSA-N 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 239000002975 chemoattractant Substances 0.000 description 1
- 230000003399 chemotactic effect Effects 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 235000019398 chlorine dioxide Nutrition 0.000 description 1
- 208000003167 cholangitis Diseases 0.000 description 1
- 230000001989 choleretic effect Effects 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 239000000812 cholinergic antagonist Substances 0.000 description 1
- 229940018560 citraconate Drugs 0.000 description 1
- HNEGQIOMVPPMNR-IHWYPQMZSA-N citraconic acid Chemical compound OC(=O)C(/C)=C\C(O)=O HNEGQIOMVPPMNR-IHWYPQMZSA-N 0.000 description 1
- XFTRTWQBIOMVPK-UHFFFAOYSA-N citramalic acid Chemical compound OC(=O)C(O)(C)CC(O)=O XFTRTWQBIOMVPK-UHFFFAOYSA-N 0.000 description 1
- 229910017052 cobalt Inorganic materials 0.000 description 1
- 239000010941 cobalt Substances 0.000 description 1
- GUTLYIVDDKVIGB-UHFFFAOYSA-N cobalt atom Chemical compound [Co] GUTLYIVDDKVIGB-UHFFFAOYSA-N 0.000 description 1
- 239000005515 coenzyme Substances 0.000 description 1
- OHCQJHSOBUTRHG-UHFFFAOYSA-N colforsin Natural products OC12C(=O)CC(C)(C=C)OC1(C)C(OC(=O)C)C(O)C1C2(C)C(O)CCC1(C)C OHCQJHSOBUTRHG-UHFFFAOYSA-N 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 230000000112 colonic effect Effects 0.000 description 1
- LGZKGOGODCLQHG-UHFFFAOYSA-N combretastatin Natural products C1=C(O)C(OC)=CC=C1CC(O)C1=CC(OC)=C(OC)C(OC)=C1 LGZKGOGODCLQHG-UHFFFAOYSA-N 0.000 description 1
- 238000010668 complexation reaction Methods 0.000 description 1
- 239000008139 complexing agent Substances 0.000 description 1
- 230000008876 conformational transition Effects 0.000 description 1
- 230000008602 contraction Effects 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 239000013256 coordination polymer Substances 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 239000010949 copper Substances 0.000 description 1
- 230000007797 corrosion Effects 0.000 description 1
- 238000005260 corrosion Methods 0.000 description 1
- 238000002316 cosmetic surgery Methods 0.000 description 1
- 229940037530 cough and cold preparations Drugs 0.000 description 1
- LDHQCZJRKDOVOX-NSCUHMNNSA-N crotonic acid Chemical compound C\C=C\C(O)=O LDHQCZJRKDOVOX-NSCUHMNNSA-N 0.000 description 1
- 230000000120 cytopathologic effect Effects 0.000 description 1
- 239000000824 cytostatic agent Substances 0.000 description 1
- 238000000354 decomposition reaction Methods 0.000 description 1
- 239000000850 decongestant Substances 0.000 description 1
- 229940124581 decongestants Drugs 0.000 description 1
- 206010061428 decreased appetite Diseases 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000018044 dehydration Effects 0.000 description 1
- 238000006297 dehydration reaction Methods 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 210000004207 dermis Anatomy 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- NTCJKZSYQTZRQE-CSMGIIAWSA-N difopein Chemical group C([C@@H](C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O)C(C)C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CO)C(C)C)C1=CNC=N1 NTCJKZSYQTZRQE-CSMGIIAWSA-N 0.000 description 1
- 239000003866 digestant Substances 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 238000003618 dip coating Methods 0.000 description 1
- XPPKVPWEQAFLFU-UHFFFAOYSA-J diphosphate(4-) Chemical compound [O-]P([O-])(=O)OP([O-])([O-])=O XPPKVPWEQAFLFU-UHFFFAOYSA-J 0.000 description 1
- 235000011180 diphosphates Nutrition 0.000 description 1
- 206010013023 diphtheria Diseases 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 238000011037 discontinuous sequential dilution Methods 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000002934 diuretic Substances 0.000 description 1
- 229940030606 diuretics Drugs 0.000 description 1
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 239000000890 drug combination Substances 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 239000000428 dust Substances 0.000 description 1
- 208000001848 dysentery Diseases 0.000 description 1
- 230000002196 ecbolic effect Effects 0.000 description 1
- 235000013399 edible fruits Nutrition 0.000 description 1
- 230000002526 effect on cardiovascular system Effects 0.000 description 1
- 150000002066 eicosanoids Chemical class 0.000 description 1
- 229920002549 elastin Polymers 0.000 description 1
- 230000005684 electric field Effects 0.000 description 1
- 230000005518 electrochemistry Effects 0.000 description 1
- 238000010041 electrostatic spinning Methods 0.000 description 1
- 239000002895 emetic Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 206010014665 endocarditis Diseases 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 208000029182 enterotoxemia Diseases 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 239000002532 enzyme inhibitor Substances 0.000 description 1
- 229940125532 enzyme inhibitor Drugs 0.000 description 1
- 229960003276 erythromycin Drugs 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 229960005309 estradiol Drugs 0.000 description 1
- 229930182833 estradiol Natural products 0.000 description 1
- 229940011871 estrogen Drugs 0.000 description 1
- 239000000262 estrogen Substances 0.000 description 1
- OYQYHJRSHHYEIG-UHFFFAOYSA-N ethyl carbamate;urea Chemical compound NC(N)=O.CCOC(N)=O OYQYHJRSHHYEIG-UHFFFAOYSA-N 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000003419 expectorant effect Effects 0.000 description 1
- 229940066493 expectorants Drugs 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 238000013265 extended release Methods 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 229950003499 fibrin Drugs 0.000 description 1
- 229940012952 fibrinogen Drugs 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 239000012467 final product Substances 0.000 description 1
- 235000019688 fish Nutrition 0.000 description 1
- 208000028331 flaccid paralysis Diseases 0.000 description 1
- 239000011737 fluorine Substances 0.000 description 1
- 229910052731 fluorine Inorganic materials 0.000 description 1
- 229940028334 follicle stimulating hormone Drugs 0.000 description 1
- 201000011424 foodborne botulism Diseases 0.000 description 1
- 229940053641 forteo Drugs 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 235000021022 fresh fruits Nutrition 0.000 description 1
- 230000000942 galactokinetic effect Effects 0.000 description 1
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical compound NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 1
- WIGCFUFOHFEKBI-UHFFFAOYSA-N gamma-tocopherol Natural products CC(C)CCCC(C)CCCC(C)CCCC1CCC2C(C)C(O)C(C)C(C)C2O1 WIGCFUFOHFEKBI-UHFFFAOYSA-N 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 239000004083 gastrointestinal agent Substances 0.000 description 1
- 229940125695 gastrointestinal agent Drugs 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 230000002070 germicidal effect Effects 0.000 description 1
- MASNOZXLGMXCHN-ZLPAWPGGSA-N glucagon Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 MASNOZXLGMXCHN-ZLPAWPGGSA-N 0.000 description 1
- 229960004666 glucagon Drugs 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 229940050410 gluconate Drugs 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 229940097042 glucuronate Drugs 0.000 description 1
- 229940049906 glutamate Drugs 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- JFCQEDHGNNZCLN-UHFFFAOYSA-N glutaric acid Chemical compound OC(=O)CCCC(O)=O JFCQEDHGNNZCLN-UHFFFAOYSA-N 0.000 description 1
- 239000003933 gonadotropin antagonist Substances 0.000 description 1
- 229920000578 graft copolymer Polymers 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 210000003128 head Anatomy 0.000 description 1
- MNWFXJYAOYHMED-UHFFFAOYSA-N heptanoic acid Chemical compound CCCCCCC(O)=O MNWFXJYAOYHMED-UHFFFAOYSA-N 0.000 description 1
- FUZZWVXGSFPDMH-UHFFFAOYSA-N hexanoic acid Chemical compound CCCCCC(O)=O FUZZWVXGSFPDMH-UHFFFAOYSA-N 0.000 description 1
- 229960001340 histamine Drugs 0.000 description 1
- 239000008240 homogeneous mixture Substances 0.000 description 1
- 235000012907 honey Nutrition 0.000 description 1
- 230000003054 hormonal effect Effects 0.000 description 1
- 244000052637 human pathogen Species 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 229960003160 hyaluronic acid Drugs 0.000 description 1
- 239000002908 hydrocholeretic agent Substances 0.000 description 1
- 229960000890 hydrocortisone Drugs 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 229940050526 hydroxyethylstarch Drugs 0.000 description 1
- 230000037417 hyperactivation Effects 0.000 description 1
- 239000000864 hyperglycemic agent Substances 0.000 description 1
- 239000003326 hypnotic agent Substances 0.000 description 1
- 230000000147 hypnotic effect Effects 0.000 description 1
- 229960004716 idoxuridine Drugs 0.000 description 1
- 230000000984 immunochemical effect Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 229940125721 immunosuppressive agent Drugs 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 238000007373 indentation Methods 0.000 description 1
- 208000022760 infectious otitis media Diseases 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 239000003999 initiator Substances 0.000 description 1
- 230000030214 innervation Effects 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 229910001410 inorganic ion Inorganic materials 0.000 description 1
- 230000035992 intercellular communication Effects 0.000 description 1
- 230000008611 intercellular interaction Effects 0.000 description 1
- 102000009634 interleukin-1 receptor antagonist activity proteins Human genes 0.000 description 1
- 108040001669 interleukin-1 receptor antagonist activity proteins Proteins 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- LVHBHZANLOWSRM-UHFFFAOYSA-N itaconic acid Chemical compound OC(=O)CC(=C)C(O)=O LVHBHZANLOWSRM-UHFFFAOYSA-N 0.000 description 1
- 210000001117 keloid Anatomy 0.000 description 1
- 210000002510 keratinocyte Anatomy 0.000 description 1
- 230000001530 keratinolytic effect Effects 0.000 description 1
- CSSYQJWUGATIHM-IKGCZBKSSA-N l-phenylalanyl-l-lysyl-l-cysteinyl-l-arginyl-l-arginyl-l-tryptophyl-l-glutaminyl-l-tryptophyl-l-arginyl-l-methionyl-l-lysyl-l-lysyl-l-leucylglycyl-l-alanyl-l-prolyl-l-seryl-l-isoleucyl-l-threonyl-l-cysteinyl-l-valyl-l-arginyl-l-arginyl-l-alanyl-l-phenylal Chemical compound C([C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 CSSYQJWUGATIHM-IKGCZBKSSA-N 0.000 description 1
- 229940078795 lactoferrin Drugs 0.000 description 1
- 235000021242 lactoferrin Nutrition 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 238000002357 laparoscopic surgery Methods 0.000 description 1
- 239000008141 laxative Substances 0.000 description 1
- 229940125722 laxative agent Drugs 0.000 description 1
- 238000002386 leaching Methods 0.000 description 1
- 229940058352 levulinate Drugs 0.000 description 1
- 229940010454 licorice Drugs 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 229920006008 lipopolysaccharide Polymers 0.000 description 1
- 229910052744 lithium Inorganic materials 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 235000020121 low-fat milk Nutrition 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 229940049920 malate Drugs 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- BJEPYKJPYRNKOW-UHFFFAOYSA-N malic acid Chemical compound OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 1
- WKPWGQKGSOKKOO-RSFHAFMBSA-N maytansine Chemical compound CO[C@@H]([C@@]1(O)C[C@](OC(=O)N1)([C@H]([C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(C)=O)CC(=O)N1C)C)[H])\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 WKPWGQKGSOKKOO-RSFHAFMBSA-N 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 239000012577 media supplement Substances 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 229960003987 melatonin Drugs 0.000 description 1
- DRLFMBDRBRZALE-UHFFFAOYSA-N melatonin Chemical compound COC1=CC=C2NC=C(CCNC(C)=O)C2=C1 DRLFMBDRBRZALE-UHFFFAOYSA-N 0.000 description 1
- 230000009245 menopause Effects 0.000 description 1
- HNEGQIOMVPPMNR-NSCUHMNNSA-N mesaconic acid Chemical compound OC(=O)C(/C)=C/C(O)=O HNEGQIOMVPPMNR-NSCUHMNNSA-N 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- WSFSSNUMVMOOMR-NJFSPNSNSA-N methanone Chemical compound O=[14CH2] WSFSSNUMVMOOMR-NJFSPNSNSA-N 0.000 description 1
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 1
- 239000003094 microcapsule Substances 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 230000002438 mitochondrial effect Effects 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- VYQNWZOUAUKGHI-UHFFFAOYSA-N monobenzone Chemical compound C1=CC(O)=CC=C1OCC1=CC=CC=C1 VYQNWZOUAUKGHI-UHFFFAOYSA-N 0.000 description 1
- 229940031346 monovalent vaccine Drugs 0.000 description 1
- 230000000510 mucolytic effect Effects 0.000 description 1
- 229940066491 mucolytics Drugs 0.000 description 1
- 239000002048 multi walled nanotube Substances 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 208000010805 mumps infectious disease Diseases 0.000 description 1
- 229940035363 muscle relaxants Drugs 0.000 description 1
- 239000003158 myorelaxant agent Substances 0.000 description 1
- GKTNLYAAZKKMTQ-UHFFFAOYSA-N n-[bis(dimethylamino)phosphinimyl]-n-methylmethanamine Chemical compound CN(C)P(=N)(N(C)C)N(C)C GKTNLYAAZKKMTQ-UHFFFAOYSA-N 0.000 description 1
- 239000002114 nanocomposite Substances 0.000 description 1
- 239000003887 narcotic antagonist Substances 0.000 description 1
- 230000003533 narcotic effect Effects 0.000 description 1
- 230000017074 necrotic cell death Effects 0.000 description 1
- 208000004995 necrotizing enterocolitis Diseases 0.000 description 1
- 210000005036 nerve Anatomy 0.000 description 1
- 210000000715 neuromuscular junction Anatomy 0.000 description 1
- 239000002858 neurotransmitter agent Substances 0.000 description 1
- 229910052759 nickel Inorganic materials 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 229960000988 nystatin Drugs 0.000 description 1
- VQOXZBDYSJBXMA-NQTDYLQESA-N nystatin A1 Chemical compound O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1/C=C/C=C/C=C/C=C/CC/C=C/C=C/[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 VQOXZBDYSJBXMA-NQTDYLQESA-N 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 235000020660 omega-3 fatty acid Nutrition 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 230000011164 ossification Effects 0.000 description 1
- 230000002188 osteogenic effect Effects 0.000 description 1
- KHPXUQMNIQBQEV-UHFFFAOYSA-N oxaloacetic acid Chemical compound OC(=O)CC(=O)C(O)=O KHPXUQMNIQBQEV-UHFFFAOYSA-N 0.000 description 1
- SOQBVABWOPYFQZ-UHFFFAOYSA-N oxygen(2-);titanium(4+) Chemical class [O-2].[O-2].[Ti+4] SOQBVABWOPYFQZ-UHFFFAOYSA-N 0.000 description 1
- 239000002863 oxytocic agent Substances 0.000 description 1
- 229940094443 oxytocics prostaglandins Drugs 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 230000001769 paralizing effect Effects 0.000 description 1
- 230000000849 parathyroid Effects 0.000 description 1
- 210000002990 parathyroid gland Anatomy 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000011049 pearl Substances 0.000 description 1
- 230000037368 penetrate the skin Effects 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 201000006195 perinatal necrotizing enterocolitis Diseases 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 230000008845 photoaging Effects 0.000 description 1
- 230000008832 photodamage Effects 0.000 description 1
- 239000000419 plant extract Substances 0.000 description 1
- 229940127126 plasminogen activator Drugs 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 238000007747 plating Methods 0.000 description 1
- 210000003281 pleural cavity Anatomy 0.000 description 1
- 231100000614 poison Toxicity 0.000 description 1
- 230000007096 poisonous effect Effects 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920000729 poly(L-lysine) polymer Polymers 0.000 description 1
- 229920001318 poly(benzyl glutamate) Polymers 0.000 description 1
- 229920000435 poly(dimethylsiloxane) Polymers 0.000 description 1
- 229920001691 poly(ether urethane) Polymers 0.000 description 1
- 108700022290 poly(gamma-glutamic acid) Proteins 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920003229 poly(methyl methacrylate) Polymers 0.000 description 1
- 229920002627 poly(phosphazenes) Polymers 0.000 description 1
- 229920001495 poly(sodium acrylate) polymer Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000447 polyanionic polymer Polymers 0.000 description 1
- 229920001230 polyarylate Polymers 0.000 description 1
- 229920002721 polycyanoacrylate Polymers 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 229920000139 polyethylene terephthalate Polymers 0.000 description 1
- 239000005020 polyethylene terephthalate Substances 0.000 description 1
- 229920000656 polylysine Polymers 0.000 description 1
- 229920001444 polymaleic acid Polymers 0.000 description 1
- 229920006254 polymer film Polymers 0.000 description 1
- 229920000307 polymer substrate Polymers 0.000 description 1
- 239000004926 polymethyl methacrylate Substances 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920001299 polypropylene fumarate Polymers 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 229920001296 polysiloxane Polymers 0.000 description 1
- 239000011118 polyvinyl acetate Substances 0.000 description 1
- 229920002689 polyvinyl acetate Polymers 0.000 description 1
- 239000004800 polyvinyl chloride Substances 0.000 description 1
- 229920000915 polyvinyl chloride Polymers 0.000 description 1
- 230000005195 poor health Effects 0.000 description 1
- 229940050271 potassium alum Drugs 0.000 description 1
- GRLPQNLYRHEGIJ-UHFFFAOYSA-J potassium aluminium sulfate Chemical compound [Al+3].[K+].[O-]S([O-])(=O)=O.[O-]S([O-])(=O)=O GRLPQNLYRHEGIJ-UHFFFAOYSA-J 0.000 description 1
- 229930191090 pradimicin Natural products 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 239000000583 progesterone congener Substances 0.000 description 1
- 150000003180 prostaglandins Chemical class 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 230000004952 protein activity Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 239000003368 psychostimulant agent Substances 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 239000002510 pyrogen Substances 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 150000003254 radicals Chemical class 0.000 description 1
- 229940121896 radiopharmaceutical Drugs 0.000 description 1
- 239000012217 radiopharmaceutical Substances 0.000 description 1
- 230000002799 radiopharmaceutical effect Effects 0.000 description 1
- 229920005604 random copolymer Polymers 0.000 description 1
- 229940044551 receptor antagonist Drugs 0.000 description 1
- 239000002464 receptor antagonist Substances 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 244000132619 red sage Species 0.000 description 1
- 206010038351 renal abscess Diseases 0.000 description 1
- 210000005000 reproductive tract Anatomy 0.000 description 1
- 201000004193 respiratory failure Diseases 0.000 description 1
- 210000003019 respiratory muscle Anatomy 0.000 description 1
- 239000003169 respiratory stimulant agent Substances 0.000 description 1
- 229940066293 respiratory stimulants Drugs 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 201000005404 rubella Diseases 0.000 description 1
- 239000010018 saw palmetto extract Substances 0.000 description 1
- 231100000241 scar Toxicity 0.000 description 1
- 230000037387 scars Effects 0.000 description 1
- 239000003229 sclerosing agent Substances 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 229940125723 sedative agent Drugs 0.000 description 1
- 239000000932 sedative agent Substances 0.000 description 1
- 208000013223 septicemia Diseases 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 230000009919 sequestration Effects 0.000 description 1
- 229940076279 serotonin Drugs 0.000 description 1
- 239000012679 serum free medium Substances 0.000 description 1
- 206010040400 serum sickness Diseases 0.000 description 1
- 239000004017 serum-free culture medium Substances 0.000 description 1
- 239000002356 single layer Substances 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 229940126586 small molecule drug Drugs 0.000 description 1
- 235000002639 sodium chloride Nutrition 0.000 description 1
- 210000004872 soft tissue Anatomy 0.000 description 1
- 239000002689 soil Substances 0.000 description 1
- 238000005063 solubilization Methods 0.000 description 1
- 230000007928 solubilization Effects 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 208000018198 spasticity Diseases 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000003270 steroid hormone Substances 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 150000003432 sterols Chemical class 0.000 description 1
- 235000003702 sterols Nutrition 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 239000011550 stock solution Substances 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-N succinic acid Chemical compound OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 1
- 230000003746 surface roughness Effects 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 230000000948 sympatholitic effect Effects 0.000 description 1
- 230000001975 sympathomimetic effect Effects 0.000 description 1
- 229940064707 sympathomimetics Drugs 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 150000004579 taxol derivatives Chemical class 0.000 description 1
- 229960003604 testosterone Drugs 0.000 description 1
- 206010043378 tetanus neonatorum Diseases 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 229940021747 therapeutic vaccine Drugs 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 229960000103 thrombolytic agent Drugs 0.000 description 1
- 230000002537 thrombolytic effect Effects 0.000 description 1
- 229940043672 thyroid preparations Drugs 0.000 description 1
- 230000001256 tonic effect Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 239000003204 tranquilizing agent Substances 0.000 description 1
- 230000002936 tranquilizing effect Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 150000003852 triazoles Chemical class 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 201000008827 tuberculosis Diseases 0.000 description 1
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 239000003383 uricosuric agent Substances 0.000 description 1
- 208000019206 urinary tract infection Diseases 0.000 description 1
- 229940125575 vaccine candidate Drugs 0.000 description 1
- NQPDZGIKBAWPEJ-UHFFFAOYSA-N valeric acid Chemical compound CCCCC(O)=O NQPDZGIKBAWPEJ-UHFFFAOYSA-N 0.000 description 1
- MYPYJXKWCTUITO-LYRMYLQWSA-N vancomycin Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=C2C=C3C=C1OC1=CC=C(C=C1Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]1C(=O)N[C@H](C(N[C@@H](C3=CC(O)=CC(O)=C3C=3C(O)=CC=C1C=3)C(O)=O)=O)[C@H](O)C1=CC=C(C(=C1)Cl)O2)=O)NC(=O)[C@@H](CC(C)C)NC)[C@H]1C[C@](C)(N)[C@H](O)[C@H](C)O1 MYPYJXKWCTUITO-LYRMYLQWSA-N 0.000 description 1
- 229960003165 vancomycin Drugs 0.000 description 1
- MYPYJXKWCTUITO-UHFFFAOYSA-N vancomycin Natural products O1C(C(=C2)Cl)=CC=C2C(O)C(C(NC(C2=CC(O)=CC(O)=C2C=2C(O)=CC=C3C=2)C(O)=O)=O)NC(=O)C3NC(=O)C2NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(CC(C)C)NC)C(O)C(C=C3Cl)=CC=C3OC3=CC2=CC1=C3OC1OC(CO)C(O)C(O)C1OC1CC(C)(N)C(O)C(C)O1 MYPYJXKWCTUITO-UHFFFAOYSA-N 0.000 description 1
- 238000007740 vapor deposition Methods 0.000 description 1
- 239000005526 vasoconstrictor agent Substances 0.000 description 1
- 239000003071 vasodilator agent Substances 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 239000002435 venom Substances 0.000 description 1
- 231100000611 venom Toxicity 0.000 description 1
- 210000001048 venom Anatomy 0.000 description 1
- 229920002554 vinyl polymer Polymers 0.000 description 1
- 230000009278 visceral effect Effects 0.000 description 1
- 235000019155 vitamin A Nutrition 0.000 description 1
- 239000011719 vitamin A Substances 0.000 description 1
- 235000019165 vitamin E Nutrition 0.000 description 1
- 229940046009 vitamin E Drugs 0.000 description 1
- 239000011709 vitamin E Substances 0.000 description 1
- 229940045997 vitamin a Drugs 0.000 description 1
- 150000003722 vitamin derivatives Chemical class 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 235000020334 white tea Nutrition 0.000 description 1
- 201000011423 wound botulism Diseases 0.000 description 1
- 210000000707 wrist Anatomy 0.000 description 1
- 210000000216 zygoma Anatomy 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/70—Web, sheet or filament bases ; Films; Fibres of the matrix type containing drug
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/29—Parathyroid hormone, i.e. parathormone; Parathyroid hormone-related peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/465—Hydrolases (3) acting on ester bonds (3.1), e.g. lipases, ribonucleases
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/07—Bacillus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
- A61K9/0021—Intradermal administration, e.g. through microneedle arrays, needleless injectors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Epidemiology (AREA)
- Veterinary Medicine (AREA)
- Chemical & Material Sciences (AREA)
- Public Health (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Endocrinology (AREA)
- Dermatology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Zoology (AREA)
- Medicinal Preparation (AREA)
Abstract
A device which comprises a substrate which includes a plurality of asperities, such as microneedles, extending from the surface of the substrate, and an electrospun material in contact with the substrate. The electrospun material may comprise a plurality of nanofibers which carry at least one biologically active agent. Such devices are useful as transdermal delivery devices for delivering pharmaceuticals and other biologically active agents.
Description
NANOFIBER STRUCTURES ON ASPERITIES
FOR SEQUESTERING, CARRYING AND
TRANSFERRING SUBSTANCES
This application claims priority based on provisional application Serial No.
60/798,928, filed May 9, 2006, provisional application Serial No. 60/848,506, filed September 29, 2006, provisional application Serial No. 60/848,507, filed September 29, 2006, provisional application Serial No.
60/848,504, filed September 29, 2006, provisional application Serial No.
60/848,505, filed September 29, 2006, and provisional application Serial No. 60/848,213, filed September 29, 2006, the contents of which are incorporated herein by reference in their entireties.
FIELD OF THE INVENTION
The present invention relates to structures that contain one or more fiber and/or nanofiber structures on asperities, including, but not limited to, pins, microprojections, and microneedles. In one embodiment, the present invention relates to structures that contain one or more fiber and/or nanofiber structures on asperities including pins, microprojections, and microneedles where the nanofiber and/or fiber structures are designed to sequester, carry and/or encapsulate one or more substances. In still another embodiment, the present invention relates to a process for forming one or more fibers, nanofibers or structures made therefrom on asperities, such as pins, microprojections, and microneedles where such fibers and/or structures are designed to sequester, carry, and/or encapsulate one or more substances and to deliver such substances, such as therapeutic drugs and preventive medicines, through the skin.
BACKGROUND OF THE INVENTION
There is an interest in methods to sequester, entrap, encapsulate and/or deposit various compounds or substances on the surfaces of and/or within various structures (e.g., polymer, metal, or ceramic structures). One such method that holds promise is the use of fibers and/or nanofibers that are designed to carry one or more compounds or substances, where such fibers, nanofibers, or structures made therefrom are placed, deposited or formed on one or more surfaces of a material (e.g.. a polymer, metal, ceramic or other material).
Such fibers could be used as a vehicle for the topical delivery of drugs.
Topical delivery of drugs is a useful method for achieving systemic or localized pharmacological effects. An example is disclosed in U.S. Pat. No. 3,964,482 (by Gerstel), in which an array of either solid or hollow microneedles is used to penetrate through the stratum comeum, into the epidermal layer, but not to the dermal layer; however, hollow microneedles create engineering issues and require a reservoir or other source of fluid. Solid needles do not offer sufficient loading of the substance, let alone sufficient preservation and stabilization of the substance..
Thus, there is a need in the art for products that can be designed to incorporate various fibers and/or nanofibers, where the fibers and/or nanofibers are designed to carry, sequester and/or encapsulate one or more compounds or substances, thereby providing for efficient loading of the substance, sufficient preservation and stabilization of the substance, and desired release characteristics.
SUMMARY OF THE INVENTION
In accordance with an aspect of the present invention, there is provided a device which includes a substrate comprising a surface and a plurality of asperities extending from said surface, and an electrospun material in contact with said substrate. The electrospun material may be any of a variety of forms, including, but not limited to, fibers, such as nanofibers and microfibers, including fiber mats, three-dimensional films, spheres, tubes, or any other geometrical shape, and the like. In one non-limiting embodiment, the electrospun material is in the form of nanofibers. In a non-limiting embodiment the electrospun material may be formed from a polymer, including but not limited to those described hereinbelow.
The electrospun material, in one embodiment, comprises at least one carrier substance, such as a polymer, capable of carrying a biologically active agent, and at least one biologically active agent.
The present invention also is directed to administering at least one biologically active agent, such as a drug, or a prophylactic or therapeutic agent, to a human or non-human animal by providing a device including a substrate, and an electrospun material, which includes the biologically active agent, in contact with the substrate as hereinabove described. The human or non-human animal is contacted with the device such that the at least one biologically active agent is released into the human or non-human animal.
In accordance with yet another aspect of the present invention, there is provided a device which comprises an ionically cross-linked macromolecular assembly and at least one biologically active agent, such as those described herein, contained in said assembly. In a non-limiting embodiment, the ionically cross-linked macromolecular assembly comprises an ionically cross-linked water soluble polymer.
In another non-limiting embodiment, the device further comprises a substrate which comprises a surface and a plurality of asperities, such as microprojections and microneedles, extending from the surface. The macromolecular assembly containing the at least one biologically active agent is in contact with the substrate.
In a non-limiting embodiment, the ionically cross-linked macromolecular assembly containing the at least one biologically active agent may be in the form of an electrospun material which may be any of a variety of forms, including, but not limited to, fibers, such as nanofibers and microfibers, including fiber mats, three-dimensional films, spheres, tubes, or any other geometrical shape, and the like.
BRIEF DESCRIPTION OF THE DRAWINGS
The invention now will be described with respect to the drawings, wherein:
Figure I is a low magnification optical image of grounded carbon nanofibers coated with polyethylene oxide nanofibers;
FOR SEQUESTERING, CARRYING AND
TRANSFERRING SUBSTANCES
This application claims priority based on provisional application Serial No.
60/798,928, filed May 9, 2006, provisional application Serial No. 60/848,506, filed September 29, 2006, provisional application Serial No. 60/848,507, filed September 29, 2006, provisional application Serial No.
60/848,504, filed September 29, 2006, provisional application Serial No.
60/848,505, filed September 29, 2006, and provisional application Serial No. 60/848,213, filed September 29, 2006, the contents of which are incorporated herein by reference in their entireties.
FIELD OF THE INVENTION
The present invention relates to structures that contain one or more fiber and/or nanofiber structures on asperities, including, but not limited to, pins, microprojections, and microneedles. In one embodiment, the present invention relates to structures that contain one or more fiber and/or nanofiber structures on asperities including pins, microprojections, and microneedles where the nanofiber and/or fiber structures are designed to sequester, carry and/or encapsulate one or more substances. In still another embodiment, the present invention relates to a process for forming one or more fibers, nanofibers or structures made therefrom on asperities, such as pins, microprojections, and microneedles where such fibers and/or structures are designed to sequester, carry, and/or encapsulate one or more substances and to deliver such substances, such as therapeutic drugs and preventive medicines, through the skin.
BACKGROUND OF THE INVENTION
There is an interest in methods to sequester, entrap, encapsulate and/or deposit various compounds or substances on the surfaces of and/or within various structures (e.g., polymer, metal, or ceramic structures). One such method that holds promise is the use of fibers and/or nanofibers that are designed to carry one or more compounds or substances, where such fibers, nanofibers, or structures made therefrom are placed, deposited or formed on one or more surfaces of a material (e.g.. a polymer, metal, ceramic or other material).
Such fibers could be used as a vehicle for the topical delivery of drugs.
Topical delivery of drugs is a useful method for achieving systemic or localized pharmacological effects. An example is disclosed in U.S. Pat. No. 3,964,482 (by Gerstel), in which an array of either solid or hollow microneedles is used to penetrate through the stratum comeum, into the epidermal layer, but not to the dermal layer; however, hollow microneedles create engineering issues and require a reservoir or other source of fluid. Solid needles do not offer sufficient loading of the substance, let alone sufficient preservation and stabilization of the substance..
Thus, there is a need in the art for products that can be designed to incorporate various fibers and/or nanofibers, where the fibers and/or nanofibers are designed to carry, sequester and/or encapsulate one or more compounds or substances, thereby providing for efficient loading of the substance, sufficient preservation and stabilization of the substance, and desired release characteristics.
SUMMARY OF THE INVENTION
In accordance with an aspect of the present invention, there is provided a device which includes a substrate comprising a surface and a plurality of asperities extending from said surface, and an electrospun material in contact with said substrate. The electrospun material may be any of a variety of forms, including, but not limited to, fibers, such as nanofibers and microfibers, including fiber mats, three-dimensional films, spheres, tubes, or any other geometrical shape, and the like. In one non-limiting embodiment, the electrospun material is in the form of nanofibers. In a non-limiting embodiment the electrospun material may be formed from a polymer, including but not limited to those described hereinbelow.
The electrospun material, in one embodiment, comprises at least one carrier substance, such as a polymer, capable of carrying a biologically active agent, and at least one biologically active agent.
The present invention also is directed to administering at least one biologically active agent, such as a drug, or a prophylactic or therapeutic agent, to a human or non-human animal by providing a device including a substrate, and an electrospun material, which includes the biologically active agent, in contact with the substrate as hereinabove described. The human or non-human animal is contacted with the device such that the at least one biologically active agent is released into the human or non-human animal.
In accordance with yet another aspect of the present invention, there is provided a device which comprises an ionically cross-linked macromolecular assembly and at least one biologically active agent, such as those described herein, contained in said assembly. In a non-limiting embodiment, the ionically cross-linked macromolecular assembly comprises an ionically cross-linked water soluble polymer.
In another non-limiting embodiment, the device further comprises a substrate which comprises a surface and a plurality of asperities, such as microprojections and microneedles, extending from the surface. The macromolecular assembly containing the at least one biologically active agent is in contact with the substrate.
In a non-limiting embodiment, the ionically cross-linked macromolecular assembly containing the at least one biologically active agent may be in the form of an electrospun material which may be any of a variety of forms, including, but not limited to, fibers, such as nanofibers and microfibers, including fiber mats, three-dimensional films, spheres, tubes, or any other geometrical shape, and the like.
BRIEF DESCRIPTION OF THE DRAWINGS
The invention now will be described with respect to the drawings, wherein:
Figure I is a low magnification optical image of grounded carbon nanofibers coated with polyethylene oxide nanofibers;
Figure 2 shows a carbon fiber tip coated with nanofibers, and spanning nanofibers near the tip;
Figure 3 shows the tip of a carbon fiber coated with a ball of nanofibers at the tip;
Figure 4 shows a drawing of an asperity which has an increased surface area near the tip, and has corners that protect the nanofibers from shearing forces;
Figure 5 shows a drawing of an embodiment of an asperity having barbs and circumferential grooves;
Figure 6 shows a drawing of another embodiment of an asperity having barbs;
Figure 7A shows one embodiment of a two-polymer device, wherein the microneedle array comprises a soluble first layer which dissolves upon administration (Figure 7B) thereby releasing a relatively less soluble second layer into the skin;
Figure 8 shows one embodiment of a flexible microneedle array(s);
Figures 9A and 9B show one embodiment of a device comprising an elastomeric element which, upon pressure, changes form to hold the array(s) on the skin;
Figure 10 is a scanning electron microscope picture showing an overview of one embodiment of a microneedle array with a particular density;
Figure 11 is a scanning electron microscope picture showing a close up, side view of one embodiment of a single microneedle (e.g. within an array) with a particular shape and height;
Figure 12 is a scanning electron microscope picture showing a close up, top view of one embodiment of a single microneedle (e.g. within an array) with eight sides (i.e. eight surfaces) coming together at the top to form a point or tip;
Figure 13 shows a prospective microneedle array with a higher density;
Figure 14 shows an embodiment wherein a hydrogel is fabricated on the surface of an embodiment of the device of the present invention (e.g., a microneedle array) using aqueous based methods;
Figure 3 shows the tip of a carbon fiber coated with a ball of nanofibers at the tip;
Figure 4 shows a drawing of an asperity which has an increased surface area near the tip, and has corners that protect the nanofibers from shearing forces;
Figure 5 shows a drawing of an embodiment of an asperity having barbs and circumferential grooves;
Figure 6 shows a drawing of another embodiment of an asperity having barbs;
Figure 7A shows one embodiment of a two-polymer device, wherein the microneedle array comprises a soluble first layer which dissolves upon administration (Figure 7B) thereby releasing a relatively less soluble second layer into the skin;
Figure 8 shows one embodiment of a flexible microneedle array(s);
Figures 9A and 9B show one embodiment of a device comprising an elastomeric element which, upon pressure, changes form to hold the array(s) on the skin;
Figure 10 is a scanning electron microscope picture showing an overview of one embodiment of a microneedle array with a particular density;
Figure 11 is a scanning electron microscope picture showing a close up, side view of one embodiment of a single microneedle (e.g. within an array) with a particular shape and height;
Figure 12 is a scanning electron microscope picture showing a close up, top view of one embodiment of a single microneedle (e.g. within an array) with eight sides (i.e. eight surfaces) coming together at the top to form a point or tip;
Figure 13 shows a prospective microneedle array with a higher density;
Figure 14 shows an embodiment wherein a hydrogel is fabricated on the surface of an embodiment of the device of the present invention (e.g., a microneedle array) using aqueous based methods;
Figure 15 shows an alternative embodiment wherein physiologically active substances can be dissolved or dispersed in a solution of a cross-linker (e.g., a solution having multivalent or polyvalent ions);
Figure 16 shows a C. botulinum type A toxin amino acid sequence;
Figure 17 shows another C. botulinum type A toxin amino acid sequence;
Figure 18 shows the amino acid sequence of wild-type anthrax protective antigen;
Figure 19 shows the nucleotide sequence encoding wild-type anthrax protective antigen;
Figure 20 shows the amino acid sequences of human 1- 34 PTH and bovine 1- 34 PTH.
(The present invention is not limited only to administering human hormones.
The hormone homolog from other species (e.g., salmon, porcine, etc.) may have equal or better results);
Figure 21 shows the amino acid sequences for GLP-1, Exendin-4, Exendin-4 (3 -39), and Exendin-4 (9 - 39);
Figure 22 shows the nucleotide sequence of the coding region for the C.
botulinum type A
neurotoxin;
Figure 23 shows C. botulinum type A toxin expression constructs; constructs used to provide C. botulinum or C. difficile sequences also are shown;
Figure 24 shows the nucleotide sequence of the C. Botulinum C fragment gene sequences contained within pAlterBot;
Figure 25 shows the C. botulinum type A toxin expression constructs;
constructs used to provide C. botulinum sequences also are shown;
Figure 26 shows the nucleotide sequence present in the pETHisa vector which encodes the pHisBot fusion protein;
Figure 27 shows the amino acid sequence of the pHisBot protein; and Figure 28 shows the expected results in a test of electrospun PA
functionality.
DETAILED DESCRIPTION OF THE INVENTION
' As used herein the word "asperities" means the microscopic surface elevations present on the surface of a material due to surface roughness of a material, such as pins, microprojections, and microneedles. The asperities, microprojections, and microneedles preferably are in the form of piercing elements which are dimensioned to penetrate into or through a desired body part such as a tissue, or organ, or which may deliver a biological material transdermally, intradermally, intraepidermally, or transmucosally. In a non-limiting embodiment, the asperity, microprojection, or microneedle is dimensioned such that it penetrates through the stratum corneum into the underlying epidermis layer, and in some embodiments, the dermal layer of the skin.
The term "transdermal" are used herein means the delivery of an agent into and/or through at least the top layer of the skin. The term "intradermal" means the delivery or release within the skin.
The term "intra-epidermal" means the delivery or release specifically within the epidermal layer of the skin.
While the microneedle embodiment (described below) may be employed, other systems and apparatus that employ tiny skin piercing elements to enhance transdermal agent delivery are also contemplated, as disclosed in U.S. Pat. Nos. 5,879,326, 3,814,097, 5,250,023, 3,964,482, Reissue U.S. Pat. No. 25,637, and PCT Publication Nos. WO 96/37155, WO 96/37256, WO
96/17648, WO
97/03718, WO 98/11937, WO 98/00193, WO 97/48440, WO 97/48441, WO 97/48442, WO
98/00193, WO 99/64580, WO 98/28037, WO 98/29298, and WO 98/29365; all incorporated herein by reference in their entireties.
It is not intended that the present invention be limited to a precise geometry or topology of the microneedles. In one embodiment, the microneedles are defined by a plurality of surfaces sloping upwards from a relatively broad base to a tip (e.g. a pyramidal shape). In another embodiment, the microneedles have a generally conical-shaped body (e.g. a single curved surface).
Furthermore, within the scope of the present invention, the asperities, such as microprojections and microneedles, in one embodiment, may include one or more indentations and/or barbs, which aid in retaining the nanofibers on the asperities.
It is not intended that the present invention be limited, by the precise dimensions of the microneedles. In one embodiment, the microneedles described herein have a microneedle height to width (measured at the base) ratio of between 1.2 and 2.0 (and in one embodiment between 1.4 and 1.7), and the structure is predominantly solid, rather than hollow. These factors contribute to the force required to penetrate human skin being smaller than that required to break the penetrating elements. This applies to both single microneedles and various microneedle arrays, for which penetration forces are different depending on the number of penetrating elements, their height and spacing between adjacent microneedles.
In one embodiment, a prototypical microneedle has a diameter of between 200 and 500 microns (and in another embodiment, between 300 and 400 microns) at its broad end (e.g., at the base), and tapers to a sharp tip or chisel edges with a somewhat smaller diameter at its other end.
The diameter of the tip may, for example, be in the range from about 50 microns to about 1 microns.
In one embodiment, the microprojections or microneedles have a length (or height) or less than 1000 microns, and in one embodiment less than 700 microns, but more than 250 microns. In another embodiment, the microneedles have a height of between 550 and 650 microns (such as, for example, between 580 and 620 microns) with a height to width ratio of between 1.5 and 1.7. The microprojections may be formed in different shapes, such as needles, blades, pins, punches, and combinations thereof. In one embodiment, the microneedles are pyramidal in shape (e.g., having between 6 and 12 sides, and in one embodiment, eight sides).
The term "fiber" includes not only structures that are cylindrical, but also includes structures which vary from a cylindrical shape, such as, for example, structures which are spherical, acicular, droplet shaped, or flattened or ribbon shaped. A "fiber-forming" material is capable of being fabricated into fibers. The fiber-forming materials that may be used in this invention include polymers, which can be in a liquid state, such as melted, in solution, or in suspension.
Water, organic solvents, or mixtures thereof.or heat can be used to convert solid polymer into a liquid "fiber-forming" material. In one embodiment, electrospinning creates "pearls on a string"
or encapsulated balls on very thin fibers. This technique may be useful when compounds do not mix well, or when one needs to meet extended release requirements, or when one wants to deliver balls and the fibers are just a simple carrier.
Additionally, as used herein, nanofibers are fibers having an average diameter in the range of about 1 nanometer to about 25,000 nanometers (25 microns). In another embodiment, the nanofibers of the present invention are fibers having an average diameter in the range of about 1 nanometer to about 10,000 nanometers, or about 1 nanometer to about 5,000 nanometers, or about 3 nanometers to about 3,000 nanometers, or about 7 nanometers to about 1,000 nanometers, or even about 10 nanometers to about 500 nanometers, In another embodiment, the nanofibers of the present invention are fibers having an average diameter of less than 25,000 nanometers, or less than 10,000 nanometers, or even less than 5,000 nanometers. In still another embodiment, the nanofibers of the present invention are fibers having an average diameter of less than 3,000 nanometers, or less than about 1,000 nanometers, or even less than about 500 nanometers.
In another embodiment, the nanofibers may have a diameter as small as 0.3 nanometers. In yet another embodiment the nanometers have a diameter between 3 nanometers and about 25 microns. In a further embodiment, the nanofibers have a diameter of from about 100 nanometers to about 25 microns. In still another embodiment the nanofibers have a diameter of from about 100 nanometers to about a micron. Such small diameters provide a high surface area to mass ratio, such as, for example, about 300m2/g. Within the scope of the present invention, a fiber may be any length. The term "fiber" also encompasses particles that are drop-shaped, flat, or that may otherwise form a cylindrical shape. Additionally, it should be noted that here, as well as elsewhere in the text, ranges may be combined.
The at least one fiber-forming material used in this invention may be selected from any fiber-forming material which can be dissolved and is otherwise compatible with the biological material to be preserved. Fiber-forming materials which may be used in the practice of the method of the present invention include water soluble polymers, for example. In particular, acceptable fiber-forming materials, by way of example and not of limitation, include polyvinyl pyrrolidone) (PVP), polyethyl oxazoline (PEOZ), polyethylenlmine (PEI), polyethylene oxide (PEO) and mixtures thereof. Other polymers of interest include polyvinylalcohol, poly(ethylene glycol), polyoxymethylene, poly(hydroxyethyl methacrylate), carboxymethyl cellulose, hydroxypropylcellulose, alginic acid, chitosan, poly(glutamic acid), poly(isobutylacrylamide), poly(butyl methacrylate), poly(ethyl methacrylate), poly(vinylidene fluoride) poly(hydroxyvalerate), poly(L-lactic acid), polycaprolactone, poly(lactide-co-glycolide), poly(hydroxybutyrate), poly(hydroxybutyrate-co-valerate), polydioxanone, polyorthoester, polyanhydride, poly(glycolic acid), poly(vinyl methyl ether), polyvinylidene chloride, polyacrylonitrile, poly(trimethylene carbonate), poly(iminocarbonate), and copolymers thereof. Other illustrative polymers are set forth in Table 1 below.
A. Suitable Hydrophilic Polymers Polyacrylamide Poly(Acrylic Acid-Co-Hypophosphite) Polyacrylic Acid, Sodium Salt Poly(Alkyl(C 16-22)Acrylate) Poly(Ethylene Glycol) or Poly(Propylene Glycol) Poly(Vinyl Alcohol) Polypyrrolidone or Polyvinylpyrrolidone Polysaccharides Such As Chitosan, Alginate, Amylose Water Soluble Fractions Of Proteins Such As Collagen, Gelatin B. Suitable Biostable, Hydrophobic Polymers Poly(Divinylbenzene-Co-Ethylstyrene) Polyisobutylene Polylimonene Polymaleic Acid Polyoxyethylene Dioleate Poly(Vinyl Acetate) or Poly(Vinyl Chloride) Polystyrene, Polyurethane, Polyurethane-Poly(Ethylene Oxide) Graft Copolymer Poly(Ether Urethane) or Poly(Ether Urethane Urea) Polyethylene Polycarbonate Poly(Ester Amide) Polyacrylonitrile Poly(Aryl Ether Keton) Poly(Dimethyl Siloxane) And Other Polysiloxanes Poly(Ethylene Terephthalate) And Other Polyesters Poly(2-Hydroxyethylmethacrylate) or Polymethylmethacrylate C. Suitable Biodegradable, Hydrophobic Polymers Poly(Glycolic Acid), Poly(Lactic Acid) And Co-Polymers Thereof Polyhydroxybutyrate (Phb) Polyhydroxyvalerate (Phv), And Co-Polymers Thereof Polycaprolactone Polydioxanone And Other Synthetic Degradable Polyesters, Blends Thereof, And Copolymers Thereof Polyanhydrides Poly(Amino Acids) Such As Poly(Benzyl Glutamate) "Pseudo"-Poly(Amino Acids) Such As Tyrosine-Derived Polycarbonates And Polyarylates And Copolymers Thereof With Poly(Ethylene Glycol) Poly(Ortho Ester) Polyphosphazenes Poly(Propylene Fumarate) Although not specifically limited to any one production method, the fibers and/or nanofibers of the present invention are, in one embodiment, formed via an electrospinning process. The electrospinning of liquids and/or solutions capable of forming fibers, also known within the fiber forming industry as electrostatic spinning, is well known and has been described in a number of patents as well as in the general literature. The process of electrospinning generally involves the creation of an electrical field at the surface of a liquid. The resulting electrical forces create ajet of liquid that carries electrical charge. Thus, the liquid jets may be attracted to other electrically charged objects at a suitable electrical potential. As the jet of liquid elongates and travels, it will harden and dry. The hardening and drying of the elongated jet of liquid may be caused by cooling of the liquid, i.e., where the liquid is normally a solid at room temperature:
evaporation of a solvent, e.g., by dehydration, (physically induced hardening), or by a curing mechanism (chemically induced hardening) or by a combination of such methods. The produced fibers are collected on a suitably located, oppositely charged receiver and subsequently removed from it as needed, or directly applied to an oppositely charged or grounded generalized target area. In a non-limiting embodiment, the fibers are collected on a receiver such as, for example, a polystyrene or polyester net or a foil slide.
Fibers produced by this process have been used in a wide variety of applications, and are known, from United States Patent Nos. 4,043,331: 4,878,908; and 6,753,454, all of which are incorporated herein by reference in their entireties. One of the major advantages of electrospun fibers is that very thin fibers can be produced having diameters, usually on the order of about 50 nanometers to about 25,000 nanometers (25 microns), or even on the order of about 50 nanometers to about 5,000 nanometers (5 microns), or even on the order of about 50 nanometers to about 1,000 nanometers.
It will be appreciated that, because of the very small diameter of the fibers, the fibers have a high surface area per unit of mass. This high surface area to mass ratio permits fiber-forming material solutions to be transformed from solvated fiber-forming materials to solid nanofibers in fractions of a second. When biological materials are dissolved or suspended in a fiber-forming material solution which then is formed into fibers, the samples experience a rapid loss of excess solvent. This invention thereby also provides a fiber containing a mixture of at least one fiber-forming material and at least one preserved biological material and optionally other materials (e.g.
carriers, fillers, etc.). The mixture may, in some embodiments, be substantially homogeneous;
however, the present invention also contemplates non-homogeneous mixtures.
As one skilled in the art will recognize, the fibers may be spun using a wide variety of conditions such as potential difference, flow rate, and gap distance. These parameters will vary with conditions such as humidity or other environmental conditions, the size of the biological material or other additive, the solution viscosity, the collection surface, and the polymer conductivity, among others. The at least one fiber-forming material is in a liquid state when it is electrospun with the biological material to form a fiber containing a mixture of the at least one fiber-forming material and the at least one biological material. In one embodiment, the present invention contemplates mixtures of the at least one fiber-forming material and at least one biological material, including mixtures where the biological material is soluble in the at least one fiber-forming material in its liquid state (homogeneous or single phase systems) and those mixtures in which the at least one biological material is insoluble in the at least one fiber-forming material in its liquid state (heterogeneous or multi-phase systems). When the biological material is insoluble in the at least one fiber-forming material in its liquid state, the biological material may take the form of a suspension or emulsion in the fiber-forming material. Whether the biological material is soluble or insoluble in the fiber-forming material, the biological material and the fiber-forming material may be mixed by any method which forms a substantially uniform mixture, including, for example, mechanical shaking or stirring, although other methods (such as sonication) may be used. As one skilled in the art will recognize, solubility of the biological material in the fiber-forming material solution will depend on the characteristics of the material itself, as well as factors such as, for example, the requirements of the material for a specific pH range, osmolarity, or the presence of co-factors for the material.
By way of a non-limiting example, polyethylene oxide (PEO) (Mw 400,000), and polyvinylpyrrolidone (PVP) (Mw 360,000) can be used as polymer substrates for the electrospinning of fibers. In case of PEO, about 2.5 mg/ml of bioactive agent(s) in approximately 6% w/v polymer solution can be used in electrospinning the sample. A cone cap is typically used to do the spinning at room temperature, using a voltage of 14 KV, a current of 80 nA, and positive polarity. The gap distance can be 28.5 cm, and the sample can be collected on polyester net or other suitable substrate.
By way of a non-limiting example, PVP fibers can be electrospun from a solution containing about 2.5 mg/ml of bioactive agent(s) in 22% w/v polymer. A cone cap is again typically used to do the spinning at room temperature, using a voltage of 22 KV, a current of 360 nA, and positive polarity. The gap distance can be 23 cm, and the sample collected on a polyester net or other suitable substrate.
Although not limited solely hereto, suitable arrays of asperities can made by the growth of elongated cylindrical crystals by a vapor-liquid-solid process; growth of polycyanoacrylate fibers from small deposits of catalyst material; MEMs technology of the sort utilized in the semiconductor electronics industry; removing, by dissolution, fracture, or decomposition, the matrix from a composite that contains acicular particles; and in many other ways known in the art.
In one non-limiting embodiment, the asperities are microneedles which are anisotropically etched MEMs microneedles in silicon.
In one embodiment, the solid microneedles are fabricated in a crystal silicon material suitable for use in the administration of the various preparations discussed herein. Without limiting the invention in any manner to any particular mechanism, it is believed that the biologically active materials or drug(s) is delivered by microporation of the stratum corneum, and polymer-drug deposition within the patient's skin and subsequent dissolution or erosion of the polymer. The drug becomes thereby bioavailable; it can dissolve and diffuse to the biological target, or alternatively, it can remain at the site of administration. Micropores are made into the stratum comeum by means of a microneedle array penetration, which optionally can be enhanced further by applying energy in the form of ultrasonic, heat and/or electric signals across or through the skin.
As is discussed above, it is possible to incorporate, encapsulate, entrap and/or deposit one or more compounds or substances on, in or around fibers and/or nanofibers. One manner by which this can be accomplished is by dissolving and/or dispersing the desired substance(s) or compound(s) in a polymer solution that is to be electrospun before it is electrospun. In one embodiment, the material inside the nanofiber is sequestered and preserved by the polymer matrix provided by the nanofiber.
Pharmaceutically active or bioactive substances which may be included in the electrospun material are listed in the Physicians' Desk Reference, 57th Edition (2003), and include allergens, amebicides and trichomonacides, analeptic agents, analgesics, anorexics, antacids, antihelmintics, antialcohol preparations, antiarthritics, antiasthma agents, antibacterials and antiseptics, antibiotics, antiviral antibiotics, anticancer preparations, anticholinergic drug inhibitors, anticoagulants, anticonvulsants, antidepressants, antidiabetic agents, antidiarrheals, antidiuretics, antienuresis agents, antifibrinolytic agents, antifibrotics (systemic), antiflatulents, antifungal agents, antigonadotropin, antihistamines, antihyperammonia agents, anti-inflammatory agents, antimalarials, antimetabolites, anti-migraine preparations, antinauseants, antineoplastics, anti-obesity preparations, antiparasitics, anti-parkinsonism drugs, antipruritics, antipyretics, antispasmodics and antichloinergics, antitoxoplasmosis agents, antitussives, antivertigo agents, antiviral agents, bone metabolism regulators, bowel evacuants, bronchial dilators, calcium preparations, cardiovascular preparations, central nervous system stimulants, cerumenolytics, chelating agents, choleretics, cholesterol reducers and anti-hyperlipemics, colonic content acidifiers, cough and cold preparations, decongestants, expectorants and combinations, diuretics, emetics, enzymes and digestants, fertility agents, fluorine preparations, galactokinetic agents, geriatrics, germicides, hematinics, hemorrhoidal preparations, histamine H. receptor antagonists, hormones, hydrocholeretics, hyperglycemic agents, hypnotics, immunosuppressives, laxatives, mucolytics, muscle relaxants, narcotic antagonists, narcotic detoxification agents, ophthalmological osmotic dehydrating agents, otic preparations, oxytocics, parashypatholytics, parathyroid preparations, pediculicides, premenstrual therapeutics, psychostimulants, quinidines, radiopharmaceuticals, respiratory stimulants, salt substitutes, scabicides, sclerosing agents, sedatives, sympatholytics, sympathomimetics, thrombolytics, thyroid preparations, toxins for therapeutic vaccine use, tranquilizers, tuberculosis preparations, uricosuric agents, urinary acidifiers, urinary alkalinizing agents, urinary tract analgesic, urological irrigants, uterine contractants, vaginal therapeutics and vitamins and each specific compound or composition listed under each of the foregoing categories in the Physicians' Desk Reference.
They include, but not limited to water-soluble molecules possessing pharmacological activity, such as a peptide, protein, enzyme, enzyme inhibitor, antigen, cytostatic agent, anti-inflammatory agent, antibiotic, DNA-construct, RNA-construct, or growth factor. Examples of therapeutic proteins are interleukins, albumins, growth hormones, aspariginase, superoxide dismutase, monoclonal antibodies. Biological agents include also water-insoluble drugs, such as camptothecin and related topoisomerase I inhibitors, gemcitabine, taxanes and paclitaxel derivatives.
Other compounds include, for example, peptides, including peptidoglycans, as well as anti-tumor agents, cardiovascular agents such as forskolin; anti-neoplastics such as combretastatin, vinbiastine, doxorubicin, maytansine; anti-infectives such as vancomycin, erythromycin;
anti-fungals such as nystatin, amphotericin B, triazoles, papulocandins, pneumocandins, echinocandins, polyoxins, nikkomycins, pradimicins, benanomicins; anti-anxiety agents, gastrointestinal agents, central nervous system-activating agents, analgesics, fertility agents, anti-inflammatory agents, steroidal agents, anti-urecemic agents, cardiovascular agents, vasodilating agents, vasoconstricting agents and the like.
Other biologically active agents which may be included in the electrospun material include vaccine antigens. The vaccine antigens of the invention can be derived from a cell, a bacteria or virus particle or a portion thereof. The antigen can be a protein, peptide, polysaccharide, glycoprotein, glycolipid, or combination thereof which elicits an immunogenic response in a human;
or in an animal, for example, a mammal, bird, or fish. The immunogenic response can be humoral, mucosal, or cell mediated. Examples are viral proteins, such as influenza proteins, human immunodeficiency virus (HIV) proteins, Herpes virus proteins, and hepatitus A
and B proteins.
Additional examples include antigens derived from rotavirus, measles, mumps, rubella, and polio; or from bacterial proteins and lipopolysaccharides such as Gram-negative bacterial cell walls. Further antigens may also be those derived from organisms such as Haemophilus influenza, Clostridium antigens, including but not limited to, Clostridium tetani, Corynebacterium diphtheria, and Nesisseria gonhorrhoae, as well as anthrax antigens.
In another embodiment, the bioactive agent in the electrospun formulation comprises a cytokine. Cytokines are hormone-like substances secreted by a wide variety of cells, including (but not limited to) lymphocytes (e.g., T cells), macrophages, fibroblasts, and endothelial cells. It is now known that cytokines consist of a broad class of glycoproteins that have the ability to regulate intercellular communication (e.g., cell-cell interaction) in both normal and pathologic situations.
Cytokines generally contain from approximately 60 to 200 amino acid residues, with a relative molecular weight of between 15 and 25 kd. At least 35 distinct cytokines have been elucidated. It is not intended that the present invention be limited by the particular cytokine.
Table 2 provides illustrative examples.
ame bbr. y e Specific Name nterferons FN I ha Leukocyte Interferon eta Fibroblast Interferon amma acro hage Activation Factor nterleukins L-1 1 alpha ndogenous P ro en I beta ymphocyte-Activating Factor I ra L-1 Receptor Antagonist L-2 -cell Growth Factor L-3 ast Cell Growth Factor L-4 -cell Growth Factor L-5 osino hil Differentiation Factor L-6 bridoma Growth Factor L-7 m ho oietin L-8 Granulocyte Chemotactic Protein L-9 e akar oblast Growth Factor L-10 Cytokine Synthesis Inhibitor actor L-11 Stromal Cell-Derived Cytokine IL-12 4atural Killer Cell Stimulatory actor umor Necrosis Factors F alpha Cachectin eta m hotoxin Colony Stimulating CSF GM-CS Granulocyte-macrophage Colony-actors Stimulating Factor p-CS acrophage Growth Factor G-CSF Granulocyte Colony-stimulating actor PO r hropoietin ransforming Growth GF eta 1 Cartilage-inducing Factor Factor eta 2 pstein-Barr Virus-inducing actor eta 3 issue-derived Growth Factor Other Growth Factors IF eukemia Inhibitory Factor W acrophage Migration-inhibiting actor CP onocyte Chemoattractant rotein EGF idermal Growth Factor DGF latelet-derived Growth Factor FGF lpha cidic Fibroblast Growth Factor eta 3asic Fibroblast Growth Factor LGF nsulin-like Growth Factor GF erve Growth Factor CGF .13-cell growth factor Thus, the present invention provides a method of administering one or more drugs to a patient comprising the steps of penetrating at least an outer layer of the skin of the patient with one or more asperities, such as pins, microprojections, or microneedles extending from a surface of a substrate, wherein at least one of the one or more asperities, such as pins, microprojections, or microneedles (or portion thereof), is contacted or coated (uniformly or non-uniformly) with an electrospun polymer/drug(s) preparation, and releasing at least one of the one or more drugs into the patient.
The relative amounts of fiber-forming material and biological material that may be present in the fiber of the present invention may vary. In one embodiment, the biological material comprises between about 1 and about 50 percent (more typically 30 percent) by weight to volume (w/v) of the mixture from which the fiber is electrospun. In another example, the biological material comprises 10 percent of the mixture or less. In still another example, the biological material may be 25 percent, 5 percent, 0.5 percent of the mixture by weight to volume. It is envisioned that larger or smaller concentrations of biological material may also be utilized.
It is advantageous to coat the asperities (including microprojections and microneedles) with nanofibers which contain useful substances inside or on the nanofiber.
Different substances can be concentrated near the tips of the asperities. The high surface area per unit volume of a fiber, in particular a nanofiber, makes it possible to carry a high mass of particles containing bioactive material per unit volume on the outside surface of the fiber and/or nanofiber.
In one embodiment, it is even more useful to coat the tips of the asperities with nanofibers carrying one or more useful substances, and to have nanofibers that sequester a second set of useful substances span the regions between the asperities.
If, in one embodiment, the surfaces with asperities are mechanically pressed into contact with a second surface, the nanofibers on top of the asperities will be transferred onto, or impressed into the second surface. If, in one embodiment, the second surface is a sheet of material thinner than the height of the asperities, the nanofibers may be pushed through the sheet and available for chemical reactions or other purposes on the other side of the sheet while the nanofibers that span the spaces between the asperities are pressed onto the first surface of the sheet.
In one, embodiment, the present invention permits a designer to specify the relative amounts and kinds of useful materials, in each of three regions: on the surface near the tip of the asperity, a ball on top of the asperity, (including microprojections and microneedles) and in the space between the asperities. Such designs can be manufactured by one or methods in accordance with the present invention.
In one embodiment, quantities of around 1 microgram of one or more bioactive substances per pin and/or asperities have been found to be useful. For a material with a specific gravity near one, a cube with edges that are 0.1 mm (100 microns) long, would weigh 1 microgram. For nanofibers, the specific gravity is only about 0.2, so the volume required for 1 microgram is correspondingly larger The edge of a 1 microgram cube of nanofibers is about 170 microns long.
Coatings made of fibers and/or nanofibers for an array of asperities can be designed to produce a variety of useful arrangements of the nanofibers. Thus, in one embodiment, the present invention utilizes an attraction between electrically charged fibers and/or nanofibers and a sharp point. Further, because electrospun nanofibers are very long, the same nanofiber may span the space between adjacent tips and/or be attached to a large number of tips, resulting in the creation of a thin, non-woven sheet supported on the tips of the array of pins.
Other arrangements of the nanof bers, created by the methods of the present invention provide a number of advantages.
In one embodiment, the nanofibers are wrapped around the tip of each asperity, such as microprojections or microneedles, to form a relatively thick coating on the tip, with relatively few nanofibers spanning the spaces between the tips. This can be accomplished by controlling the electrospinning process so that the electrospinning jet is collected on the tips held near the location where the onset of the electrically driven bending instability occurs, and further, the jet is nearly dry, but is still soft and can readily bend. These conditions also favor mechanical buckling as the jet is caught and stopped on the tip. Via the present invention, the ability to create such nanofiber structures can be realized.
The combination of these effects, and the presence of the pin, causes the nanofibers to generate a cotton-swab-like ("Q-Tip"-like) collection of nanofibers near the tip of the pin.
Conglutination of the nanofibers can also be controlled, so that the fibers may range from fibers that are not attached to each other and slide past each other at crossing points, or fibers that are mechanically attached to each other at crossing points. The material on which the one or more asperities are formed must be a good enough electrical conductor that charge carried via or on the arriving jet(s) is conducted away. A sufficient level of ionic conductivity exists on the surface of ordinary glass at a normal ambient relative humidity. If a material with an excessively low conductivity is utilized, the effective conductivity of the asperities can be increased sufficiently by coating them with a ten to 1000 nanometer thick layer of carbon or other conductor or conductive material. This can be accomplished by any suitable technique including, but not limited to, vapor deposition, or by evaporation of carbon or metal onto the surface bearing the one or more asperities.
It should be noted that cotton-swab-like shapes can be used as collectors for electrospun nanofibers where. in one embodiment, such collectors are placed on one or more rotating mandrels In another embodiment, the present invention does not require the use of a rotating pin Instead, in this embodiment. the arriving nanofiber rotates around the tip region of the pin. This is made to happen locally and separately at the tip of each asperity. When the arriving fiber moves from one asperity to an adjacent one, a nanofiber segment remains between the two asperities, but the total amount of material in the spanning nanofibers is much less than the total amount accumulated near the tips of all the asperities.
In another embodiment, the arriving nanofibers can be accumulated in a "ball"
attached to the tip if the electrical conductivity of the collected fibers is kept at a relatively high value as the fiber accumulates. The conductivity of the solidifying nanofibers can be adjusted by addition of ions such as lithium or sodium, and, optionally. with a less volatile liquid substance added to the solvent used in the electrospinning process. The less volatile substance supports ionic conduction of the electrical charge on the arriving nanofiber to the asperity, which is maintained thereby at an attractive electrical potential. This condition allows the arriving nanofiber (which can, in one embodiment, be regarded as a jet solidified enough to retain its fiber-like shape, but still quite soft, sticky, and electrically conducting) to be collected on top of nanofibers that have already been collected. The less volatile solvent can be retained in the collected nanofibers, or in another embodiment this solvent can be evaporated in a time slightly longer than the time required to collect the desired mass of nanofibers.
In the absence of such ionic conduction through the collected fibers, charge retained on the topmost layer will repel the arriving nanofiber, and cause it to move toward uncoated pins. The uncoated pins may be some distance away: so long lengths of spanning nanofiber can be generated, in form of a non-woven mat and utilized in some embodiments of the present invention.
Three modes of collection of nanofiber are available to the device designer, although the present invention is not limited thereto. Two cause the nanofiber to be collected on or in front of the tip of the asperity, where the probability of its being pressed mechanically through a thin layer of material is high. The third mode is the a "non-woven mat" supported on the tips of the asperities Only a relatively small fraction of the material in the "non-woven mat' will be carried through the surface as the as the asperities are pressed against the surface. The remaining matter is brought into intimate contact with the outer surface of the thin layer, where it can be used to protect the surface or in other ways.
In one embodiment, the present invention relates to a structure where the tips of one or more asperities are coated with a cotton-swab-like arrangement of nanofibers bearing one useful material.
Another set of useful materials is collected in balls attached to the tip of each asperity. A third set of useful materials is collected in nanofibers that span the spaces between asperities.
In another embodiment, the present invention relates to multilayer structures where material is collected in the vicinity of the tip of the pin. in the 'cotton-swab-like"
part of the structure, the material collected in "balls" in front of the tip of the asperity, and the "spanning segments" that extend from the tip of one asperity to the tip of an adjacent asperity.
An electrospinning jet that wrapped polyethylene oxide nanofibers around or on the tip of each asperity in an array, was demonstrated by collecting nanofibers on closely spaced carbon fibers of the sort used in reinforced composites, which are electrically conducting, very stiff, and have diameters of about 7 microns. The jet used was, in one embodiment. less than a centimeter in length.
Potential differences between the electrospinning tip and the electrically grounded carbon fibers were in the range between about one and about two kilovolts, although the present invention is not limited to just these differences. The diameters of the collected nanofibers were about one micron.
The velocity of the jet as it arrived at the tips of the carbon fibers was low, perhaps less than about one meter per second, or perhaps even about one tenth of one meter per second. The specifications above were of a representative experiment and are not intended to act as limitations on the scope of the present invention.
The carbon nanofibers, separated by various distances, were mounted on adhesive tape at lateral distances ranging from about one millimeter to side by side contact.
The carbon fibers were projected at different distances toward the jet. Cottonswab-like coatings were formed on fibers separated by less than one millimeter. Balls were grown on fibers that projected furthest in the direction from which the jet arrives. The balls and cotton-swab-like structures sometimes formed at the tips of two carbon fibers which were separated by less than a few tens of microns A relatively small number of spanning nanofibers extended between fibers that are about one millimeter apart.
Figure 1 is a low magnification optical image of 7 micron diameter carbon fibers supported on transparent tape. The divisions in the scale shown in the image are one millimeter apart. The tips of the fibers were coated with polyethylene oxide nanofibers by the electrospinning methods described in this invention. The carbon nanofibers were grounded, and then held about 1 cm below the tip at which the electrospinning jet was created. The orifice from which the jet issued was at the end of a slender glass tube which had an internal diameter of about 60 microns. The potential difference between the electrospinning tip and the carbon nanofibers was about 1.5 kV. The position at which the electrically driven bending instability occurred is noted, and the tips of the carbon fibers were held. by hand and moving slightly, near this position. The collection of the nanofibers required about 10 or 20 seconds, and was terminated when white spots are visible at the ends of the carbon fibers. The nanofiber coating extended all the way around the tip of each of the carbon fibers.
Figure 2 shows a coated carbon fiber tip at higher magnification. The diameter of the coated fiber was about 70 microns, so the radial thickness of the coating was about 30 microns. Several spanning nanofibers can be seen near the tip. showing that the number of spanning nanofibers was smaller than the number of nanofibers on the tip. The end of the coated fiber is rounded. The diameter varied slightly at different places along the axis. The upper part of the figure is out of focus, and is seen, by focusing on this region, to be smaller in diameter than the region near the tip.
Figure 3 shows the tip of a carbon fiber, of the same sort as in Figures 1 and 2, coated with a ball of nanofibers at the tip. This carbon fiber is extended beyond its neighbors, and is in a position to collect more, less dry fibers, which is consistent with the mechanisms described in this disclosure, for the creation of balls on the tips by enhanced electrical conductivity of the collected fibers.
If the jet were wet when collected, balls or droplets also form. The fluid jet carries liquid into the droplet until the charge accumulates to a high enough value to cause the jet to move to a new location, usually leaving a spanning fiber to mark its path. These droplets do not dry as rapidly as nanofibers, but probably still provide significant sequestration and protection to bioactive substances in the fluid. The distinctions between balls of nanofibers and fluid droplets are noted but not emphasized or critical to the present invention.
In one embodiment, the devices of the present invention are employed for the injection of bioactive substances through the skin. Bioactive substances, (for therapeutic, diagnostic, vaccination, immunization, behavior modification, health monitoring, and other such purposes) need to be injected through the skin. This can be accomplished by coating the bioactive substance on a tapered pin which pierces the skin and deposits the bioactive material inside, either as a particle or by dissolving it in blood or other body fluids.
In practice it is desirable to use arrays of many pins, or microprojections, or microneedles to achieve efficacious concentrations of the bioactive material inside the body.
In most instances below, references to a pin or microprojection or microneedle are intended to describe both a single pin, microprojection, or microneedle, and an array of a large number of similar pins, microprojections, or microneedles. A prototypical pin, microprojection, or microneedle for this purpose, in one embodiment, has a diameter of about 100 microns at its broad end and tapers to a sharp tip of chisel edges with somewhat smaller diameter at its other end. The diameter of the tip may for example, be in the range from about 50 microns to about 5 microns.
Such a pin, microprojection, or microneedle can be inserted through the skin and withdrawn with minimal damage to the skin tissue.
It is advantageous to coat the tip with nanofibers which contain a useful substance inside or on the nanofiber. When the coated pin, microprojection, or microneedle is inserted through the skin, the coating material is distributed between the outer surface of the skin, the surface of the hole created in the skin, and the interior of the body.
In another embodiment, the present invention relates to nanofibers that are carried on a pin, microprojection, or microneedle that will and/or are designed to absorb substances from inside the body and retain a sample of these substances when the pin is withdrawn. The retained substances can then be analyzed for diagnosis, control, or other purposes. Glucose concentration monitoring provides an example.
Nanofibers adhere tightly to the tips and to each other during insertion. When wet with bodily fluids the fibers may become slippery, dissolve, degrade, release bioactive substances by leaching or chemical reaction or produce other useful effects. The material used for the nanofiber and the known possibilities for forming nanofibers from complex mixtures of substances provide many options, which are included in this invention.
The bioactive materials are to be injected through the skin, as described herein. The spanning nanofibers are applied in a thin layer. For example, the spanning fibers could be a nitric oxide (or chlorine dioxide) releasing structure of the sort described in other co-owned University of Akron patents. This sort of non-woven mat applied over the top of pins, microprojections, or microneedles, already coated with the bioactive substances for injection through the skin, could be used both to keep the device sterile between manufacture and use, and to sterilize the skin during and after use.
The non-injected material in the spanning nanofibers contributes to an advantageous design that utilizes both injected and non-injected components of the nanofibers.
Because the pins used to carry the nanofibers through the skin are much thicker than the carbon fibers, and in ordered arrays, it is clear from the results obtained with the thin carbon fibers, that microgram quantities of nanofibers can be placed at desired locations, described above, on the arrays of pins created by MEMs fabrication methods.
The cotton-swab like shape is a desirable arrangement of nanofibers, since the majority of the useful material is attached directly to the part of the pin that will be inside the skin when the device is used, Reactions between reagents in dry fibers that span the spaces between pins can release a material to disinfect the skin, or to adhere to the skin after the pins are removed and manage fluids escaping from the puncture holes, or for other purposes.
Because, in one embodiment, the nanofibers of the present invention are much smaller than the asperities needed to penetrate the skin, the shape of the tips of the pins can be modified to carry more nanofibers through the skin.
Figure 4 shows radial steps which both increase the surface area near the tip and provide corners that protect some of the nanofibers from the shearing forces that would otherwise wipe the nanofibers off the tip as it is forced through the skin.
Figure 5 provides even more protection of against wiping off of material to be injected, obtained by the creation of forward facing barbs and also illustrates the use of circumferential grooves to protect the fibers from wiping.
Figure 6 has backward facing barbs that protect some of the nanofibers from wiping as the point is inserted, and also tends to carry some of the nanofibers as the tip is withdrawn. The withdrawn material would then be available for analysis. Only the region close to the tip of the pin is shown in these three figures. The patterns shown are not limiting. These patterns may continue in the same way or with variations along the entire surface of the pin.
In another embodiment, two drugs are employed in an electrospun formulation.
In some embodiments, the first drug and the second drug are different, but selected from antidepressant compounds, analgesic compounds, anti-inflammatory steroidal compounds (corticosteroids), non-steroidal anti-inflammatory compounds (NSAIDs), antibiotic compounds, anti-fungal compounds, antiviral compounds, antiproliferative compounds, antiglaucoma compounds, immunomodulatory compounds, cell transport/mobility impeding agents, cytokines and peptides/proteins skin-treating compounds sunscreens skin protectants, leukotrienes such as LTB4, antimetabolite compounds, antipsoriatic compounds, keratolytic compounds, anxiolytic compounds, and antipsychotic compounds. In a preferred embodiment, the polymer/two drug electrospun preparation is delivered transdermally, intradermally, intra-epidermally, transmucosally, or subcutaneously. Alternatively, the electrospun material including the two drugs is delivered IP, IV, or IM.
The present invention further contemplates, in one embodiment, a drug delivery system comprising a) a substrate comprising asperities such as microprojections or microneedles, and b) an embodiment of the various electrospun preparations (mentioned above). The term "substrate", as used herein, includes materials out of which the asperities are made including, but not limited to, silicon. When microprojections or microneedles are used, they may be, in one embodiment, solid.
In another embodiment, they may be hollow. It is not intended that the present invention be limited to the manner in which the microneedles are contacted with the electrospun preparation. In one embodiment, the microneedles are contacted only at the microneedle tips. In one embodiment, the preparation contacts the entire substrate (or substantially the entire substrate) such that the preparation contacts even the spaces between an array of microneedles. It is not intended that the present invention be limited to uniform coatings of the preparation. In one embodiment, the preparation is present on the substrate in a non-uniform manner. In one embodiment, an electrospun polymer/drug(s) preparation is sprayed on said microneedles. In one embodiment, said microneedles are dipped into an electrospun preparation.
In one embodiment of the multidrug microneedle array, the drugs are separated on the array into different regions or zones in the manner of a mosaic. Conceptually, the mosaic approach provides a means of packaging, storing and delivering to the patient drug combinations without encountering conventional formulation issues. Incompatible drugs need not be chemically "compatibilized" if they are deposited and stored at different addresses on a microneedle array or other type of skin patch.
One particularly useful application of the mosaic design comprises a multidrug microneedle embodiment where a non-polar and a polar drug are to be co-administered. While such drugs are not easily mixed into a single vehicle, the mosaic design permits both drugs to be on the same delivery platform, albeit separated. Another particularly useful application of the mosaic design comprises a multidrug microneedle embodiment wherein it is desired to carry drugs that cancel one another's side effects or that have synergistic effects. Such uses would be particularly appropriate where traditional formulation happens to be problematic.
It is not intended that the present invention be limited by the nature of the substrate comprising said microneedles. In one embodiment, the microneedles are formulated out of polymer.
In another embodiment, the microneedles are made with a mold. In a preferred embodiment, the microneedles are etched out of a silicon substrate. In a preferred embodiment, said silicon microneedles are solid and the electrospun polymer/drug(s) formulation is deposited on said microneedles.
It is not intended that the present invention be limited to a single polymer or a single layer on said microneedles. In one embodiment, a first layer comprises a first polymer and a second layer a second polymer, where said second polymer is less soluble (e.g. in water) than said first polymer (Figure 7A). When the microneedles are administered, the microenvironment of the skin causes the first layer to dissolve (or substantially dissolve) thereby releasing the second (or top) layer from the microneedles (Figure 7B). The bioactive agent (e.g. drug, antigen or other substance to be delivered) can be in the first layer, second layer, or both. Preferably, it is in the second layer. For example, in one embodiment, the present invention contemplates a substance delivery device comprising: a substrate having a back surface and a front surface; a plurality of solid microneedles extending upwards from the front surface of the substrate; a first polymer layer in contact with said microneedles; and a second polymer layer in contact with said first polymer layer, said second polymer layer comprising at least one bioactive substance.
It is also not intended that the present invention be limited to inflexible microneedle arrays.
Indeed, embodiments of flexible microneedle arrays are contemplated. In one embodiment of a flexible microneedle, the present invention contemplates separating microneedles into individual "islands" by cutting into (and even through) the substrate so as to define such islands or regions separated by channels or streets (which can be, in one embodiment, filled or partially filled with polymer or drug). In one embodiment, the present invention contemplates mounting the substrate onto an adhesive material (e.g. adhesive tape) and dicing or cutting through the substrate to generate flexible arrays (Figure 8). In this manner, the risk of breakage when pushing against the back of the silicon substrates, when applying the patch to the skin, is reduced.
Various features can be added to the microneedle arrays to assure proper delivery. In one embodiment, the present invention contemplates the use of a plastic or otherwise elastomeric device positioned above the array relative to the skin (or attached or incorporated into the substrate or upper layer) that snaps into place once pressure is applied against the patch to push and keep the array of microneedles in the skin while the patch is on (to make sure needles are inside the skin and to avoid the need for an applicator in the final product, which is fully disposable in this embodiment). In one embodiment, the elastomeric element takes a first form prior to administration (Figure 9A) and then takes a second form after application of pressure (Figure 9B). In other words, the elastomeric element (which can be arched, curved or generally U-shaped) undergoes a shape change or deformation upon receiving the pressure from pushing the array into contact with the skin (e.g. from concave to convex).
Thus, the present invention contemplates formulations and devices, including but not limited to delivery devices, as well as methods of making formulations and devices. In one embodiment, the present invention contemplates a method of creating a substance delivery device, comprising:
providing i) an electrospun polymer formulation comprising at least one substance, and ii) a substrate comprising a plurality of microprojections; and depositing at least a portion of said preparation onto at least a portion of said substrate, so as to create a substance delivery device. The present invention also contemplates, as a device, the treated substrate prepared according to the above-described method. In one embodiment, said electrospun formulation comprises nanofibers.
It is not intended that the present invention be limited to a particular water-soluble polymer.
In one embodiment, said water-soluble polymer is selected from the group consisting of PVP, hydroxyethylcellulose, carboxymethyl cellulose, alginic acid, chitosan, and poly(glutamic acid).
It is not intended that the present invention be limited by the nature of the substance. In one embodiment, said substance is a therapeutic protein. In another embodiment, said substance is a vaccine antigen. In one embodiment, first and second substances are used (e.g., a vaccine antigen as a first substance, and adjuvant as the second substance).
The present invention, as mentioned above, also contemplates methods of administering substances (including but not limited to pharmaceuticals). In one embodiment, the present invention contemplates a method of administering a substance, comprising: providing a subject and the delivery device described above; and contacting said subject with said delivery device under conditions such at least a portion of said substance is released from said device. The term "subject"
includes human and non-human animals. In the case of humans, the term includes more than patients. The term also includes healthy, asymptomatic recipients. In one embodiment, said contacting comprises piercing the subject's skin with said asperities such as microprojections or microneedles.
The present invention also contemplates, in one embodiment, a substance delivery device comprising: a substrate having a back surface and a front surface; and a plurality of solid microneedles extending upwards from the front surface of the substrate, the microneedles comprising an electrospun polymer formulation, said formulation comprising at least one substance.
In one embodiment, said formulation provides for a sustained release of substance. In another embodiment, said formulation provides for various release rates of said substance.
When in an array, the density of the microprojections is, in one embodiment, at least 10 microprojections/cm2, in another embodiment, at least 200 microprojections/cm2, and, in some embodiments, at least 1000 microprojections/cm2. In one embodiment, each microneedle is spaced (when measured center to center with another microneedle) between 300 microns and 2.7 mm apart.
In one embodiment, the spacing is approximately three times the height of the microneedle, i.e. for a microneedle that is 600 microns (plus or minus 200 microns) in height, the spacing may be 1.8 mm, while for a microneedle that is 900 microns in height, the spacing may be 2.7 mm, while for a microneedle that is 300 microns in height, the spacing may be 900 microns.
The figures herein provide illustrative examples of microneedles and corresponding arrays.
Figure 10 is a scanning electron microscope picture showing an overview of one embodiment of a microneedle array (each microneedle is approximately 620 microns, plus or minus 20 microns, in height) with a particular density (the distance between microneedles, when measured center to center, is approximately 1.8 mm, plus or minus 200 microns. Figure I1 is a scanning electron microscope close up, side view of one embodiment of a single microneedle (e.g.
within the array) of approximately 620 microns (plus or minus 20 microns) in height showing the pyramidal shape.
Figure 12 is a scanning electron microscope close up, top view of one embodiment of a single microneedle (e.g. within the array) with eight sides (i.e. eight surfaces) coming together at the top to form a point or tip, wherein the width is approximately 385 microns, plus or minus 5 microns, and the height is approximately 620 microns, plus or minus 20 microns.
It is not intended that the present invention be limited to a particular density. Figure 13 shows a prospective microneedle array with a higher density of microneedles.
In another non-limiting embodiment, the present invention comprises a microfabricated device for transdermal, intra-epidermal, intradermal or transmucosal drug delivery comprising ionically cross-linked macromolecular assemblies, which provides sufficient mechanical strength, sufficient capacity of loading various amounts of drug, stability, and release characteristics. After the device is brought in contact with a subject's skin, the substance is released.
lonically cross-linked macromolecular assemblies are polymer networks that are formed through the establishment of reversible links between the macromolecular chains, as described in "J.
Berger, M Reist, J.M. Mayer, 0. Felt, N.A. Peppas, R. Gurny, Structure and interactions in covalently and ionically crosslinked chitosan hydrogels for biomedical applications, European Journal of Pharmaceutics and Biopharmaceutics 57 (2004) 19-34. " They can include polyelectrolyte complexes; multilayer polyelectrolyte materials, complexes of polyelectrolytes with low molecular weight ions; assemblies of dendrimers; ionically cross-linked hydrogels, which can be in the form of film; micro-and nanospheres; micro- and nanocapsules; micro-and nanofibers. The properties of cross-linked hydrogels depend mainly on their cross-linking density, namely the ratio of moles of cross-linking units to the moles of polymer repeating units, polymer characteristics, and microstructure of the material. lonically cross-linked assemblies include those in which gradient exists in the density of the cross-linking agent.
lonically cross-linked macromolecular assemblies of the present invention comprise a substance to be delivered. The preferred substances of the present invention are biologically active agents such as those described herein, including but not limited to, pharmaceutically active substances, such as therapeutic drugs, which can include small molecule drugs, proteins, peptides, nucleic acids, hormones, or vaccines, which can include antigens and adjuvants.
The formulation containing the pharmaceutically active substance can be in the form of an ionically cross-linked three dimensional film, sphere, tube, fiber, such as a nanofiber or microfiber, or in any other geometrical shape, and is attached the surface of the device by chemical or physical means.
The polymers of this aspect of the present invention may be water-soluble polymers. In one embodiment they are polyelectrolytes - polymers containing ionic or ionizable groups. In another embodiment they are polymers capable of establishing ionic complexes, such as sodium -poly(ethylene oxide), or sodium -poly[di(methoxyethoxyethoxy)phosphazene complex. In one embodiment the polymers are biodegradable polymers. Typical examples of such polymers are poly(ethylene glycol), polyvinylpyrrolidone, polyvinylalcohol, poly(ethylene oxide), polyoxymethylene, poly(hydroxyethyl methacrylate), carboxymethylcellulose, hydroxyethylcellulose, hydroxypropylcellulose, alginic acid, chitosan, poly(glutamic acid), poly(isobutylacrylamide), poly(ethylenimine), and copolymers thereof. The polymers can be linear, branched, brush- or comb-like in their macromolecular architecture. Copolymers can be random or block copolymers, or biomolecules (such as fibrin, fibrinogen, cellulose, starch, collagen and hyaluronic acid). In yet another embodiment, the polymers can be hydrophobic, but contain hydrophilic groups or hydrophilic segments capable of forming ionic cross-links or complexes.
Examples of hydrophobic polymers are poly(butyl methacrylate), poly(ethyl methacrylate), poly(vinylidene fluoride) poly(hydroxyvalerate), poly(L-lactic acid), polycaprolactone, poly(lactide-co-glycolide), poly(hydroxybutyrate), poly(hydroxybutyrate-co-valerate), polydioxanone, polyorthoester, polyanhydride, poly(glycolic acid), poly(vinyl methyl ether), polyvinylidene chloride, polyacrylonitrile, poly(trimethylene carbonate), poly(iminocarbonate), and other derivitized polyurethanes, and poly(organosiloxanes).
It is contemplated that the ionically cross-linked macromolecular assembly/drug(s) preparation can be deposited on a surface (in a uniform or non-uniform manner). In one embodiment, the preparation is deposited (e.g. by dipping, coating, spin coating, spraying, or by suitable applicator) on an array of asperities such as those described herein, such as microprojections or microneedles for transdermal, intradermal, or transmucosal delivery of the bioactive substance.
While the microneedle embodiment (described herein) is preferred, other systems and apparatus that employ tiny skin piercing elements to enhance transdermal agent delivery are also contemplated, as disclosed in U.S. Pat. Nos. 5,879,326, 3,814,097, 5,250,023, 3,964,482, Reissue U.S. Pat. No. 25,637, and PCT Publication Nos. WO 96/37155, WO
96/37256, WO
96/17648, WO 97/03718, WO 98/11937, WO 98/00193, WO 97/48440, WO 97/48441, WO
97/48442, WO 98/00193, WO 99/64580, WO 98/28037, WO 98/29298, and WO 98/29365;
all incorporated herein by reference in their entirety.
In one non-limiting embodiment, the macromolecular assembly can be prepared by ionic cross-linking or complexation of nanofibers. Polymeric materials can be fabricated in fibers, nano-and microfibers. The term "fiber" includes not only structures that are cylindrical, but also includes structures which vary from a cylindrical shape, such as for example, structures which are flattened or ribbon shaped. When fine fibers are randomly distributed they can form an interlocking net (non-woven fine fiber).
A"fiber-forming" material is capable of being fabricated into fibers. The fiber-forming materials used in this invention include polymers, which can be in a liquid state, such as melted, in solution, or in suspension. Water, organic solvents, or mixtures thereof or heat can be used to convert solid polymer into a liquid "fiber-forming" material. Electrostatic solution spinning is one method of making nanofibers and microfiber. Such electrospun material is then treated with a solution of an ion-complexing agent for cross-linking.
In one embodiment, the macromolecular assembly can be fabricated on the surface of the device using an aqueous based method (Figure 14). The advantages of such method for making ionically cross-linked hydrogels are that it avoids the use of organic solvents, heat, and, complicated manufacturing equipment. In one embodiment, the method involves the following steps. First, a solution of containing polymer and pharmaceutically active substance can be applied to a device using methods, such as dipcoating, spin coating, electrospinning, spraying, or with a brush or other suitable applicator. The preferred solution is a solution in water or in aqueous buffer; however organic solutions can be used or added if beneficial. The surface of a device can be dried after the application if desired. Secondly, a solution containing multivalent or polyvalent ions (cross-linker), is applied to the surface using the previously described methods.
Multivalent ions can be selected from the group if inorganic ions, such as calcium, zinc bismuth, barium, magnesium, aluminum, copper, cobalt, nickel, or cadmium, or organic ions, such as spermine, spermidine, or polylysine. In one embodiment, the salt of the monovalent ion is a calcium salt, such as calcium chloride, or CaC l2. The salt of the multivalent ion may be present in the solution at any concentration and pH, preferably from about 1% to about 25% and a pH from 4 to 9. The Ca2+ ions in the solution serve as a cross-linker, whereby the film is stabilized when they contact the solution containing the calcium salt.
The device can then be dried by freeze-drying, treating it with ethanol or other water miscible organic solvent, or under vacuum.
Alternatively, a physiologically active substance can be dissolved or dispersed in a solution of the cross-linker (multivalent or polyvalent ions) (Figure 15). In one embodiment of such a method, the physiologically active substance is introduced in the film at the same stage as the film is stabilized.
In one embodiment, the ionic cross-linking process can be applied to the total volume of the polymer film. In another embodiment the cross-linking process is limited to portion of the film, such as a portion localized on the elevated part of the device. In yet another embodiment, the cross-linking process is only applied to a portion of the film, which is localized on the tip of the elevated part of the device.
It is realized that the nature of the cross-linking agent used in the process can influence the stability of the film and thus the disintegration time and the release kinetics upon the administration. It is generally known that the disintegration and release time increases as the stability of the ionic links in hydrogel matrices increases in the following way: two valent ionic cross-linker, such as calcium ion, three valent ionic cross-linker, such as aluminum ion, multivalent organic ions, such as spermine or spermidine, polyvalent organic ions, such as poly(L-lysine). It is also understood that an increase in the cross-linking density of the hydrogel matrix can also lead to the increase in the disintegration of the hydrogel formulation and release time of the pharmaceutically active substance.
In one embodiment multiple ions are used to cross-link hydrogel matrix. In another embodiment the gradient of ions is achieved through the depth of the film. In yet another embodiment, the cross-linking density is also varied through the volume of the film. This can be achieved via varying the cross-linker and its concentration with time in the cross-linking solution.
Alternatively, the polymer hydrogel is composed of interpenetrating networks of ionically cross-linked polyelectrolytes.
In a preferred embodiment, only one type of a cross-linker is used and no additional cross-linking agent is added in the course of the process.
In yet another embodiment, the type of cross-linker and the concentration of the cross-linkers varies in the various zones of the device. Thus, various modes of release kinetics can be achieved using the same device.
The present invention contemplates administering one or more of the various embodiments of the formulations (described herein) comprising a drug, such as a prophylactic or therapeutic to humans and animals. In one embodiment, the present invention contemplates a method comprising:
a) providing i) a preparation comprising at least one drug in a ionically-cross-linked macromolecular assembly and ii) a subject, wherein said subject is a human or non-human animal; and b) contacting said subject with said preparation (e.g. under conditions such that at least a portion of said drug is released into said subject). In one embodiment, the present invention contemplates a method comprising: a) providing i) a preparation comprising one or more drugs in a macromolecular assembly formulation and ii) a subject, wherein said subject is a human or non-human animal; and b) contacting said subject with said preparation (e.g. under conditions such that at least a portion of said drug is released into said subject).
In one embodiment, two drugs are employed in a macromolecular assembly formulation. In some embodiments, first drug and second drug are different, but selected from antidepressant compounds, analgesic compounds, anti-inflammatory steroidal compounds (corticosteroids), non-steroidal antiinflammatory compounds (NSAIDs), antibiotic compounds, anti-fungal compounds, antiviral compounds, antiproliferative compounds, antiglaucoma compounds, immunomodulatory compounds, cell transport/mobility impeding agents, cytokines and peptides/proteins skin-treating compounds sunscreens skin protectants, leukotrienes such as LTB4, antimetabolite compounds, antipsoriatic compounds, keratolyiic compounds, anxiolytic compounds, and antipsychotic compounds. In a preferred embodiment, the hydrogel/two drug preparation is delivered transdermally, intradermally, intra-epidermally, transmucosally, subcutaneously, IP, IV or IM.
The present invention further contemplates, in one embodiment, a drug delivery system comprising a) a substrate comprising asperities such as those described herein, such as microprojections or microneedles, and an embodiment of the various ionically cross-linked preparations (mentioned above). When microneedles are used, they may be hollow, but preferably they are solid. It is not intended that the present invention be limited to the manner in which the microneedles are contacted with the macromolecular assembly preparation. In one embodiment, the microneedles are contacted only at the microneedle tips. In a preferred embodiment, the preparation contacts the entire substrate (or substantially the entire substrate) such that the preparation contacts even the spaces between an array of microneedles. It is not intended that the present invention be limited to uniform coatings of the preparation. In one embodiment, the preparation is present on the substrate in a non-uniform manner. In one embodiment, a ionically cross-linked macromolecular assembly/drug(s) preparation is sprayed on said microneedles. In one embodiment, said microneedles are dipped into a preparation.
Thus, the present invention contemplates formulations and devices, including but not limited to delivery devices, as well as methods of making formulations and devices. In one embodiment, the present invention contemplates a method of creating a substance delivery device, comprising:
providing i) an ionically cross-linked macromolecular assembly which includes at least one substance, such as a biologically active agent as described herein and ii) a substrate comprising a plurality of asperities such as those described herein, such as microprojections and microneedles;
and depositing at least a portion of said preparation onto at least a portion of said substrate, so as to create a substance delivery device. The present invention also contemplates, as a device, the treated substrate prepared according to the above-described method. In one embodiment, said ionically cross-linked macro-molecular assembly comprises an ionically cross-linked water-soluble polymer.
In a preferred embodiment, said ionically cross-linked macromolecular assembly has a multilayer structure. In another embodiment, said ionically cross-linked macromolecular assembly comprises ionically cross-linked nanofibers.
It is not intended that the present invention be limited to a particular water-soluble polymer.
In one embodiment, said water-soluble polymer is selected from the group consisting of carboxymethyl cellulose, alginic acid, chitosan, poly(glutamic acid).
It is not intended that the present invention be limited by the nature of the nanofibers. In one embodiment, wherein said ionically cross-linked nanofibers comprise ionically cross-linked chitosan nanofibers.
It is not intended that the present invention be limited by the nature of the substance. In one embodiment, said substance is a therapeutic protein. In another embodiment, said substance is vaccine antigen. In one embodiment, first and second substances are used (e.g.
a vaccine antigen as a first substance, and adjuvant as the second substance).
The present invention, as mentioned above, also contemplates methods of administering substances (including but not limited to pharmaceuticals). In one embodiment, the present invention contemplates a method of administering a substance, comprising: providing: a subject and the delivery device described above; and contacting said subject with said delivery device under conditions such at least a portion of said substance is released from said device. In one embodiment, said contacting comprises piercing the subject's skin with said microprojections.
The present invention also contemplates, in one embodiment, a substance delivery device comprising: a substrate having a back surface and a front surface; and a plurality of solid microneedles extending upwards from the front surface of the substrate, the microneedles comprising a ionically cross-linked macromolecular assembly formulation, said formulation comprising at least one substance. In one embodiment, said ionically cross-linked macromolecular assemblies provide for a sustained release of substance. In another embodiment,said ionically cross-linked macromolecular assemblies provide for various release rates of said substance.
"Polyelectrolytes" are defined here as polymers that contain ionic (ionized or ionizable) groups, which groups impart to the polymer anionic, cationic, or amphiphilic character. The ionic groups can be in the form of a salt, or, alternatively, an acid or base that is, or can be, at least partially dissociated. Polyelectrolytes can also contain non-ionic side groups. Polyelectrolyte can be biodegradable (e.g. to prevent eventual deposition and accumulation of polymer molecules in the body) or non-biodegradable under the conditions of use. A preferred polyelectrolyte is a polyanion and contains ionic groups that include carboxylic acid, sulfonic acid, hydroxyl, or phosphate moieties.
Pharmaceutically active substances which may be included in the resulting preparation which includes the macromolecular assembly hereinabove described may be those described herein.
In one non-limiting embodiment, a hydrogel/drug(s) preparation is delivered transdermally, intra-epidermally, intradermally, or transmucosally using anisotropically etched MEMS
microneedles in silicon. In one embodiment, the invention contemplates solid asperities such as those herein described, such as microprojections or microneedles which are fabricated in a crystal silicon material suitable for use in the administration of the various preparations discussed above.
Without limiting the invention in any manner to any particular mechanism, it is believed that the drug(s) is delivered by microporation of the stratum corneum, and polymer-drug deposition within the patient's skin and subsequent dissolution or erosion of the polymer. The drug becomes thereby bioavailable; it can dissolve and diffuse to the biological target, or alternatively, it can remain at the site of administration. Micropores are made into the stratum corneum by means of a microneedle array penetration, which can optionally be further enhanced by applying energy in the form of ultrasonic, heat and/or electric signals across or through the skin.
In one embodiment, the present invention contemplates a method of administering one or more drugs to a patient comprising the steps of penetrating at least an outer layer of the skin of the subject with one or more microneedles extending from a front surface of a substrate, at least one of the one or more microneedles (or portion thereof) contacted or coated (uniformly or non-uniformly) by a macromolecular assembly/drug(s) preparation (discussed above), and releasing at least one of the one or more drugs into the subject.
In another, non-limiting embodiment, the at least one biologically active agent is a toxin.
For example, several species of Clostridium produce toxins of significance to human and animal health. [C.L. Hatheway, Clin. Microbiol. Rev. 3:66-98 (1990).] The effects of these toxins range from diarrheal diseases that can cause destruction of the colon, to paralytic effects that can cause death (see Table 3). Particularly at risk for developing clostridial diseases are neonates and humans and animals in poor health (e.g., those suffering from diseases associated with old age or immunodeficiency diseases).
Clostridium botulinum produces the most poisonous biological toxins known. The lethal human dose is a mere 10-9 mg/kg bodyweight for toxin in the bloodstream. THe closely related isoforms of botulinal toxin blocks nerve transmission to the muscles, resulting in flaccid paralysis.
When the toxin reaches airway and respiratory muscles, the consequence is respiratory failure that can cause death. [S. Arnon, J. Infect. Dis.154:201-206 (1986).]
C. botulinum spores are carried by dust and are found on vegetables taken from the soil, on fresh fruits, and on agricultural products such as honey. Under conditions favorable to the organism, the spores germinate to vegetative cells which produce toxin. [S. Amon, Ann.
Rev. Med. 31:541 (1980).] Botulism disease may be grouped into four types, based on the method of introduction of the toxin isoform into the bloodstream. Food-borne botulism results from ingesting improperly preserved and inadequately heated food that contains botulinal toxin. [K.L.
MacDonald et al., Am. J.
Epidemiol. 124:794 (1986).] The death rate due to botulinal toxin is 12% and can be higher in particular risk groups. [C.O. Tacket et al., Am. J. Med. 76:794 (1984).] Wound-induced botulism results from C. botulinum penetrating traumatized tissue and producing toxin that is absorbed into the bloodstream.
Clostridium Species of Medical and Veterinary Importance*
Species Disease C. aminovalericum Bacteriuria (pregnant women) C. argentinense Infected wounds; Bacteremia; Botulism; Infections of amniotic fluid C. baratii Infected war wounds; Peritonitis; Infectious processes of the eye, ear and prostate C. beijerinckikii Infected wounds C. bifermentans Infected wounds; Abscesses; Gas Gangrene; Bacteremia C. botulinum Food poisoning; Botulism (wound, food, infant) C. butyricum Urinary tract, lower respiratory tract, pleural cavity, and abdominal infections;
Infected wounds; Abscesses; Bacteremia C. cadaveris Abscesses; Infected wounds C. carnis Soft tissue infections; Bacteremia C. chauvoei Blackleg C. clostridioforme Abdominal, cervical, scrotal, pleural, and other infections; Septicemia;
Peritonitis; Appendicitis C. cochlearium Isolated from human disease processes, but role in disease unknown.
C. difficile Antimicrobial-associated diarrhea; Pseudomembranous enterocolitis;
Bacteremia;
Pyogenic infections C. fallax Soft tissue infections C. ghnoii Soft tissue infections C. glycolicum Wound infections; Abscesses; Peritonitis C. hastiforme Infected war wounds; Bacteremia; Abscesses C. histolyticum Infected war wounds; Gas gangrene; Gingival plaque isolate C. indolis Gastrointestinal tract infections C. innocuum Gastrointestinal tract infections; Empyema C. irregulare Penile lesions C. leptum Isolated from human disease processes, but role in disease unknown Clostridium Species of Medical and Veterinary Importance*
Species. Disease C. limosum Bacteremia; Peritonitis; Pulmonary infections C. malenominatum Various infectious processes C. novyi Infected wounds; Gas gangrene; Blackleg, Big head (ovine);
Redwater disease (bovine) C. oroticum Urinary tract infections; Rectal abscesses C. paraputrificum Bacteremia; Peritonitis; Infected wounds; Appendicitis C. perfringens Gas gangrene; Anaerobic cellulitis; Intra-abdominal abscesses;
Soft tissue infections; Food poisoning; Necrotizing pneumonia;
Empyema; Meningitis; Bacteremia; Uterine Infections; Enteritis necrotans; Lamb dysentery Struck; Ovine Enterotoxemia C. putrefaciens Bacteriuria (Pregnant women with bacteremia) C. putrificum Abscesses; Infected wounds; Bacteremia C. ramosum Infections of the abdominal cavity, genital tract, lung, and biliary tract; Bacteremia C. sartagoforme Isolated from human disease processes, but role in disease unknown.
C. septicum Gas gangrene; Bacteremia; Suppurative infections; Necrotizing enterocolitis; Braxy C. sordellii Gas gangrene; Wound infections; Penile lesions; Bacteremia;
Abscesses; Abdominal and vaginal infections C. sphenoides Appendicitis; Bacteremia; Bone and soft tissue infections;
Intraperitoneal infections; Infected war wounds; Visceral gas gangrene; Renal abscesses C. sporogenes Gas gangrene; Bacteremia; Endocarditis; central nervous system and europulmonary infections; Penile lesions; Infected war wounds; Other pyogenic infections C. subterminale Bacteremia; Empyema; Biliary tract, soft tissue and bone infections C. symbiosum Liver abscesses; Bacteremia; Infections resulting due to bowel flora C. tertium Gas gangrene; Appendicitis; Brain abscesses; Intestinal tract and soft tissue infections; infected war wounds; penodonitis;
Bacteremia Clostridium Species of Medical and Veterinary Importance*
Species isease C. tetani etanus; Infected gums and teeth; Corneal ulcerations;
4astoid and middle ear infections; Intraperitoneal infections; Tetanus neonatorum; Postpartum uterine infections; Soft tissue infections, especially related to rauma (including abrasions and lacerations); Infections elated to use of contaminated needles C. thermosaccharolyticum solated from human disease processes, but role in disease nknown.
* Compiled from P.G. Engelkirk et al. "Classification", Principles and Practice of Clinical Anaerobic Bacteriology, pp. 22-23, Star Publishing Co., Belmont, CA (1992); J.
Stephen and R.A.
Petrowski, "Toxins Which Traverse Membranes and Deregulate Cells," in Bacterial Toxins, 2d ed., pp. 66-67, American Society for Microbiology (1986); R. Berkow and A.J.
Fletcher (eds.), Bacterial Diseases," Merck Manual of Diagnosis and Therapy, 16th ed., pp. 116-126, Merck Research Laboratories, Rahway, N.J. (1992); and O.H. Sigmund and C.M. Fraser (eds.), "Clostridial Infections, "Merck Veterinary Manual, 5th ed., pp. 396-409, Merck & Co., Rahway, N.J. (1979).
[M.N. Swartz, "Anaerobic Spore-Forming Bacilli: The Clostridia," pp. 633-646, in B.D.
Davis et al.,(eds.), Microbiology, 4th edition, J.B. Lippincott Co. (1990).]
Inhalation botulism has been reported as the result of accidental exposure in the laboratory [E.
Holzer, Med. Klin. 41:1735 (1962)] and could arise if the toxin is used as an agent of biological warfare [D.R. Franz et al., in Botulinum and Tetanus Neurotoxins, B.R. DasGupta, ed., Plenum Press, New York (1993), pp. 473-476]. Infectious infant botulism results from C. botulinum colonization of the infant intestine with production of toxin and its absorption into the bloodstream. It is likely that the bacterium gains entry when spores are ingested and subsequently germinate. [S. Arnon, J. Infect.
Dis. 154:201 (1986).]
Different strains of Clostridium botulinum each produce one of seven structurally similar but antigenically distinct toxin isoforms designated by the letters A-G. Serotype A toxin has been implicated in 26% of the cases of food botulism; types B, E and F have also been implicated in a smaller percentage of the food botulism cases [H. Sugiyama, Microbiol. Rev.
44:419 (1980)].
Wound botulism has been reportedly caused by only types A or B toxins [H.
Sugiyama, supra].
Nearly all cases of infant botulism have been caused by bacteria producing either type A or type B
toxin. (Exceptionally, one New Mexico case was caused by Clostridium botulinum producing type F
toxin and another by Clostridium botulinum producing a type B-type F hybrid.) [S. Arnon, Epidemiol. Rev. 3:45 (1981)] Type C toxin affects waterfowl, cattle, horses and mink. Type D toxin affects cattle, and type E toxin affects both humans and birds.
A trivalent antitoxin derived from horse plasma is commercially available from Connaught Industries Ltd. as a therapy for toxin types A, B, and E. However, the antitoxin has several disadvantages. First, extremely large dosages must be injected intravenously and/or intramuscularly.
Second, multiple administrations of antitoxin can trigger serious side effects, such as acute anaphylaxis which can lead to death, and serum sickness. Finally, the efficacy of the antitoxin is uncertain and the treatment is costly.
[C.O. Tacket et al., Am. J. Med. 76:794 (1984).]
A heptavalent equine botulinal antitoxin which uses only the F(ab')2 portion of the antibody molecule has been tested by the United States Military. [M. Balady, USAMRDC
Newsletter, p. 6 (1991).] This was raised against impure toxoids in those large animals and is not a high titer preparation.
A pentavalent human antitoxin has been collected from immunized human subjects for use as a treatment for infant botulism. The supply of this antitoxin is limited and cannot be expected to meet the needs of all individuals stricken with botulism disease. In addition, collection of human sera must involve screening out HIV and other potentially serious human pathogens. [P.J. Schwarz and S.S.on, Western J. Med. 156:197 (1992).]
Immunization of subjects with toxin preparations has been done in an attempt to induce immunity against botulinal toxins. A C. botulinum vaccine comprising chemically inactivated (i.e., formaldehyde-treated) type A, B,C, D and E toxin is commercially available for human usage.
However, this vaccine preparation has several disadvantages. First, the efficacy of this vaccine is variable (in particular, only 78% of recipients produce protective levels of anti-type B antibodies following administration of the primary series). Second, immunization is painful (deep subcutaneous inoculation is required for administration), with adverse reactions being common (moderate to severe local reactions occur in approximately 6% of recipients upon initial injection; this number rises to approximately 11% of individuals who receive booster injections) [Informational Brochure for the Pentavalent (ABCDE) Botulinum Toxoid, Centers for Disease Control].
Third, preparation of the vaccine is dangerous as active toxin must be handled by laboratory workers.
What are needed are safe and effective vaccine preparations for administration to those at risk of exposure to C. botulinum toxins.
The present invention contemplates, in a non-limiting embodiment, a preparation comprising at least one polymer and at least one Clostridium antigen or toxin (or fragment thereof) such as those selected from a species set forth in Table 3. The present invention contemplates, in one embodiment, such an antigen or toxin (or fragment thereof) in a preparation suitable for transdermal, intradermal, or transmuscosal delivery. In a preferred embodiment, the species is C.
botulinum. In one embodiment, the antigen or toxin (or fragment thereof) is in a hydrogel formulation. In one embodiment, the antigen or toxin (or fragment thereof) is attached or linked to a carrier. In one embodiment, the antigen or toxin (or fragment thereof) is part of a fusion protein. In one embodiment, the antigen or toxin (or fragment thereof) is in a micelle formulation. In one embodiment, the antigen or toxin (or fragment thereof) is in or on nanofibers, nanotubes, nanospheres, or nanocapsules. In one embodiment, the antigen or toxin (or fragment thereof) is complexed with one or more dendrimers. In one embodiment, the antigen or toxin (or fragment thereof) is in a liposome preparation (e.g. for liposome delivery). In a preferred embodiment, the antigen or toxin (or fragment thereof) is on the surface of a substrate, e.g.
on a skin patch, microneedle array, or the like. Combinations of the above are specifically contemplated, including but not limited to, substrates comprising the Clostridium antigen(s) or toxin(s) (or fragment(s) thereof) in a polymer formulation, or in an assembly of nanofibers. In a particularly preferred embodiment, the toxin is functionally impaired (e.g. it will not cause toxicity).
In one embodiment, the Clostridium antigen or toxin (or fragment thereof) is in a hydrogel formulation. It is not intended that the present invention be limited by the nature of the hydrogel since a variety of types can be used, including but not limited to ionically cross-linked hydrogels or hydrogel films. It is contemplated that the hydrogel/antigen(s) or hydrogel/toxin(s) preparation can be deposited on a surface (in a uniform or non-uniform manner). In one embodiment, the preparation is deposited (e.g. by dipping, coating, spin coating, spraying, or by suitable applicator) on an may of microprojections or microneedles for transdermal, intradermal or transmucosal delivery of the antigen(s). In one embodiment, the present invention contemplates a method comprising: a) providing i) a preparation comprising one or more Clostridium antigens or toxins (or fragments thereof) in a hydrogel formulation and ii) a subject, wherein said subject is a human or non-human animal; and b) contacting said subject with said preparation (e.g.
under conditions such that said subject generates an immune response to said one or more antigens or toxins).
When polymers are used, it is not intended that the present invention be limited by the nature of the polymer since a variety of types can be used (see Table 1). In one embodiment, the polymer comprises polyvinylpyrrolidone or hydroxy-propylcellulose. In one embodiment, the polymer comprises hydroxyethylcel lulose.
It is not intended that the present invention be limited to the manner in which the preparation of polymer and antigen (or toxin) is prepared. However, in a preferred embodiment, the preparation is electrospun to create fibers or fiber mats. It is preferred that at least a portion of the antigen (or toxin) in the electrospun fibers or mats be capable of release or escape from the polymer (e.g. upon contact with an aqueous or semi-aqueous environment). In certain embodiments (e.g. cosmetic), it is desired that the toxin be functional. In other embodiments (e.g. vaccines), it is not necessary that the toxin be functional (e.g. mutants and chemically treated toxins can be used).
In a preferred embodiment, the toxin polypeptides comprise one or more Clostridium botulinum neurotoxins. The invention contemplates the use of polypeptides derived from C.
botulinum toxin as immunogens for the production of vaccines and antitoxins, as well as for cosmetic purposes. The C. botulinum vaccines and antitoxins find use in humans and other animals.
In one embodiment, the present invention contemplates a fusion protein comprising a non-toxin protein sequence and a portion of the Clostridium botulinum type A toxin. In one embodiment, the C. botulinum type A toxin sequences comprise a portion of the sequence shown in Figure 16. In another embodiment, the C. botulinum type A toxin sequences comprise a portion of the sequence shown in Figure 17. It is not intended that the present invention be limited by the nature of the fusion protein. For example, the fusion protein may comprise the Clostridium botulinum type A
toxin sequence as shown in Figure 17 along with a poly-histidine tract. The toxins are conveniently made in host cells containing a recombinant expression vector, wherein the vector encodes a fusion protein comprising a non-toxin protein sequence and a portion of the Clostridium botulinum type A
toxin sequence shown in Figure 16. In this embodiment, the host cell is capable of expressing the encoded Clostridium botulinum type A toxin protein as a soluble protein at a level greater than or equal to 0.25% to 10% of the total cellular protein and preferably at a level greater than or equal to 0.75% of the total cellular protein. It is not intended that the present invention be limited by the nature of the fusion protein expressed by the recombinant vector in the host cell. For example, the fusion protein may comprise the Clostridium botulinum type A toxin sequence as set forth shown in Figure 17, along with a poly-histidine tract.
Regardless of whether a wild-type, mutant, or toxin fusion proteins are used, the present invention contemplates administering one or more of the various embodiments of the preparations described above as a vaccine to humans and animals, or as a cosmetic. In one embodiment, the present invention contemplates a vaccine-related method comprising: a) providing i) a preparation comprising at least one polymer and one or more C. botulinum toxins and ii) a subject, wherein said subject is a human or non-human animal; and b) contacting said subject with said preparation (e.g.
under conditions such that said subject generates an immune response to said one or more antigens).
In a preferred embodiment, the toxin is electrospun with one or more polymers such as those described herein so as to create an electrospun preparation. As discussed below, in a preferred embodiment, the electrospun preparation is part of a vaccine delivery system or a cosmetic.
The present invention further contemplates, in one embodiment, a vaccine delivery system comprising a) a substrate such as described herein comprising asperities such as those described herein, such as microprojections or microneedles, and an embodiment of the various preparations (mentioned above) comprising polymer and toxin. In a preferred embodiment, the asperities, such as microprojections or microneedles have dimensions such that they penetrate into the stratum corneum, the epidermal layer, and, in some embodiments, the dermal layer. In one embodiment, the microprojections or microneedles have a length (or height) or less than 1000 microns, more preferably less than 500 microns, and still more preferably less than 250 microns. The microprojections may be formed in different shapes, such as needles, blades, pins, punches, and combinations thereof. When in an array, the density of the microprojections is at least 10 microprojections/cm2, more preferably, at least 200 microprojections/cm2, and, in some embodiments, at least 1000 microprojections/cm2. The microneedles may be hollow or solid.
It is not intended that the present invention be limited by the nature of the substrate comprising said microneedles. In one embodiment, the microneedles are formulated out of polymer.
In one embodiment, the microneedles are formulated (at least in part) out of a polymer/antigen(s) or polymer/toxin(s) preparation. In another embodiment, the microneedles are made with a mold. In a preferred embodiment, the microneedles are etched out of a silicon substrate.
In a preferred embodiment, said silicon microneedles are solid and an electrospun polymer/antigen(s) preparation is deposited on said microneedles.
Thus, the present invention contemplates novel conjugates, formulations, delivery devices, methods of conjugation, methods of formulation, and methods of delivery. In one embodiment, the present invention contemplates a method of creating a formulation: providing i) at least one fiber-forming material, and ii) a preparation comprising at least one Clostridium toxin; mixing said fiber-forming material with said preparation so as to create a mixture; and electrospinning said mixture to create an electrospun formulation. In one embodiment, the method further comprises: depositing at least a portion of said electrospun material onto at least a portion of a substrate to create a treated substrate (e.g. microneedles, including but not limited to etched solid microneedles). The present invention also contemplates, as a device, the treated substrate prepared according to the above-described method. In one embodiment, said fiber-forming material comprises hydroxypropylcellulose, while in another embodiment said fiber-forming material comprises PVP.
In one embodiment, said preparation comprises first and second Clostridium toxins. In one embodiment, said first toxin comprises at least a portion of a C. difficile toxin and said second toxin comprises at least a portion of C. botulinum toxin. In one embodiment, said first and second toxin are part of a fusion protein.
In one embodiment, the present invention contemplates a method of creating a toxin delivery device: providing i) at least one fiber-forming material, ii) a preparation comprising at least one Clostridium toxin, and iii) a substrate comprising a plurality microprojections; mixing said fiber-forming material with said preparation so as to create a mixture;
electrospinning said mixture to create an electrospun material; and depositing at least a portion of said electrospun material onto at least a portion of said substrate, so as to create a toxin delivery device. In one embodiment, said Clostridium toxin is a C. botulinum toxin. The present invention also contemplates, as a device, the treated substrate prepared according to the above-described method. In one embodiment, said fiber-forming material comprises hydroxypropylcellulose, while in another embodiment said fiber-forming material comprises PVP.
The present invention, as mentioned above, also contemplates methods of administering antigens and vaccines. In one embodiment, the present invention contemplates a method of administering antigen, comprising: providing: a subject and the toxin delivery device described above; and contacting said subject with said antigen delivery device under conditions such at least a portion of said antigen is released from said device. In one embodiment, said contacting of step b) comprises piercing the subject's skin with said microprojections.
The present invention also contemplates, in one embodiment, a toxin delivery device comprising: a substrate having a back surface and a front surface; a plurality of solid microneedles extending upwards from the front surface of the substrate, the microneedles comprising a formulation, said formulation comprising at least one polymer and at least one Clostridium toxin (e.g. a C. botulinum toxin).
As used herein, the term "fusion protein" refers to a chimeric protein containing the protein of interest (i.e., C. botulinum toxin A or B and fragments thereof) joined to an exogenous protein fragment (the fusion partner which consists of a non-toxin protein). The fusion partner may enhance solubility of the C. botulinum protein as expressed in a host cell, may provide an affinity tag to allow purification of the recombinant fusion protein from the host cell or culture supernatant, or both. If desired, the fusion protein may be removed from the protein of interest (i.e., toxin protein or fragments thereof) prior to immunization by a variety of enzymatic or chemical means known to the art.
As used herein, the term "poly-histidine tract" when used in reference to a fusion protein refers to the presence of two to ten histidine residues at either the amino-or carboxy-terminus of a protein of interest. A poly-histidine tract of six to ten residues is preferred. The poly-histidine tract is also defined functionally as being a number of consecutive histidine residues added to the protein of interest which allows the affinity purification of the resulting fusion protein on a nickel-chelate column.
The botulinal neurotoxin is synthesized as a single polypeptide chain which is processed into a heavy (H) and a light (L) chain; these two chains are held together via disulfide bonds in the active toxin [B.R. DasGupta and H. Sugiyama, Biochem. Biophys. Res. Commun. 48:108 (1972);
reviewed in B.R. DasGupta, J. Physiol. 84:220 (1990) and H. Sugiyama, Microbiol. Rev. 44:419 (1980)]. Antisera raised against purified preparations of isolated H and L
chains have been shown to protect mice against the lethal effects of the toxin; however, the effectiveness of the two antisera differ with the anti-H sera being more potent (H. Sugiyama, supra).
While the different botulinal toxins show structural similarity to one another, the different serotypes are reported to be immunologically distinct (i.e., sera raised against one toxin type does not cross-react to a significant degree with other types). Thus, the generation of multivalent vaccines may require the use of more than one type of toxin. Purification methods have been reported for native toxin types A, B, C, D, E, and F [reviewed in G. Sakaguchi, Pharmac.
Ther. 19:165 (1983)].
As the different botulinal toxins are structurally related, the invention contemplates polymer/toxin formulations with any of the botulinal toxins (e.g., types A-30 F) as soluble recombinant fusion proteins, and in particular electrospun formulations. In one preferred embodiment, toxins A and B of C. difficile are contemplated as immunogens (either separately or together). In one embodiment, recombinant C. botulinum toxin proteins are used as antigens in mono- and multivalent vaccine preparations. For example, soluble, substantially endotoxin-free recombinant C. botulinum type A toxin proteins may be used alone or in conjunction with either recombinant or native toxins or toxoids from C. botulinum, C. difficile and C.
tetani as antigens for the preparation of these mono- and multivalent vaccines. It is contemplated that, due to the structural similarity of C. botulinum and C. tetani toxin proteins, a vaccine comprising C. difficile and botulinum toxin proteins (native or recombinant or a mixture thereof) be used to stimulate an immune response against C. botulinum, C. tetani and C. difficile.
The adverse consequences of exposure to botulinal toxin would be avoided by immunization of subjects at risk of exposure to the toxin with nontoxic preparations which confer immunity such as chemically or genetically detoxified toxin. In general, chemical detoxification of bacterial toxins using agents such as formaldehyde, glutaraldehyde or hydrogen peroxide can be used for the generation of vaccines or antitoxins. A delicate balance must be struck between too much and too little chemical modification. If the treatment is insufficient, the vaccine may retain residual toxicity.
If the treatment is too excessive, the vaccine may lose potency due to destruction of native immunogenic determinants.
Vaccines which confer immunity against one or more of the toxin types A, B, E
and F would be useful as a means of protecting humans from the deleterious effects of those C. botulinum toxins known to affect man. Vaccines which confer immunity against one or more of the toxin types C, D
and E would be useful for veterinary applications.
The C fragment of the C. botulinum type A neurotoxin heavy chain has been evaluated as a vaccine candidate. The C. botulinum type A neurotoxin gene has been cloned and sequenced [D.E.
Thompson et al., Eur. J. Biochem. 189:73 (1990)]. The C fragment of the type A
toxin was expressed as either a fusion protein comprising the botulinal C fragment fused with the maltose binding protein (MBP) or as a native protein [H.F. LaPenotiere et al., supra].
The plasmid construct encoding the native protein was reported to be unstable, while the fusion protein was expressed in inclusion bodies as insoluble protein. Immunization of mice with crudely purified MBP fusion protein resulted in protection against IP challenge with 3 LD50 doses of toxin [LaPenotiere et al., supra]. However, this recombinant C. botulinum type A toxin C fragment/MBP
fusion protein is not a suitable immunogen for the production of vaccines as it is expressed as an insoluble protein in E.
coli. Furthermore, this recombinant C. botulinum type A toxin C fragment/MBP
fusion protein was not shown to be substantially free of endotoxin contamination. Experience with recombinant C.
botulinum type A toxin C fragment/MBP fusion proteins shows that the presence of the MBP on the fusion protein greatly complicates the removal of endotoxin from preparations of the recombinant fusion protein.
Inclusion body protein must be solubilized prior to purification and/or administration to a host. The harsh treatment of inclusion body protein needed to accomplish this solubilization may reduce the immunogenicity of the purified protein. Ideally, recombinant proteins to be used as vaccines are expressed as soluble proteins at high levels (i.e., greater than or equal to about 0.75% of total cellular protein) in E. coli or other host cells. This facilitates the production and isolation of sufficient quantities of the immunogen in a highly purified form (i.e., substantially free of endotoxin or other pyrogen contamination). The ability to express recombinant toxin proteins as soluble proteins in E. coli is advantageous due to the low cost of growth compared to insect or mammalian tissue culture cells.
In one embodiment, the vaccine comprises the C fragment of the C. botulinum type A toxin and a poly-histidine tract (also called a histidine tag). In a particularly preferred embodiment, a fusion protein comprising the histidine tagged C fragment (expressed using the pET series of expression vectors (Novagen)) is employed in one of the polymer/toxin formulations of the present invention, and in particular an electrospun formulation. The pET expression system utilizes a vector containing the T7 promoter which encodes the fusion protein and a host cell which can be induced to express the T7 DNA polymerase (i.e., a DE3 host strain). The production of C fragment fusion proteins containing a histidine tract is not limited to the use of a particular expression vector and host strain. Several commercially available expression vectors and host strains can be used to express the C fragment protein sequences as a fusion protein containing a histidine tract (For example, the pQE series (pQE-8, 12, 16, 17, 18, 30, 31, 32, 40, 41, 42, 50, 51, 52, 60 and 70) of expression vectors (Qiagen) which are used with the host strains M15[pREP4]
(Qiagen) and SG13009[pREP4] (Qiagen) can be used to express fusion proteins containing six histidine residues at the amino-terminus of the fusion protein).
When recombinant clostridial toxin proteins produced in gram-negative bacteria (e.g., E.
coli) are used as vaccines, they are purified to remove endotoxin prior to administration to a host animal. In order to vaccinate a host, an immunogenicallyeffective amount of purified substantially endotoxin-free recombinant clostridial toxin protein is administered in any of a number of physiologically acceptable carriers known to the art. When administered for the purpose of vaccination, the purified substantially endotoxin-free recombinant clostridial toxin protein may be used alone or in conjunction with known adjutants, including potassium alum, aluminum phosphate, aluminum hydroxide, Gerbu adjuvant (GmDP; C.C. Biotech Corp.), RMI adjuvant (MPL; RJBI
Immunochemical research, Inc.), QS21 (Cambridge Biotech). The alum and aluminum-based adjutants are particularly preferred when vaccines are to be administered to humans.
A variety of routes of immunization may be used, such as nasal, oral, intramuscular, intra-peritoneal, etc. However, it is preferred that immunization be through the skin (e.g. subcutaneous, or more preferably transdermally, intradermally or transmucosally using asperities such as microprojections or microneedles, as discussed herein).
In one embodiment, the present invention contemplates using Clostridium antigen(s) and/or toxin(s) in polymer formulations for vaccines and cosmetics. In a preferred embodiment, such antigens and toxins are electrospun with one or more polymers or hydrogels, such as those discussed herein.
In a preferred embodiment, the preparation comprising Clostridium antigen(s) or toxin(s) is capable, after electrospinning, of acting as an antigen by eliciting an immune response in a human or animal. It is envisioned that in such an embodiment, a medically acceptable fiber-forming material may be used to preserve the antigen for later rehydration and use as a vaccine. In general, rehydration of the fiber of the present invention may be accomplished by mixing the fiber with a solvent for the fiber-forming material. When the fiber is used to preserve an antigen for use in a vaccine, the solvent will optimally be a medically acceptable compound.
It is not intended that the present invention be limited to the method by which the electrospun antigen(s) or toxin(s) is administered. The resulting vaccine may be injected or an ingested vaccine. However, in a preferred embodiment, the vaccine is administered at or in the skin.
In a particularly preferred embodiment, the electrospun polymer/ antigen(s) material is delivered on microneedles or on a patch such that antigen(s) is released into the skin.
In one non-limiting embodiment, the toxin may be contained in an ionically cross-linked macromolecular assembly, such as those hereinabove described, including but not limited to hydrogels, such as those hereinabove described.
In one embodiment, the present invention contemplates a method of administering one or more antigens such as the toxins hereinabove described, to a patient comprising the steps of penetrating at least an outer layer of the skin of the patient with one or more microneedles extending from a front surface of a substrate, at least one of the one or more microneedles (or portion thereof) contacted or coated (uniformly or non-uniformly) by an antigen preparation (discussed above), and releasing at least one of the one or more antigens into the patient.
One use of microneedle vehicle for delivery of the polymer/toxin(s) preparations described above involves cosmetic applications, and in particular, facial cosmetic applications. The administration of an appropriate dose of, for example, botulinum toxin, to attenuate tone of muscles about the eyes and forehead can in many cases remove wrinkles characteric of aging in skin overlying the muscle while inducing only mild, often acceptable muscle weakness. Such chemodenervating agents also may be used to induce cosmetic improvement in hemifacial paralysis by intentionally inducing partial paralysis in the contralateral side of the face thereby to improve bilateral facial symmetry.
Administration of low doses of the agents into muscles activating the jaw can retard tooth wear caused by involuntary or unconscious clenching of the teeth.
Examples of direct effects are the treatment of unwanted involuntary pathologic muscle stimulation, i.e., spasm, rigidity, or hyperstimulation, by direct administration throughout, or in the area of innervation of, the affected muscle or muscles. Thus, diseases involving muscle spasticity in general can be treated, typically without regard for its cause. The drug may be used to alleviate overstimulation, rigidity, or spasticity in muscle or muscle groups caused by stroke, cerebral palsey, multiple sclerosis, unilateral or bilateral parkinsonism, and other diseases characterized by spasmodic or continuous muscle hyperstimulation.
Accordingly, it is an object of the invention to provide a novel method of standardizing chemodenervating neurotoxin-derived pharmaceuticals such as botulinumderived pharmaceuticals by using microneedle administration. Another object is to standardize botulinum toxin preparations with respect to their zone of denervation when administered in vivo. Another object is to provide novel (lower) dosage forms of such agents. Yet another object is to provide novel therapies for muscle spasticity andlor hyperactivation heretofore untreatable or treatable only imperfectly with systemic drugs or surgery.
While many such neurotoxins are known, the currently most promising reagents of this type are the family of toxins derived from Clostridium botulinum, and the most preferred is pharmaceutical grade botulinum toxin Type A available commercially from Allergan Pharmaceuticals, Inc. under the tradename OCULINUM. The therapetic effects are achieved at dosage levels in the range between a few I.U. to 500 to 1000 I.U., preferably no more than 500 I.U., and most preferably no more than 300 I.U., and still most preferably between 50 I.U. and 200 I.U., administered on a microneedle array about a muscle or muscle group. The dimensions of the microneedle array control the zone of destruction of a subset of the neuromuscular junctions innervating the muscle, leaving others in a functional state.
Facial expression lines such as the transverse forehead lines or the nasolabial fold are created by attachments of projections of facial muscles into the dermis. Contraction of facial muscles generally is well known to produce the various characteristic forms of facial expressions such as smiling, grimacing, etc. In addition, exaggeration of facial lines also is associated with the aging process. The general principle of the application of the toxin is to limit the tonic contractile state of facial muscles so as to reduce muscle tone and to improve or change the quality and characteristics of facial expression.
The transverse forehead lines may be reduced in intensity by administering a quantity of toxin with a diffusion field of approximately 5 to 10 mms at the superior border of the forehead and at a point approximately 15 mms superior to the brow. This can be done symmetrically on both sides of the forehead. The glabellar lines (the frowning lines in the mid position of the forehead) may be targeted by treated the glabellar muscles with a toxin quantity producing a field of denervation of 5 to 10 mms The toxin is administered 15 mms. above the brow line in the mid position of the forehead. The nasal labial fold lines can be diminished in their intensity by treating the zygomatic major and minor muscles which emanate from the zygomatic arch and extend diagonally to the position of the nasal labial fold.
Thus, in one embodiment, the present invention contemplates a method of cosmetically decreasing facial wrinkling in a subject, the method comprising: providing i) a subject, and ii) a microneedle array comprising a chemodenervating pharmaceutical in a polymer formulation; and placing said microneedle array on the skin of said subject under conditions whereby said wrinkling is reduced. In a preferred embodiment said denervating pharmaceutical comprises a neurotoxin derived from Clostridium botulinum. In a particularly preferred embodiment, said neurotoxin is in the form of a fusion protein. In one embodiment, said chemodenervating agent is Acetyl hexapeptide-3 (trade name Argireline). Argireline is manufactured by a Spanish company Lipotec and is a hexapeptide (a chain of 6 amino acids) attached to the acetic acid residue. It is believed to work by inhibiting the release of neurotransmitters. When applied to the skin, Argireline relaxes facial tension leading to the reduction in facial lines and wrinkles with regular use.
In a further embodiment, the present invention contemplates a method of decreasing sweating (e.g. excessive sweating of the underarms, palms, feet, etc.) of a subject, the method comprising: providing i) a subject, and ii) a microneedle array comprising a chemodenervating pharmaceutical in a polymer formulation; and placing said microneedle array on the skin of said subject under conditions whereby said sweating is reduced. In a preferred embodiment said denervating pharmaceutical comprises a neurotoxin derived from Clostridium botulinum. In a particularly preferred embodiment, said neurotoxin is in the form of a fusion protein.
Alternatively, the present invention contemplates, in one embodiment, that alpha-Bungarotoxin molecules can be used in the manner of botulinum toxin A. In one embodiment, native alpha-Bungarotoxin is employed. As used herein, "native"
alphabungarotoxin molecules are those found in the venom of Bungarus multicinctus. The complete amino acid sequence of native alpha-bungarotoxin molecules and the DNA sequences that encode them have been published (see, e.g., GenBank accession numbers X91990, AF056400-AF056417, AJ131356, Y17057, Y17058, Y 17693, Y 17694). In one embodiment, the native sequence is IVCHTTATSPISAVTCPPGENLCYRKMWCD-AFCSSRGKV VELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG.
In a preferred embodiment, modified alpha-bungarotoxin molecules that have altered binding specificities are employed. In particular, modification of residues 38 (Lys) and 42 (Leu) to Pro and Gln, respectively, altered the binding specificity of alphabungarotoxin from alpha7-containing nicotinic acetylcholine receptors to alpha3beta.2-containing nicotinic acetylcholine receptors.
.59 Additional modifications to these amino acid residues and other amino acid residues are possible.
In another non-limiting embodiment, the at least one biologically active agent is an anthrax antigen. Anthrax is an acute infectious disease caused by the bacterium B.
anthracis. It occurs in wild and domestic lower vertebrates (cattle, sheep, goats, etc.), but can also occur in humans (e.g. do to exposure to infected animals or because of bioterrorism). The virulence of B. anthracis is dependent on Anthrax Toxin and the capsule, a polymer of gamma-D-glutamic acid. Anthrax Toxin (AT) consists of two enzymatic moieties, edema factor (EF) and lethal factor (LF), and a single receptor-binding moiety, protective antigen (PA).
The capsule is a poor immunogen. Wild-type PA (the amino acid sequence of which is shown in Figure 18) is also a poor immunogen. Indeed, the currently licensed human anthrax vaccine (AVA, BioPort Corporation, Lansing Mich.) requires six vaccinations over eighteen months followed by yearly boosters to induce and maintain protective anti-PA titers (Pittman et al., Vaccine 20:1412-20, 2002; Pittman et al., Vaccine 20:972-78, 2001). In some vaccines, this regimen is associated with undesirable side effects (Pittman et al., Vaccine 20:972-78, 2001). Thus, there is a need for an effective and safe vaccine that would require fewer doses to confer immunity to anthrax.
The present invention, in a non-limiting embodiment, an anthrax antigen (or fragment thereof) in a preparation suitable for transdermal, intra-epidermal, intradermal or intramucosal delivery. In another embodiment, antigen from Y. pestis or F. tularensis is contemplated in a preparation suitable for transdermal delivery. In a preferred embodiment, the present invention contemplates mutant anthrax protective antigen (e.g. the mutant antigens set forth in Table 4 below, or fragment thereof) in a preparation suitable for transdermal delivery.
Table 4. amino acid residues at which Cys substitutions inhibited PA acrivity by at least 100-fold.
Residues Domain 1 1210, K225, T240, K245 2 S337, G342, W346, T357, I364, P379, T380, S382, T390, T393, K397, N399, Y411, I419, A420, N422, F427, S248, D451, D453, V455, N458 4 1656, N657, I665, D683, L687 In one embodiment, the mutant protective antigen (or fragment thereof) is attached or linked to a carrier. In one embodiment, the mutant protective antigen (or fragment thereof) is part of a fusion protein. In one embodiment, the mutant protective antigen (or fragment thereof) is in a micelle formulation. In one embodiment, the mutant protective antigen (or fragment thereof) is in or on nanofibers, nanotubes, nanospheres, or nanocapsules. In one embodiment, the mutant protective antigen (or fragment thereof) is complexed with one or more dendrimers. In one embodiment, the mutant protective antigen (or fragment thereof) is in a liposome preparation (e.g. for liposome delivery). In a preferred embodiment, the mutant protective antigen (or fragment thereof) is on the surface of a substrate, e.g. on a skin patch, such as an array, of asperities such as those described herein, such as microprojections or microneedles or the like. Combinations of the above are contemplated specifically, including but not limited to substrates comprising the mutant protective antigen (or fragment thereof) in a polymer formulation, or in an assembly of nanofibers. In a particularly preferred embodiment, the mutant is functionally impaired (e.g.
it will not form pores or channels, or will otherwise not cause toxicity).
The present invention contemplates, in one embodiment, a preparation suitable for transdermal, intradermal, intra-epidermal, transmucosal, subcutaneous, intravenous, or intramuscular delivery comprising a first anthrax antigen (or fragment thereof) in a mixture with a second anthrax antigen (or fragment thereof). The present invention contemplates, in one embodiment, a preparation suitable for transdermal, transmucosal, subcutaneous, intravenous, or intramuscular delivery comprising a first anthrax antigen (or fragment thereof) conjugated to a second anthrax antigen (or fragment thereof). These first and second antigens (or fragments thereof) can be prepared simply as a mixture or, alternatively, they can be linked together in a conjugate. In one embodiment, the first and second antigens (or fragments thereof) are in a micelle formulation. In one embodiment, the first and second antigens (or fragments thereof) are in or on nanofibers, nanotubes, nanospheres, or nanocapsules. In one embodiment, the first and second antigens (or fragments thereof) are complexed with one or more dendrimers. In one embodiment, the first and second antigens (or fragments thereof) are in a liposome preparation (e.g. for liposome delivery). In a preferred embodiment, the first and second antigens (or fragments thereof) are on the surface of a substrate, e.g. on a skin patch, microneedle array, or the like. Combinations of the above are specifically contemplated, including but not limited to substrates comprising the first and second antigens (or fragments thereof) in a polymer formulation, or in an assembly of nanofibers. While edema factor and/or lethal factor (or fragments thereof) can be used as first and second antigens, in a preferred embodiment, said first and second antigens comprises (respectively) poly-glutamic acid and protective antigen (or fragment thereof). The present invention contemplates, in one embodiment, a preparation suitable for transdermal delivery comprising wild-type protective antigen or mutant protective antigen (e.g. the mutant antigens set forth in Table 4) conjugated to poly-glutamic acid. In a preferred embodiment, the present invention contemplates an array of microprojections or microneedles comprising anthrax antigen(s) selected from the group consisting of wild-type protective antigen (or fragment thereof), mutant protective antigen (or fragment thereof), a conjugate of wild-type protective antigen (or fragment thereof) and poly-glutamic acid, and a conjugate of mutant protective antigen (or fragment thereof) and poly-glutamic acid. In a particularly preferred embodiment, the mutant is functionally impaired (e.g.
it will not form pores or channels, or will otherwise not cause toxicity). In a preferred embodiment, the microprojections or microneedles have dimensions such that they penetrate into the stratum comeum, the epidermal layer, and, in some embodiments, the dermal layer. In one embodiment, the microprojections or microneedles have a length (or height) or less than 1000 microns, more preferably less than 500 microns, and still more preferably less than 250 microns. The microprojections may be formed in different shapes, such as needles, blades, pins, punches, and combinations thereof. When in an array, the density of the microprojections is at least microprojections/cm2, more preferably, at least 200 microprojections/cm2, and, in some embodiments, at least 1000 microprojections/cmz.
The present invention further contemplates, in one embodiment, a preparation comprising at least one polymer and at least one anthrax antigen (or fragment thereof). In another embodiment, antigen from Y. pestis or F. tularensis is contemplated in such a polymer preparation. It is not intended that the present invention be limited by the nature of the polymer since a variety of types can be used (see Table 1). In one embodiment, cross-linked polymers are employed. However, in a preferred embodiment, the polymer comprises polyvinylpyrrolidone or hydroxypropylcellulose. It is not intended that the present invention be limited by the nature of the antigen(s) in the polymer preparation. While anthrax edema factor and/or lethal factor (or fragments thereof) can be use, in one embodiment, the antigen(s) is/are selected from the group consisting of wild-type anthrax protective antigen (or fragment thereof), mutant protective antigen (or fragment thereof), a conjugate of wild-type protective antigen (or fragment thereof) and poly-glutamic acid, and a conjugate of mutant protective antigen (or fragment thereof) and poly-glutamic acid. In a particularly preferred embodiment, the mutant is functionally impaired (e.g.
it will not form pores or channels, or will otherwise not cause toxicity). It is contemplated that the polymer/antigen(s) preparation can be administered by a variety of routes (e.g. IP, IM, IV, inhalation, transdermal, intradermal, intra-epidermal, transmucosal, subcutaneous, etc.) It is not intended that the present invention be limited to the manner in which the preparation of polymer and antigen(s) is prepared. However, in one embodiment, the preparation is electrospun to create fibers or fiber mats. It is preferred that at least a portion of the antigen in the electrospun fibers or mats be capable of release or escape from the polymer (e.g. upon contact with an aqueous or semi-aqueous environment).
While edema factor and/or lethal factor can be used as antigens, in one embodiment, said antigen in said polymer preparation comprises poly-glutamic acid and protective antigen (or fragment thereof). These antigens can be prepared simply as a mixture.
However, in a preferred embodiment, the antigen comprises a conjugate of poly-glutamic acid and protective antigen (or fragment thereof). In one embodiment, the conjugate is prepared by covalently linking poly-glutamic acid to protective antigen (or fragment thereof). In one embodiment, the protective antigen (or fragment thereof) is wild-type. In a preferred embodiment, the protective antigen (or fragment thereof) is a mutant. In a particularly preferred embodiment, the mutant is functionally impaired (e.g. it will not form pores or channels, or will otherwise not cause toxicity).
It is not intended that the present invention be limited to a particular mutant. A variety of mutants have been described that are functionally impaired. For example, U.S.
Patent No.
7,037,503 (hereby incorporated by reference) to Collier et al. describes a group of dominant negative mutants having point mutations at positions 397 and/or 425 of the PA
protein (see Figure 18 for the wild-type sequence of the PA protein). In addition, Mourez et al.
(PNAS 100:13803 2003) describe 568 mutants, thirty-three of which demonstrate reduced ability to mediate toxicity (see Table 4). The present invention contemplates various embodiments wherein one or more of such mutants are employed (whether conjugated or unconjugated).
It is not intended that the present invention be limited to the nature of the conjugates (when conjugates are used). U.S. Patent Application 20060134143 to Schneerson et al.
(hereby incorporated by reference) describes immunogenic conjugates of poly-gamma-glutamic acid (PGA) made using a variety of different PGA types (including but not limited to PGA
comprising D-glutamic acid and PGA comprising L-glutamic acid) extracted from culture supernatants of B.
anthracis. In one example, recombinant wild-type PA was derivatized with adipic acid dihydrazide and reacted. On the other hand, Aulinger et al. (Infection & Immunity 73:3408 2005) describes conjugating PA (or a PA mutant) to purified PGA via a carbodiimide reaction.
Poly-L-glutamic acid and poly-D-glutamic acid sodium salt are commercially available from Sigma-Aldrich (St. Louis).
Protective antigen and fragments thereof (i.e. the 63kDa and 20kDa fragments) are commercially available from List Biological Laboratories, Inc. When a fragment is used, it is preferred that the 63kDa fragment is used (or a mutant thereof).
The present invention further contemplates, in one embodiment, a preparation comprising at least one anthrax antigen (or fragment thereof) in a hydrogel formulation. In another embodiment, antigen from Y. pestis or F. tularensis is contemplated in such a preparation.
It is not intended that the present invention be limited by the nature of the hydrogel since a variety of types can be used, including but not limited to ionically cross-linked hydrogels or hydrogel films. It is not intended that the present invention be limited by the nature of the antigen(s) in the hydrogel preparation. While edema factor and/or lethal factor (or fragments thereof) can be use, in one embodiment, the antigen(s) is/are selected from the group consisting of wild-type protective antigen (or fragment thereof), mutant protective antigen (or fragment thereof), a conjugate of wild-type protective antigen (or fragment thereof) and poly-glutamic acid, and a conjugate of mutant protective antigen (or fragment thereof) and poly-glutamic acid. In a particularly preferred embodiment, the mutant is functionally impaired (e.g. it will not form pores or channels, or will otherwise not cause toxicity). It is contemplated that the hydrogel/antigen(s) preparation can be deposited on a surface (in a uniform or non-uniform manner). In one embodiment, the preparation is deposited (e.g.
by dipping, coating, spin coating, spraying, or by suitable applicator) on an array of microprojections or microneedles for transdermal or transmucosal delivery of the antigen(s).
Regardless of whether a mutant or wild-type is used, the present invention contemplates administering one or more of the various embodiments of the preparations described above as a vaccine to humans and animals. In one embodiment, the present invention contemplates a method comprising: a) providing i) a preparation comprising at least one polymer and one or more anthrax antigens (or fragments thereof) and ii) a subject, wherein said subject is a human or non-human animal; and b) contacting said subject with said preparation (e.g. under conditions such that said subject generates an immune response to said one or more antigens). In one embodiment, the present invention contemplates a method comprising: a) providing i) a preparation comprising one or more anthrax antigens (or fragments thereof) in a hydrogel formulation and ii) a subject, wherein said subject is a human or non-human animal; and b) contacting said subject with said preparation (e.g.
under conditions such that said subject generates an immune response to said one or more antigens).
In a preferred embodiment, a conjugate of two anthrax antigens is employed (as discussed above). In a preferred embodiment, the conjugate is electrospun with one or more polymers so as to create an electrospun preparation. As discussed below, in a preferred embodiment, the electrospun preparation is part of a vaccine delivery system. In a preferred embodiment, the electrospun preparation is delivered transdermally, intradermally, intra-epidermally, transmucosally, subcutaneously, IP, IV or IM.
The present invention further contemplates, in one embodiment, a vaccine delivery system comprising a) a substrate comprising microprojections or microneedles,and an embodiment of the various preparations (mentioned above) comprising either i) antigen(s) alone (or fragments thereof), ii) antigen(s) (or fragments thereof) and carrier alone, iii) polymer (or hydrogel) and antigen(s) (or fragments thereof), iv) conjugates of poly-glutamic acid and wild-type or mutant protective antigen (or fragment thereof), or v) iv) polymer (or hydrogel) and conjugates of poly-glutamic acid and wild-type or mutant protective antigen (or fragment thereof). When microneedles are used, they may be solid or hollow. It is not intended that the present invention be limited to the manner in which the microneedles are contacted with the preparation. In one embodiment, the microneedles are contacted only at the microneedle tips. In a preferred embodiment, the preparation contacts the entire substrate (or substantially the entire substrate) such that the preparation contacts even the spaces between an may of microneedles. It is not intended that the present invention be limited to uniform coatings of the preparation. In one embodiment, the preparation is present on the substrate in a non-uniform manner.
In one embodiment, a polymer/antigen(s) preparation is sprayed on said microneedles. In one embodiment, said microneedles are dipped into a preparation comprising at least one polymer and at least one anthrax antigen (or fragment thereof). In a preferred embodiment, an electrospun polymer/antigen(s) preparation is deposited on said microneedles. In another embodiment, antigen from Y. pestis or F. tularensis is contemplated in such an electrospun polymer/antigen(s) preparation and this preparation is deposited on said microneedles.
In one embodiment, the present invention contemplates using at least two different anthrax protective antigens (or fragments thereof). For example, in order to generate effective immunity against more virulent strains of Bacillus anthracis, such as Vollum 1 B, the Ames strain, two or more different sources of protective antigens (or fragments thereof) are contemplated in one embodiment, and mutants in another embodiment. Protective antigen from variants of such strains are also contemplated.
Thus, the present invention contemplates novel conjugates, formulations, delivery devices, methods of conjugation, methods of formulation, and methods of delivery. In one embodiment, the present invention contemplates a method of creating a formulation: providing i) at least one fiber-forming material, and ii) a preparation comprising at least one anthrax antigen; mixing said fiber-forming material with said preparation so as to create a mixture; and electrospinning said mixture to create electrospun formulation. In one embodiment, the method further comprises: depositing at least a portion of said electrospun material onto at least a portion of a substrate to create a treated substrate (e.g. a substrate comprising microneedles). The present invention also contemplates, as a device, the treated substrate prepared according to the above-described method. In one embodiment, said fiber-forming material comprises hydroxypropylcellulose, while in another embodiment said fiber-forming material comprises PVP. In one embodiment, said preparation comprises first and second anthrax antigens (e.g. said first anthrax antigen comprises poly-gamma-glutamic acid and said second anthrax antigen comprises protective antigen). In one embodiment, said protective antigen is wild-type, while in another embodiment, said protective antigen is mutant. In a preferred embodiment, said first and second antigens are linked to form a conjugate.
In one embodiment, the present invention contemplates a method of creating an antigen delivery device, comprising: providing i) at least one fiber-forming material, ii) a preparation comprising at least two anthrax antigens, and iii) a substrate comprising a plurality of microprojections; mixing said fiber-forming material with said preparation so as to create a mixture;
electrospinning said mixture to create electrospun material; and depositing at least a portion of said electrospun material onto at least a portion of said substrate, so as to create an antigen delivery device. In one embodiment, said two anthrax antigens comprises poly-gamma-glutamic acid and protective antigen (e.g. linked to form a conjugate). In one embodiment, said protective antigen is wild-type, while in another embodiment, said protective antigen is mutant. In one embodiment, said fiber-forming material comprises hydroxypropylcellulose, while in another embodiment said fiber-forming material comprises PVP. The present invention also contemplates, as a device, the antigen delivery device prepared according to the above-described method.
The present invention also contemplates, in one embodiment, a drug delivery device comprising: a substrate having a back surface and a front surface; a plurality of solid microneedles extending upwards from the front surface of the substrate, the microneedles comprising a formulation, said formulation comprising at least one polymer and at least one anthrax antigen (e.g.
a two antigen conjugate as described above).
Anthrax toxin is a member of the binary bacterial toxins, a subset of intracellularly acting toxins in which the enzymatic and receptor-binding moieties are secreted by the bacteria as discrete monomeric proteins. While an understanding of the mechanism of action of these toxins is not needed for the successful practice of the various embodiments of the present invention, it is believed these proteins assemble at the surface of receptor-bearing eukaryotic cells to form toxic hetero-oligomeric complexes. The complexes are internalized and delivered to an acidic compartment, where the receptor-binding moiety inserts into the membrane and mediates translocation of the enzymatic moiety to the cytosol. Within the cytosol, the enzymatic moiety modifies a molecular target, disrupting cell physiology and causing cytopathic effects.
Anthrax toxin consists of two enzymatic moieties, edema factor (EF; 89 kDa) and lethal factor (LF; 90 kDa), and a single receptor-binding moiety, protective antigen (PA; 83 kDa), named for its ability to elicit protective immunity. The amino acid sequence for wild-type PA is shown in Figure 18. The nucleic acid sequence encoding wild-type PA is shown in Figure 19. EF is a Ca 2+
and calmodulin-dependent adenylate cyclase, and LF is a ZnZ+ -dependent protease that cleaves mitogen-activated protein kinase kinases.
The crystallographic structure of intact PA has been solved and shows that the protein is organized into four domains. Domain 1, the N-terminal domain, contains the furin cleavage site and therefore encompasses PA20. That portion of domain 1 within PA63, termed domain F, contains two calcium atoms and participates in EF/LF binding and oligomerization. Domain 2 contains a flexible loop (2132-2133) that is believed to form the transmembrane region of the pore. While not limiting the invention in any manner by reference to proposed mechanisms, it is believed (based on ion conductance experiments on Cys-substitution mutants) that the 2132-2133 loops from the seven subunits of the prepore combine to form a transmembrane 14-strand 13 -barrel.
Domain 3 is believed to be involved in oligomerization, and domain 4, the C-terminal domain, contains the receptor-binding site. In addition to monomeric PA, the structure of a soluble form of the PA63 heptamer has been solved; it is believed to represent the conformation of the heptamer before pore formation and has been termed the prepore.
PA mutants have been described that block the intoxication process. There has been some interest in mutations that make the protein dominantly negative (DN), thereby converting it into a potent antitoxin. Without limiting the invention in any manner by reference to proposed mechanisms, it is believed that DN-PA co-oligomerizes with wild-type PA63 and inhibits its ability to form pores and mediate translocation. Point mutations at D425 and F427, a deletion or substitution of the 2132-2133 loop, or combinations of these mutations, have been shown to confer varying degrees of DN activity on PA. Interestingly, the conjugation of such a=DN mutant to PGA
has been reported to generate a much improved immune response (as compared to wild-type PA
alone or even wild-type PA conjugated to PGA). Aulinger et al. (Infection &
Immunity 73:3408 2005). In one embodiment, the present invention contemplates transdermal delivery of such conjugates, wherein said mutant comprises a substitution at K397, D425 or both. In a preferred embodiment, said mutant is selected from the group consisting of K397A, K397D, K397C, and K397Q. In another embodiment, said mutant is selected from the group consisting of D425A, D425N, D425E, and D425K. In another embodiment, said mutant is defined by a substitution at position F427 (including but not limited to F427A, F427D, and F427K). In one embodiment, the present invention contemplates transdermal delivery of such conjugates, wherein said mutant comprises a substitution at K397, D425 and F427. In one embodiment, the present invention contemplates transdermal delivery of such conjugates, wherein said mutant comprises a deletion or substitution of the 213z-2 133 loop.
The analysis of large arrays of PA mutants has recently become feasible, following identification of ways to obtain small-scale preparations of PA mutants and screen them rapidly and reliably for defects in PA functions. To search PA for additional DN sites, researchers at the University of Oklahoma developed a protocol to mutate each of the 568 amino acids of PA63 to Cys and characterize the resulting mutants. They restricted their study to PA63 because PA20 does not appear to play a role in intoxication besides preventing toxin assembly in solution. Cys-replacements were chosen because this amino acid is absent from PA and because the thiol-containing side chain is amenable to specific derivatization, facilitating structure-function studies.
These researchers first screened for mutations that a caused large (>100-fold) reduction in PA's ability to mediate toxicity (these mutations are listed in Table 4). Such mutations were identified in all four domains, but a majority were in domain 2. Mutations conferring the DN
phenotype were found exclusively within domain 2, in the 2136 strand, the 2137 strand, or the 21310-21311 loop.
Because DN mutants prevent the conformational transition of PA63 from the prepore to the pore state, they concluded that these structural elements play major roles in this change.
As noted above, in another embodiment, antigen from Y. pestis or F. tularensis is contemplated in a preparation suitable for transdermal delivery. It is not intended that the present invention be limited by the particular antigens from these organisms. However, in one embodiment, an Fl capsule antigen from Y. pestis is employed in a polymer formulation (e.g. electrospun formulation) deposited on a microneedle array. In another embodiment, the LcrV
protein (or fragment thereof) from Y. pestis is similarly employed. In a particular embodiment, these two antigens are used together (as a mixture, conjugate or fusion protein). In still another embodiment, one or more virulence-associated factors are employed, including but not limited to catalase-peroxidase (KatY), murine toxin (Ymt), plasminogen activator (Pla), and Fl capsule antigen (Can) from Y. pestis. In one embodiment, a specific sequence of the outer membrane protein encoded by the fopA gene of F. tularensis is employed.
In one embodiment, the present invention contemplates using new and previously identified PA mutants (or fragments thereof) in vaccines. In a preferred embodiment, such mutants are conjugated to PGA and electrospun with one or more polymers.
In a preferred embodiment, the preparation comprising anthrax antigen(s) is capable, after electrospinning, of acting as an antigen by eliciting an immune response in a human or animal. It is envisioned that in such an embodiment, a medically acceptable fiber-forming material may be used to preserve the antigen for later rehydration and use as a vaccine. In general, rehydration of the fiber of the present invention may be accomplished by mixing the fiber with a solvent for the fiber-forming material. When the fiber is used to preserve an antigen for use in a vaccine, the solvent will optimally be a medically acceptable compound.
It is not intended that the present invention be limited to the method by which the electrospun anthrax antigen(s) is administered. The resulting vaccine may be injected or an ingested vaccine. However, in a preferred embodiment, the vaccine is administered at or in the skin. In a particularly preferred embodiment, the electrospun polymer/anthrax antigen(s) material is delivered on microneedles or on a patch such that antigen(s) is released into the skin.
In one embodiment, the anthrax antiget(s) may be contained in an ionically cross-linked macromolecular assembly such as those hereinabove described, including a hydrogel, as described hereinabove.
In one embodiment, the present invention contemplates a method of administering one or more anthrax antigens to a patient comprising the steps of penetrating at least an outer layer of the skin of the patient with one or more microneedles extending from a front surface of a substrate, at least one of the one or more microneedles (or portion thereof) contacted or coated (uniformly or non-uniformly) by an anthrax antigen preparation (discussed above), and releasing at least one of the one or more anthrax antigens into the patient.
In another non-limiting embodiment, the at least one biologically active agent is a hormone.
Osteoporosis is a bone disorder characterized by progressive bone loss that predisposes an individual to an increased risk of fracture, typically in the hip, spine and wrist. The progressive bone loss, which typically begins between the ages of 40 and 50, is mainly asymptomatic until a bone fracture occurs, leading to a high degree of patient morbidity and mortality.
Eighty percent of those affected by osteoporosis are women and, based on recent studies, during the six years following the onset of menopause, women lose one third of their bone mass.
Parathyroid hormone (PTH) is a hormone secreted by the parathyroid gland that regulates the metabolism of calcium and phosphate in the body. PTH has stirred great interest in the treatment of osteoporosis for its ability to promote bone formation and, hence, dramatically reduced incidence of fractures. Large-scale clinical trials have shown that PTH effectively and safely reduces the percentage of vertebral and non-vertebral fractures in women with osteoporosis. PTH-based agents have also stirred interest in the treatment of bone fractures (in both men and women) by virtue of their ability to accelerate bone healing.
To this end, various stabilized formulations of PTH-based agents have been developed that can be reconstituted for subcutaneous injection, which, as discussed below, is the conventional means of delivery. Illustrative are the formulations disclosed in U.S. Pat.
No. 5,563,122 ("Stabilized Parathyroid Hormone Composition") and U.S. patent application Pub. No.
("Stabilized Teriparatide Solutions"), which are incorporated by reference herein in their entirety.
A currently approved injectable PTH-based agent is FORTEO (an rDNA derived teriparatide injection), which contains recombinant human parathyroid hormone (1-34), (rhPTH (1-34)).
FORTEOTM is typically prescribed for women with a history of osteoporotic fracture, who have multiple risk factors for fracture, or who have failed or are intolerant of previous osteoporosis therapy, based on a physician's assessment. In postmenopausal women with Osteoporosis, FORTEOTM has been found to increase bone mineral density (BMD) and reduce the risk of vertebral and non-vertebral fractures.
FORTEOTM has also been found to increase bone mass in men with primary or hypogonadal osteoporosis who are at high risk for fracture. These include men with a history of osteoporotic fracture, or who have multiple risk factors for fracture, or who have failed or are intolerant to previous osteoporosis therapy. In men with primary or hypogonadal osteoporosis, FORTEOTM has similarly been found to increase BMD.
Despite the efficacy of PTH in treating disorders such as osteoporosis, there are several drawbacks and disadvantages associated with the disclosed prior art methods of delivering PTH, particularly, via subcutaneous injection. A major drawback is that subcutaneous injection is a difficult and uncomfortable procedure, which often results in poor patient compliance.
What is needed is a more comfortable hormone delivery approach with good patient compliance.
The present invention contemplates, in one embodiment, a hormone, including but not limited to PTH (or a fragment thereof, such as the 1-34 fragment), in a preparation suitable for transdermal, intradermal, intra-epidermal or intramucosal delivery. In one embodiment, the hormone (or fragment thereof) is attached or linked to a carrier. In one embodiment, the hormone (or fragment thereof) is part of a fusion protein. In one embodiment, the hormone (or fragment thereof) is in a micelle formulation. In one embodiment, the hormone (or fragment thereof) is in or on nanofibers, nanotubes, nanospheres, or nanocapsules. In one embodiment, the hormone (or fragment thereof) is complexed with one or more dendrimers. In one embodiment, the hormone (or fragment thereof) is in a liposome preparation (e.g. for liposome delivery). In a preferred embodiment, the hormone (or fragment thereof) is on the surface of a substrate, e.g. on a skin patch, an array, of asperities such as those herein described, such as microprojections or microneedles, or the like.
Combinations of the above are contemplated specifically, including but not limited to substrates comprising the hormone (or fragment thereof) in a polymer formulation, or in an assembly of nanofibers. In a particularly preferred embodiment, the hormone is functional and not functionally impaired.
The present invention contemplates, in one embodiment, a preparation suitable for transdermal, intradermal, intra-epidermal, transmucosal, subcutaneous, intravenous, or intramuscular delivery comprising a first hormone (or fragment thereof) in a mixture with a second hormone (or fragment thereof). These first and second hormones (or fragments thereof) can be prepared simply as a mixture or, alternatively, they can be linked together in a conjugate. In one embodiment, the first and second hormones (or fragments thereof) are in a micelle formulation. In one embodiment, the first and second hormones (or fragments thereof) are in or on nanofibers, nanotubes, nanospheres, or nanocapsules. In one embodiment, the first and second hormones (or fragments thereof) are complexed with one or more dendrimers. In one embodiment, the first and second hormones (or fragments thereof) are in a liposome preparation (e.g. for liposome delivery).
In a preferred embodiment, the first and second hormones (or fragments thereof) are on the surface of a substrate, e.g. on a skin patch, microneedle array, or the like.
Combinations of the above are specifically contemplated, including but not limited to substrates comprising the first and second hormones (or fragments thereof) in a polymer formulation, or in an assembly of nanofibers. In a preferred embodiment, said first hormone is PTH (or the 1-34 fragment thereof) and the second hormone is calcitonin (e.g. human or salmon). In a preferred embodiment, the hormone(s) preparation is placed on microprojections or microneedles having dimensions such that they penetrate into the stratum corneum, the epidermal layer, and, in some embodiments, the dermal layer. In one embodiment, the microprojections or microneedles have a length (or height) or less than 1000 microns, more preferably less than 500 microns, and still more preferably less than 250 microns. The microprojections may be formed in different shapes, such as needles, blades, pins, punches, and combinations thereof. When in an array, the density of the microprojections is at least microprojections/cm2, more preferably, at least 200 microprojections/cmz, and, in some embodiments, at least 1000 microprojections/cm2.
The present invention further contemplates, in one embodiment, a preparation comprising at least one polymer and at least one hormone (or fragment thereof). It is not intended that the present invention be limited by the nature of the polymer since a variety of types can be used (see Table 1).
In one embodiment, cross-linked polymers are employed. However, in a preferred embodiment, the polymer comprises polyvinylpyrrolidone or hydroxypropylcellulose. In another embodiment, said polymer is hydroxyethylcellulose. It is not intended that the present invention be limited by the nature of the hormone(s) in the polymer preparation. However, in a particularly preferred embodiment, a functional PTH (or the 1-34 PTH fragment) is contemplated for use in the polymer formulation. Human and bovine sequences of 1-34 PTH are shown in Figure 20. It is contemplated that the polymer/hormone(s) preparation can be administered by a variety of routes (e.g. IP, IM, IV, inhalation, transdermal, intradermal, 'infra-epidermal, transmucosal, subcutaneous, etc.).
It is not intended that the present invention be limited to the manner in which the preparation of polymer and hormone(s) is prepared. However, in a preferred embodiment, the preparation is electrospun to create fibers or fiber mats. It is preferred that at least a portion of the hormone in the electrospun fibers or mats be capable of release or escape from the polymer (e.g. upon contact with an aqueous or semi-aqueous environment). In one embodiment, the electrospun polymer/hormone(s) fiber mat is placed directly on the skin. In another embodiment, the polymer/hormone(s) fiber mat is part of a delivery vehicle (e.g. skin patch, microneedle array, etc.).
The present invention further contemplates, in one embodiment, a preparation comprising at least one hormone (or fragment thereof) in a hydrogel formulation. It is not intended that the present invention be limited by the nature of the hydrogel since a variety of types can be used, including but not limited to ionically cross-linked hydrogels or hydrogel films. It is not intended that the present invention be limited by the nature of the hormone(s) in the hydrogel preparation. In a particularly preferred embodiment, the hormone comprises a functional PTH (or 1-34 fragment thereof). It is contemplated that the hydrogel/hormone(s) preparation can be deposited on a surface (in a uniform or non-uniform manner). In one embodiment, the preparation is deposited (e.g.
by dipping, coating, spin coating, spraying, or by suitable applicator) on an array of asperities such as microprojections or microneedles as described herein for transdermal, intradermal, intra-epidermal, or transmucosal delivery of the hormone(s).
Other systems and apparatus that employ tiny skin piercing elements to enhance transdermal agent delivery are disclosed in U.S. Pat. Nos. 5,879,326, 3,814,097, 5,250,023, 3,964,482, Reissue U.S. Pat. No. 25,637, and PCT Publication Nos. WO 96/37155, WO 96/37256, WO
96/17648, WO
97/03718, WO 98/11937, WO 98/00193, WO 97/48440, WO 97/48441, WO 97/48442, WO
98/00193, WO 99/64580, WO 98/28037, WO 98/29298, and WO 98/29365; all incorporated herein by reference in their entirety.
The present invention contemplates administering one or more of the various embodiments of the preparations described above as a prophylactic or therapeutic to humans and animals. In one embodiment, the present invention contemplates a method comprising: a) providing i) a preparation comprising at least one polymer and one or more hormones (or fragments thereof) and ii) a subject, wherein said subject is a human or non-human animal; and b) contacting said subject with said preparation (e.g. under conditions such that at least a portion of said hormone is released into said subject). In one embodiment, the present invention contemplates a method comprising: a) providing i) a preparation comprising one or more hormones (or fragments thereof) in a hydrogel formulation and ii) a subject, wherein said subject is a human or non-human animal; and b) contacting said subject with said preparation (e.g. under conditions such that at least a portion of said hormone is released into said subject). In a preferred embodiment, two hormones are employed (as discussed above). In a preferred embodiment, the hormones are electrospun with one or more polymers so as to create an electrospun preparation. As discussed below, in a preferred embodiment, the electrospun preparation is part of a hormone delivery system. In a preferred embodiment, the electrospun preparation is delivered transdermally, intradermally, intra-epidermal, transmucosally, subcutaneously, IP, IV or IM.
The present invention further contemplates, in one embodiment, a hormone delivery system comprising a) a substrate comprising microprojections or microneedles, and an embodiment of the various preparations (mentioned above) comprising either i) hormone(s) alone (or fragments thereof), ii) hormone(s) (or fragments thereof) and carrier alone, or iii) polymer (or hydrogel) and hormone(s) (or fragments thereof). When microneedles are used, they may be solid or hollow. It is not intended that the present invention be limited to the manner in which the microneedles are contacted with the preparation. In one embodiment, the microneedles are contacted only at the microneedle tips. In a preferred embodiment, the preparation contacts the entire substrate (or substantially the entire substrate) such that the preparation contacts even the spaces between an array of microneedles. It is not intended that the present invention be limited to uniform coatings of the preparation. In one embodiment, the preparation is present on the substrate in a non-uniform manner. In one embodiment, a polymer/hormone(s) preparation is sprayed on said microneedles. In one embodiment, said microneedles are dipped into a preparation comprising at least one polymer and at least one hormone (or fragment thereof). In a preferred embodiment, an electrospun polymer/hormone(s) preparation is deposited on said microneedles.
It is not intended that the present invention be limited by the nature of the substrate comprising said microneedles. In one embodiment, the microneedles are formulated out of polymer.
In one embodiment, the microneedles are formulated (at least in part) out of a polymer/hormone(s) preparation. In another embodiment, the microneedles are made with a mold. In a preferred embodiment, the microneedles are etched out of a silicon substrate. In a preferred embodiment, said silicon microneedles are solid and an electrospun polymer/hormone(s) preparation is deposited on said microneedles.
Thus, the present invention contemplates novel formulations, delivery devices, methods of formulation, and methods of delivery. In one embodiment, the present invention contemplates a method of creating a formulation: providing i) at least one fiber-forming material, and ii) a preparation comprising at least one hormone (or fragment thereof); mixing said fiber-forming material with said preparation so as to create a mixture; and electrospinning said mixture to create electrospun formulation. In one embodiment, the method further comprises:
depositing at least a portion of said electrospun material onto at least a portion of a substrate (e.g. a substrate comprising microneedles, including but not limited to etched solid microneedles) to create a treated substrate..
The present invention also contemplates, as a device, the treated substrate prepared according to the above-described method. In one embodiment, said fiber-forming material comprises hydroxypropyl-cellulose, while in another embodiment said fiber-forming material comprises PVP. In one embodiment, said preparation comprises first and second hormones. In a preferred embodiment, said first hormone comprises PTH (1-34).
In one embodiment, the present invention contemplates a method of creating a hormone delivery device, comprising: providing i) at least one fiber-forming material, ii) a preparation comprising providing i) at least one fiber-forming material, ii) a preparation comprising at least one hormone (or fragment thereof), and iii) a substrate comprising a plurality microprojections; mixing said fiber-forming material with said preparation so as to create a mixture;
electrospinning said mixture to create electrospun material; and depositing at least a portion of said electrospun material onto at least a portion of said substrate, so as to create a hormone delivery device. In a preferred embodiment, said hormone comprises PTH (1-34). In one embodiment, said fiber-forming material comprises hydroxypropyl-cellulose, while in another embodiment said fiber-forming material comprises PVP. The present invention also contemplates, as a device, the hormone delivery device prepared according to the above-described method.
The present invention, as mentioned above, also contemplates methods of administering hormones. On one embodiment, the method of administering hormone comprises:
providing: a subject and the hormone delivery device described above; and contacting said subject with said delivery device under conditions such at least a portion of said hormone is released from said device. In one embodiment, said contacting of step b) comprises piercing the subject's skin with said microprojections.
The present invention also contemplates, in one embodiment, a hormone delivery device comprising: a substrate having a back surface and a front surface; a plurality of solid microneedles extending upwards from the front surface of the substrate, the microneedles comprising a formulation, said formulation comprising at least one polymer and at least one hormone (or fragment thereof). In a preferred embodiment, said hormone comprises PTH (1-34).
Importantly, the present invention contemplates utilizing, in some embodiments, peptide hormones that are protease resistant. In one embodiment, such protease-resistant peptides are peptides comprising protecting groups. In some embodiments, the peptide hormone (such as 1-34 PTH) has the amino terminus blocked by standard methods to prevent digestion by exopeptidases, for example by acetylation. In another embodiment, the carboxyl terminus is blocked by standard methods to prevent digestion by exopeptidases, for example, by amidation. In some embodiments, both the amino terminus and the carboxyl terminus are blocked, e.g. the amino terminus is blocked with an acetal group, and said peptide's carboxyl terminus is blocked with an acetate group. In another embodiment, endoprotease-resistance is achieved using peptides which comprise at least one D-amino acid.
The present invention contemplates a variety of hormones and hormone combinations in the above-indicated formulations and delivery vehicles. Vertebrate hormones fall into three chemical classes: Amine derived hormones (examples are catecholamines and thyroxine, as well as melatonin and serotonin); Peptide hormones (examples are TRH and vasopression, as well as leuteinizing hormone, follicle-stimulating hormone, EPO, angiotensin, gastrin, growth hormone and thyroid-stimulating hormone; preferred embodiments of peptide hormones include glucagon, glucagon-like peptide GLP-1, and Exendin-4); Lipid and phospholipids (examples are steroid hormones such as testosterone and cortisol, sterol hormones such as calcitriol, and eicosanoids such as prostaglandins).
The most commonly-prescribed hormones are estrogens and progestagens, thyroxine (such as levothyrroxin) and steroids. Of course, insulin is used by diabetics.
A "pharmacologic dose" of a hormone is a medical usage referring to an amount of a hormone far greater than naturally occurs in a healthy body. The effects of pharmacologic doses of hormones may be different from responses to naturally-occurring amounts and may be therapeutically useful. An example is the ability of pharmacologic doses of glucocorticoid to suppress inflammation.
In a preferred embodiment, the present invention contemplates formulations of a PTH-based agent, such as PTH-based agent is selected from the group consisting of hPTH(1-34), hPTH salts and analogs, teriparatide and related peptides. Throughout this application, the terms "PTH-based agent" and "PTH(1-34)" include, without limitation, recombinant hPTH(I-34), synthetic hpTH(1-34), PTH(1-34), teriparatide, hPTH(I-34) salts, simple derivatives of hPTH(1-34), such as hPTH(1-34) amide, and closely related molecules, such as hPTH(1-33) or hPTH(1-31) amide, or any other closely related osteogenic peptide. Synthetic hPTH(1-34) is the most preferred PTH agent (however, 1-34 PTH from other species is also contemplated).
Examples of pharmaceutically acceptable hPTH salts include, without limitation, acetate, propionate, butyrate, pentanoate, hexanoate, heptanoate, levulinate, chloride, bromide, citrate, succinate, maleate, glycolate, gluconate, glucuronate, 3-hydroxyisobutyrate, tricarballylicate, malonate, adipate, citraconate, glutarate, itaconate, mesaconate, citramalate, dimethylolpropinate, tiglicate, glycerate, methacrylate, isocrotonate,l3-hydroxibutyrate, crotonate, angelate, hydracrylate, ascorbate, aspartate, glutamate, 2-hydroxyisobutyrate, lactate, malate, pyruvate, fumarate, tartarate, nitrate, phosphate, benzene, sulfonate, methane sulfonate, sulfate and sulfonate.
Preferably, the PTH-based agent is present in the coating formulation at a concentration in the range of approximately 1-30 wt. %.
More preferably, the amount of PTH-based agent contained in the solid biocompatible coating (i.e., microprojection member or product) is in the range of approximately l g-1000 g, even more preferably, in the range of approximately 10-100 g.
In a further embodiment of the invention, the coating formulation includes at least one polymeric material or polymer that has amphiphilic properties, which can comprise, without limitation, cellulose derivatives, such as hydroxyethylcellulose (HEC), hydroxypropylmethylcellulose (HPMC), hydroxypropycellulose (HPC), methylcellulose (MC), hydroxyethylmethylcellulose (HEMC), or ethylhydroxy-ethylcellulose (EHEC), as well as pluronics.
In one embodiment of the invention, the concentration of the polymer presenting amphiphilic properties in the coating formulation is in the range of approximately 0.01-20 wt. %, and in one embodiment in the range of approximately 0.03-10 wt.% of the coating formulation.
In another embodiment, the coating formulation includes a hydrophilic polymer selected from the following group: hydroxyethyl starch, carboxymethyl cellulose and salts of, dextran, poly(vinyl alcohol), poly(ethylene oxide), poly(2-hydroxyethylmethacrylate), poly(n-vinyl pyrolidone), polyethylene glycol and mixtures thereof, and like polymers.
In one embodiment, the concentration of the hydrophilic polymer in the coating formulation is in the range of approximately 1-30 wt. %, and in another embodiment, in the range of approximately 1-20 wt. % of the coating formulation.
In one embodiment, the present invention contemplates utilizing an electrospun formulation (e.g. alone or on a delivery vehicle described herein) comprising at least one substance to improve the look and/or feel of skin, wherein said substance is selected from the group consisting of vitamins (e.g. A, C, D and/or E), polysaccharides, botanicals, proteins/peptides (e.g.
collagen, keratin, elastin, and peptide fragments thereof, including but not limited to pentapeptides such as KTTKS), fatty acids (omega-3, omega-6, etc.), and enzymes/coenzymes. In one embodiment, bioactive factors from whey (e.g. lactalbumin, lactoferrin, lactose, etc.) are contemplated for such formulations.
With respect to botanicals, both plant extracts and purified bioactive agents from plants (e.g.
in electrospun polymer formulations) are contemplated in some embodiments. It is not intended that the present invention be limited to a particular plant or group of plants.
Illustrative plants (from which extracts can be made or agents can be purified) include but are not limited to aloe vera, St.
John's Wort (hypericum crean), Noni (Morinda citrifolia), coffee plant, white and green tea (camellia sinensis), avocado (persea Americana), jojoba (simmondsia chinensis), almond (prunus dulcis), olive oils (olea europea), Sea Kulp, Yacon (smallanthus sonchifolius), soy (glycine max), comfrey plant (symphytum uplandicum), gotu cola (centella asiatica), and African Baobab Tree (adansonia digitata). In one embodiment, the present invention contemplates extracts or purified agents useful for treating cellulite, wherein said plants are selected from the group consisting of meadowsweet (spiraea ulmaria), coffee plant (caffeine), ginkgo (ginkgo biloba), birch (betula), common ivy (hedera helix), and lemon (citrus lemon). In one embodiment, the present invention contemplates extracts or purified agents useful for treating acne, wherein said plants are selected from the group consisting of saw palmetto (sereonnoa repens), green tea (camellia sinensis), soy (glycyne soja), burdock (arctium lappa), tea tree (melaleuca alternifolia), wild pansy (viola tricolor), kiwi (actinidia chinensis), kokum (garcinia indica), and licorice (glycyrrhiza glabra). In one embodiment, the present invention contemplates extracts or purified agents useful as skin whiteners, wherein said plant is selected from the group consisting of bearbeny (arctostaphylos uva-ursi), aloe vera, lemon citrus, white mulberry (moms alba), Chinese sage (salvia miltrionhiza), watercress (nasturtium officinale), and amla (embelica officinalis). In one embodiment, the present invention contemplates extracts or purified agents useful for specific skin conditions, wherein said plant is selected from the group consisting of yarrow flowers (achillea millefolium), oats (avena sativa), pot marigold (calendula officinalis), chesnut bark (castaneva sativa), hawthorn fruits (crataegus monogina), cucumber seeds (cucumis sativus), semitake mushrooms (cordyceps sabolifera), wormwood (artemesia carvifolia), oriental horsetail (equisetum arvense), and tamanu (calophyllum inophyllum).
In one embodiment, the present invention contemplates utilizing a delivery vehicle described herein comprising at least one hormone (e.g. electrospun hormone) to treat (or prevent) a skin condition. In one embodiment, the hormone (e.g., estradiol, or a vitamin) is prescribed to treat a condition, including but not limited to a skin condition that is the result of photodamage or photoaging. In one embodiment, the present invention contemplates treating a skin condition associated with inflammation with such a delivery device described herein comprising one or more retinoids (the vitamin A family). In yet another embodiment, the present invention contemplates utilizing a delivery vehicle described herein (e.g. microneedle array) comprising Vitamin D (and/or analogs) for the treatment of psoriasis. In one embodiment of the present invention, the delivery device comprising Vitamin E is utilized for the prevention and treatment of skin scars and/or keloids. In another embodiment, the present invention contemplates utilizing one of the delivery devices described herein comprising selenium in order to a) protect keratinocytes against damage from ultraviolet radiation, b) promote the healing of wounds and burns, and c) reduce the chance of skin cancer (i.e. an anti-oncogenic treatment). In one embodiment, the present invention contemplates such a delivery device comprising combinations of the above-named vitamins and minerals (e.g. vitamin D in combination with selenium) in a formulation (e.g.
an electrospun formulation or hydrogel formulation).
In one embodiment, the present invention contemplates utilizing a delivery vehicle described herein (e.g. microneedle array) for delivery of Vitamin C (e.g. in an electrospun polymer formulation) in subjects (e.g. subjects who cannot take Vitamin C orally) through the skin. In another embodiment, the present invention contemplates the delivery of Vitamin C to the skin without utilizing a microneedle may (e.g. in an electrospun polymer formulation or on a skin patch).
In still another embodiment, Vitamin C is administered using both of the above approaches are utilized so as to achieve both local and systemic administration.
In one embodiment, the present invention contemplates utilizing a delivery vehicle described herein comprising at least one hormone (e.g. electrospun hormone) to treat (or prevent) type II
diabetes. In one embodiment, the hormone is GLP-1. In another embodiment, the hormone is Exendin-4 or fragments thereof such as Exendin-4 (3-39) and Exendin-4 (9-39).
As noted above, in some embodiments, protease resistance versions of such peptide hormones are contemplated, including but not limited to N-acetal GLP-1 (commercially available from Phoenix Pharmaceuticals, Inc.). The amino acid sequences for such peptide hormones are shown in Figure 21.
In one embodiment, the present invention contemplates electrospun hormones, including but not limited to PTH(1-34). In a preferred embodiment, such hormones are electrospun with one or more polymers such as those described herein.
In a preferred embodiment, the preparation comprising hormone(s) is capable, after electrospinning, of releasing some functional hormone into the human or animal. It is envisioned that in such an embodiment, a medically acceptable fiber-forming material may be used to preserve the hormone(s) for later rehydration and use. In general, rehydration of the fiber of the present invention may be accomplished by mixing the fiber with a solvent for the fiber-forming material.
When the fiber is used to preserve a hormone, the solvent will optimally be a medically acceptable compound.
It is not intended that the present invention be limited to the method by which the electrospun hormone(s) is administered. However, in a preferred embodiment, the hormone(s) is administered at or in the skin. In a particularly preferred embodiment, the electrospun polymer/hormone(s) material is delivered on microneedles or on a patch such that hormone(s) is released into the skin.
In a non-limiting embodiment, the hormones(s) is (are) contained in an ionically cross-linked macromolecular assembly such as those hereinabove described, including but not limited to a hydrogel, such as those hereinabove described.
lonically cross-linked macromolecular assemblies of the present invention comprise a substance to be delivered such as one or more hormones. The formulation containing the pharmaceutically active substance can be in the form of an ionically cross-linked three dimensional film, sphere, tube, fiber, or in any other, geometrical shape and is attached the surface of the device by chemical or physical means.
It is contemplated that the ionically cross-linked macromolecular assembly/drug(s) preparation can be deposited on a surface (in a uniform or non-uniform manner). In one embodiment, the preparation is deposited (e.g. by dipping, coating, spin coating, spraying, or by suitable applicator) on an array of microprojections or microneedles for transdermal, intradermal or transmucosal delivery of the hormone(s).
In one embodiment, the present invention contemplates a method of administering one or more hormones to a patient comprising the steps of penetrating at least an outer layer of the skin of the patient with one or more asperities such as those hereinabove described, such as microprojections or microneedles extending from a front surface of a substrate, at least one of the one or more microneedles (or portion thereof) contacted or coated (uniformly or non-uniformly) by an hormone preparation (discussed above), and releasing at least one of the one or more hormones into the patient.
Other applications for spatially controlled deposition of electrospun fibers:
Appropriate nanofibers could be applied to the edge of a blade, such as a razor blade, or on or between multiple blades or to the piercing edges of a syringe needle. The fibers could aid in the lubrication, prevent corrosion, or minimize bleeding for example.
The needle could be coated with the fibers. These fibers may be adjuvant polymers, such as PVP. Upon injection of the vaccine, the adjuvant During injection, the coating provides lubrication during the insertion. The same or another kind of fiber can also serve as an adjuvant.
Multiple layers of fibers or composites that have varied chemistries, like the NO delivering patches, with Vitamin C spun out on one pin and nitrite spun out on another, or fibers containing each are spun onto the same needle The fibers deliver the NO when moisture from the skin, or from a puncture of the skin activates the reagents. For some applications the reagents may be placed on the separate pins which are inserted at the same time.
The spinning methods utilized in the present invention can also be used to coat only the surface of a stent, without forming a web between the struts of a stent. Only the metal is coated;
thus there is not made a stent graft but a fibrous coating that allows fluids to flow through the open interstices of the stent during insertion, and fluids can have direct access to the interior surface of the blood vessel through these interstices after the stent is inserted The steerable (directable) nature of the jets used in this invention can improve application of fibers to skin. Fine details of the wound can be coated with less "bridging"
than when a typical bending and coiling jet is used. Before when it was attempted to spin out fibers in attempts to control bleeding wounds, such as, for example, when fibers were spun onto a liver wound on a dog, the fibers tented over the wound surface. Now the fibers may be delivered directly to a specific surface, such as a grounded surface on a wound, where one would want only to deliver a polymer containing a small quantity of growth factor to enhance healing of the wound.
This may be useful in plastic surgery, where only a small incision is treated in this way. A small wire may be laid on top of the incision, and function as the target or ground, that provides even greater control of the place at which the fiber is attached to the wound.
Controlled jets of the sort described in this invention can be used in laparoscopic surgery to cover, protect. medicate, mechanically stabilize or treat tissues to which a surgeon has only very limited access.
In another embodiment, the asperities coated with nanofibers in accordance with the present invention may be employed as ion and fluid transport membranes for utilization of hierarchical structures of multiwall nanotubes on carbon nanofibers.
The hierarchical structure described includes, in its simplest concept, carbon nanofibers with radial branches which may or may not have metal particles at the end of each radial branch. Each radial branch is connected electrically through a path that is a part of the carbon hierarchical structure, to an external electrical circuit. The methods described in this invention can be used to coat the end of each branch and metal particle with a porous network of polymer nanofibers. If these pores are filled with an ionized network this network can function as a selective ion transport membrane, which is an essential component of a fuel cell. Thus, in one embodiment, the present invention makes it possible to make radical new designs for fuel cells, batteries, and bioelectric contacts. It could also lead to new designs for electrochemical sensors which depend on the motion of ions in the vicinity of an electrode, which is a large class of sensors.
The ability to deposit one kind of nanofiber at the tips of the carbon nanotube branches and other kinds of nanofibers to span the interstices between the tips of the branches makes it feasible to consider new ways of creating essential paths for the flow of gases and liquids through the hierarchical structures of carbon and other materials, including the electrically conducting variations of titanium oxide known as Magneli phases, and other such conducting or semiconducting materials, some of which are listed in the following reference by J. R. Smith, et al.
The use of electrospun nanofibers to form durable ion transport membranes is also an enabling technology for the manufacture of light emitting diodes and photoelectric diodes that depend on the motion of ions in the vicinity of asperities on a surface.
("Electrodes Based on Magnelipahse Titanium Oxides", J. R. Smith, F. C. Walsh, and R L Clarke, Journal of Applied Electrochemistry, Vol. 28 (1988), pages 1021-1033. Reviews in Applied ElectrochemisU, Number 50).
EXAMPLES
The invention now will be described with respect to the following examples, however, the scope of the present invention is not intended to be limited thereby.
Construction And Expression Of C. botulinum C Fragment Fusion Proteins The C. botulinum type A neurotoxin gene has been cloned and sequenced [Thompson, et al., Eur. J. Biochem. 189:73 (1990)]. The nucleotide sequence of the toxin gene is available from the EMBL/GenBank sequence data banks under the accession number X52066; the nucleotide sequence of the coding region is set forth in Figure 22. The amino acid sequence of the C. botulinum type A
neurotoxin is shown in Figure 16. The type A neurotoxin gene is synthesized as a single polypeptide chain which is processed to form a dimer composed of a light and a heavy chain linked via disulfide bonds. The 50 kD carboxy-terminal portion of the heavy chain is referred to as the C
fragment or the Hc domain.
A number of attempts by others to express polypeptides comprising the C
fragment of C.
botulinum type A toxin as a native polypeptide (e.g., not as a fusion protein) in E. coli have been unsuccessful [H.F. LaPenotiere, et al. in Botulinum and Tetanus Neurotoxins, DasGupta, Ed., Plenum Press, New York (1993), pp. 463-466]. Expression of the C fragment as a fusion with the E.
coli MBP was reported to result in the production of insoluble protein (H.F.
LaPenotiere, et al., supra).
In order to produce soluble recombinant C fragment proteins in E. coli, Dr.
Williams has shown that it is desirable to construct fusion proteins comprising a synthetic C fragment gene derived from the C. botulinum type A toxin and either a portion of the C.
difficile toxin protein or the MBP. See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
a) Construction Of Plasmids Encoding C Fragment Fusion Proteins Fusion proteins comprising a fusion between the MBP, portions of the C.
difficile toxin A repeat domain (shown to be expressed as a soluble fusion protein) and the C
fragment of the C. botulinum type A toxin have been described. See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference). A fusion protein comprising the C fragment of the C.
botulinum type A toxin and the MBP was also constructed by Dr. Williams.
Figure 23 provides a schematic representation of the botulinal fusion proteins along with the donor constructs containing the C. difficile toxin A sequences or C. botulinum C fragment sequences which were used to generate the botulinal fusion proteins. In Figure 23, the solid boxes represent C. difficile toxin A gene sequences, the open boxes represent C.
botulinum C fragment sequences and the solid black ovals represent the E. coil MBP. When the name for a restriction enzyme appears inside parenthesis, this indicates that the restriction site was destroyed during construction. An asterisk appearing with the name for a restriction enzyme indicates that this restriction site was recreated at the cloning junction.
In Figure 23, a restriction map of the pMA1870-2680 and pPA1100-2680 constructs which contain sequences derived from the C. difficile toxin A repeat domain are shown; these constructs can be used as the source of C. difficile toxin A gene sequences for the construction of plasmids encoding fusions between the C. botulinum C fragment gene and the C. difficile toxin A gene. Dr.
Williams demonstrated that the pMA 1870-2680 expression construct expresses high levels of soluble, intact fusion protein (20 mg/liter culture) which can be affinity purified on an amylose column. See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference). The pAlterBot construct was used by Dr. Williams as the source of C. botulinum C
fragment gene sequences for the botulinal fusion proteins (obtained from J. Middlebrook and R. Lemley at the U.S.
Department of Defense). pAlterBot contains a synthetic C. botulinum C fragment inserted in to the pALTER-1 vector (Promega). This synthetic C fragment gene encodes the same amino acids as does the naturally occurring C fragment gene. The naturally occurring C fragment sequences, like most clostridial genes, are extremely A/T rich (Thompson et al., supra). This high A/T content creates expression difficulties in E. coli and yeast due to altered codon usage frequency and fortuitous polyadenylation sites, respectively. In order to improve the expression of C
fragment proteins in E.
coli, a synthetic version of the gene was created by Dr. Williams in which the non-preferred codons were replaced with preferred codons. See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
The nucleotide sequence of the C. botulinum C fragment gene sequences contained within pAlterBot is shown in Figure 24. The first six nucleotides (ATGGCT) encode methionine and alanine residues, respectively. These two amino acids result from the insertion of the C. botulinum C fragment sequences into the pALTER vector and provide the initiator methionine residue. The amino acid sequence of the C. botulinum C fragment encoded by the sequences contained within pAlterBot is shown in Figure 17. The first two amino acids (Met Ala) are encoded by vector-derived sequences. From the third amino acid residue onward (Arg), the amino acid sequence is identical to that found in the C. botulinum type A toxin gene.
. The pMA1870-2680, pPA1100-2680 and pAlterBot constructs were used by Dr.
Williams as progenitor plasmids to make expression constructs in which fragments of the C.
difficile toxin A
repeat domain were expressed as genetic fusions with the C. botulinum C
fragment gene using the pMAL-c expression vector (New England BioLabs). See Williams et al., U.S.
Patent 5,919,665 (hereby incorporated by reference). The pMAL-c expression vector generates fusion proteins which contain the MBP at the amino-terminal end of the protein. A construct, pMBot, in which the C.
botulinum C fragment gene was expressed as a fusion with only the MBP was constructed by Dr.
Williams (Figure 23). Fusion protein expression can be induced from E. coli strains harboring the above plasmids, and induced protein was affinity purified on an amylose resin column.
i) Construction Of pBlueBot In order to facilitate the cloning of the C. botulinum C fragment gene sequences into a number of desired constructs, the botulinal gene sequences can be removed from pAlterBot and were inserted into the pBluescript plasmid (Stratagene) to generate pBlueBot (Figure 23). pBlueBot was constructed by Dr. Williams as follows. Bacteria containing the pAlterBot plasmid were grown in medium containing tetracycline and plasmid DNA was isolated using the QlAprep-spin Plasmid Kit (Qiagen). One microgram of pAlterBot DNA was digested with Ncol and the resulting 3' recessed sticky end was made blunt using the Klenow fragment of DNA polymerase I (here after the Klenow fragment). The pAlterBot DNA was then digested with Hindlll to release the botulinal gene sequences (the Bot insert) as a blunt (filled Nco1 site)-Hind111 fragment.
pBluescript vector DNA
was prepared by digesting 200 ng of pBluescript DNA with SmaI and.HindIIl. The digestion products from both plasmids were resolved on an agarose gel. The appropriate fragments were removed from the gel, mixed and purified utilizing the Prep-a-Gene kit (BioRad). The eluted DNA
was then ligated using T4 DNA ligase and used to transform competent DH5a cells (Gibco-BRL).
Host cells were made competent for transformation using the calcium chloride protocol of Sambrook et al., supra at 1.82-1.83. Recombinant clones were isolated and confirmed by restriction digestion using standard recombinant molecular biology techniques (Sambrook et al, supra). The resultant clone, pBlueBot, contains several useful unique restriction sites flanking the Bot insert (i.e., the C. botulinum C fragment sequences derived from pAlterBot) as shown in Figure 23. See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
ii) Construction Of C. difficile/C. botulinum/MBP Fusion Proteins Constructs encoding fusions between the C. difficile toxin A gene and the C. botulinum C
fragment gene and the MBP were made by Dr. Williams utilizing the same recombinant DNA
methodology outlined above; these fusion proteins contained varying amounts of the C. difficile toxin A repeat domain.
See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
The pMABot clone contains a 2.4 kb insert derived from the C. difficile toxin A gene fused to the Bot insert (i.e, the C. botulinum C fragment sequences derived from pAlterBot). pMABot (Figure 23) was constructed by mixing gel-purified DNA from NotUHindII1 digested pBlueBot (the 1.2 kb Bot fragment), SpeI/NotI digested pPA1100-2680 (the 2.4 kb C. difficile toxin A repeat fragment) and XbaUHindlll digested pMAL-c vector. Recombinant clones were isolated by Dr.
Williams, confirmed by restriction digestion and purified using the QlAprep-spin Plasmid Kit (Qiagen). This clone expresses the toxin A repeats and the botulinal C
fragment protein sequences as an in-frame fusion with the MBP.
The pMCABot construct contains a 1.0 kb insert derived from the C. difficile toxin A gene fused to the Bot insert (i.e, the C. botulinum C fragment sequences derived from pAlterBot).
pMCABot was constructed by digesting the pMABot clone with EcoRl to remove the 5' end of the C. difficile toxin A repeat (see Figure 23, the pMAL-c vector contains a EcoRI
site 5' to the C.
difficile insert in the pMABot clone). The restriction sites were filled and religated together after gel purification. The resultant clone (pMCABot, Figure 23) generated an in-frame fusion between the MBP and the remaining 3' portion of the C. difficile toxin A repeat domain fused to the Bot gene.
See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
The pMNABot clone contains the I kb SpeUEcoRI (filled) fragment from the C.
difficile toxin A repeat domain (derived from clone pPA 1100-2680) and the 1.2 kb C.
botulinum C fragment gene as a Ncol (filled)/HindI1l fragment (derived from pAlterBot). These two fragments were inserted by Dr. Williams into the pMAL-c vector digested with XbaUHindI1l. The two insert fragments were generated by digestion of the appropriate plasmid with EcoRI
(pPA 1100-2680) or Ncol (pAlterBot) followed by treatment with the Klenow fragment. After treatment with the Klenow fragment, the plasmids were digested with the second enzyme (either Spel or HindIII). All three fragments were gel purified, mixed and Prep-a-Gene purified prior to ligation. Following ligation and transformation, putative recombinants were analyzed by restriction analysis; the EcoRl site was found to be regenerated at the fusion junction, as was predicted for a fusion between the filled EcoRI and Ncol sites. See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
A construct encoding a fusion protein between the botulinal C fragment gene and the MBP
gene was constructed (i.e., this fusion lacks any C. difficile toxin A gene sequences) and termed pMBot. The pMBot construct was made by Dr. Williams by removal of the C.
difficile toxin A
sequences from the pMABot construct and fusing the C fragment gene sequences to the MBP. This was accomplished by digestion of pMABot DNA with Stul (located in the pMALc polylinker 5' to the Xbal site) and Xbal (located 3' to the Notl site at the toxA-Bot fusion junction), filling in the Xbal site using the Kienow fragment, gel purifying the desired restriction fragment, and ligating the blunt ends to circularize the plasmid. Following ligation and transformation, putative recombinants were analyzed by restriction mapping of the Bot insert (i.e., the C. botulinum C fragment sequences). See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
b) Expression Of C. botulinum C Fragment Fusion Proteins In E. coli Large scale (I liter) cultures of the pMAL-c vector, and each recombinant construct described above in (a) can be grown, induced, and soluble protein fractions isolated as described in Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference), who reported yields in excess of 20 mg fusion protein per liter culture.
Production Of Soluble C. botulinum C Fragment Protein Substantially Free Of Endotoxin Contamination In order to determine if the solubility of the botulinal C fragment was enhanced by expressing the C fragment protein as a native protein, an N-terminal His-tagged protein or as a fusion with glutathione-S-transferase (GST), alternative expression plasmids have been constructed.
See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
Figure 25 provides a schematic representation of the vectors described below.
In Figure 25, the following abbreviations are used. pP refers to the pET23 vector. pHIS
refers to the pETHisa vector. pBlue refers to the pBluescript vector. pM
refers to the pMAL-c vector and pG refers to the pGEX3T vector. The solid black lines represent C.
botulinum C fragment gene sequences; the solid black ovals represent the MBP; the hatched ovals represent GST; "HHHHH"
represents the poly-histidine tag. In Figure 25, when the name for a restriction enzyme appears inside parenthesis, this indicates that the restriction site was destroyed during construction. An asterisk appearing with the name for a restriction enzyme indicates that this restriction site was recreated at a cloning junction.
i) Construction Of pPBot In order to express the C. botulinum C fragment as a native (i.e., non-fused) protein, the pPBot plasmid (shown schematically in Figure 25) was constructed by Dr.
Williams as follows. The C fragment sequences present in pAlterBot were removed by digestion of pAlterBot with NcoI and Hindlll. The NcoUHindll l C fragment insert was ligated to pETHisa vector which was digested with Ncol and HindIII. This ligation creates an expression construct in which the Ncol-encoded methionine of the botulinal C fragment is the initiator codon and directs expression of the native botulinal C fragment. The ligation products were used to transform competent BL21(DE3)pLysS
cells (Novagen). Recombinant clones were identified by restriction mapping.
See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
ii) Construction Of pHisBot In order to express the C. botulinum C fragment containing a poly-histidine tag at the amino-terminus of the recombinant protein, the pHisBot plasmid (shown schematically in Figure 8) was constructed by Dr. Williams as follows. The NcoUHindlll botulinal C fragment insert from pAlterbot was ligated into the pETHisa vector which was digested with Nhel and Hindill. The Ncol (on the C fragment insert) and Nhel (on the pETHisa vector) sites were filled in using the Klenow fragment prior to ligation; these sites were then blunt end ligated (the Ndel site was regenerated at the clone junction as predicted). The ligation products were used to transform competent BL21(DE3)pLysS cells and recombinant clones were identified by restriction mapping. See Williams et at., U.S. Patent 5,919,665 (hereby incorporated by reference).
The resulting pHisBot 'clone expresses the botulinal C fragment protein with a histidine-tagged N-terminal extension having the following sequence:
MetGlyHisHisHisHisHisHisHisHisHisHisSerSerGlyHislleGluGlyArgHisMetAla; the amino acids encoded by the botulinal C fragment gene are underlined and the vector encoded amino acids are presented in plain type. The nucleotide sequence present in the pETHisa vector which encodes the pHisBot fusion protein is set forth in Figure 26. The amino acid sequence of the pHisBot protein is set forth in Figure 27.
iii) Construction Of pGBot The botulinal C fragment protein was expressed as a fusion with the glutathione-S-transferase protein by constructing the pGBot plasmid (shown schematically in Figure 24). This expression construct was created by Dr. Williams by cloning the NotUSall C
fragment insert present in pBlueBot into the pGEX3T vector which was digested with Smal and Xhol. The Notl site (present on the botulinal fragment) was made blunt prior to ligation using the Klenow fragment. The ligation products were used to transform competent BL21 cells. See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
iv) solubility and purification The pGBot protein was almost entirely insoluble under the utilized conditions, while the pHisBot protein was soluble. See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference). For improved affinity purification of the soluble pHisBot protein (in terms of both yield and purity), an alternative poly-histidine binding affinity resin (Ni-NTA
resin; Qiagen) is desirable.
The Ni-NTA resin has a superior binding affinity (Kd= I x 10-13 at pH 8.0;
Qiagen user manual) relative to the His-bind resin.
Based upon the foregoing disclosure, it should now be apparent that Clostridium toxins, and in particular, C. botulinum toxins, together with polymer (e.g. in an electrospun formulation) can be used as vaccines. A particularly desirable administration approach is transdermal, via microprojections (e.g. an array of microneedles). A variety of polymers, as well as delivery vehicles, can be used without departing from the spirit of the invention. In one embodiment, the electrospun polymer/toxin(s) fiber mat is placed directly on the skin. In another embodiment, the polymer/toxin(s) fiber mat is part of a delivery vehicle (e.g. skin patch, microneedle array, etc.) Mutagenesis. To generate a complete library of Cys mutants of PA63 one can use the QuikChange (Stratagene) method to generate point mutations, in conjunction with automated systems currently used for high-throughput DNA sequencing. The pag gene encoding PA is AT rich (34% GC) and does not present significant technical hurdles. Automated systems can be used to synthesize the mutagenic oligonucleotide pairs, and the quality of mutagenic oligonucleotides can be confirmed by automated capillary electrophoresis. In this manner, a full plate can be processed in a day, and the oligonucleotides needed for complete mutagenesis of PA63 can be synthesized and checked in 12 days. After manually performing the PCR mutagenesis in 96-well plates and transforming the resulting mutated plasmids into E. coli, automation can again be used for preparing DNA from the colonies and sequencing of the region of interest. Clones bearing the desired mutation can be used for functional screens.
As noted above, researchers at the University of Oklahoma used this protocol to generate 568 mutants, corresponding to the replacement of every amino acid of PA63 with Cys. Thirty three mutants (6% of the total number of mutants tested) were both strongly defective and well expressed.
As shown in Table 3, the 33 mutations were distributed among the four domains of PA, with a majority in domain 2.
Some Inactive Mutants Are Dominant. The 33 inactive mutants were tested by the researchers at the University of Oklahoma for ability to inhibit the toxicity of a mixture of PA and LFNDTA toward CHO cells at ratios of mutated to wild-type PA up to 8:1. Those that showed measurable inhibitory activity under these conditions were defined, for the purpose of this study, as "dominant negative" (DN). Nine preparations of mutant PA were inhibitory:
1364, T380, S382, T393, K397, N399, Y41 1, N422, and F427. The present invention contemplates using such mutant protective antigens both alone and in conjugates (as described above). Like the DN mutants characterized earlier, the purified DN Cys-mutants showed defects specifically in pore formation and translocation. PA bearing T393C, T380C, or S382C showed strong DN
activity, only slightly weaker than that of the K397D + D425K double mutant characterized earlier.
N399C and N422C
showed moderate DN activity, and 1364C and Y411 C showed weak inhibitory activity.
One of the strongest of the five DN mutants, T393C, was tested by researchers at the University of Oklahoma for ability to protect Fisher 344 rats from a lethal challenge with a mixture of PA and LF. Like the other DN mutants tested, T393C prevented symptoms of intoxication until the time of death, whereas rats challenged with native toxin alone became moribund 75 rain after challenge (data not shown). In the end, 33 well-expressed mutants with defects in toxicity were described by the Oklahoma group.
In contrast to the Cys substitutions, Ala substitutions created by the Oklahoma group at selected sites gave different results: Y411A showed strong DN activity; T380A
and N399A showed weak DN activity; and N422 and S382A showed no DN activity. At position 393, Cys or Lys gave strong DN activity; Asp or Ala gave moderate DN activity; and Ser gave no DN
activity. The present invention contemplates employing these Ala substituted mutant protective antigens alone or as conjugates (as described above).
Conjugating wild-type and mutant PA to PGA. Conjugates are readily synthesized as follows. To I mg of PA in 0.5 ml phosphate-buffered saline (PBS; pH 7.0), 0.5 mg of degraded PGA can be added. After PGA has dissolved, 5 mg of I-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride should be added, and the solution mixed on a rotary shaker at 25C for 4 hours. One can monitor the conjugation process by SDS-PAGE.
Moreover, the conjugates can be purified on a PDIO column (Amersham Biosciences), verified by SDS-PAGE, and stored at -20C until use.
Alternatively, gamma-PGA polypeptides can be synthesized (with various lengths, e.g. 5, 10, 15 or 20 residues) and can be bound to carrier proteins at either the C-or N-termini (for further reactions). The various types of these polypeptides are described in U.S.
Patent Application 20060134143 to Schneerson et al. (hereby incorporated by reference) including but not limited to PGA comprising D-glutamic acid and PGA comprising L-glutamic acid:
Type I: NBrAcGly3_yDPGAn- COOH(Br-G 1 y3_7DPGA,,-C) NBrAc-GIy3--yLPGAõ-COOH(Br-GIy3--yLPGAn-C) Type II: NAc-L-Cys-G 1 y3-yDPGAn,-COOH(Cys-Gly3-yDPGA,,-C) NAc-L-Cys-G 1 y3-7LPGA,,,-COOH(Cys-GIy3-yLPGA,,-C) Type III: NAc-yDPGA,,-G I y3-L-Cys-CONH2(N- yDPGAõ-G 1 y3-Cys) NAc-yLPGAn-Gly3-L-Cys-CONH2(N-yLPGA,,-G I y3-Cys) Type IV: CHO-G 1 y3- yDPGAõ-COOH
Type V: NAc-yDPGAr,-GIy3-CO-AH
NAc-yDPGAn-CO-AH
Type VI: NAc--yDPGAõ-Cys-CONHZ
In one example, recombinant wild-type PA is derivatized with adipic acid dihydrazide and reacted with one or more of these polypeptides.
Using Y. pestis antigens. As noted above, in another embodiment, antigen from Y. pestis is contemplated in a preparation suitable for transdermal delivery. It is not intended that the present invention be limited by the particular antigens from these organisms. However, in one embodiment, an Fl capsule antigen from Y. pestis is employed in a polymer formulation (e.g. electrospun formulation) deposited on a microneedle array. In another embodiment, a protein (or fragment) from the injectisome from Y. pestis is employed. In a preferred embodiment, the LcrV protein (or fragment thereof) from the Y. pestis injectisome is similarly employed. With regard to the latter, Table 5 shows the amino acid sequence for LcrV of Y. pestis, as well as from some other sources.
Y pews IOM LdV' MIFtAYEptaPqF1YIEDL~(VFtVD~L7 GE9GõSvi L'ELV~1 VKGQQiIbISIlCYDPR~BVt Y. 8YV&O=WM I.CN MIFAY6QIPQIPIEDLEKVFCVFMR'6FK;S
YpMtMtbLCrV i9FtA IEDLEttVAt+~ T+Gi11~S81'YF2SUM
P. eatwnt7sA
Y. POWs i0M I.GYV AHRV27'DDIP.I.LIQCILATIPLP!*DATLAOGHYDHOIaGTKAVDM'L68..
SPHYOWARA
Y.OVWDMWW ICN A~KVtTDO1xLIlacI1AYPLFBII91IL~t~6i.ItEtvftEE6SS..S~l7T~IAA
Y (JB9UdfbLCYv A10RVITDOI6LL?.IQIAYYLPrLU%ILKfG}lYD20N(X4iiIlLT9..SP2MP1PLi1A
P aw*waw pav Y Q@64`9IOM li7V
EMVDIP`SLZIDRIPDDItd1;ViV1SMdiDGDAdiBXLRB8d1iBL4A8LtfIYSVIpAEIHQ(N
Y endOVOON,ia9laY
ERaP1~HPSLSADEtIDADxIdCYIVf~S~tiAGlbajLSlcLtiB8I11RLTABI;iEIYSVI(YU3ItazN
Y. pswurtoPbltrV iM PSL~DRIL~7 A9teLMASLiAS1WCiYSVICRBIM
P S&Wkrom Pc.v Elmuft ~I~I~~~~I~~LT~s+-I~-~
Y, pEbtslOM I CN iSS862IIdIffiX<CSIMkNOdLYC.YTD. E3IPPU49MYICITEFQWQTTI WD...
:... ....
YoarawmKm LAfv L488G7LNIIVRSIIVII4DI0II,YOYTD.&3IFY 4ABYi{I1~PQ{PQPF
Y Psetftb LaY IS IFTISDRSIETl3M47LYGYTD.=FKaB4BYR1 I
P. emofncw abrv I jM4[h&,YC~.~~ . . . . . . .
V. peaNafOM (.nN
cSomi4SlmoG+i*Bl1KTITGAi.CiLiQtfiYS1RlMM*IIMLSNI'ATY'CSDKSRP11lmLV80K
YaaBmG1pwc9 L.orv Ivs 8 RI ~ SY~L~lA2~CSD[i3RPLrDLVSax YpmaabdbLcrV rvsn~ s _ r~rrCSDtcsRela+nivs P. esrtlDTse R:N sI
Y. p6SVS FdM LOV TTWDITSR@WAI8l1I2RFICjLyDSt?s3tyLpD'r6GR
Y. fJ-VBIl7CIOW608 L.GYY TTQS'JDITSREN9AIF.AU@tFTQiiYDSVKiXX[ LaD7M
Y pssumbPh LcrV
P. aert,gJnxa PCtV 3 T D QiSUD3v I~
Because of the similarity between three of the organisms (but not P.
aeruginosa), the present invention contemplates, in one embodiment, using the LcrV protein (or fragment thereof) of any of these three organisms in order to generate protection against Y. pestis. If a fragment is used, typically the fragment will be at least twenty (20) amino acids and selected in a region of high conservation (see Table 5).
Where Fl capsule antigen and LcrV protein are made as a fusion protein, the fusion protein may be made by selecting appropriate coding sequences from GenBank accession No. AF07461 1.
Using F. tularensis antigens. As noted above, in another embodiment, antigen from F. tularensis is contemplated in a preparation suitable for transdermal delivery. It is not intended that the present invention be limited by the particular antigens from these organisms. However, in one embodiment, a specific sequence of the outer membrane protein (or fragment thereof) encoded by the fopA gene of F. tularensis is employed.
Alternatively, a protein (or fragment thereof) encoded by the tul4 gene is employed. The PCR primers that will conveniently amplify these genes are given below:
*tu14 primers (forward, ATTACAATGGCAGGCTCCAGA; reverse, GCCCAAGTTTTATCGTTCTTCTCA) will specifically amplify an 89-bp fragment of the tul4 gene (GenBank accession no. M32059) encoding a 17-kDa lipoprotein.
* fopA primers (forward, AACAATGGCACCTAGTAATATTTCTGG; reverse, CCACCAAAGAACCATGTTAAACC) will amplify an 86 bp fragment of the fopA gene (GenBank accession no. AF097542) which encodes a 43-kDa outer membrane protein.
The proteins can be expressed in vitro or in vivo and then formulated (e.g. in an electrospun formulation) for application to the microneedle array.
Electrospinning Anthrax Protective Antigen. In this example, the protocol for electrospinning anthrax antigen is described. Pure native PA (List Biological Laboratories) will be reconstituted in I ml of distilled water containing 0.1 % Bovine Serum Albumin (BSA) at a concentration of 1 mg/ml. 400 Al of the solution will be further diluted with equal volume of aqueous 0.1% BSA to prepare the PA solution which will be mixed appropriately with PVP as described below. The "unspun" 500 g/ml PA solution will be used as the control for the evaluation of retention of functionality (although this is not required for a vaccine).
Two electrospinning solutions will be prepared utilizing the PA solution. The first will consist of 400 l of PA solution, and 1600 Al of 0.075 mM Polyvinylpyrrolidone (PVP) dissolved in absolute ethanol, and the second will have distilled water as the solvent. Both solutions will be utilized in preparation of electrospun mats, and tested in the assay of functionality to confirm that protein activity has been retained upon introduction of polymer solution.
Because an approximate concentration of 100 g/ml of PA is required for the functionality test, and the volume needed for the cell-based assay is 1 ml, 100 mg of the material is deposited onto the collector. It is estimated that the mixture of PA and PVP in ethanol will be electrospun at 20 uUmin and 16 kV, while the completely aqueous mixture will be electrospun at 5-10 uUmin and 20 kV. From previous experiments it can be estimated that, regardless of which solution is electrospun, only 50% to"75% of the total material will be deposited on the collector. 1500 l of each solution is electrospun onto aluminum foil, coated with Teflon to ease the removal of the electrospun mat from the foil. The entire material deposited on the sheet will be peeled off and dissolved in 1 ml of MatTek tissue culture medium to provide samples for the test of functionality.
This stock solution will be further diluted with culture medium to a final estimated concentration of 10 g/ml; this concentration is 50-100 times the required amount for the test of functionality.
The cells used in this test are MonoMac 6 cells (DSMZ, Braunschweig, Germany)) maintained in RPMI 1640 (Hyclone) medium supplemented with 10% fetal bovine serum (FBS), 2mM L-glutamine, 1% non-essential amino acids, 1 mM oxaloacetate, 0.45 mM
pyruvate, 0.2 U/ml insulin (OPI media supplement, Sigma, St.Louis, MO), and 1% (v/v) penicillin streptomycin solution (final concentrations 100 IU penicilin G and 100 gg streptomycin per ml, Sigma). Cells are washed with Hank's Balanced Salt Solution (HBSS; Hyclone) at 37 C once prior to commencing experiments, which are all carried in serum free media without antibiotics.
The functionality experiments are based on examination of Lethal Factor (LF) proteolytic activity in the cytosol of viable cells. We have shown in previous experiments that LF added to the surrounding medium cannot enter MonoMac 6 cells unless functionally active PA
is present to facilitate its transport from the medium into the cytosol. MonoMac 6 cells are washed with warm DPBS and are resuspended in Macrophage Serum Free Medium (Gibco) for plating at a density of 1 x 106/ml/well in 24 well microplates. After addition of each of the PA
solutions to be tested (two different dissolved electrospun preparations and an aliquot of the "unspun"
solution) and a 100 ng/mi solution of LF (List Biolabs) to separate wells of cells, the cells are incubated for different periods of time, and at each designated time point a 200 Rl aliquot of cell suspension is removed.
Cells are pelleted by centrifugation and are then lysed in a buffer containing 0.1% Nonidet P-40 (NP40), 150 mM NaCI, 40 mM Tris @H 7.2), 10% 5 glycerol, 5 mM NaF, 1 mM Na pyrophosphate, 1mM Na o-vanadate, 10 mM ophenanthroline, and 100 ng/ml phenylmethyl sulfonyl fluoride (PMSF) at 70 C for 10 min.
The lysates are separated by SDS-polyacrylamide gel electrophoresis and the presence of intact or cleaved MEK-2 is quantitated by immunoblotting. Aliquots of 7.5-10 ug total cell lysate protein per well are loaded onto 10% SDS gels (Novex) and electrophoresed followed by transfer to nitrocellulose membranes in an electrotransfer apparatus (Novex) for 1 h at 30 V. The membranes are blocked with 5% low-fat milk in This-buffered saline buffer, pH 7.6, containing 0.1% Tween 20 for 1 h at room temperature and then probed with anti-MEK-2 rabbit polyclonal antibody (Santa Cruz) at a dilution of 1:2000. Goat anti-rabbit IgG is used at a dilution of 1:2000 as the secondary antibody.
Blots are washed after probing and processed with the Enhanced Chemiluminescence detection kit according to the manufacturer's directions.
The predicted results for a successful delivery of LF are illustrated in Figure 28.
As can be seen in Figure 28, it is expected that after 4 hours of incubation of MonoMac 6 cells with LF alone or with PA alone, there is no degradation of the MAP
Kinase MEK-2 detected in an immunoblot, or "Western blot," of the cell lysates, whereas when LF and PA
are both present, MEK-2 is destroyed within the cells in 4 hours. If the electrospun PA behaves in a~manner similar to unspun PA (as is to be expected), one can anticipate seeing MEK-2 cleavage as shown in Figure 28.
Delivering Electrospun PA To A Tissue Model. In this example, the protocol for delivering electrospun PA through MatTek EpiDerm 200 epidermal equivalent tissue, using 600 um microspike-bearing silicon chips and collecting the surrounding medium from the base of the MatTek units for challenge with LF and MonoMac 6 cells, is described.
Testing Antigenicity of Electrospun PA. In this example, the protocol for testing for preservation of antigenicity of the electrospun PA using a commercially available polyclonal goat anti-PA antibody from List Biological Laboratories is described. This antibody recognizes PA even after it has been subjected to SDS-polyacrylamide gel electrophoresis, indicating that, at least in goats, the PA can be prepared as an immunogen to generate a robust immune response. Aliquots of the dissolved samples of electrospun PA generated from the two solvent systems will be separated by SDS polyacrylamide gel electrophoresis along with aliquots of the "unspun"
PA control and transferred to nitrocellulose membranes as described above. The membranes will be probed with an appropriate dilution of the goat anti-PA antibody, while a rabbit anti-goat polyclonal antibody will be used as the secondary antibody. The membranes will then be examined by enhanced chemiluminescence as described above. This test is less stringent than the functionality assay (and all that is needed for a vaccine) because even PA which has been denatured by the electrospinning protocol (which is not expected) will retain its capacity to be recognized by the goat antibody.
However, we can still quantitate the delivery of immunoreactive PA after electrospinning and even after delivery across an epidermal equivalent model by using a semiquantitative immunoblotting procedure known as a "slot blot." The slot-blot apparatus allows direct application of samples collected after electrospinning, or after delivery through a skin equivalent, onto a nitrocelulose membrane. The apparatus can accommodate 48 samples at a time, including a series of sequential dilutions of the "unspun" PA control, the PA concentrations of which are all precisely known. After all the samples are applied, the membrane is removed and incubated with goat anti-PA primary antibody and rabbit-antigoat secondary antibody, and examined by enhanced chemiluminescence as described above.
Based upon the foregoing disclosure, it should now be apparent that anthrax antigens, and in particular, certain conjugates of two anthrax antigens (one of which being a mutant), taken alone or together with polymer (e.g. in an electrospun formulation) can be used as vaccines. A particularly desirable administration approach is transdermal, via microprojections (e.g.
an array of microneedles). A variety of polymers and mutants, as well as delivery vehicles, can be used without departing from the spirit of the invention. In one embodiment, the electrospun polymer/antigen(s) fiber mat is placed directly on the skin. In another embodiment, the polymer/antigen(s) fiber mat is part of a delivery vehicle (e.g. skin patch, microneedle array, etc.) Parathyroid Hormone (PTH 1-34) Polyvinylpyrrolidone (PVP) molecular weight of -1,300,000 from Sigma-Aldrich was dissolved at a concentration of 0.075mM in 0.4% Human Serum Albumin (HSA) in water and magnetically stirred for 3 hours. A 550 pg/ml peptide solution supplied by Immunotopics as part of its PTH 1-34 Elisa kit was used as the hormone source. The electrospinning PTH 1-34 solution was prepared by mixing the PVP and PTH
solutions at an 80% /
20% (v/v) PVP/PTH ratio. The electrospinning method was utilized to deposit a nanocomposite of the solution onto the substrates. A total of 1.0 ml was electrospun onto the target. The coating was created at the flow rate of 80min, voltage of 20 kV, and a distance between the collector and needle of 10 cm. The coated devices were attached to microcentrifuge tubes with crazy glue to add stability, and ease the handling process. The transdermal delivery experiments were carried out using EpiDerm Full Thickness (EFT-300) tissue models from MatTek Corporation.
The samples were placed on top of the tissue model units with sufficient pressure to ensure that the spikes had entered the tissue, thereby beginning the time release study. At each time point the tissue model its with the devices in place were moved into pre-warmed media, and supernatant was collected. After the 24 hour harvest, the devices were removed, the tissue was cut out of the holders and homogenized into 500 l of tissue culture media in a microfuge tube using a small motor-driven pestle. The ground tissue was centrifuged, and analysis of the supernatant medium was performed.
To test tissue viability after the 24 hour time point, mitochondrial dehydrogenase activity was assayed using Alamar Blue reduction. Due to this assay's interaction with the HRP assay only two tissue model units from each set were examined for viability.
Based upon the foregoing disclosure, it should now be apparent that hormones, and in particular, PTH(1-34), together with polymer (e.g. in an electrospun formulation) can be used prophylatically (to prevent) or therapeutically (to treat) bone loss. A
particularly desirable administration approach is transdermal, via microprojections (e.g. an array of microneedles). A
variety of polymers and hormones (or hormone combinations), as well as delivery vehicles, can be used without departing from the spirit of the invention. For example, iIn one embodiment, the electrospun polymer/hormone(s) fiber mat is placed directly on the skin. In another embodiment, the polymer/hormone(s) fiber mat is part of a delivery vehicle (e.g. skin patch, microneedle array, etc.).
The disclosures of all patents and publications (including published patent applications) are hereby incorporated by reference to the same extent as if each patent and publication were individually and specifically incorporated by reference.
Although the invention has been described in detail with particular reference to certain embodiments detailed herein, other embodiments can achieve the same results.
Variations and modifications of the present invention will be obvious to those skilled in the art and the present invention is intended to cover in the appended claims all such modifications and equivalents.
Figure 16 shows a C. botulinum type A toxin amino acid sequence;
Figure 17 shows another C. botulinum type A toxin amino acid sequence;
Figure 18 shows the amino acid sequence of wild-type anthrax protective antigen;
Figure 19 shows the nucleotide sequence encoding wild-type anthrax protective antigen;
Figure 20 shows the amino acid sequences of human 1- 34 PTH and bovine 1- 34 PTH.
(The present invention is not limited only to administering human hormones.
The hormone homolog from other species (e.g., salmon, porcine, etc.) may have equal or better results);
Figure 21 shows the amino acid sequences for GLP-1, Exendin-4, Exendin-4 (3 -39), and Exendin-4 (9 - 39);
Figure 22 shows the nucleotide sequence of the coding region for the C.
botulinum type A
neurotoxin;
Figure 23 shows C. botulinum type A toxin expression constructs; constructs used to provide C. botulinum or C. difficile sequences also are shown;
Figure 24 shows the nucleotide sequence of the C. Botulinum C fragment gene sequences contained within pAlterBot;
Figure 25 shows the C. botulinum type A toxin expression constructs;
constructs used to provide C. botulinum sequences also are shown;
Figure 26 shows the nucleotide sequence present in the pETHisa vector which encodes the pHisBot fusion protein;
Figure 27 shows the amino acid sequence of the pHisBot protein; and Figure 28 shows the expected results in a test of electrospun PA
functionality.
DETAILED DESCRIPTION OF THE INVENTION
' As used herein the word "asperities" means the microscopic surface elevations present on the surface of a material due to surface roughness of a material, such as pins, microprojections, and microneedles. The asperities, microprojections, and microneedles preferably are in the form of piercing elements which are dimensioned to penetrate into or through a desired body part such as a tissue, or organ, or which may deliver a biological material transdermally, intradermally, intraepidermally, or transmucosally. In a non-limiting embodiment, the asperity, microprojection, or microneedle is dimensioned such that it penetrates through the stratum corneum into the underlying epidermis layer, and in some embodiments, the dermal layer of the skin.
The term "transdermal" are used herein means the delivery of an agent into and/or through at least the top layer of the skin. The term "intradermal" means the delivery or release within the skin.
The term "intra-epidermal" means the delivery or release specifically within the epidermal layer of the skin.
While the microneedle embodiment (described below) may be employed, other systems and apparatus that employ tiny skin piercing elements to enhance transdermal agent delivery are also contemplated, as disclosed in U.S. Pat. Nos. 5,879,326, 3,814,097, 5,250,023, 3,964,482, Reissue U.S. Pat. No. 25,637, and PCT Publication Nos. WO 96/37155, WO 96/37256, WO
96/17648, WO
97/03718, WO 98/11937, WO 98/00193, WO 97/48440, WO 97/48441, WO 97/48442, WO
98/00193, WO 99/64580, WO 98/28037, WO 98/29298, and WO 98/29365; all incorporated herein by reference in their entireties.
It is not intended that the present invention be limited to a precise geometry or topology of the microneedles. In one embodiment, the microneedles are defined by a plurality of surfaces sloping upwards from a relatively broad base to a tip (e.g. a pyramidal shape). In another embodiment, the microneedles have a generally conical-shaped body (e.g. a single curved surface).
Furthermore, within the scope of the present invention, the asperities, such as microprojections and microneedles, in one embodiment, may include one or more indentations and/or barbs, which aid in retaining the nanofibers on the asperities.
It is not intended that the present invention be limited, by the precise dimensions of the microneedles. In one embodiment, the microneedles described herein have a microneedle height to width (measured at the base) ratio of between 1.2 and 2.0 (and in one embodiment between 1.4 and 1.7), and the structure is predominantly solid, rather than hollow. These factors contribute to the force required to penetrate human skin being smaller than that required to break the penetrating elements. This applies to both single microneedles and various microneedle arrays, for which penetration forces are different depending on the number of penetrating elements, their height and spacing between adjacent microneedles.
In one embodiment, a prototypical microneedle has a diameter of between 200 and 500 microns (and in another embodiment, between 300 and 400 microns) at its broad end (e.g., at the base), and tapers to a sharp tip or chisel edges with a somewhat smaller diameter at its other end.
The diameter of the tip may, for example, be in the range from about 50 microns to about 1 microns.
In one embodiment, the microprojections or microneedles have a length (or height) or less than 1000 microns, and in one embodiment less than 700 microns, but more than 250 microns. In another embodiment, the microneedles have a height of between 550 and 650 microns (such as, for example, between 580 and 620 microns) with a height to width ratio of between 1.5 and 1.7. The microprojections may be formed in different shapes, such as needles, blades, pins, punches, and combinations thereof. In one embodiment, the microneedles are pyramidal in shape (e.g., having between 6 and 12 sides, and in one embodiment, eight sides).
The term "fiber" includes not only structures that are cylindrical, but also includes structures which vary from a cylindrical shape, such as, for example, structures which are spherical, acicular, droplet shaped, or flattened or ribbon shaped. A "fiber-forming" material is capable of being fabricated into fibers. The fiber-forming materials that may be used in this invention include polymers, which can be in a liquid state, such as melted, in solution, or in suspension.
Water, organic solvents, or mixtures thereof.or heat can be used to convert solid polymer into a liquid "fiber-forming" material. In one embodiment, electrospinning creates "pearls on a string"
or encapsulated balls on very thin fibers. This technique may be useful when compounds do not mix well, or when one needs to meet extended release requirements, or when one wants to deliver balls and the fibers are just a simple carrier.
Additionally, as used herein, nanofibers are fibers having an average diameter in the range of about 1 nanometer to about 25,000 nanometers (25 microns). In another embodiment, the nanofibers of the present invention are fibers having an average diameter in the range of about 1 nanometer to about 10,000 nanometers, or about 1 nanometer to about 5,000 nanometers, or about 3 nanometers to about 3,000 nanometers, or about 7 nanometers to about 1,000 nanometers, or even about 10 nanometers to about 500 nanometers, In another embodiment, the nanofibers of the present invention are fibers having an average diameter of less than 25,000 nanometers, or less than 10,000 nanometers, or even less than 5,000 nanometers. In still another embodiment, the nanofibers of the present invention are fibers having an average diameter of less than 3,000 nanometers, or less than about 1,000 nanometers, or even less than about 500 nanometers.
In another embodiment, the nanofibers may have a diameter as small as 0.3 nanometers. In yet another embodiment the nanometers have a diameter between 3 nanometers and about 25 microns. In a further embodiment, the nanofibers have a diameter of from about 100 nanometers to about 25 microns. In still another embodiment the nanofibers have a diameter of from about 100 nanometers to about a micron. Such small diameters provide a high surface area to mass ratio, such as, for example, about 300m2/g. Within the scope of the present invention, a fiber may be any length. The term "fiber" also encompasses particles that are drop-shaped, flat, or that may otherwise form a cylindrical shape. Additionally, it should be noted that here, as well as elsewhere in the text, ranges may be combined.
The at least one fiber-forming material used in this invention may be selected from any fiber-forming material which can be dissolved and is otherwise compatible with the biological material to be preserved. Fiber-forming materials which may be used in the practice of the method of the present invention include water soluble polymers, for example. In particular, acceptable fiber-forming materials, by way of example and not of limitation, include polyvinyl pyrrolidone) (PVP), polyethyl oxazoline (PEOZ), polyethylenlmine (PEI), polyethylene oxide (PEO) and mixtures thereof. Other polymers of interest include polyvinylalcohol, poly(ethylene glycol), polyoxymethylene, poly(hydroxyethyl methacrylate), carboxymethyl cellulose, hydroxypropylcellulose, alginic acid, chitosan, poly(glutamic acid), poly(isobutylacrylamide), poly(butyl methacrylate), poly(ethyl methacrylate), poly(vinylidene fluoride) poly(hydroxyvalerate), poly(L-lactic acid), polycaprolactone, poly(lactide-co-glycolide), poly(hydroxybutyrate), poly(hydroxybutyrate-co-valerate), polydioxanone, polyorthoester, polyanhydride, poly(glycolic acid), poly(vinyl methyl ether), polyvinylidene chloride, polyacrylonitrile, poly(trimethylene carbonate), poly(iminocarbonate), and copolymers thereof. Other illustrative polymers are set forth in Table 1 below.
A. Suitable Hydrophilic Polymers Polyacrylamide Poly(Acrylic Acid-Co-Hypophosphite) Polyacrylic Acid, Sodium Salt Poly(Alkyl(C 16-22)Acrylate) Poly(Ethylene Glycol) or Poly(Propylene Glycol) Poly(Vinyl Alcohol) Polypyrrolidone or Polyvinylpyrrolidone Polysaccharides Such As Chitosan, Alginate, Amylose Water Soluble Fractions Of Proteins Such As Collagen, Gelatin B. Suitable Biostable, Hydrophobic Polymers Poly(Divinylbenzene-Co-Ethylstyrene) Polyisobutylene Polylimonene Polymaleic Acid Polyoxyethylene Dioleate Poly(Vinyl Acetate) or Poly(Vinyl Chloride) Polystyrene, Polyurethane, Polyurethane-Poly(Ethylene Oxide) Graft Copolymer Poly(Ether Urethane) or Poly(Ether Urethane Urea) Polyethylene Polycarbonate Poly(Ester Amide) Polyacrylonitrile Poly(Aryl Ether Keton) Poly(Dimethyl Siloxane) And Other Polysiloxanes Poly(Ethylene Terephthalate) And Other Polyesters Poly(2-Hydroxyethylmethacrylate) or Polymethylmethacrylate C. Suitable Biodegradable, Hydrophobic Polymers Poly(Glycolic Acid), Poly(Lactic Acid) And Co-Polymers Thereof Polyhydroxybutyrate (Phb) Polyhydroxyvalerate (Phv), And Co-Polymers Thereof Polycaprolactone Polydioxanone And Other Synthetic Degradable Polyesters, Blends Thereof, And Copolymers Thereof Polyanhydrides Poly(Amino Acids) Such As Poly(Benzyl Glutamate) "Pseudo"-Poly(Amino Acids) Such As Tyrosine-Derived Polycarbonates And Polyarylates And Copolymers Thereof With Poly(Ethylene Glycol) Poly(Ortho Ester) Polyphosphazenes Poly(Propylene Fumarate) Although not specifically limited to any one production method, the fibers and/or nanofibers of the present invention are, in one embodiment, formed via an electrospinning process. The electrospinning of liquids and/or solutions capable of forming fibers, also known within the fiber forming industry as electrostatic spinning, is well known and has been described in a number of patents as well as in the general literature. The process of electrospinning generally involves the creation of an electrical field at the surface of a liquid. The resulting electrical forces create ajet of liquid that carries electrical charge. Thus, the liquid jets may be attracted to other electrically charged objects at a suitable electrical potential. As the jet of liquid elongates and travels, it will harden and dry. The hardening and drying of the elongated jet of liquid may be caused by cooling of the liquid, i.e., where the liquid is normally a solid at room temperature:
evaporation of a solvent, e.g., by dehydration, (physically induced hardening), or by a curing mechanism (chemically induced hardening) or by a combination of such methods. The produced fibers are collected on a suitably located, oppositely charged receiver and subsequently removed from it as needed, or directly applied to an oppositely charged or grounded generalized target area. In a non-limiting embodiment, the fibers are collected on a receiver such as, for example, a polystyrene or polyester net or a foil slide.
Fibers produced by this process have been used in a wide variety of applications, and are known, from United States Patent Nos. 4,043,331: 4,878,908; and 6,753,454, all of which are incorporated herein by reference in their entireties. One of the major advantages of electrospun fibers is that very thin fibers can be produced having diameters, usually on the order of about 50 nanometers to about 25,000 nanometers (25 microns), or even on the order of about 50 nanometers to about 5,000 nanometers (5 microns), or even on the order of about 50 nanometers to about 1,000 nanometers.
It will be appreciated that, because of the very small diameter of the fibers, the fibers have a high surface area per unit of mass. This high surface area to mass ratio permits fiber-forming material solutions to be transformed from solvated fiber-forming materials to solid nanofibers in fractions of a second. When biological materials are dissolved or suspended in a fiber-forming material solution which then is formed into fibers, the samples experience a rapid loss of excess solvent. This invention thereby also provides a fiber containing a mixture of at least one fiber-forming material and at least one preserved biological material and optionally other materials (e.g.
carriers, fillers, etc.). The mixture may, in some embodiments, be substantially homogeneous;
however, the present invention also contemplates non-homogeneous mixtures.
As one skilled in the art will recognize, the fibers may be spun using a wide variety of conditions such as potential difference, flow rate, and gap distance. These parameters will vary with conditions such as humidity or other environmental conditions, the size of the biological material or other additive, the solution viscosity, the collection surface, and the polymer conductivity, among others. The at least one fiber-forming material is in a liquid state when it is electrospun with the biological material to form a fiber containing a mixture of the at least one fiber-forming material and the at least one biological material. In one embodiment, the present invention contemplates mixtures of the at least one fiber-forming material and at least one biological material, including mixtures where the biological material is soluble in the at least one fiber-forming material in its liquid state (homogeneous or single phase systems) and those mixtures in which the at least one biological material is insoluble in the at least one fiber-forming material in its liquid state (heterogeneous or multi-phase systems). When the biological material is insoluble in the at least one fiber-forming material in its liquid state, the biological material may take the form of a suspension or emulsion in the fiber-forming material. Whether the biological material is soluble or insoluble in the fiber-forming material, the biological material and the fiber-forming material may be mixed by any method which forms a substantially uniform mixture, including, for example, mechanical shaking or stirring, although other methods (such as sonication) may be used. As one skilled in the art will recognize, solubility of the biological material in the fiber-forming material solution will depend on the characteristics of the material itself, as well as factors such as, for example, the requirements of the material for a specific pH range, osmolarity, or the presence of co-factors for the material.
By way of a non-limiting example, polyethylene oxide (PEO) (Mw 400,000), and polyvinylpyrrolidone (PVP) (Mw 360,000) can be used as polymer substrates for the electrospinning of fibers. In case of PEO, about 2.5 mg/ml of bioactive agent(s) in approximately 6% w/v polymer solution can be used in electrospinning the sample. A cone cap is typically used to do the spinning at room temperature, using a voltage of 14 KV, a current of 80 nA, and positive polarity. The gap distance can be 28.5 cm, and the sample can be collected on polyester net or other suitable substrate.
By way of a non-limiting example, PVP fibers can be electrospun from a solution containing about 2.5 mg/ml of bioactive agent(s) in 22% w/v polymer. A cone cap is again typically used to do the spinning at room temperature, using a voltage of 22 KV, a current of 360 nA, and positive polarity. The gap distance can be 23 cm, and the sample collected on a polyester net or other suitable substrate.
Although not limited solely hereto, suitable arrays of asperities can made by the growth of elongated cylindrical crystals by a vapor-liquid-solid process; growth of polycyanoacrylate fibers from small deposits of catalyst material; MEMs technology of the sort utilized in the semiconductor electronics industry; removing, by dissolution, fracture, or decomposition, the matrix from a composite that contains acicular particles; and in many other ways known in the art.
In one non-limiting embodiment, the asperities are microneedles which are anisotropically etched MEMs microneedles in silicon.
In one embodiment, the solid microneedles are fabricated in a crystal silicon material suitable for use in the administration of the various preparations discussed herein. Without limiting the invention in any manner to any particular mechanism, it is believed that the biologically active materials or drug(s) is delivered by microporation of the stratum corneum, and polymer-drug deposition within the patient's skin and subsequent dissolution or erosion of the polymer. The drug becomes thereby bioavailable; it can dissolve and diffuse to the biological target, or alternatively, it can remain at the site of administration. Micropores are made into the stratum comeum by means of a microneedle array penetration, which optionally can be enhanced further by applying energy in the form of ultrasonic, heat and/or electric signals across or through the skin.
As is discussed above, it is possible to incorporate, encapsulate, entrap and/or deposit one or more compounds or substances on, in or around fibers and/or nanofibers. One manner by which this can be accomplished is by dissolving and/or dispersing the desired substance(s) or compound(s) in a polymer solution that is to be electrospun before it is electrospun. In one embodiment, the material inside the nanofiber is sequestered and preserved by the polymer matrix provided by the nanofiber.
Pharmaceutically active or bioactive substances which may be included in the electrospun material are listed in the Physicians' Desk Reference, 57th Edition (2003), and include allergens, amebicides and trichomonacides, analeptic agents, analgesics, anorexics, antacids, antihelmintics, antialcohol preparations, antiarthritics, antiasthma agents, antibacterials and antiseptics, antibiotics, antiviral antibiotics, anticancer preparations, anticholinergic drug inhibitors, anticoagulants, anticonvulsants, antidepressants, antidiabetic agents, antidiarrheals, antidiuretics, antienuresis agents, antifibrinolytic agents, antifibrotics (systemic), antiflatulents, antifungal agents, antigonadotropin, antihistamines, antihyperammonia agents, anti-inflammatory agents, antimalarials, antimetabolites, anti-migraine preparations, antinauseants, antineoplastics, anti-obesity preparations, antiparasitics, anti-parkinsonism drugs, antipruritics, antipyretics, antispasmodics and antichloinergics, antitoxoplasmosis agents, antitussives, antivertigo agents, antiviral agents, bone metabolism regulators, bowel evacuants, bronchial dilators, calcium preparations, cardiovascular preparations, central nervous system stimulants, cerumenolytics, chelating agents, choleretics, cholesterol reducers and anti-hyperlipemics, colonic content acidifiers, cough and cold preparations, decongestants, expectorants and combinations, diuretics, emetics, enzymes and digestants, fertility agents, fluorine preparations, galactokinetic agents, geriatrics, germicides, hematinics, hemorrhoidal preparations, histamine H. receptor antagonists, hormones, hydrocholeretics, hyperglycemic agents, hypnotics, immunosuppressives, laxatives, mucolytics, muscle relaxants, narcotic antagonists, narcotic detoxification agents, ophthalmological osmotic dehydrating agents, otic preparations, oxytocics, parashypatholytics, parathyroid preparations, pediculicides, premenstrual therapeutics, psychostimulants, quinidines, radiopharmaceuticals, respiratory stimulants, salt substitutes, scabicides, sclerosing agents, sedatives, sympatholytics, sympathomimetics, thrombolytics, thyroid preparations, toxins for therapeutic vaccine use, tranquilizers, tuberculosis preparations, uricosuric agents, urinary acidifiers, urinary alkalinizing agents, urinary tract analgesic, urological irrigants, uterine contractants, vaginal therapeutics and vitamins and each specific compound or composition listed under each of the foregoing categories in the Physicians' Desk Reference.
They include, but not limited to water-soluble molecules possessing pharmacological activity, such as a peptide, protein, enzyme, enzyme inhibitor, antigen, cytostatic agent, anti-inflammatory agent, antibiotic, DNA-construct, RNA-construct, or growth factor. Examples of therapeutic proteins are interleukins, albumins, growth hormones, aspariginase, superoxide dismutase, monoclonal antibodies. Biological agents include also water-insoluble drugs, such as camptothecin and related topoisomerase I inhibitors, gemcitabine, taxanes and paclitaxel derivatives.
Other compounds include, for example, peptides, including peptidoglycans, as well as anti-tumor agents, cardiovascular agents such as forskolin; anti-neoplastics such as combretastatin, vinbiastine, doxorubicin, maytansine; anti-infectives such as vancomycin, erythromycin;
anti-fungals such as nystatin, amphotericin B, triazoles, papulocandins, pneumocandins, echinocandins, polyoxins, nikkomycins, pradimicins, benanomicins; anti-anxiety agents, gastrointestinal agents, central nervous system-activating agents, analgesics, fertility agents, anti-inflammatory agents, steroidal agents, anti-urecemic agents, cardiovascular agents, vasodilating agents, vasoconstricting agents and the like.
Other biologically active agents which may be included in the electrospun material include vaccine antigens. The vaccine antigens of the invention can be derived from a cell, a bacteria or virus particle or a portion thereof. The antigen can be a protein, peptide, polysaccharide, glycoprotein, glycolipid, or combination thereof which elicits an immunogenic response in a human;
or in an animal, for example, a mammal, bird, or fish. The immunogenic response can be humoral, mucosal, or cell mediated. Examples are viral proteins, such as influenza proteins, human immunodeficiency virus (HIV) proteins, Herpes virus proteins, and hepatitus A
and B proteins.
Additional examples include antigens derived from rotavirus, measles, mumps, rubella, and polio; or from bacterial proteins and lipopolysaccharides such as Gram-negative bacterial cell walls. Further antigens may also be those derived from organisms such as Haemophilus influenza, Clostridium antigens, including but not limited to, Clostridium tetani, Corynebacterium diphtheria, and Nesisseria gonhorrhoae, as well as anthrax antigens.
In another embodiment, the bioactive agent in the electrospun formulation comprises a cytokine. Cytokines are hormone-like substances secreted by a wide variety of cells, including (but not limited to) lymphocytes (e.g., T cells), macrophages, fibroblasts, and endothelial cells. It is now known that cytokines consist of a broad class of glycoproteins that have the ability to regulate intercellular communication (e.g., cell-cell interaction) in both normal and pathologic situations.
Cytokines generally contain from approximately 60 to 200 amino acid residues, with a relative molecular weight of between 15 and 25 kd. At least 35 distinct cytokines have been elucidated. It is not intended that the present invention be limited by the particular cytokine.
Table 2 provides illustrative examples.
ame bbr. y e Specific Name nterferons FN I ha Leukocyte Interferon eta Fibroblast Interferon amma acro hage Activation Factor nterleukins L-1 1 alpha ndogenous P ro en I beta ymphocyte-Activating Factor I ra L-1 Receptor Antagonist L-2 -cell Growth Factor L-3 ast Cell Growth Factor L-4 -cell Growth Factor L-5 osino hil Differentiation Factor L-6 bridoma Growth Factor L-7 m ho oietin L-8 Granulocyte Chemotactic Protein L-9 e akar oblast Growth Factor L-10 Cytokine Synthesis Inhibitor actor L-11 Stromal Cell-Derived Cytokine IL-12 4atural Killer Cell Stimulatory actor umor Necrosis Factors F alpha Cachectin eta m hotoxin Colony Stimulating CSF GM-CS Granulocyte-macrophage Colony-actors Stimulating Factor p-CS acrophage Growth Factor G-CSF Granulocyte Colony-stimulating actor PO r hropoietin ransforming Growth GF eta 1 Cartilage-inducing Factor Factor eta 2 pstein-Barr Virus-inducing actor eta 3 issue-derived Growth Factor Other Growth Factors IF eukemia Inhibitory Factor W acrophage Migration-inhibiting actor CP onocyte Chemoattractant rotein EGF idermal Growth Factor DGF latelet-derived Growth Factor FGF lpha cidic Fibroblast Growth Factor eta 3asic Fibroblast Growth Factor LGF nsulin-like Growth Factor GF erve Growth Factor CGF .13-cell growth factor Thus, the present invention provides a method of administering one or more drugs to a patient comprising the steps of penetrating at least an outer layer of the skin of the patient with one or more asperities, such as pins, microprojections, or microneedles extending from a surface of a substrate, wherein at least one of the one or more asperities, such as pins, microprojections, or microneedles (or portion thereof), is contacted or coated (uniformly or non-uniformly) with an electrospun polymer/drug(s) preparation, and releasing at least one of the one or more drugs into the patient.
The relative amounts of fiber-forming material and biological material that may be present in the fiber of the present invention may vary. In one embodiment, the biological material comprises between about 1 and about 50 percent (more typically 30 percent) by weight to volume (w/v) of the mixture from which the fiber is electrospun. In another example, the biological material comprises 10 percent of the mixture or less. In still another example, the biological material may be 25 percent, 5 percent, 0.5 percent of the mixture by weight to volume. It is envisioned that larger or smaller concentrations of biological material may also be utilized.
It is advantageous to coat the asperities (including microprojections and microneedles) with nanofibers which contain useful substances inside or on the nanofiber.
Different substances can be concentrated near the tips of the asperities. The high surface area per unit volume of a fiber, in particular a nanofiber, makes it possible to carry a high mass of particles containing bioactive material per unit volume on the outside surface of the fiber and/or nanofiber.
In one embodiment, it is even more useful to coat the tips of the asperities with nanofibers carrying one or more useful substances, and to have nanofibers that sequester a second set of useful substances span the regions between the asperities.
If, in one embodiment, the surfaces with asperities are mechanically pressed into contact with a second surface, the nanofibers on top of the asperities will be transferred onto, or impressed into the second surface. If, in one embodiment, the second surface is a sheet of material thinner than the height of the asperities, the nanofibers may be pushed through the sheet and available for chemical reactions or other purposes on the other side of the sheet while the nanofibers that span the spaces between the asperities are pressed onto the first surface of the sheet.
In one, embodiment, the present invention permits a designer to specify the relative amounts and kinds of useful materials, in each of three regions: on the surface near the tip of the asperity, a ball on top of the asperity, (including microprojections and microneedles) and in the space between the asperities. Such designs can be manufactured by one or methods in accordance with the present invention.
In one embodiment, quantities of around 1 microgram of one or more bioactive substances per pin and/or asperities have been found to be useful. For a material with a specific gravity near one, a cube with edges that are 0.1 mm (100 microns) long, would weigh 1 microgram. For nanofibers, the specific gravity is only about 0.2, so the volume required for 1 microgram is correspondingly larger The edge of a 1 microgram cube of nanofibers is about 170 microns long.
Coatings made of fibers and/or nanofibers for an array of asperities can be designed to produce a variety of useful arrangements of the nanofibers. Thus, in one embodiment, the present invention utilizes an attraction between electrically charged fibers and/or nanofibers and a sharp point. Further, because electrospun nanofibers are very long, the same nanofiber may span the space between adjacent tips and/or be attached to a large number of tips, resulting in the creation of a thin, non-woven sheet supported on the tips of the array of pins.
Other arrangements of the nanof bers, created by the methods of the present invention provide a number of advantages.
In one embodiment, the nanofibers are wrapped around the tip of each asperity, such as microprojections or microneedles, to form a relatively thick coating on the tip, with relatively few nanofibers spanning the spaces between the tips. This can be accomplished by controlling the electrospinning process so that the electrospinning jet is collected on the tips held near the location where the onset of the electrically driven bending instability occurs, and further, the jet is nearly dry, but is still soft and can readily bend. These conditions also favor mechanical buckling as the jet is caught and stopped on the tip. Via the present invention, the ability to create such nanofiber structures can be realized.
The combination of these effects, and the presence of the pin, causes the nanofibers to generate a cotton-swab-like ("Q-Tip"-like) collection of nanofibers near the tip of the pin.
Conglutination of the nanofibers can also be controlled, so that the fibers may range from fibers that are not attached to each other and slide past each other at crossing points, or fibers that are mechanically attached to each other at crossing points. The material on which the one or more asperities are formed must be a good enough electrical conductor that charge carried via or on the arriving jet(s) is conducted away. A sufficient level of ionic conductivity exists on the surface of ordinary glass at a normal ambient relative humidity. If a material with an excessively low conductivity is utilized, the effective conductivity of the asperities can be increased sufficiently by coating them with a ten to 1000 nanometer thick layer of carbon or other conductor or conductive material. This can be accomplished by any suitable technique including, but not limited to, vapor deposition, or by evaporation of carbon or metal onto the surface bearing the one or more asperities.
It should be noted that cotton-swab-like shapes can be used as collectors for electrospun nanofibers where. in one embodiment, such collectors are placed on one or more rotating mandrels In another embodiment, the present invention does not require the use of a rotating pin Instead, in this embodiment. the arriving nanofiber rotates around the tip region of the pin. This is made to happen locally and separately at the tip of each asperity. When the arriving fiber moves from one asperity to an adjacent one, a nanofiber segment remains between the two asperities, but the total amount of material in the spanning nanofibers is much less than the total amount accumulated near the tips of all the asperities.
In another embodiment, the arriving nanofibers can be accumulated in a "ball"
attached to the tip if the electrical conductivity of the collected fibers is kept at a relatively high value as the fiber accumulates. The conductivity of the solidifying nanofibers can be adjusted by addition of ions such as lithium or sodium, and, optionally. with a less volatile liquid substance added to the solvent used in the electrospinning process. The less volatile substance supports ionic conduction of the electrical charge on the arriving nanofiber to the asperity, which is maintained thereby at an attractive electrical potential. This condition allows the arriving nanofiber (which can, in one embodiment, be regarded as a jet solidified enough to retain its fiber-like shape, but still quite soft, sticky, and electrically conducting) to be collected on top of nanofibers that have already been collected. The less volatile solvent can be retained in the collected nanofibers, or in another embodiment this solvent can be evaporated in a time slightly longer than the time required to collect the desired mass of nanofibers.
In the absence of such ionic conduction through the collected fibers, charge retained on the topmost layer will repel the arriving nanofiber, and cause it to move toward uncoated pins. The uncoated pins may be some distance away: so long lengths of spanning nanofiber can be generated, in form of a non-woven mat and utilized in some embodiments of the present invention.
Three modes of collection of nanofiber are available to the device designer, although the present invention is not limited thereto. Two cause the nanofiber to be collected on or in front of the tip of the asperity, where the probability of its being pressed mechanically through a thin layer of material is high. The third mode is the a "non-woven mat" supported on the tips of the asperities Only a relatively small fraction of the material in the "non-woven mat' will be carried through the surface as the as the asperities are pressed against the surface. The remaining matter is brought into intimate contact with the outer surface of the thin layer, where it can be used to protect the surface or in other ways.
In one embodiment, the present invention relates to a structure where the tips of one or more asperities are coated with a cotton-swab-like arrangement of nanofibers bearing one useful material.
Another set of useful materials is collected in balls attached to the tip of each asperity. A third set of useful materials is collected in nanofibers that span the spaces between asperities.
In another embodiment, the present invention relates to multilayer structures where material is collected in the vicinity of the tip of the pin. in the 'cotton-swab-like"
part of the structure, the material collected in "balls" in front of the tip of the asperity, and the "spanning segments" that extend from the tip of one asperity to the tip of an adjacent asperity.
An electrospinning jet that wrapped polyethylene oxide nanofibers around or on the tip of each asperity in an array, was demonstrated by collecting nanofibers on closely spaced carbon fibers of the sort used in reinforced composites, which are electrically conducting, very stiff, and have diameters of about 7 microns. The jet used was, in one embodiment. less than a centimeter in length.
Potential differences between the electrospinning tip and the electrically grounded carbon fibers were in the range between about one and about two kilovolts, although the present invention is not limited to just these differences. The diameters of the collected nanofibers were about one micron.
The velocity of the jet as it arrived at the tips of the carbon fibers was low, perhaps less than about one meter per second, or perhaps even about one tenth of one meter per second. The specifications above were of a representative experiment and are not intended to act as limitations on the scope of the present invention.
The carbon nanofibers, separated by various distances, were mounted on adhesive tape at lateral distances ranging from about one millimeter to side by side contact.
The carbon fibers were projected at different distances toward the jet. Cottonswab-like coatings were formed on fibers separated by less than one millimeter. Balls were grown on fibers that projected furthest in the direction from which the jet arrives. The balls and cotton-swab-like structures sometimes formed at the tips of two carbon fibers which were separated by less than a few tens of microns A relatively small number of spanning nanofibers extended between fibers that are about one millimeter apart.
Figure 1 is a low magnification optical image of 7 micron diameter carbon fibers supported on transparent tape. The divisions in the scale shown in the image are one millimeter apart. The tips of the fibers were coated with polyethylene oxide nanofibers by the electrospinning methods described in this invention. The carbon nanofibers were grounded, and then held about 1 cm below the tip at which the electrospinning jet was created. The orifice from which the jet issued was at the end of a slender glass tube which had an internal diameter of about 60 microns. The potential difference between the electrospinning tip and the carbon nanofibers was about 1.5 kV. The position at which the electrically driven bending instability occurred is noted, and the tips of the carbon fibers were held. by hand and moving slightly, near this position. The collection of the nanofibers required about 10 or 20 seconds, and was terminated when white spots are visible at the ends of the carbon fibers. The nanofiber coating extended all the way around the tip of each of the carbon fibers.
Figure 2 shows a coated carbon fiber tip at higher magnification. The diameter of the coated fiber was about 70 microns, so the radial thickness of the coating was about 30 microns. Several spanning nanofibers can be seen near the tip. showing that the number of spanning nanofibers was smaller than the number of nanofibers on the tip. The end of the coated fiber is rounded. The diameter varied slightly at different places along the axis. The upper part of the figure is out of focus, and is seen, by focusing on this region, to be smaller in diameter than the region near the tip.
Figure 3 shows the tip of a carbon fiber, of the same sort as in Figures 1 and 2, coated with a ball of nanofibers at the tip. This carbon fiber is extended beyond its neighbors, and is in a position to collect more, less dry fibers, which is consistent with the mechanisms described in this disclosure, for the creation of balls on the tips by enhanced electrical conductivity of the collected fibers.
If the jet were wet when collected, balls or droplets also form. The fluid jet carries liquid into the droplet until the charge accumulates to a high enough value to cause the jet to move to a new location, usually leaving a spanning fiber to mark its path. These droplets do not dry as rapidly as nanofibers, but probably still provide significant sequestration and protection to bioactive substances in the fluid. The distinctions between balls of nanofibers and fluid droplets are noted but not emphasized or critical to the present invention.
In one embodiment, the devices of the present invention are employed for the injection of bioactive substances through the skin. Bioactive substances, (for therapeutic, diagnostic, vaccination, immunization, behavior modification, health monitoring, and other such purposes) need to be injected through the skin. This can be accomplished by coating the bioactive substance on a tapered pin which pierces the skin and deposits the bioactive material inside, either as a particle or by dissolving it in blood or other body fluids.
In practice it is desirable to use arrays of many pins, or microprojections, or microneedles to achieve efficacious concentrations of the bioactive material inside the body.
In most instances below, references to a pin or microprojection or microneedle are intended to describe both a single pin, microprojection, or microneedle, and an array of a large number of similar pins, microprojections, or microneedles. A prototypical pin, microprojection, or microneedle for this purpose, in one embodiment, has a diameter of about 100 microns at its broad end and tapers to a sharp tip of chisel edges with somewhat smaller diameter at its other end. The diameter of the tip may for example, be in the range from about 50 microns to about 5 microns.
Such a pin, microprojection, or microneedle can be inserted through the skin and withdrawn with minimal damage to the skin tissue.
It is advantageous to coat the tip with nanofibers which contain a useful substance inside or on the nanofiber. When the coated pin, microprojection, or microneedle is inserted through the skin, the coating material is distributed between the outer surface of the skin, the surface of the hole created in the skin, and the interior of the body.
In another embodiment, the present invention relates to nanofibers that are carried on a pin, microprojection, or microneedle that will and/or are designed to absorb substances from inside the body and retain a sample of these substances when the pin is withdrawn. The retained substances can then be analyzed for diagnosis, control, or other purposes. Glucose concentration monitoring provides an example.
Nanofibers adhere tightly to the tips and to each other during insertion. When wet with bodily fluids the fibers may become slippery, dissolve, degrade, release bioactive substances by leaching or chemical reaction or produce other useful effects. The material used for the nanofiber and the known possibilities for forming nanofibers from complex mixtures of substances provide many options, which are included in this invention.
The bioactive materials are to be injected through the skin, as described herein. The spanning nanofibers are applied in a thin layer. For example, the spanning fibers could be a nitric oxide (or chlorine dioxide) releasing structure of the sort described in other co-owned University of Akron patents. This sort of non-woven mat applied over the top of pins, microprojections, or microneedles, already coated with the bioactive substances for injection through the skin, could be used both to keep the device sterile between manufacture and use, and to sterilize the skin during and after use.
The non-injected material in the spanning nanofibers contributes to an advantageous design that utilizes both injected and non-injected components of the nanofibers.
Because the pins used to carry the nanofibers through the skin are much thicker than the carbon fibers, and in ordered arrays, it is clear from the results obtained with the thin carbon fibers, that microgram quantities of nanofibers can be placed at desired locations, described above, on the arrays of pins created by MEMs fabrication methods.
The cotton-swab like shape is a desirable arrangement of nanofibers, since the majority of the useful material is attached directly to the part of the pin that will be inside the skin when the device is used, Reactions between reagents in dry fibers that span the spaces between pins can release a material to disinfect the skin, or to adhere to the skin after the pins are removed and manage fluids escaping from the puncture holes, or for other purposes.
Because, in one embodiment, the nanofibers of the present invention are much smaller than the asperities needed to penetrate the skin, the shape of the tips of the pins can be modified to carry more nanofibers through the skin.
Figure 4 shows radial steps which both increase the surface area near the tip and provide corners that protect some of the nanofibers from the shearing forces that would otherwise wipe the nanofibers off the tip as it is forced through the skin.
Figure 5 provides even more protection of against wiping off of material to be injected, obtained by the creation of forward facing barbs and also illustrates the use of circumferential grooves to protect the fibers from wiping.
Figure 6 has backward facing barbs that protect some of the nanofibers from wiping as the point is inserted, and also tends to carry some of the nanofibers as the tip is withdrawn. The withdrawn material would then be available for analysis. Only the region close to the tip of the pin is shown in these three figures. The patterns shown are not limiting. These patterns may continue in the same way or with variations along the entire surface of the pin.
In another embodiment, two drugs are employed in an electrospun formulation.
In some embodiments, the first drug and the second drug are different, but selected from antidepressant compounds, analgesic compounds, anti-inflammatory steroidal compounds (corticosteroids), non-steroidal anti-inflammatory compounds (NSAIDs), antibiotic compounds, anti-fungal compounds, antiviral compounds, antiproliferative compounds, antiglaucoma compounds, immunomodulatory compounds, cell transport/mobility impeding agents, cytokines and peptides/proteins skin-treating compounds sunscreens skin protectants, leukotrienes such as LTB4, antimetabolite compounds, antipsoriatic compounds, keratolytic compounds, anxiolytic compounds, and antipsychotic compounds. In a preferred embodiment, the polymer/two drug electrospun preparation is delivered transdermally, intradermally, intra-epidermally, transmucosally, or subcutaneously. Alternatively, the electrospun material including the two drugs is delivered IP, IV, or IM.
The present invention further contemplates, in one embodiment, a drug delivery system comprising a) a substrate comprising asperities such as microprojections or microneedles, and b) an embodiment of the various electrospun preparations (mentioned above). The term "substrate", as used herein, includes materials out of which the asperities are made including, but not limited to, silicon. When microprojections or microneedles are used, they may be, in one embodiment, solid.
In another embodiment, they may be hollow. It is not intended that the present invention be limited to the manner in which the microneedles are contacted with the electrospun preparation. In one embodiment, the microneedles are contacted only at the microneedle tips. In one embodiment, the preparation contacts the entire substrate (or substantially the entire substrate) such that the preparation contacts even the spaces between an array of microneedles. It is not intended that the present invention be limited to uniform coatings of the preparation. In one embodiment, the preparation is present on the substrate in a non-uniform manner. In one embodiment, an electrospun polymer/drug(s) preparation is sprayed on said microneedles. In one embodiment, said microneedles are dipped into an electrospun preparation.
In one embodiment of the multidrug microneedle array, the drugs are separated on the array into different regions or zones in the manner of a mosaic. Conceptually, the mosaic approach provides a means of packaging, storing and delivering to the patient drug combinations without encountering conventional formulation issues. Incompatible drugs need not be chemically "compatibilized" if they are deposited and stored at different addresses on a microneedle array or other type of skin patch.
One particularly useful application of the mosaic design comprises a multidrug microneedle embodiment where a non-polar and a polar drug are to be co-administered. While such drugs are not easily mixed into a single vehicle, the mosaic design permits both drugs to be on the same delivery platform, albeit separated. Another particularly useful application of the mosaic design comprises a multidrug microneedle embodiment wherein it is desired to carry drugs that cancel one another's side effects or that have synergistic effects. Such uses would be particularly appropriate where traditional formulation happens to be problematic.
It is not intended that the present invention be limited by the nature of the substrate comprising said microneedles. In one embodiment, the microneedles are formulated out of polymer.
In another embodiment, the microneedles are made with a mold. In a preferred embodiment, the microneedles are etched out of a silicon substrate. In a preferred embodiment, said silicon microneedles are solid and the electrospun polymer/drug(s) formulation is deposited on said microneedles.
It is not intended that the present invention be limited to a single polymer or a single layer on said microneedles. In one embodiment, a first layer comprises a first polymer and a second layer a second polymer, where said second polymer is less soluble (e.g. in water) than said first polymer (Figure 7A). When the microneedles are administered, the microenvironment of the skin causes the first layer to dissolve (or substantially dissolve) thereby releasing the second (or top) layer from the microneedles (Figure 7B). The bioactive agent (e.g. drug, antigen or other substance to be delivered) can be in the first layer, second layer, or both. Preferably, it is in the second layer. For example, in one embodiment, the present invention contemplates a substance delivery device comprising: a substrate having a back surface and a front surface; a plurality of solid microneedles extending upwards from the front surface of the substrate; a first polymer layer in contact with said microneedles; and a second polymer layer in contact with said first polymer layer, said second polymer layer comprising at least one bioactive substance.
It is also not intended that the present invention be limited to inflexible microneedle arrays.
Indeed, embodiments of flexible microneedle arrays are contemplated. In one embodiment of a flexible microneedle, the present invention contemplates separating microneedles into individual "islands" by cutting into (and even through) the substrate so as to define such islands or regions separated by channels or streets (which can be, in one embodiment, filled or partially filled with polymer or drug). In one embodiment, the present invention contemplates mounting the substrate onto an adhesive material (e.g. adhesive tape) and dicing or cutting through the substrate to generate flexible arrays (Figure 8). In this manner, the risk of breakage when pushing against the back of the silicon substrates, when applying the patch to the skin, is reduced.
Various features can be added to the microneedle arrays to assure proper delivery. In one embodiment, the present invention contemplates the use of a plastic or otherwise elastomeric device positioned above the array relative to the skin (or attached or incorporated into the substrate or upper layer) that snaps into place once pressure is applied against the patch to push and keep the array of microneedles in the skin while the patch is on (to make sure needles are inside the skin and to avoid the need for an applicator in the final product, which is fully disposable in this embodiment). In one embodiment, the elastomeric element takes a first form prior to administration (Figure 9A) and then takes a second form after application of pressure (Figure 9B). In other words, the elastomeric element (which can be arched, curved or generally U-shaped) undergoes a shape change or deformation upon receiving the pressure from pushing the array into contact with the skin (e.g. from concave to convex).
Thus, the present invention contemplates formulations and devices, including but not limited to delivery devices, as well as methods of making formulations and devices. In one embodiment, the present invention contemplates a method of creating a substance delivery device, comprising:
providing i) an electrospun polymer formulation comprising at least one substance, and ii) a substrate comprising a plurality of microprojections; and depositing at least a portion of said preparation onto at least a portion of said substrate, so as to create a substance delivery device. The present invention also contemplates, as a device, the treated substrate prepared according to the above-described method. In one embodiment, said electrospun formulation comprises nanofibers.
It is not intended that the present invention be limited to a particular water-soluble polymer.
In one embodiment, said water-soluble polymer is selected from the group consisting of PVP, hydroxyethylcellulose, carboxymethyl cellulose, alginic acid, chitosan, and poly(glutamic acid).
It is not intended that the present invention be limited by the nature of the substance. In one embodiment, said substance is a therapeutic protein. In another embodiment, said substance is a vaccine antigen. In one embodiment, first and second substances are used (e.g., a vaccine antigen as a first substance, and adjuvant as the second substance).
The present invention, as mentioned above, also contemplates methods of administering substances (including but not limited to pharmaceuticals). In one embodiment, the present invention contemplates a method of administering a substance, comprising: providing a subject and the delivery device described above; and contacting said subject with said delivery device under conditions such at least a portion of said substance is released from said device. The term "subject"
includes human and non-human animals. In the case of humans, the term includes more than patients. The term also includes healthy, asymptomatic recipients. In one embodiment, said contacting comprises piercing the subject's skin with said asperities such as microprojections or microneedles.
The present invention also contemplates, in one embodiment, a substance delivery device comprising: a substrate having a back surface and a front surface; and a plurality of solid microneedles extending upwards from the front surface of the substrate, the microneedles comprising an electrospun polymer formulation, said formulation comprising at least one substance.
In one embodiment, said formulation provides for a sustained release of substance. In another embodiment, said formulation provides for various release rates of said substance.
When in an array, the density of the microprojections is, in one embodiment, at least 10 microprojections/cm2, in another embodiment, at least 200 microprojections/cm2, and, in some embodiments, at least 1000 microprojections/cm2. In one embodiment, each microneedle is spaced (when measured center to center with another microneedle) between 300 microns and 2.7 mm apart.
In one embodiment, the spacing is approximately three times the height of the microneedle, i.e. for a microneedle that is 600 microns (plus or minus 200 microns) in height, the spacing may be 1.8 mm, while for a microneedle that is 900 microns in height, the spacing may be 2.7 mm, while for a microneedle that is 300 microns in height, the spacing may be 900 microns.
The figures herein provide illustrative examples of microneedles and corresponding arrays.
Figure 10 is a scanning electron microscope picture showing an overview of one embodiment of a microneedle array (each microneedle is approximately 620 microns, plus or minus 20 microns, in height) with a particular density (the distance between microneedles, when measured center to center, is approximately 1.8 mm, plus or minus 200 microns. Figure I1 is a scanning electron microscope close up, side view of one embodiment of a single microneedle (e.g.
within the array) of approximately 620 microns (plus or minus 20 microns) in height showing the pyramidal shape.
Figure 12 is a scanning electron microscope close up, top view of one embodiment of a single microneedle (e.g. within the array) with eight sides (i.e. eight surfaces) coming together at the top to form a point or tip, wherein the width is approximately 385 microns, plus or minus 5 microns, and the height is approximately 620 microns, plus or minus 20 microns.
It is not intended that the present invention be limited to a particular density. Figure 13 shows a prospective microneedle array with a higher density of microneedles.
In another non-limiting embodiment, the present invention comprises a microfabricated device for transdermal, intra-epidermal, intradermal or transmucosal drug delivery comprising ionically cross-linked macromolecular assemblies, which provides sufficient mechanical strength, sufficient capacity of loading various amounts of drug, stability, and release characteristics. After the device is brought in contact with a subject's skin, the substance is released.
lonically cross-linked macromolecular assemblies are polymer networks that are formed through the establishment of reversible links between the macromolecular chains, as described in "J.
Berger, M Reist, J.M. Mayer, 0. Felt, N.A. Peppas, R. Gurny, Structure and interactions in covalently and ionically crosslinked chitosan hydrogels for biomedical applications, European Journal of Pharmaceutics and Biopharmaceutics 57 (2004) 19-34. " They can include polyelectrolyte complexes; multilayer polyelectrolyte materials, complexes of polyelectrolytes with low molecular weight ions; assemblies of dendrimers; ionically cross-linked hydrogels, which can be in the form of film; micro-and nanospheres; micro- and nanocapsules; micro-and nanofibers. The properties of cross-linked hydrogels depend mainly on their cross-linking density, namely the ratio of moles of cross-linking units to the moles of polymer repeating units, polymer characteristics, and microstructure of the material. lonically cross-linked assemblies include those in which gradient exists in the density of the cross-linking agent.
lonically cross-linked macromolecular assemblies of the present invention comprise a substance to be delivered. The preferred substances of the present invention are biologically active agents such as those described herein, including but not limited to, pharmaceutically active substances, such as therapeutic drugs, which can include small molecule drugs, proteins, peptides, nucleic acids, hormones, or vaccines, which can include antigens and adjuvants.
The formulation containing the pharmaceutically active substance can be in the form of an ionically cross-linked three dimensional film, sphere, tube, fiber, such as a nanofiber or microfiber, or in any other geometrical shape, and is attached the surface of the device by chemical or physical means.
The polymers of this aspect of the present invention may be water-soluble polymers. In one embodiment they are polyelectrolytes - polymers containing ionic or ionizable groups. In another embodiment they are polymers capable of establishing ionic complexes, such as sodium -poly(ethylene oxide), or sodium -poly[di(methoxyethoxyethoxy)phosphazene complex. In one embodiment the polymers are biodegradable polymers. Typical examples of such polymers are poly(ethylene glycol), polyvinylpyrrolidone, polyvinylalcohol, poly(ethylene oxide), polyoxymethylene, poly(hydroxyethyl methacrylate), carboxymethylcellulose, hydroxyethylcellulose, hydroxypropylcellulose, alginic acid, chitosan, poly(glutamic acid), poly(isobutylacrylamide), poly(ethylenimine), and copolymers thereof. The polymers can be linear, branched, brush- or comb-like in their macromolecular architecture. Copolymers can be random or block copolymers, or biomolecules (such as fibrin, fibrinogen, cellulose, starch, collagen and hyaluronic acid). In yet another embodiment, the polymers can be hydrophobic, but contain hydrophilic groups or hydrophilic segments capable of forming ionic cross-links or complexes.
Examples of hydrophobic polymers are poly(butyl methacrylate), poly(ethyl methacrylate), poly(vinylidene fluoride) poly(hydroxyvalerate), poly(L-lactic acid), polycaprolactone, poly(lactide-co-glycolide), poly(hydroxybutyrate), poly(hydroxybutyrate-co-valerate), polydioxanone, polyorthoester, polyanhydride, poly(glycolic acid), poly(vinyl methyl ether), polyvinylidene chloride, polyacrylonitrile, poly(trimethylene carbonate), poly(iminocarbonate), and other derivitized polyurethanes, and poly(organosiloxanes).
It is contemplated that the ionically cross-linked macromolecular assembly/drug(s) preparation can be deposited on a surface (in a uniform or non-uniform manner). In one embodiment, the preparation is deposited (e.g. by dipping, coating, spin coating, spraying, or by suitable applicator) on an array of asperities such as those described herein, such as microprojections or microneedles for transdermal, intradermal, or transmucosal delivery of the bioactive substance.
While the microneedle embodiment (described herein) is preferred, other systems and apparatus that employ tiny skin piercing elements to enhance transdermal agent delivery are also contemplated, as disclosed in U.S. Pat. Nos. 5,879,326, 3,814,097, 5,250,023, 3,964,482, Reissue U.S. Pat. No. 25,637, and PCT Publication Nos. WO 96/37155, WO
96/37256, WO
96/17648, WO 97/03718, WO 98/11937, WO 98/00193, WO 97/48440, WO 97/48441, WO
97/48442, WO 98/00193, WO 99/64580, WO 98/28037, WO 98/29298, and WO 98/29365;
all incorporated herein by reference in their entirety.
In one non-limiting embodiment, the macromolecular assembly can be prepared by ionic cross-linking or complexation of nanofibers. Polymeric materials can be fabricated in fibers, nano-and microfibers. The term "fiber" includes not only structures that are cylindrical, but also includes structures which vary from a cylindrical shape, such as for example, structures which are flattened or ribbon shaped. When fine fibers are randomly distributed they can form an interlocking net (non-woven fine fiber).
A"fiber-forming" material is capable of being fabricated into fibers. The fiber-forming materials used in this invention include polymers, which can be in a liquid state, such as melted, in solution, or in suspension. Water, organic solvents, or mixtures thereof or heat can be used to convert solid polymer into a liquid "fiber-forming" material. Electrostatic solution spinning is one method of making nanofibers and microfiber. Such electrospun material is then treated with a solution of an ion-complexing agent for cross-linking.
In one embodiment, the macromolecular assembly can be fabricated on the surface of the device using an aqueous based method (Figure 14). The advantages of such method for making ionically cross-linked hydrogels are that it avoids the use of organic solvents, heat, and, complicated manufacturing equipment. In one embodiment, the method involves the following steps. First, a solution of containing polymer and pharmaceutically active substance can be applied to a device using methods, such as dipcoating, spin coating, electrospinning, spraying, or with a brush or other suitable applicator. The preferred solution is a solution in water or in aqueous buffer; however organic solutions can be used or added if beneficial. The surface of a device can be dried after the application if desired. Secondly, a solution containing multivalent or polyvalent ions (cross-linker), is applied to the surface using the previously described methods.
Multivalent ions can be selected from the group if inorganic ions, such as calcium, zinc bismuth, barium, magnesium, aluminum, copper, cobalt, nickel, or cadmium, or organic ions, such as spermine, spermidine, or polylysine. In one embodiment, the salt of the monovalent ion is a calcium salt, such as calcium chloride, or CaC l2. The salt of the multivalent ion may be present in the solution at any concentration and pH, preferably from about 1% to about 25% and a pH from 4 to 9. The Ca2+ ions in the solution serve as a cross-linker, whereby the film is stabilized when they contact the solution containing the calcium salt.
The device can then be dried by freeze-drying, treating it with ethanol or other water miscible organic solvent, or under vacuum.
Alternatively, a physiologically active substance can be dissolved or dispersed in a solution of the cross-linker (multivalent or polyvalent ions) (Figure 15). In one embodiment of such a method, the physiologically active substance is introduced in the film at the same stage as the film is stabilized.
In one embodiment, the ionic cross-linking process can be applied to the total volume of the polymer film. In another embodiment the cross-linking process is limited to portion of the film, such as a portion localized on the elevated part of the device. In yet another embodiment, the cross-linking process is only applied to a portion of the film, which is localized on the tip of the elevated part of the device.
It is realized that the nature of the cross-linking agent used in the process can influence the stability of the film and thus the disintegration time and the release kinetics upon the administration. It is generally known that the disintegration and release time increases as the stability of the ionic links in hydrogel matrices increases in the following way: two valent ionic cross-linker, such as calcium ion, three valent ionic cross-linker, such as aluminum ion, multivalent organic ions, such as spermine or spermidine, polyvalent organic ions, such as poly(L-lysine). It is also understood that an increase in the cross-linking density of the hydrogel matrix can also lead to the increase in the disintegration of the hydrogel formulation and release time of the pharmaceutically active substance.
In one embodiment multiple ions are used to cross-link hydrogel matrix. In another embodiment the gradient of ions is achieved through the depth of the film. In yet another embodiment, the cross-linking density is also varied through the volume of the film. This can be achieved via varying the cross-linker and its concentration with time in the cross-linking solution.
Alternatively, the polymer hydrogel is composed of interpenetrating networks of ionically cross-linked polyelectrolytes.
In a preferred embodiment, only one type of a cross-linker is used and no additional cross-linking agent is added in the course of the process.
In yet another embodiment, the type of cross-linker and the concentration of the cross-linkers varies in the various zones of the device. Thus, various modes of release kinetics can be achieved using the same device.
The present invention contemplates administering one or more of the various embodiments of the formulations (described herein) comprising a drug, such as a prophylactic or therapeutic to humans and animals. In one embodiment, the present invention contemplates a method comprising:
a) providing i) a preparation comprising at least one drug in a ionically-cross-linked macromolecular assembly and ii) a subject, wherein said subject is a human or non-human animal; and b) contacting said subject with said preparation (e.g. under conditions such that at least a portion of said drug is released into said subject). In one embodiment, the present invention contemplates a method comprising: a) providing i) a preparation comprising one or more drugs in a macromolecular assembly formulation and ii) a subject, wherein said subject is a human or non-human animal; and b) contacting said subject with said preparation (e.g. under conditions such that at least a portion of said drug is released into said subject).
In one embodiment, two drugs are employed in a macromolecular assembly formulation. In some embodiments, first drug and second drug are different, but selected from antidepressant compounds, analgesic compounds, anti-inflammatory steroidal compounds (corticosteroids), non-steroidal antiinflammatory compounds (NSAIDs), antibiotic compounds, anti-fungal compounds, antiviral compounds, antiproliferative compounds, antiglaucoma compounds, immunomodulatory compounds, cell transport/mobility impeding agents, cytokines and peptides/proteins skin-treating compounds sunscreens skin protectants, leukotrienes such as LTB4, antimetabolite compounds, antipsoriatic compounds, keratolyiic compounds, anxiolytic compounds, and antipsychotic compounds. In a preferred embodiment, the hydrogel/two drug preparation is delivered transdermally, intradermally, intra-epidermally, transmucosally, subcutaneously, IP, IV or IM.
The present invention further contemplates, in one embodiment, a drug delivery system comprising a) a substrate comprising asperities such as those described herein, such as microprojections or microneedles, and an embodiment of the various ionically cross-linked preparations (mentioned above). When microneedles are used, they may be hollow, but preferably they are solid. It is not intended that the present invention be limited to the manner in which the microneedles are contacted with the macromolecular assembly preparation. In one embodiment, the microneedles are contacted only at the microneedle tips. In a preferred embodiment, the preparation contacts the entire substrate (or substantially the entire substrate) such that the preparation contacts even the spaces between an array of microneedles. It is not intended that the present invention be limited to uniform coatings of the preparation. In one embodiment, the preparation is present on the substrate in a non-uniform manner. In one embodiment, a ionically cross-linked macromolecular assembly/drug(s) preparation is sprayed on said microneedles. In one embodiment, said microneedles are dipped into a preparation.
Thus, the present invention contemplates formulations and devices, including but not limited to delivery devices, as well as methods of making formulations and devices. In one embodiment, the present invention contemplates a method of creating a substance delivery device, comprising:
providing i) an ionically cross-linked macromolecular assembly which includes at least one substance, such as a biologically active agent as described herein and ii) a substrate comprising a plurality of asperities such as those described herein, such as microprojections and microneedles;
and depositing at least a portion of said preparation onto at least a portion of said substrate, so as to create a substance delivery device. The present invention also contemplates, as a device, the treated substrate prepared according to the above-described method. In one embodiment, said ionically cross-linked macro-molecular assembly comprises an ionically cross-linked water-soluble polymer.
In a preferred embodiment, said ionically cross-linked macromolecular assembly has a multilayer structure. In another embodiment, said ionically cross-linked macromolecular assembly comprises ionically cross-linked nanofibers.
It is not intended that the present invention be limited to a particular water-soluble polymer.
In one embodiment, said water-soluble polymer is selected from the group consisting of carboxymethyl cellulose, alginic acid, chitosan, poly(glutamic acid).
It is not intended that the present invention be limited by the nature of the nanofibers. In one embodiment, wherein said ionically cross-linked nanofibers comprise ionically cross-linked chitosan nanofibers.
It is not intended that the present invention be limited by the nature of the substance. In one embodiment, said substance is a therapeutic protein. In another embodiment, said substance is vaccine antigen. In one embodiment, first and second substances are used (e.g.
a vaccine antigen as a first substance, and adjuvant as the second substance).
The present invention, as mentioned above, also contemplates methods of administering substances (including but not limited to pharmaceuticals). In one embodiment, the present invention contemplates a method of administering a substance, comprising: providing: a subject and the delivery device described above; and contacting said subject with said delivery device under conditions such at least a portion of said substance is released from said device. In one embodiment, said contacting comprises piercing the subject's skin with said microprojections.
The present invention also contemplates, in one embodiment, a substance delivery device comprising: a substrate having a back surface and a front surface; and a plurality of solid microneedles extending upwards from the front surface of the substrate, the microneedles comprising a ionically cross-linked macromolecular assembly formulation, said formulation comprising at least one substance. In one embodiment, said ionically cross-linked macromolecular assemblies provide for a sustained release of substance. In another embodiment,said ionically cross-linked macromolecular assemblies provide for various release rates of said substance.
"Polyelectrolytes" are defined here as polymers that contain ionic (ionized or ionizable) groups, which groups impart to the polymer anionic, cationic, or amphiphilic character. The ionic groups can be in the form of a salt, or, alternatively, an acid or base that is, or can be, at least partially dissociated. Polyelectrolytes can also contain non-ionic side groups. Polyelectrolyte can be biodegradable (e.g. to prevent eventual deposition and accumulation of polymer molecules in the body) or non-biodegradable under the conditions of use. A preferred polyelectrolyte is a polyanion and contains ionic groups that include carboxylic acid, sulfonic acid, hydroxyl, or phosphate moieties.
Pharmaceutically active substances which may be included in the resulting preparation which includes the macromolecular assembly hereinabove described may be those described herein.
In one non-limiting embodiment, a hydrogel/drug(s) preparation is delivered transdermally, intra-epidermally, intradermally, or transmucosally using anisotropically etched MEMS
microneedles in silicon. In one embodiment, the invention contemplates solid asperities such as those herein described, such as microprojections or microneedles which are fabricated in a crystal silicon material suitable for use in the administration of the various preparations discussed above.
Without limiting the invention in any manner to any particular mechanism, it is believed that the drug(s) is delivered by microporation of the stratum corneum, and polymer-drug deposition within the patient's skin and subsequent dissolution or erosion of the polymer. The drug becomes thereby bioavailable; it can dissolve and diffuse to the biological target, or alternatively, it can remain at the site of administration. Micropores are made into the stratum corneum by means of a microneedle array penetration, which can optionally be further enhanced by applying energy in the form of ultrasonic, heat and/or electric signals across or through the skin.
In one embodiment, the present invention contemplates a method of administering one or more drugs to a patient comprising the steps of penetrating at least an outer layer of the skin of the subject with one or more microneedles extending from a front surface of a substrate, at least one of the one or more microneedles (or portion thereof) contacted or coated (uniformly or non-uniformly) by a macromolecular assembly/drug(s) preparation (discussed above), and releasing at least one of the one or more drugs into the subject.
In another, non-limiting embodiment, the at least one biologically active agent is a toxin.
For example, several species of Clostridium produce toxins of significance to human and animal health. [C.L. Hatheway, Clin. Microbiol. Rev. 3:66-98 (1990).] The effects of these toxins range from diarrheal diseases that can cause destruction of the colon, to paralytic effects that can cause death (see Table 3). Particularly at risk for developing clostridial diseases are neonates and humans and animals in poor health (e.g., those suffering from diseases associated with old age or immunodeficiency diseases).
Clostridium botulinum produces the most poisonous biological toxins known. The lethal human dose is a mere 10-9 mg/kg bodyweight for toxin in the bloodstream. THe closely related isoforms of botulinal toxin blocks nerve transmission to the muscles, resulting in flaccid paralysis.
When the toxin reaches airway and respiratory muscles, the consequence is respiratory failure that can cause death. [S. Arnon, J. Infect. Dis.154:201-206 (1986).]
C. botulinum spores are carried by dust and are found on vegetables taken from the soil, on fresh fruits, and on agricultural products such as honey. Under conditions favorable to the organism, the spores germinate to vegetative cells which produce toxin. [S. Amon, Ann.
Rev. Med. 31:541 (1980).] Botulism disease may be grouped into four types, based on the method of introduction of the toxin isoform into the bloodstream. Food-borne botulism results from ingesting improperly preserved and inadequately heated food that contains botulinal toxin. [K.L.
MacDonald et al., Am. J.
Epidemiol. 124:794 (1986).] The death rate due to botulinal toxin is 12% and can be higher in particular risk groups. [C.O. Tacket et al., Am. J. Med. 76:794 (1984).] Wound-induced botulism results from C. botulinum penetrating traumatized tissue and producing toxin that is absorbed into the bloodstream.
Clostridium Species of Medical and Veterinary Importance*
Species Disease C. aminovalericum Bacteriuria (pregnant women) C. argentinense Infected wounds; Bacteremia; Botulism; Infections of amniotic fluid C. baratii Infected war wounds; Peritonitis; Infectious processes of the eye, ear and prostate C. beijerinckikii Infected wounds C. bifermentans Infected wounds; Abscesses; Gas Gangrene; Bacteremia C. botulinum Food poisoning; Botulism (wound, food, infant) C. butyricum Urinary tract, lower respiratory tract, pleural cavity, and abdominal infections;
Infected wounds; Abscesses; Bacteremia C. cadaveris Abscesses; Infected wounds C. carnis Soft tissue infections; Bacteremia C. chauvoei Blackleg C. clostridioforme Abdominal, cervical, scrotal, pleural, and other infections; Septicemia;
Peritonitis; Appendicitis C. cochlearium Isolated from human disease processes, but role in disease unknown.
C. difficile Antimicrobial-associated diarrhea; Pseudomembranous enterocolitis;
Bacteremia;
Pyogenic infections C. fallax Soft tissue infections C. ghnoii Soft tissue infections C. glycolicum Wound infections; Abscesses; Peritonitis C. hastiforme Infected war wounds; Bacteremia; Abscesses C. histolyticum Infected war wounds; Gas gangrene; Gingival plaque isolate C. indolis Gastrointestinal tract infections C. innocuum Gastrointestinal tract infections; Empyema C. irregulare Penile lesions C. leptum Isolated from human disease processes, but role in disease unknown Clostridium Species of Medical and Veterinary Importance*
Species. Disease C. limosum Bacteremia; Peritonitis; Pulmonary infections C. malenominatum Various infectious processes C. novyi Infected wounds; Gas gangrene; Blackleg, Big head (ovine);
Redwater disease (bovine) C. oroticum Urinary tract infections; Rectal abscesses C. paraputrificum Bacteremia; Peritonitis; Infected wounds; Appendicitis C. perfringens Gas gangrene; Anaerobic cellulitis; Intra-abdominal abscesses;
Soft tissue infections; Food poisoning; Necrotizing pneumonia;
Empyema; Meningitis; Bacteremia; Uterine Infections; Enteritis necrotans; Lamb dysentery Struck; Ovine Enterotoxemia C. putrefaciens Bacteriuria (Pregnant women with bacteremia) C. putrificum Abscesses; Infected wounds; Bacteremia C. ramosum Infections of the abdominal cavity, genital tract, lung, and biliary tract; Bacteremia C. sartagoforme Isolated from human disease processes, but role in disease unknown.
C. septicum Gas gangrene; Bacteremia; Suppurative infections; Necrotizing enterocolitis; Braxy C. sordellii Gas gangrene; Wound infections; Penile lesions; Bacteremia;
Abscesses; Abdominal and vaginal infections C. sphenoides Appendicitis; Bacteremia; Bone and soft tissue infections;
Intraperitoneal infections; Infected war wounds; Visceral gas gangrene; Renal abscesses C. sporogenes Gas gangrene; Bacteremia; Endocarditis; central nervous system and europulmonary infections; Penile lesions; Infected war wounds; Other pyogenic infections C. subterminale Bacteremia; Empyema; Biliary tract, soft tissue and bone infections C. symbiosum Liver abscesses; Bacteremia; Infections resulting due to bowel flora C. tertium Gas gangrene; Appendicitis; Brain abscesses; Intestinal tract and soft tissue infections; infected war wounds; penodonitis;
Bacteremia Clostridium Species of Medical and Veterinary Importance*
Species isease C. tetani etanus; Infected gums and teeth; Corneal ulcerations;
4astoid and middle ear infections; Intraperitoneal infections; Tetanus neonatorum; Postpartum uterine infections; Soft tissue infections, especially related to rauma (including abrasions and lacerations); Infections elated to use of contaminated needles C. thermosaccharolyticum solated from human disease processes, but role in disease nknown.
* Compiled from P.G. Engelkirk et al. "Classification", Principles and Practice of Clinical Anaerobic Bacteriology, pp. 22-23, Star Publishing Co., Belmont, CA (1992); J.
Stephen and R.A.
Petrowski, "Toxins Which Traverse Membranes and Deregulate Cells," in Bacterial Toxins, 2d ed., pp. 66-67, American Society for Microbiology (1986); R. Berkow and A.J.
Fletcher (eds.), Bacterial Diseases," Merck Manual of Diagnosis and Therapy, 16th ed., pp. 116-126, Merck Research Laboratories, Rahway, N.J. (1992); and O.H. Sigmund and C.M. Fraser (eds.), "Clostridial Infections, "Merck Veterinary Manual, 5th ed., pp. 396-409, Merck & Co., Rahway, N.J. (1979).
[M.N. Swartz, "Anaerobic Spore-Forming Bacilli: The Clostridia," pp. 633-646, in B.D.
Davis et al.,(eds.), Microbiology, 4th edition, J.B. Lippincott Co. (1990).]
Inhalation botulism has been reported as the result of accidental exposure in the laboratory [E.
Holzer, Med. Klin. 41:1735 (1962)] and could arise if the toxin is used as an agent of biological warfare [D.R. Franz et al., in Botulinum and Tetanus Neurotoxins, B.R. DasGupta, ed., Plenum Press, New York (1993), pp. 473-476]. Infectious infant botulism results from C. botulinum colonization of the infant intestine with production of toxin and its absorption into the bloodstream. It is likely that the bacterium gains entry when spores are ingested and subsequently germinate. [S. Arnon, J. Infect.
Dis. 154:201 (1986).]
Different strains of Clostridium botulinum each produce one of seven structurally similar but antigenically distinct toxin isoforms designated by the letters A-G. Serotype A toxin has been implicated in 26% of the cases of food botulism; types B, E and F have also been implicated in a smaller percentage of the food botulism cases [H. Sugiyama, Microbiol. Rev.
44:419 (1980)].
Wound botulism has been reportedly caused by only types A or B toxins [H.
Sugiyama, supra].
Nearly all cases of infant botulism have been caused by bacteria producing either type A or type B
toxin. (Exceptionally, one New Mexico case was caused by Clostridium botulinum producing type F
toxin and another by Clostridium botulinum producing a type B-type F hybrid.) [S. Arnon, Epidemiol. Rev. 3:45 (1981)] Type C toxin affects waterfowl, cattle, horses and mink. Type D toxin affects cattle, and type E toxin affects both humans and birds.
A trivalent antitoxin derived from horse plasma is commercially available from Connaught Industries Ltd. as a therapy for toxin types A, B, and E. However, the antitoxin has several disadvantages. First, extremely large dosages must be injected intravenously and/or intramuscularly.
Second, multiple administrations of antitoxin can trigger serious side effects, such as acute anaphylaxis which can lead to death, and serum sickness. Finally, the efficacy of the antitoxin is uncertain and the treatment is costly.
[C.O. Tacket et al., Am. J. Med. 76:794 (1984).]
A heptavalent equine botulinal antitoxin which uses only the F(ab')2 portion of the antibody molecule has been tested by the United States Military. [M. Balady, USAMRDC
Newsletter, p. 6 (1991).] This was raised against impure toxoids in those large animals and is not a high titer preparation.
A pentavalent human antitoxin has been collected from immunized human subjects for use as a treatment for infant botulism. The supply of this antitoxin is limited and cannot be expected to meet the needs of all individuals stricken with botulism disease. In addition, collection of human sera must involve screening out HIV and other potentially serious human pathogens. [P.J. Schwarz and S.S.on, Western J. Med. 156:197 (1992).]
Immunization of subjects with toxin preparations has been done in an attempt to induce immunity against botulinal toxins. A C. botulinum vaccine comprising chemically inactivated (i.e., formaldehyde-treated) type A, B,C, D and E toxin is commercially available for human usage.
However, this vaccine preparation has several disadvantages. First, the efficacy of this vaccine is variable (in particular, only 78% of recipients produce protective levels of anti-type B antibodies following administration of the primary series). Second, immunization is painful (deep subcutaneous inoculation is required for administration), with adverse reactions being common (moderate to severe local reactions occur in approximately 6% of recipients upon initial injection; this number rises to approximately 11% of individuals who receive booster injections) [Informational Brochure for the Pentavalent (ABCDE) Botulinum Toxoid, Centers for Disease Control].
Third, preparation of the vaccine is dangerous as active toxin must be handled by laboratory workers.
What are needed are safe and effective vaccine preparations for administration to those at risk of exposure to C. botulinum toxins.
The present invention contemplates, in a non-limiting embodiment, a preparation comprising at least one polymer and at least one Clostridium antigen or toxin (or fragment thereof) such as those selected from a species set forth in Table 3. The present invention contemplates, in one embodiment, such an antigen or toxin (or fragment thereof) in a preparation suitable for transdermal, intradermal, or transmuscosal delivery. In a preferred embodiment, the species is C.
botulinum. In one embodiment, the antigen or toxin (or fragment thereof) is in a hydrogel formulation. In one embodiment, the antigen or toxin (or fragment thereof) is attached or linked to a carrier. In one embodiment, the antigen or toxin (or fragment thereof) is part of a fusion protein. In one embodiment, the antigen or toxin (or fragment thereof) is in a micelle formulation. In one embodiment, the antigen or toxin (or fragment thereof) is in or on nanofibers, nanotubes, nanospheres, or nanocapsules. In one embodiment, the antigen or toxin (or fragment thereof) is complexed with one or more dendrimers. In one embodiment, the antigen or toxin (or fragment thereof) is in a liposome preparation (e.g. for liposome delivery). In a preferred embodiment, the antigen or toxin (or fragment thereof) is on the surface of a substrate, e.g.
on a skin patch, microneedle array, or the like. Combinations of the above are specifically contemplated, including but not limited to, substrates comprising the Clostridium antigen(s) or toxin(s) (or fragment(s) thereof) in a polymer formulation, or in an assembly of nanofibers. In a particularly preferred embodiment, the toxin is functionally impaired (e.g. it will not cause toxicity).
In one embodiment, the Clostridium antigen or toxin (or fragment thereof) is in a hydrogel formulation. It is not intended that the present invention be limited by the nature of the hydrogel since a variety of types can be used, including but not limited to ionically cross-linked hydrogels or hydrogel films. It is contemplated that the hydrogel/antigen(s) or hydrogel/toxin(s) preparation can be deposited on a surface (in a uniform or non-uniform manner). In one embodiment, the preparation is deposited (e.g. by dipping, coating, spin coating, spraying, or by suitable applicator) on an may of microprojections or microneedles for transdermal, intradermal or transmucosal delivery of the antigen(s). In one embodiment, the present invention contemplates a method comprising: a) providing i) a preparation comprising one or more Clostridium antigens or toxins (or fragments thereof) in a hydrogel formulation and ii) a subject, wherein said subject is a human or non-human animal; and b) contacting said subject with said preparation (e.g.
under conditions such that said subject generates an immune response to said one or more antigens or toxins).
When polymers are used, it is not intended that the present invention be limited by the nature of the polymer since a variety of types can be used (see Table 1). In one embodiment, the polymer comprises polyvinylpyrrolidone or hydroxy-propylcellulose. In one embodiment, the polymer comprises hydroxyethylcel lulose.
It is not intended that the present invention be limited to the manner in which the preparation of polymer and antigen (or toxin) is prepared. However, in a preferred embodiment, the preparation is electrospun to create fibers or fiber mats. It is preferred that at least a portion of the antigen (or toxin) in the electrospun fibers or mats be capable of release or escape from the polymer (e.g. upon contact with an aqueous or semi-aqueous environment). In certain embodiments (e.g. cosmetic), it is desired that the toxin be functional. In other embodiments (e.g. vaccines), it is not necessary that the toxin be functional (e.g. mutants and chemically treated toxins can be used).
In a preferred embodiment, the toxin polypeptides comprise one or more Clostridium botulinum neurotoxins. The invention contemplates the use of polypeptides derived from C.
botulinum toxin as immunogens for the production of vaccines and antitoxins, as well as for cosmetic purposes. The C. botulinum vaccines and antitoxins find use in humans and other animals.
In one embodiment, the present invention contemplates a fusion protein comprising a non-toxin protein sequence and a portion of the Clostridium botulinum type A toxin. In one embodiment, the C. botulinum type A toxin sequences comprise a portion of the sequence shown in Figure 16. In another embodiment, the C. botulinum type A toxin sequences comprise a portion of the sequence shown in Figure 17. It is not intended that the present invention be limited by the nature of the fusion protein. For example, the fusion protein may comprise the Clostridium botulinum type A
toxin sequence as shown in Figure 17 along with a poly-histidine tract. The toxins are conveniently made in host cells containing a recombinant expression vector, wherein the vector encodes a fusion protein comprising a non-toxin protein sequence and a portion of the Clostridium botulinum type A
toxin sequence shown in Figure 16. In this embodiment, the host cell is capable of expressing the encoded Clostridium botulinum type A toxin protein as a soluble protein at a level greater than or equal to 0.25% to 10% of the total cellular protein and preferably at a level greater than or equal to 0.75% of the total cellular protein. It is not intended that the present invention be limited by the nature of the fusion protein expressed by the recombinant vector in the host cell. For example, the fusion protein may comprise the Clostridium botulinum type A toxin sequence as set forth shown in Figure 17, along with a poly-histidine tract.
Regardless of whether a wild-type, mutant, or toxin fusion proteins are used, the present invention contemplates administering one or more of the various embodiments of the preparations described above as a vaccine to humans and animals, or as a cosmetic. In one embodiment, the present invention contemplates a vaccine-related method comprising: a) providing i) a preparation comprising at least one polymer and one or more C. botulinum toxins and ii) a subject, wherein said subject is a human or non-human animal; and b) contacting said subject with said preparation (e.g.
under conditions such that said subject generates an immune response to said one or more antigens).
In a preferred embodiment, the toxin is electrospun with one or more polymers such as those described herein so as to create an electrospun preparation. As discussed below, in a preferred embodiment, the electrospun preparation is part of a vaccine delivery system or a cosmetic.
The present invention further contemplates, in one embodiment, a vaccine delivery system comprising a) a substrate such as described herein comprising asperities such as those described herein, such as microprojections or microneedles, and an embodiment of the various preparations (mentioned above) comprising polymer and toxin. In a preferred embodiment, the asperities, such as microprojections or microneedles have dimensions such that they penetrate into the stratum corneum, the epidermal layer, and, in some embodiments, the dermal layer. In one embodiment, the microprojections or microneedles have a length (or height) or less than 1000 microns, more preferably less than 500 microns, and still more preferably less than 250 microns. The microprojections may be formed in different shapes, such as needles, blades, pins, punches, and combinations thereof. When in an array, the density of the microprojections is at least 10 microprojections/cm2, more preferably, at least 200 microprojections/cm2, and, in some embodiments, at least 1000 microprojections/cm2. The microneedles may be hollow or solid.
It is not intended that the present invention be limited by the nature of the substrate comprising said microneedles. In one embodiment, the microneedles are formulated out of polymer.
In one embodiment, the microneedles are formulated (at least in part) out of a polymer/antigen(s) or polymer/toxin(s) preparation. In another embodiment, the microneedles are made with a mold. In a preferred embodiment, the microneedles are etched out of a silicon substrate.
In a preferred embodiment, said silicon microneedles are solid and an electrospun polymer/antigen(s) preparation is deposited on said microneedles.
Thus, the present invention contemplates novel conjugates, formulations, delivery devices, methods of conjugation, methods of formulation, and methods of delivery. In one embodiment, the present invention contemplates a method of creating a formulation: providing i) at least one fiber-forming material, and ii) a preparation comprising at least one Clostridium toxin; mixing said fiber-forming material with said preparation so as to create a mixture; and electrospinning said mixture to create an electrospun formulation. In one embodiment, the method further comprises: depositing at least a portion of said electrospun material onto at least a portion of a substrate to create a treated substrate (e.g. microneedles, including but not limited to etched solid microneedles). The present invention also contemplates, as a device, the treated substrate prepared according to the above-described method. In one embodiment, said fiber-forming material comprises hydroxypropylcellulose, while in another embodiment said fiber-forming material comprises PVP.
In one embodiment, said preparation comprises first and second Clostridium toxins. In one embodiment, said first toxin comprises at least a portion of a C. difficile toxin and said second toxin comprises at least a portion of C. botulinum toxin. In one embodiment, said first and second toxin are part of a fusion protein.
In one embodiment, the present invention contemplates a method of creating a toxin delivery device: providing i) at least one fiber-forming material, ii) a preparation comprising at least one Clostridium toxin, and iii) a substrate comprising a plurality microprojections; mixing said fiber-forming material with said preparation so as to create a mixture;
electrospinning said mixture to create an electrospun material; and depositing at least a portion of said electrospun material onto at least a portion of said substrate, so as to create a toxin delivery device. In one embodiment, said Clostridium toxin is a C. botulinum toxin. The present invention also contemplates, as a device, the treated substrate prepared according to the above-described method. In one embodiment, said fiber-forming material comprises hydroxypropylcellulose, while in another embodiment said fiber-forming material comprises PVP.
The present invention, as mentioned above, also contemplates methods of administering antigens and vaccines. In one embodiment, the present invention contemplates a method of administering antigen, comprising: providing: a subject and the toxin delivery device described above; and contacting said subject with said antigen delivery device under conditions such at least a portion of said antigen is released from said device. In one embodiment, said contacting of step b) comprises piercing the subject's skin with said microprojections.
The present invention also contemplates, in one embodiment, a toxin delivery device comprising: a substrate having a back surface and a front surface; a plurality of solid microneedles extending upwards from the front surface of the substrate, the microneedles comprising a formulation, said formulation comprising at least one polymer and at least one Clostridium toxin (e.g. a C. botulinum toxin).
As used herein, the term "fusion protein" refers to a chimeric protein containing the protein of interest (i.e., C. botulinum toxin A or B and fragments thereof) joined to an exogenous protein fragment (the fusion partner which consists of a non-toxin protein). The fusion partner may enhance solubility of the C. botulinum protein as expressed in a host cell, may provide an affinity tag to allow purification of the recombinant fusion protein from the host cell or culture supernatant, or both. If desired, the fusion protein may be removed from the protein of interest (i.e., toxin protein or fragments thereof) prior to immunization by a variety of enzymatic or chemical means known to the art.
As used herein, the term "poly-histidine tract" when used in reference to a fusion protein refers to the presence of two to ten histidine residues at either the amino-or carboxy-terminus of a protein of interest. A poly-histidine tract of six to ten residues is preferred. The poly-histidine tract is also defined functionally as being a number of consecutive histidine residues added to the protein of interest which allows the affinity purification of the resulting fusion protein on a nickel-chelate column.
The botulinal neurotoxin is synthesized as a single polypeptide chain which is processed into a heavy (H) and a light (L) chain; these two chains are held together via disulfide bonds in the active toxin [B.R. DasGupta and H. Sugiyama, Biochem. Biophys. Res. Commun. 48:108 (1972);
reviewed in B.R. DasGupta, J. Physiol. 84:220 (1990) and H. Sugiyama, Microbiol. Rev. 44:419 (1980)]. Antisera raised against purified preparations of isolated H and L
chains have been shown to protect mice against the lethal effects of the toxin; however, the effectiveness of the two antisera differ with the anti-H sera being more potent (H. Sugiyama, supra).
While the different botulinal toxins show structural similarity to one another, the different serotypes are reported to be immunologically distinct (i.e., sera raised against one toxin type does not cross-react to a significant degree with other types). Thus, the generation of multivalent vaccines may require the use of more than one type of toxin. Purification methods have been reported for native toxin types A, B, C, D, E, and F [reviewed in G. Sakaguchi, Pharmac.
Ther. 19:165 (1983)].
As the different botulinal toxins are structurally related, the invention contemplates polymer/toxin formulations with any of the botulinal toxins (e.g., types A-30 F) as soluble recombinant fusion proteins, and in particular electrospun formulations. In one preferred embodiment, toxins A and B of C. difficile are contemplated as immunogens (either separately or together). In one embodiment, recombinant C. botulinum toxin proteins are used as antigens in mono- and multivalent vaccine preparations. For example, soluble, substantially endotoxin-free recombinant C. botulinum type A toxin proteins may be used alone or in conjunction with either recombinant or native toxins or toxoids from C. botulinum, C. difficile and C.
tetani as antigens for the preparation of these mono- and multivalent vaccines. It is contemplated that, due to the structural similarity of C. botulinum and C. tetani toxin proteins, a vaccine comprising C. difficile and botulinum toxin proteins (native or recombinant or a mixture thereof) be used to stimulate an immune response against C. botulinum, C. tetani and C. difficile.
The adverse consequences of exposure to botulinal toxin would be avoided by immunization of subjects at risk of exposure to the toxin with nontoxic preparations which confer immunity such as chemically or genetically detoxified toxin. In general, chemical detoxification of bacterial toxins using agents such as formaldehyde, glutaraldehyde or hydrogen peroxide can be used for the generation of vaccines or antitoxins. A delicate balance must be struck between too much and too little chemical modification. If the treatment is insufficient, the vaccine may retain residual toxicity.
If the treatment is too excessive, the vaccine may lose potency due to destruction of native immunogenic determinants.
Vaccines which confer immunity against one or more of the toxin types A, B, E
and F would be useful as a means of protecting humans from the deleterious effects of those C. botulinum toxins known to affect man. Vaccines which confer immunity against one or more of the toxin types C, D
and E would be useful for veterinary applications.
The C fragment of the C. botulinum type A neurotoxin heavy chain has been evaluated as a vaccine candidate. The C. botulinum type A neurotoxin gene has been cloned and sequenced [D.E.
Thompson et al., Eur. J. Biochem. 189:73 (1990)]. The C fragment of the type A
toxin was expressed as either a fusion protein comprising the botulinal C fragment fused with the maltose binding protein (MBP) or as a native protein [H.F. LaPenotiere et al., supra].
The plasmid construct encoding the native protein was reported to be unstable, while the fusion protein was expressed in inclusion bodies as insoluble protein. Immunization of mice with crudely purified MBP fusion protein resulted in protection against IP challenge with 3 LD50 doses of toxin [LaPenotiere et al., supra]. However, this recombinant C. botulinum type A toxin C fragment/MBP
fusion protein is not a suitable immunogen for the production of vaccines as it is expressed as an insoluble protein in E.
coli. Furthermore, this recombinant C. botulinum type A toxin C fragment/MBP
fusion protein was not shown to be substantially free of endotoxin contamination. Experience with recombinant C.
botulinum type A toxin C fragment/MBP fusion proteins shows that the presence of the MBP on the fusion protein greatly complicates the removal of endotoxin from preparations of the recombinant fusion protein.
Inclusion body protein must be solubilized prior to purification and/or administration to a host. The harsh treatment of inclusion body protein needed to accomplish this solubilization may reduce the immunogenicity of the purified protein. Ideally, recombinant proteins to be used as vaccines are expressed as soluble proteins at high levels (i.e., greater than or equal to about 0.75% of total cellular protein) in E. coli or other host cells. This facilitates the production and isolation of sufficient quantities of the immunogen in a highly purified form (i.e., substantially free of endotoxin or other pyrogen contamination). The ability to express recombinant toxin proteins as soluble proteins in E. coli is advantageous due to the low cost of growth compared to insect or mammalian tissue culture cells.
In one embodiment, the vaccine comprises the C fragment of the C. botulinum type A toxin and a poly-histidine tract (also called a histidine tag). In a particularly preferred embodiment, a fusion protein comprising the histidine tagged C fragment (expressed using the pET series of expression vectors (Novagen)) is employed in one of the polymer/toxin formulations of the present invention, and in particular an electrospun formulation. The pET expression system utilizes a vector containing the T7 promoter which encodes the fusion protein and a host cell which can be induced to express the T7 DNA polymerase (i.e., a DE3 host strain). The production of C fragment fusion proteins containing a histidine tract is not limited to the use of a particular expression vector and host strain. Several commercially available expression vectors and host strains can be used to express the C fragment protein sequences as a fusion protein containing a histidine tract (For example, the pQE series (pQE-8, 12, 16, 17, 18, 30, 31, 32, 40, 41, 42, 50, 51, 52, 60 and 70) of expression vectors (Qiagen) which are used with the host strains M15[pREP4]
(Qiagen) and SG13009[pREP4] (Qiagen) can be used to express fusion proteins containing six histidine residues at the amino-terminus of the fusion protein).
When recombinant clostridial toxin proteins produced in gram-negative bacteria (e.g., E.
coli) are used as vaccines, they are purified to remove endotoxin prior to administration to a host animal. In order to vaccinate a host, an immunogenicallyeffective amount of purified substantially endotoxin-free recombinant clostridial toxin protein is administered in any of a number of physiologically acceptable carriers known to the art. When administered for the purpose of vaccination, the purified substantially endotoxin-free recombinant clostridial toxin protein may be used alone or in conjunction with known adjutants, including potassium alum, aluminum phosphate, aluminum hydroxide, Gerbu adjuvant (GmDP; C.C. Biotech Corp.), RMI adjuvant (MPL; RJBI
Immunochemical research, Inc.), QS21 (Cambridge Biotech). The alum and aluminum-based adjutants are particularly preferred when vaccines are to be administered to humans.
A variety of routes of immunization may be used, such as nasal, oral, intramuscular, intra-peritoneal, etc. However, it is preferred that immunization be through the skin (e.g. subcutaneous, or more preferably transdermally, intradermally or transmucosally using asperities such as microprojections or microneedles, as discussed herein).
In one embodiment, the present invention contemplates using Clostridium antigen(s) and/or toxin(s) in polymer formulations for vaccines and cosmetics. In a preferred embodiment, such antigens and toxins are electrospun with one or more polymers or hydrogels, such as those discussed herein.
In a preferred embodiment, the preparation comprising Clostridium antigen(s) or toxin(s) is capable, after electrospinning, of acting as an antigen by eliciting an immune response in a human or animal. It is envisioned that in such an embodiment, a medically acceptable fiber-forming material may be used to preserve the antigen for later rehydration and use as a vaccine. In general, rehydration of the fiber of the present invention may be accomplished by mixing the fiber with a solvent for the fiber-forming material. When the fiber is used to preserve an antigen for use in a vaccine, the solvent will optimally be a medically acceptable compound.
It is not intended that the present invention be limited to the method by which the electrospun antigen(s) or toxin(s) is administered. The resulting vaccine may be injected or an ingested vaccine. However, in a preferred embodiment, the vaccine is administered at or in the skin.
In a particularly preferred embodiment, the electrospun polymer/ antigen(s) material is delivered on microneedles or on a patch such that antigen(s) is released into the skin.
In one non-limiting embodiment, the toxin may be contained in an ionically cross-linked macromolecular assembly, such as those hereinabove described, including but not limited to hydrogels, such as those hereinabove described.
In one embodiment, the present invention contemplates a method of administering one or more antigens such as the toxins hereinabove described, to a patient comprising the steps of penetrating at least an outer layer of the skin of the patient with one or more microneedles extending from a front surface of a substrate, at least one of the one or more microneedles (or portion thereof) contacted or coated (uniformly or non-uniformly) by an antigen preparation (discussed above), and releasing at least one of the one or more antigens into the patient.
One use of microneedle vehicle for delivery of the polymer/toxin(s) preparations described above involves cosmetic applications, and in particular, facial cosmetic applications. The administration of an appropriate dose of, for example, botulinum toxin, to attenuate tone of muscles about the eyes and forehead can in many cases remove wrinkles characteric of aging in skin overlying the muscle while inducing only mild, often acceptable muscle weakness. Such chemodenervating agents also may be used to induce cosmetic improvement in hemifacial paralysis by intentionally inducing partial paralysis in the contralateral side of the face thereby to improve bilateral facial symmetry.
Administration of low doses of the agents into muscles activating the jaw can retard tooth wear caused by involuntary or unconscious clenching of the teeth.
Examples of direct effects are the treatment of unwanted involuntary pathologic muscle stimulation, i.e., spasm, rigidity, or hyperstimulation, by direct administration throughout, or in the area of innervation of, the affected muscle or muscles. Thus, diseases involving muscle spasticity in general can be treated, typically without regard for its cause. The drug may be used to alleviate overstimulation, rigidity, or spasticity in muscle or muscle groups caused by stroke, cerebral palsey, multiple sclerosis, unilateral or bilateral parkinsonism, and other diseases characterized by spasmodic or continuous muscle hyperstimulation.
Accordingly, it is an object of the invention to provide a novel method of standardizing chemodenervating neurotoxin-derived pharmaceuticals such as botulinumderived pharmaceuticals by using microneedle administration. Another object is to standardize botulinum toxin preparations with respect to their zone of denervation when administered in vivo. Another object is to provide novel (lower) dosage forms of such agents. Yet another object is to provide novel therapies for muscle spasticity andlor hyperactivation heretofore untreatable or treatable only imperfectly with systemic drugs or surgery.
While many such neurotoxins are known, the currently most promising reagents of this type are the family of toxins derived from Clostridium botulinum, and the most preferred is pharmaceutical grade botulinum toxin Type A available commercially from Allergan Pharmaceuticals, Inc. under the tradename OCULINUM. The therapetic effects are achieved at dosage levels in the range between a few I.U. to 500 to 1000 I.U., preferably no more than 500 I.U., and most preferably no more than 300 I.U., and still most preferably between 50 I.U. and 200 I.U., administered on a microneedle array about a muscle or muscle group. The dimensions of the microneedle array control the zone of destruction of a subset of the neuromuscular junctions innervating the muscle, leaving others in a functional state.
Facial expression lines such as the transverse forehead lines or the nasolabial fold are created by attachments of projections of facial muscles into the dermis. Contraction of facial muscles generally is well known to produce the various characteristic forms of facial expressions such as smiling, grimacing, etc. In addition, exaggeration of facial lines also is associated with the aging process. The general principle of the application of the toxin is to limit the tonic contractile state of facial muscles so as to reduce muscle tone and to improve or change the quality and characteristics of facial expression.
The transverse forehead lines may be reduced in intensity by administering a quantity of toxin with a diffusion field of approximately 5 to 10 mms at the superior border of the forehead and at a point approximately 15 mms superior to the brow. This can be done symmetrically on both sides of the forehead. The glabellar lines (the frowning lines in the mid position of the forehead) may be targeted by treated the glabellar muscles with a toxin quantity producing a field of denervation of 5 to 10 mms The toxin is administered 15 mms. above the brow line in the mid position of the forehead. The nasal labial fold lines can be diminished in their intensity by treating the zygomatic major and minor muscles which emanate from the zygomatic arch and extend diagonally to the position of the nasal labial fold.
Thus, in one embodiment, the present invention contemplates a method of cosmetically decreasing facial wrinkling in a subject, the method comprising: providing i) a subject, and ii) a microneedle array comprising a chemodenervating pharmaceutical in a polymer formulation; and placing said microneedle array on the skin of said subject under conditions whereby said wrinkling is reduced. In a preferred embodiment said denervating pharmaceutical comprises a neurotoxin derived from Clostridium botulinum. In a particularly preferred embodiment, said neurotoxin is in the form of a fusion protein. In one embodiment, said chemodenervating agent is Acetyl hexapeptide-3 (trade name Argireline). Argireline is manufactured by a Spanish company Lipotec and is a hexapeptide (a chain of 6 amino acids) attached to the acetic acid residue. It is believed to work by inhibiting the release of neurotransmitters. When applied to the skin, Argireline relaxes facial tension leading to the reduction in facial lines and wrinkles with regular use.
In a further embodiment, the present invention contemplates a method of decreasing sweating (e.g. excessive sweating of the underarms, palms, feet, etc.) of a subject, the method comprising: providing i) a subject, and ii) a microneedle array comprising a chemodenervating pharmaceutical in a polymer formulation; and placing said microneedle array on the skin of said subject under conditions whereby said sweating is reduced. In a preferred embodiment said denervating pharmaceutical comprises a neurotoxin derived from Clostridium botulinum. In a particularly preferred embodiment, said neurotoxin is in the form of a fusion protein.
Alternatively, the present invention contemplates, in one embodiment, that alpha-Bungarotoxin molecules can be used in the manner of botulinum toxin A. In one embodiment, native alpha-Bungarotoxin is employed. As used herein, "native"
alphabungarotoxin molecules are those found in the venom of Bungarus multicinctus. The complete amino acid sequence of native alpha-bungarotoxin molecules and the DNA sequences that encode them have been published (see, e.g., GenBank accession numbers X91990, AF056400-AF056417, AJ131356, Y17057, Y17058, Y 17693, Y 17694). In one embodiment, the native sequence is IVCHTTATSPISAVTCPPGENLCYRKMWCD-AFCSSRGKV VELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG.
In a preferred embodiment, modified alpha-bungarotoxin molecules that have altered binding specificities are employed. In particular, modification of residues 38 (Lys) and 42 (Leu) to Pro and Gln, respectively, altered the binding specificity of alphabungarotoxin from alpha7-containing nicotinic acetylcholine receptors to alpha3beta.2-containing nicotinic acetylcholine receptors.
.59 Additional modifications to these amino acid residues and other amino acid residues are possible.
In another non-limiting embodiment, the at least one biologically active agent is an anthrax antigen. Anthrax is an acute infectious disease caused by the bacterium B.
anthracis. It occurs in wild and domestic lower vertebrates (cattle, sheep, goats, etc.), but can also occur in humans (e.g. do to exposure to infected animals or because of bioterrorism). The virulence of B. anthracis is dependent on Anthrax Toxin and the capsule, a polymer of gamma-D-glutamic acid. Anthrax Toxin (AT) consists of two enzymatic moieties, edema factor (EF) and lethal factor (LF), and a single receptor-binding moiety, protective antigen (PA).
The capsule is a poor immunogen. Wild-type PA (the amino acid sequence of which is shown in Figure 18) is also a poor immunogen. Indeed, the currently licensed human anthrax vaccine (AVA, BioPort Corporation, Lansing Mich.) requires six vaccinations over eighteen months followed by yearly boosters to induce and maintain protective anti-PA titers (Pittman et al., Vaccine 20:1412-20, 2002; Pittman et al., Vaccine 20:972-78, 2001). In some vaccines, this regimen is associated with undesirable side effects (Pittman et al., Vaccine 20:972-78, 2001). Thus, there is a need for an effective and safe vaccine that would require fewer doses to confer immunity to anthrax.
The present invention, in a non-limiting embodiment, an anthrax antigen (or fragment thereof) in a preparation suitable for transdermal, intra-epidermal, intradermal or intramucosal delivery. In another embodiment, antigen from Y. pestis or F. tularensis is contemplated in a preparation suitable for transdermal delivery. In a preferred embodiment, the present invention contemplates mutant anthrax protective antigen (e.g. the mutant antigens set forth in Table 4 below, or fragment thereof) in a preparation suitable for transdermal delivery.
Table 4. amino acid residues at which Cys substitutions inhibited PA acrivity by at least 100-fold.
Residues Domain 1 1210, K225, T240, K245 2 S337, G342, W346, T357, I364, P379, T380, S382, T390, T393, K397, N399, Y411, I419, A420, N422, F427, S248, D451, D453, V455, N458 4 1656, N657, I665, D683, L687 In one embodiment, the mutant protective antigen (or fragment thereof) is attached or linked to a carrier. In one embodiment, the mutant protective antigen (or fragment thereof) is part of a fusion protein. In one embodiment, the mutant protective antigen (or fragment thereof) is in a micelle formulation. In one embodiment, the mutant protective antigen (or fragment thereof) is in or on nanofibers, nanotubes, nanospheres, or nanocapsules. In one embodiment, the mutant protective antigen (or fragment thereof) is complexed with one or more dendrimers. In one embodiment, the mutant protective antigen (or fragment thereof) is in a liposome preparation (e.g. for liposome delivery). In a preferred embodiment, the mutant protective antigen (or fragment thereof) is on the surface of a substrate, e.g. on a skin patch, such as an array, of asperities such as those described herein, such as microprojections or microneedles or the like. Combinations of the above are contemplated specifically, including but not limited to substrates comprising the mutant protective antigen (or fragment thereof) in a polymer formulation, or in an assembly of nanofibers. In a particularly preferred embodiment, the mutant is functionally impaired (e.g.
it will not form pores or channels, or will otherwise not cause toxicity).
The present invention contemplates, in one embodiment, a preparation suitable for transdermal, intradermal, intra-epidermal, transmucosal, subcutaneous, intravenous, or intramuscular delivery comprising a first anthrax antigen (or fragment thereof) in a mixture with a second anthrax antigen (or fragment thereof). The present invention contemplates, in one embodiment, a preparation suitable for transdermal, transmucosal, subcutaneous, intravenous, or intramuscular delivery comprising a first anthrax antigen (or fragment thereof) conjugated to a second anthrax antigen (or fragment thereof). These first and second antigens (or fragments thereof) can be prepared simply as a mixture or, alternatively, they can be linked together in a conjugate. In one embodiment, the first and second antigens (or fragments thereof) are in a micelle formulation. In one embodiment, the first and second antigens (or fragments thereof) are in or on nanofibers, nanotubes, nanospheres, or nanocapsules. In one embodiment, the first and second antigens (or fragments thereof) are complexed with one or more dendrimers. In one embodiment, the first and second antigens (or fragments thereof) are in a liposome preparation (e.g. for liposome delivery). In a preferred embodiment, the first and second antigens (or fragments thereof) are on the surface of a substrate, e.g. on a skin patch, microneedle array, or the like. Combinations of the above are specifically contemplated, including but not limited to substrates comprising the first and second antigens (or fragments thereof) in a polymer formulation, or in an assembly of nanofibers. While edema factor and/or lethal factor (or fragments thereof) can be used as first and second antigens, in a preferred embodiment, said first and second antigens comprises (respectively) poly-glutamic acid and protective antigen (or fragment thereof). The present invention contemplates, in one embodiment, a preparation suitable for transdermal delivery comprising wild-type protective antigen or mutant protective antigen (e.g. the mutant antigens set forth in Table 4) conjugated to poly-glutamic acid. In a preferred embodiment, the present invention contemplates an array of microprojections or microneedles comprising anthrax antigen(s) selected from the group consisting of wild-type protective antigen (or fragment thereof), mutant protective antigen (or fragment thereof), a conjugate of wild-type protective antigen (or fragment thereof) and poly-glutamic acid, and a conjugate of mutant protective antigen (or fragment thereof) and poly-glutamic acid. In a particularly preferred embodiment, the mutant is functionally impaired (e.g.
it will not form pores or channels, or will otherwise not cause toxicity). In a preferred embodiment, the microprojections or microneedles have dimensions such that they penetrate into the stratum comeum, the epidermal layer, and, in some embodiments, the dermal layer. In one embodiment, the microprojections or microneedles have a length (or height) or less than 1000 microns, more preferably less than 500 microns, and still more preferably less than 250 microns. The microprojections may be formed in different shapes, such as needles, blades, pins, punches, and combinations thereof. When in an array, the density of the microprojections is at least microprojections/cm2, more preferably, at least 200 microprojections/cm2, and, in some embodiments, at least 1000 microprojections/cmz.
The present invention further contemplates, in one embodiment, a preparation comprising at least one polymer and at least one anthrax antigen (or fragment thereof). In another embodiment, antigen from Y. pestis or F. tularensis is contemplated in such a polymer preparation. It is not intended that the present invention be limited by the nature of the polymer since a variety of types can be used (see Table 1). In one embodiment, cross-linked polymers are employed. However, in a preferred embodiment, the polymer comprises polyvinylpyrrolidone or hydroxypropylcellulose. It is not intended that the present invention be limited by the nature of the antigen(s) in the polymer preparation. While anthrax edema factor and/or lethal factor (or fragments thereof) can be use, in one embodiment, the antigen(s) is/are selected from the group consisting of wild-type anthrax protective antigen (or fragment thereof), mutant protective antigen (or fragment thereof), a conjugate of wild-type protective antigen (or fragment thereof) and poly-glutamic acid, and a conjugate of mutant protective antigen (or fragment thereof) and poly-glutamic acid. In a particularly preferred embodiment, the mutant is functionally impaired (e.g.
it will not form pores or channels, or will otherwise not cause toxicity). It is contemplated that the polymer/antigen(s) preparation can be administered by a variety of routes (e.g. IP, IM, IV, inhalation, transdermal, intradermal, intra-epidermal, transmucosal, subcutaneous, etc.) It is not intended that the present invention be limited to the manner in which the preparation of polymer and antigen(s) is prepared. However, in one embodiment, the preparation is electrospun to create fibers or fiber mats. It is preferred that at least a portion of the antigen in the electrospun fibers or mats be capable of release or escape from the polymer (e.g. upon contact with an aqueous or semi-aqueous environment).
While edema factor and/or lethal factor can be used as antigens, in one embodiment, said antigen in said polymer preparation comprises poly-glutamic acid and protective antigen (or fragment thereof). These antigens can be prepared simply as a mixture.
However, in a preferred embodiment, the antigen comprises a conjugate of poly-glutamic acid and protective antigen (or fragment thereof). In one embodiment, the conjugate is prepared by covalently linking poly-glutamic acid to protective antigen (or fragment thereof). In one embodiment, the protective antigen (or fragment thereof) is wild-type. In a preferred embodiment, the protective antigen (or fragment thereof) is a mutant. In a particularly preferred embodiment, the mutant is functionally impaired (e.g. it will not form pores or channels, or will otherwise not cause toxicity).
It is not intended that the present invention be limited to a particular mutant. A variety of mutants have been described that are functionally impaired. For example, U.S.
Patent No.
7,037,503 (hereby incorporated by reference) to Collier et al. describes a group of dominant negative mutants having point mutations at positions 397 and/or 425 of the PA
protein (see Figure 18 for the wild-type sequence of the PA protein). In addition, Mourez et al.
(PNAS 100:13803 2003) describe 568 mutants, thirty-three of which demonstrate reduced ability to mediate toxicity (see Table 4). The present invention contemplates various embodiments wherein one or more of such mutants are employed (whether conjugated or unconjugated).
It is not intended that the present invention be limited to the nature of the conjugates (when conjugates are used). U.S. Patent Application 20060134143 to Schneerson et al.
(hereby incorporated by reference) describes immunogenic conjugates of poly-gamma-glutamic acid (PGA) made using a variety of different PGA types (including but not limited to PGA
comprising D-glutamic acid and PGA comprising L-glutamic acid) extracted from culture supernatants of B.
anthracis. In one example, recombinant wild-type PA was derivatized with adipic acid dihydrazide and reacted. On the other hand, Aulinger et al. (Infection & Immunity 73:3408 2005) describes conjugating PA (or a PA mutant) to purified PGA via a carbodiimide reaction.
Poly-L-glutamic acid and poly-D-glutamic acid sodium salt are commercially available from Sigma-Aldrich (St. Louis).
Protective antigen and fragments thereof (i.e. the 63kDa and 20kDa fragments) are commercially available from List Biological Laboratories, Inc. When a fragment is used, it is preferred that the 63kDa fragment is used (or a mutant thereof).
The present invention further contemplates, in one embodiment, a preparation comprising at least one anthrax antigen (or fragment thereof) in a hydrogel formulation. In another embodiment, antigen from Y. pestis or F. tularensis is contemplated in such a preparation.
It is not intended that the present invention be limited by the nature of the hydrogel since a variety of types can be used, including but not limited to ionically cross-linked hydrogels or hydrogel films. It is not intended that the present invention be limited by the nature of the antigen(s) in the hydrogel preparation. While edema factor and/or lethal factor (or fragments thereof) can be use, in one embodiment, the antigen(s) is/are selected from the group consisting of wild-type protective antigen (or fragment thereof), mutant protective antigen (or fragment thereof), a conjugate of wild-type protective antigen (or fragment thereof) and poly-glutamic acid, and a conjugate of mutant protective antigen (or fragment thereof) and poly-glutamic acid. In a particularly preferred embodiment, the mutant is functionally impaired (e.g. it will not form pores or channels, or will otherwise not cause toxicity). It is contemplated that the hydrogel/antigen(s) preparation can be deposited on a surface (in a uniform or non-uniform manner). In one embodiment, the preparation is deposited (e.g.
by dipping, coating, spin coating, spraying, or by suitable applicator) on an array of microprojections or microneedles for transdermal or transmucosal delivery of the antigen(s).
Regardless of whether a mutant or wild-type is used, the present invention contemplates administering one or more of the various embodiments of the preparations described above as a vaccine to humans and animals. In one embodiment, the present invention contemplates a method comprising: a) providing i) a preparation comprising at least one polymer and one or more anthrax antigens (or fragments thereof) and ii) a subject, wherein said subject is a human or non-human animal; and b) contacting said subject with said preparation (e.g. under conditions such that said subject generates an immune response to said one or more antigens). In one embodiment, the present invention contemplates a method comprising: a) providing i) a preparation comprising one or more anthrax antigens (or fragments thereof) in a hydrogel formulation and ii) a subject, wherein said subject is a human or non-human animal; and b) contacting said subject with said preparation (e.g.
under conditions such that said subject generates an immune response to said one or more antigens).
In a preferred embodiment, a conjugate of two anthrax antigens is employed (as discussed above). In a preferred embodiment, the conjugate is electrospun with one or more polymers so as to create an electrospun preparation. As discussed below, in a preferred embodiment, the electrospun preparation is part of a vaccine delivery system. In a preferred embodiment, the electrospun preparation is delivered transdermally, intradermally, intra-epidermally, transmucosally, subcutaneously, IP, IV or IM.
The present invention further contemplates, in one embodiment, a vaccine delivery system comprising a) a substrate comprising microprojections or microneedles,and an embodiment of the various preparations (mentioned above) comprising either i) antigen(s) alone (or fragments thereof), ii) antigen(s) (or fragments thereof) and carrier alone, iii) polymer (or hydrogel) and antigen(s) (or fragments thereof), iv) conjugates of poly-glutamic acid and wild-type or mutant protective antigen (or fragment thereof), or v) iv) polymer (or hydrogel) and conjugates of poly-glutamic acid and wild-type or mutant protective antigen (or fragment thereof). When microneedles are used, they may be solid or hollow. It is not intended that the present invention be limited to the manner in which the microneedles are contacted with the preparation. In one embodiment, the microneedles are contacted only at the microneedle tips. In a preferred embodiment, the preparation contacts the entire substrate (or substantially the entire substrate) such that the preparation contacts even the spaces between an may of microneedles. It is not intended that the present invention be limited to uniform coatings of the preparation. In one embodiment, the preparation is present on the substrate in a non-uniform manner.
In one embodiment, a polymer/antigen(s) preparation is sprayed on said microneedles. In one embodiment, said microneedles are dipped into a preparation comprising at least one polymer and at least one anthrax antigen (or fragment thereof). In a preferred embodiment, an electrospun polymer/antigen(s) preparation is deposited on said microneedles. In another embodiment, antigen from Y. pestis or F. tularensis is contemplated in such an electrospun polymer/antigen(s) preparation and this preparation is deposited on said microneedles.
In one embodiment, the present invention contemplates using at least two different anthrax protective antigens (or fragments thereof). For example, in order to generate effective immunity against more virulent strains of Bacillus anthracis, such as Vollum 1 B, the Ames strain, two or more different sources of protective antigens (or fragments thereof) are contemplated in one embodiment, and mutants in another embodiment. Protective antigen from variants of such strains are also contemplated.
Thus, the present invention contemplates novel conjugates, formulations, delivery devices, methods of conjugation, methods of formulation, and methods of delivery. In one embodiment, the present invention contemplates a method of creating a formulation: providing i) at least one fiber-forming material, and ii) a preparation comprising at least one anthrax antigen; mixing said fiber-forming material with said preparation so as to create a mixture; and electrospinning said mixture to create electrospun formulation. In one embodiment, the method further comprises: depositing at least a portion of said electrospun material onto at least a portion of a substrate to create a treated substrate (e.g. a substrate comprising microneedles). The present invention also contemplates, as a device, the treated substrate prepared according to the above-described method. In one embodiment, said fiber-forming material comprises hydroxypropylcellulose, while in another embodiment said fiber-forming material comprises PVP. In one embodiment, said preparation comprises first and second anthrax antigens (e.g. said first anthrax antigen comprises poly-gamma-glutamic acid and said second anthrax antigen comprises protective antigen). In one embodiment, said protective antigen is wild-type, while in another embodiment, said protective antigen is mutant. In a preferred embodiment, said first and second antigens are linked to form a conjugate.
In one embodiment, the present invention contemplates a method of creating an antigen delivery device, comprising: providing i) at least one fiber-forming material, ii) a preparation comprising at least two anthrax antigens, and iii) a substrate comprising a plurality of microprojections; mixing said fiber-forming material with said preparation so as to create a mixture;
electrospinning said mixture to create electrospun material; and depositing at least a portion of said electrospun material onto at least a portion of said substrate, so as to create an antigen delivery device. In one embodiment, said two anthrax antigens comprises poly-gamma-glutamic acid and protective antigen (e.g. linked to form a conjugate). In one embodiment, said protective antigen is wild-type, while in another embodiment, said protective antigen is mutant. In one embodiment, said fiber-forming material comprises hydroxypropylcellulose, while in another embodiment said fiber-forming material comprises PVP. The present invention also contemplates, as a device, the antigen delivery device prepared according to the above-described method.
The present invention also contemplates, in one embodiment, a drug delivery device comprising: a substrate having a back surface and a front surface; a plurality of solid microneedles extending upwards from the front surface of the substrate, the microneedles comprising a formulation, said formulation comprising at least one polymer and at least one anthrax antigen (e.g.
a two antigen conjugate as described above).
Anthrax toxin is a member of the binary bacterial toxins, a subset of intracellularly acting toxins in which the enzymatic and receptor-binding moieties are secreted by the bacteria as discrete monomeric proteins. While an understanding of the mechanism of action of these toxins is not needed for the successful practice of the various embodiments of the present invention, it is believed these proteins assemble at the surface of receptor-bearing eukaryotic cells to form toxic hetero-oligomeric complexes. The complexes are internalized and delivered to an acidic compartment, where the receptor-binding moiety inserts into the membrane and mediates translocation of the enzymatic moiety to the cytosol. Within the cytosol, the enzymatic moiety modifies a molecular target, disrupting cell physiology and causing cytopathic effects.
Anthrax toxin consists of two enzymatic moieties, edema factor (EF; 89 kDa) and lethal factor (LF; 90 kDa), and a single receptor-binding moiety, protective antigen (PA; 83 kDa), named for its ability to elicit protective immunity. The amino acid sequence for wild-type PA is shown in Figure 18. The nucleic acid sequence encoding wild-type PA is shown in Figure 19. EF is a Ca 2+
and calmodulin-dependent adenylate cyclase, and LF is a ZnZ+ -dependent protease that cleaves mitogen-activated protein kinase kinases.
The crystallographic structure of intact PA has been solved and shows that the protein is organized into four domains. Domain 1, the N-terminal domain, contains the furin cleavage site and therefore encompasses PA20. That portion of domain 1 within PA63, termed domain F, contains two calcium atoms and participates in EF/LF binding and oligomerization. Domain 2 contains a flexible loop (2132-2133) that is believed to form the transmembrane region of the pore. While not limiting the invention in any manner by reference to proposed mechanisms, it is believed (based on ion conductance experiments on Cys-substitution mutants) that the 2132-2133 loops from the seven subunits of the prepore combine to form a transmembrane 14-strand 13 -barrel.
Domain 3 is believed to be involved in oligomerization, and domain 4, the C-terminal domain, contains the receptor-binding site. In addition to monomeric PA, the structure of a soluble form of the PA63 heptamer has been solved; it is believed to represent the conformation of the heptamer before pore formation and has been termed the prepore.
PA mutants have been described that block the intoxication process. There has been some interest in mutations that make the protein dominantly negative (DN), thereby converting it into a potent antitoxin. Without limiting the invention in any manner by reference to proposed mechanisms, it is believed that DN-PA co-oligomerizes with wild-type PA63 and inhibits its ability to form pores and mediate translocation. Point mutations at D425 and F427, a deletion or substitution of the 2132-2133 loop, or combinations of these mutations, have been shown to confer varying degrees of DN activity on PA. Interestingly, the conjugation of such a=DN mutant to PGA
has been reported to generate a much improved immune response (as compared to wild-type PA
alone or even wild-type PA conjugated to PGA). Aulinger et al. (Infection &
Immunity 73:3408 2005). In one embodiment, the present invention contemplates transdermal delivery of such conjugates, wherein said mutant comprises a substitution at K397, D425 or both. In a preferred embodiment, said mutant is selected from the group consisting of K397A, K397D, K397C, and K397Q. In another embodiment, said mutant is selected from the group consisting of D425A, D425N, D425E, and D425K. In another embodiment, said mutant is defined by a substitution at position F427 (including but not limited to F427A, F427D, and F427K). In one embodiment, the present invention contemplates transdermal delivery of such conjugates, wherein said mutant comprises a substitution at K397, D425 and F427. In one embodiment, the present invention contemplates transdermal delivery of such conjugates, wherein said mutant comprises a deletion or substitution of the 213z-2 133 loop.
The analysis of large arrays of PA mutants has recently become feasible, following identification of ways to obtain small-scale preparations of PA mutants and screen them rapidly and reliably for defects in PA functions. To search PA for additional DN sites, researchers at the University of Oklahoma developed a protocol to mutate each of the 568 amino acids of PA63 to Cys and characterize the resulting mutants. They restricted their study to PA63 because PA20 does not appear to play a role in intoxication besides preventing toxin assembly in solution. Cys-replacements were chosen because this amino acid is absent from PA and because the thiol-containing side chain is amenable to specific derivatization, facilitating structure-function studies.
These researchers first screened for mutations that a caused large (>100-fold) reduction in PA's ability to mediate toxicity (these mutations are listed in Table 4). Such mutations were identified in all four domains, but a majority were in domain 2. Mutations conferring the DN
phenotype were found exclusively within domain 2, in the 2136 strand, the 2137 strand, or the 21310-21311 loop.
Because DN mutants prevent the conformational transition of PA63 from the prepore to the pore state, they concluded that these structural elements play major roles in this change.
As noted above, in another embodiment, antigen from Y. pestis or F. tularensis is contemplated in a preparation suitable for transdermal delivery. It is not intended that the present invention be limited by the particular antigens from these organisms. However, in one embodiment, an Fl capsule antigen from Y. pestis is employed in a polymer formulation (e.g. electrospun formulation) deposited on a microneedle array. In another embodiment, the LcrV
protein (or fragment thereof) from Y. pestis is similarly employed. In a particular embodiment, these two antigens are used together (as a mixture, conjugate or fusion protein). In still another embodiment, one or more virulence-associated factors are employed, including but not limited to catalase-peroxidase (KatY), murine toxin (Ymt), plasminogen activator (Pla), and Fl capsule antigen (Can) from Y. pestis. In one embodiment, a specific sequence of the outer membrane protein encoded by the fopA gene of F. tularensis is employed.
In one embodiment, the present invention contemplates using new and previously identified PA mutants (or fragments thereof) in vaccines. In a preferred embodiment, such mutants are conjugated to PGA and electrospun with one or more polymers.
In a preferred embodiment, the preparation comprising anthrax antigen(s) is capable, after electrospinning, of acting as an antigen by eliciting an immune response in a human or animal. It is envisioned that in such an embodiment, a medically acceptable fiber-forming material may be used to preserve the antigen for later rehydration and use as a vaccine. In general, rehydration of the fiber of the present invention may be accomplished by mixing the fiber with a solvent for the fiber-forming material. When the fiber is used to preserve an antigen for use in a vaccine, the solvent will optimally be a medically acceptable compound.
It is not intended that the present invention be limited to the method by which the electrospun anthrax antigen(s) is administered. The resulting vaccine may be injected or an ingested vaccine. However, in a preferred embodiment, the vaccine is administered at or in the skin. In a particularly preferred embodiment, the electrospun polymer/anthrax antigen(s) material is delivered on microneedles or on a patch such that antigen(s) is released into the skin.
In one embodiment, the anthrax antiget(s) may be contained in an ionically cross-linked macromolecular assembly such as those hereinabove described, including a hydrogel, as described hereinabove.
In one embodiment, the present invention contemplates a method of administering one or more anthrax antigens to a patient comprising the steps of penetrating at least an outer layer of the skin of the patient with one or more microneedles extending from a front surface of a substrate, at least one of the one or more microneedles (or portion thereof) contacted or coated (uniformly or non-uniformly) by an anthrax antigen preparation (discussed above), and releasing at least one of the one or more anthrax antigens into the patient.
In another non-limiting embodiment, the at least one biologically active agent is a hormone.
Osteoporosis is a bone disorder characterized by progressive bone loss that predisposes an individual to an increased risk of fracture, typically in the hip, spine and wrist. The progressive bone loss, which typically begins between the ages of 40 and 50, is mainly asymptomatic until a bone fracture occurs, leading to a high degree of patient morbidity and mortality.
Eighty percent of those affected by osteoporosis are women and, based on recent studies, during the six years following the onset of menopause, women lose one third of their bone mass.
Parathyroid hormone (PTH) is a hormone secreted by the parathyroid gland that regulates the metabolism of calcium and phosphate in the body. PTH has stirred great interest in the treatment of osteoporosis for its ability to promote bone formation and, hence, dramatically reduced incidence of fractures. Large-scale clinical trials have shown that PTH effectively and safely reduces the percentage of vertebral and non-vertebral fractures in women with osteoporosis. PTH-based agents have also stirred interest in the treatment of bone fractures (in both men and women) by virtue of their ability to accelerate bone healing.
To this end, various stabilized formulations of PTH-based agents have been developed that can be reconstituted for subcutaneous injection, which, as discussed below, is the conventional means of delivery. Illustrative are the formulations disclosed in U.S. Pat.
No. 5,563,122 ("Stabilized Parathyroid Hormone Composition") and U.S. patent application Pub. No.
("Stabilized Teriparatide Solutions"), which are incorporated by reference herein in their entirety.
A currently approved injectable PTH-based agent is FORTEO (an rDNA derived teriparatide injection), which contains recombinant human parathyroid hormone (1-34), (rhPTH (1-34)).
FORTEOTM is typically prescribed for women with a history of osteoporotic fracture, who have multiple risk factors for fracture, or who have failed or are intolerant of previous osteoporosis therapy, based on a physician's assessment. In postmenopausal women with Osteoporosis, FORTEOTM has been found to increase bone mineral density (BMD) and reduce the risk of vertebral and non-vertebral fractures.
FORTEOTM has also been found to increase bone mass in men with primary or hypogonadal osteoporosis who are at high risk for fracture. These include men with a history of osteoporotic fracture, or who have multiple risk factors for fracture, or who have failed or are intolerant to previous osteoporosis therapy. In men with primary or hypogonadal osteoporosis, FORTEOTM has similarly been found to increase BMD.
Despite the efficacy of PTH in treating disorders such as osteoporosis, there are several drawbacks and disadvantages associated with the disclosed prior art methods of delivering PTH, particularly, via subcutaneous injection. A major drawback is that subcutaneous injection is a difficult and uncomfortable procedure, which often results in poor patient compliance.
What is needed is a more comfortable hormone delivery approach with good patient compliance.
The present invention contemplates, in one embodiment, a hormone, including but not limited to PTH (or a fragment thereof, such as the 1-34 fragment), in a preparation suitable for transdermal, intradermal, intra-epidermal or intramucosal delivery. In one embodiment, the hormone (or fragment thereof) is attached or linked to a carrier. In one embodiment, the hormone (or fragment thereof) is part of a fusion protein. In one embodiment, the hormone (or fragment thereof) is in a micelle formulation. In one embodiment, the hormone (or fragment thereof) is in or on nanofibers, nanotubes, nanospheres, or nanocapsules. In one embodiment, the hormone (or fragment thereof) is complexed with one or more dendrimers. In one embodiment, the hormone (or fragment thereof) is in a liposome preparation (e.g. for liposome delivery). In a preferred embodiment, the hormone (or fragment thereof) is on the surface of a substrate, e.g. on a skin patch, an array, of asperities such as those herein described, such as microprojections or microneedles, or the like.
Combinations of the above are contemplated specifically, including but not limited to substrates comprising the hormone (or fragment thereof) in a polymer formulation, or in an assembly of nanofibers. In a particularly preferred embodiment, the hormone is functional and not functionally impaired.
The present invention contemplates, in one embodiment, a preparation suitable for transdermal, intradermal, intra-epidermal, transmucosal, subcutaneous, intravenous, or intramuscular delivery comprising a first hormone (or fragment thereof) in a mixture with a second hormone (or fragment thereof). These first and second hormones (or fragments thereof) can be prepared simply as a mixture or, alternatively, they can be linked together in a conjugate. In one embodiment, the first and second hormones (or fragments thereof) are in a micelle formulation. In one embodiment, the first and second hormones (or fragments thereof) are in or on nanofibers, nanotubes, nanospheres, or nanocapsules. In one embodiment, the first and second hormones (or fragments thereof) are complexed with one or more dendrimers. In one embodiment, the first and second hormones (or fragments thereof) are in a liposome preparation (e.g. for liposome delivery).
In a preferred embodiment, the first and second hormones (or fragments thereof) are on the surface of a substrate, e.g. on a skin patch, microneedle array, or the like.
Combinations of the above are specifically contemplated, including but not limited to substrates comprising the first and second hormones (or fragments thereof) in a polymer formulation, or in an assembly of nanofibers. In a preferred embodiment, said first hormone is PTH (or the 1-34 fragment thereof) and the second hormone is calcitonin (e.g. human or salmon). In a preferred embodiment, the hormone(s) preparation is placed on microprojections or microneedles having dimensions such that they penetrate into the stratum corneum, the epidermal layer, and, in some embodiments, the dermal layer. In one embodiment, the microprojections or microneedles have a length (or height) or less than 1000 microns, more preferably less than 500 microns, and still more preferably less than 250 microns. The microprojections may be formed in different shapes, such as needles, blades, pins, punches, and combinations thereof. When in an array, the density of the microprojections is at least microprojections/cm2, more preferably, at least 200 microprojections/cmz, and, in some embodiments, at least 1000 microprojections/cm2.
The present invention further contemplates, in one embodiment, a preparation comprising at least one polymer and at least one hormone (or fragment thereof). It is not intended that the present invention be limited by the nature of the polymer since a variety of types can be used (see Table 1).
In one embodiment, cross-linked polymers are employed. However, in a preferred embodiment, the polymer comprises polyvinylpyrrolidone or hydroxypropylcellulose. In another embodiment, said polymer is hydroxyethylcellulose. It is not intended that the present invention be limited by the nature of the hormone(s) in the polymer preparation. However, in a particularly preferred embodiment, a functional PTH (or the 1-34 PTH fragment) is contemplated for use in the polymer formulation. Human and bovine sequences of 1-34 PTH are shown in Figure 20. It is contemplated that the polymer/hormone(s) preparation can be administered by a variety of routes (e.g. IP, IM, IV, inhalation, transdermal, intradermal, 'infra-epidermal, transmucosal, subcutaneous, etc.).
It is not intended that the present invention be limited to the manner in which the preparation of polymer and hormone(s) is prepared. However, in a preferred embodiment, the preparation is electrospun to create fibers or fiber mats. It is preferred that at least a portion of the hormone in the electrospun fibers or mats be capable of release or escape from the polymer (e.g. upon contact with an aqueous or semi-aqueous environment). In one embodiment, the electrospun polymer/hormone(s) fiber mat is placed directly on the skin. In another embodiment, the polymer/hormone(s) fiber mat is part of a delivery vehicle (e.g. skin patch, microneedle array, etc.).
The present invention further contemplates, in one embodiment, a preparation comprising at least one hormone (or fragment thereof) in a hydrogel formulation. It is not intended that the present invention be limited by the nature of the hydrogel since a variety of types can be used, including but not limited to ionically cross-linked hydrogels or hydrogel films. It is not intended that the present invention be limited by the nature of the hormone(s) in the hydrogel preparation. In a particularly preferred embodiment, the hormone comprises a functional PTH (or 1-34 fragment thereof). It is contemplated that the hydrogel/hormone(s) preparation can be deposited on a surface (in a uniform or non-uniform manner). In one embodiment, the preparation is deposited (e.g.
by dipping, coating, spin coating, spraying, or by suitable applicator) on an array of asperities such as microprojections or microneedles as described herein for transdermal, intradermal, intra-epidermal, or transmucosal delivery of the hormone(s).
Other systems and apparatus that employ tiny skin piercing elements to enhance transdermal agent delivery are disclosed in U.S. Pat. Nos. 5,879,326, 3,814,097, 5,250,023, 3,964,482, Reissue U.S. Pat. No. 25,637, and PCT Publication Nos. WO 96/37155, WO 96/37256, WO
96/17648, WO
97/03718, WO 98/11937, WO 98/00193, WO 97/48440, WO 97/48441, WO 97/48442, WO
98/00193, WO 99/64580, WO 98/28037, WO 98/29298, and WO 98/29365; all incorporated herein by reference in their entirety.
The present invention contemplates administering one or more of the various embodiments of the preparations described above as a prophylactic or therapeutic to humans and animals. In one embodiment, the present invention contemplates a method comprising: a) providing i) a preparation comprising at least one polymer and one or more hormones (or fragments thereof) and ii) a subject, wherein said subject is a human or non-human animal; and b) contacting said subject with said preparation (e.g. under conditions such that at least a portion of said hormone is released into said subject). In one embodiment, the present invention contemplates a method comprising: a) providing i) a preparation comprising one or more hormones (or fragments thereof) in a hydrogel formulation and ii) a subject, wherein said subject is a human or non-human animal; and b) contacting said subject with said preparation (e.g. under conditions such that at least a portion of said hormone is released into said subject). In a preferred embodiment, two hormones are employed (as discussed above). In a preferred embodiment, the hormones are electrospun with one or more polymers so as to create an electrospun preparation. As discussed below, in a preferred embodiment, the electrospun preparation is part of a hormone delivery system. In a preferred embodiment, the electrospun preparation is delivered transdermally, intradermally, intra-epidermal, transmucosally, subcutaneously, IP, IV or IM.
The present invention further contemplates, in one embodiment, a hormone delivery system comprising a) a substrate comprising microprojections or microneedles, and an embodiment of the various preparations (mentioned above) comprising either i) hormone(s) alone (or fragments thereof), ii) hormone(s) (or fragments thereof) and carrier alone, or iii) polymer (or hydrogel) and hormone(s) (or fragments thereof). When microneedles are used, they may be solid or hollow. It is not intended that the present invention be limited to the manner in which the microneedles are contacted with the preparation. In one embodiment, the microneedles are contacted only at the microneedle tips. In a preferred embodiment, the preparation contacts the entire substrate (or substantially the entire substrate) such that the preparation contacts even the spaces between an array of microneedles. It is not intended that the present invention be limited to uniform coatings of the preparation. In one embodiment, the preparation is present on the substrate in a non-uniform manner. In one embodiment, a polymer/hormone(s) preparation is sprayed on said microneedles. In one embodiment, said microneedles are dipped into a preparation comprising at least one polymer and at least one hormone (or fragment thereof). In a preferred embodiment, an electrospun polymer/hormone(s) preparation is deposited on said microneedles.
It is not intended that the present invention be limited by the nature of the substrate comprising said microneedles. In one embodiment, the microneedles are formulated out of polymer.
In one embodiment, the microneedles are formulated (at least in part) out of a polymer/hormone(s) preparation. In another embodiment, the microneedles are made with a mold. In a preferred embodiment, the microneedles are etched out of a silicon substrate. In a preferred embodiment, said silicon microneedles are solid and an electrospun polymer/hormone(s) preparation is deposited on said microneedles.
Thus, the present invention contemplates novel formulations, delivery devices, methods of formulation, and methods of delivery. In one embodiment, the present invention contemplates a method of creating a formulation: providing i) at least one fiber-forming material, and ii) a preparation comprising at least one hormone (or fragment thereof); mixing said fiber-forming material with said preparation so as to create a mixture; and electrospinning said mixture to create electrospun formulation. In one embodiment, the method further comprises:
depositing at least a portion of said electrospun material onto at least a portion of a substrate (e.g. a substrate comprising microneedles, including but not limited to etched solid microneedles) to create a treated substrate..
The present invention also contemplates, as a device, the treated substrate prepared according to the above-described method. In one embodiment, said fiber-forming material comprises hydroxypropyl-cellulose, while in another embodiment said fiber-forming material comprises PVP. In one embodiment, said preparation comprises first and second hormones. In a preferred embodiment, said first hormone comprises PTH (1-34).
In one embodiment, the present invention contemplates a method of creating a hormone delivery device, comprising: providing i) at least one fiber-forming material, ii) a preparation comprising providing i) at least one fiber-forming material, ii) a preparation comprising at least one hormone (or fragment thereof), and iii) a substrate comprising a plurality microprojections; mixing said fiber-forming material with said preparation so as to create a mixture;
electrospinning said mixture to create electrospun material; and depositing at least a portion of said electrospun material onto at least a portion of said substrate, so as to create a hormone delivery device. In a preferred embodiment, said hormone comprises PTH (1-34). In one embodiment, said fiber-forming material comprises hydroxypropyl-cellulose, while in another embodiment said fiber-forming material comprises PVP. The present invention also contemplates, as a device, the hormone delivery device prepared according to the above-described method.
The present invention, as mentioned above, also contemplates methods of administering hormones. On one embodiment, the method of administering hormone comprises:
providing: a subject and the hormone delivery device described above; and contacting said subject with said delivery device under conditions such at least a portion of said hormone is released from said device. In one embodiment, said contacting of step b) comprises piercing the subject's skin with said microprojections.
The present invention also contemplates, in one embodiment, a hormone delivery device comprising: a substrate having a back surface and a front surface; a plurality of solid microneedles extending upwards from the front surface of the substrate, the microneedles comprising a formulation, said formulation comprising at least one polymer and at least one hormone (or fragment thereof). In a preferred embodiment, said hormone comprises PTH (1-34).
Importantly, the present invention contemplates utilizing, in some embodiments, peptide hormones that are protease resistant. In one embodiment, such protease-resistant peptides are peptides comprising protecting groups. In some embodiments, the peptide hormone (such as 1-34 PTH) has the amino terminus blocked by standard methods to prevent digestion by exopeptidases, for example by acetylation. In another embodiment, the carboxyl terminus is blocked by standard methods to prevent digestion by exopeptidases, for example, by amidation. In some embodiments, both the amino terminus and the carboxyl terminus are blocked, e.g. the amino terminus is blocked with an acetal group, and said peptide's carboxyl terminus is blocked with an acetate group. In another embodiment, endoprotease-resistance is achieved using peptides which comprise at least one D-amino acid.
The present invention contemplates a variety of hormones and hormone combinations in the above-indicated formulations and delivery vehicles. Vertebrate hormones fall into three chemical classes: Amine derived hormones (examples are catecholamines and thyroxine, as well as melatonin and serotonin); Peptide hormones (examples are TRH and vasopression, as well as leuteinizing hormone, follicle-stimulating hormone, EPO, angiotensin, gastrin, growth hormone and thyroid-stimulating hormone; preferred embodiments of peptide hormones include glucagon, glucagon-like peptide GLP-1, and Exendin-4); Lipid and phospholipids (examples are steroid hormones such as testosterone and cortisol, sterol hormones such as calcitriol, and eicosanoids such as prostaglandins).
The most commonly-prescribed hormones are estrogens and progestagens, thyroxine (such as levothyrroxin) and steroids. Of course, insulin is used by diabetics.
A "pharmacologic dose" of a hormone is a medical usage referring to an amount of a hormone far greater than naturally occurs in a healthy body. The effects of pharmacologic doses of hormones may be different from responses to naturally-occurring amounts and may be therapeutically useful. An example is the ability of pharmacologic doses of glucocorticoid to suppress inflammation.
In a preferred embodiment, the present invention contemplates formulations of a PTH-based agent, such as PTH-based agent is selected from the group consisting of hPTH(1-34), hPTH salts and analogs, teriparatide and related peptides. Throughout this application, the terms "PTH-based agent" and "PTH(1-34)" include, without limitation, recombinant hPTH(I-34), synthetic hpTH(1-34), PTH(1-34), teriparatide, hPTH(I-34) salts, simple derivatives of hPTH(1-34), such as hPTH(1-34) amide, and closely related molecules, such as hPTH(1-33) or hPTH(1-31) amide, or any other closely related osteogenic peptide. Synthetic hPTH(1-34) is the most preferred PTH agent (however, 1-34 PTH from other species is also contemplated).
Examples of pharmaceutically acceptable hPTH salts include, without limitation, acetate, propionate, butyrate, pentanoate, hexanoate, heptanoate, levulinate, chloride, bromide, citrate, succinate, maleate, glycolate, gluconate, glucuronate, 3-hydroxyisobutyrate, tricarballylicate, malonate, adipate, citraconate, glutarate, itaconate, mesaconate, citramalate, dimethylolpropinate, tiglicate, glycerate, methacrylate, isocrotonate,l3-hydroxibutyrate, crotonate, angelate, hydracrylate, ascorbate, aspartate, glutamate, 2-hydroxyisobutyrate, lactate, malate, pyruvate, fumarate, tartarate, nitrate, phosphate, benzene, sulfonate, methane sulfonate, sulfate and sulfonate.
Preferably, the PTH-based agent is present in the coating formulation at a concentration in the range of approximately 1-30 wt. %.
More preferably, the amount of PTH-based agent contained in the solid biocompatible coating (i.e., microprojection member or product) is in the range of approximately l g-1000 g, even more preferably, in the range of approximately 10-100 g.
In a further embodiment of the invention, the coating formulation includes at least one polymeric material or polymer that has amphiphilic properties, which can comprise, without limitation, cellulose derivatives, such as hydroxyethylcellulose (HEC), hydroxypropylmethylcellulose (HPMC), hydroxypropycellulose (HPC), methylcellulose (MC), hydroxyethylmethylcellulose (HEMC), or ethylhydroxy-ethylcellulose (EHEC), as well as pluronics.
In one embodiment of the invention, the concentration of the polymer presenting amphiphilic properties in the coating formulation is in the range of approximately 0.01-20 wt. %, and in one embodiment in the range of approximately 0.03-10 wt.% of the coating formulation.
In another embodiment, the coating formulation includes a hydrophilic polymer selected from the following group: hydroxyethyl starch, carboxymethyl cellulose and salts of, dextran, poly(vinyl alcohol), poly(ethylene oxide), poly(2-hydroxyethylmethacrylate), poly(n-vinyl pyrolidone), polyethylene glycol and mixtures thereof, and like polymers.
In one embodiment, the concentration of the hydrophilic polymer in the coating formulation is in the range of approximately 1-30 wt. %, and in another embodiment, in the range of approximately 1-20 wt. % of the coating formulation.
In one embodiment, the present invention contemplates utilizing an electrospun formulation (e.g. alone or on a delivery vehicle described herein) comprising at least one substance to improve the look and/or feel of skin, wherein said substance is selected from the group consisting of vitamins (e.g. A, C, D and/or E), polysaccharides, botanicals, proteins/peptides (e.g.
collagen, keratin, elastin, and peptide fragments thereof, including but not limited to pentapeptides such as KTTKS), fatty acids (omega-3, omega-6, etc.), and enzymes/coenzymes. In one embodiment, bioactive factors from whey (e.g. lactalbumin, lactoferrin, lactose, etc.) are contemplated for such formulations.
With respect to botanicals, both plant extracts and purified bioactive agents from plants (e.g.
in electrospun polymer formulations) are contemplated in some embodiments. It is not intended that the present invention be limited to a particular plant or group of plants.
Illustrative plants (from which extracts can be made or agents can be purified) include but are not limited to aloe vera, St.
John's Wort (hypericum crean), Noni (Morinda citrifolia), coffee plant, white and green tea (camellia sinensis), avocado (persea Americana), jojoba (simmondsia chinensis), almond (prunus dulcis), olive oils (olea europea), Sea Kulp, Yacon (smallanthus sonchifolius), soy (glycine max), comfrey plant (symphytum uplandicum), gotu cola (centella asiatica), and African Baobab Tree (adansonia digitata). In one embodiment, the present invention contemplates extracts or purified agents useful for treating cellulite, wherein said plants are selected from the group consisting of meadowsweet (spiraea ulmaria), coffee plant (caffeine), ginkgo (ginkgo biloba), birch (betula), common ivy (hedera helix), and lemon (citrus lemon). In one embodiment, the present invention contemplates extracts or purified agents useful for treating acne, wherein said plants are selected from the group consisting of saw palmetto (sereonnoa repens), green tea (camellia sinensis), soy (glycyne soja), burdock (arctium lappa), tea tree (melaleuca alternifolia), wild pansy (viola tricolor), kiwi (actinidia chinensis), kokum (garcinia indica), and licorice (glycyrrhiza glabra). In one embodiment, the present invention contemplates extracts or purified agents useful as skin whiteners, wherein said plant is selected from the group consisting of bearbeny (arctostaphylos uva-ursi), aloe vera, lemon citrus, white mulberry (moms alba), Chinese sage (salvia miltrionhiza), watercress (nasturtium officinale), and amla (embelica officinalis). In one embodiment, the present invention contemplates extracts or purified agents useful for specific skin conditions, wherein said plant is selected from the group consisting of yarrow flowers (achillea millefolium), oats (avena sativa), pot marigold (calendula officinalis), chesnut bark (castaneva sativa), hawthorn fruits (crataegus monogina), cucumber seeds (cucumis sativus), semitake mushrooms (cordyceps sabolifera), wormwood (artemesia carvifolia), oriental horsetail (equisetum arvense), and tamanu (calophyllum inophyllum).
In one embodiment, the present invention contemplates utilizing a delivery vehicle described herein comprising at least one hormone (e.g. electrospun hormone) to treat (or prevent) a skin condition. In one embodiment, the hormone (e.g., estradiol, or a vitamin) is prescribed to treat a condition, including but not limited to a skin condition that is the result of photodamage or photoaging. In one embodiment, the present invention contemplates treating a skin condition associated with inflammation with such a delivery device described herein comprising one or more retinoids (the vitamin A family). In yet another embodiment, the present invention contemplates utilizing a delivery vehicle described herein (e.g. microneedle array) comprising Vitamin D (and/or analogs) for the treatment of psoriasis. In one embodiment of the present invention, the delivery device comprising Vitamin E is utilized for the prevention and treatment of skin scars and/or keloids. In another embodiment, the present invention contemplates utilizing one of the delivery devices described herein comprising selenium in order to a) protect keratinocytes against damage from ultraviolet radiation, b) promote the healing of wounds and burns, and c) reduce the chance of skin cancer (i.e. an anti-oncogenic treatment). In one embodiment, the present invention contemplates such a delivery device comprising combinations of the above-named vitamins and minerals (e.g. vitamin D in combination with selenium) in a formulation (e.g.
an electrospun formulation or hydrogel formulation).
In one embodiment, the present invention contemplates utilizing a delivery vehicle described herein (e.g. microneedle array) for delivery of Vitamin C (e.g. in an electrospun polymer formulation) in subjects (e.g. subjects who cannot take Vitamin C orally) through the skin. In another embodiment, the present invention contemplates the delivery of Vitamin C to the skin without utilizing a microneedle may (e.g. in an electrospun polymer formulation or on a skin patch).
In still another embodiment, Vitamin C is administered using both of the above approaches are utilized so as to achieve both local and systemic administration.
In one embodiment, the present invention contemplates utilizing a delivery vehicle described herein comprising at least one hormone (e.g. electrospun hormone) to treat (or prevent) type II
diabetes. In one embodiment, the hormone is GLP-1. In another embodiment, the hormone is Exendin-4 or fragments thereof such as Exendin-4 (3-39) and Exendin-4 (9-39).
As noted above, in some embodiments, protease resistance versions of such peptide hormones are contemplated, including but not limited to N-acetal GLP-1 (commercially available from Phoenix Pharmaceuticals, Inc.). The amino acid sequences for such peptide hormones are shown in Figure 21.
In one embodiment, the present invention contemplates electrospun hormones, including but not limited to PTH(1-34). In a preferred embodiment, such hormones are electrospun with one or more polymers such as those described herein.
In a preferred embodiment, the preparation comprising hormone(s) is capable, after electrospinning, of releasing some functional hormone into the human or animal. It is envisioned that in such an embodiment, a medically acceptable fiber-forming material may be used to preserve the hormone(s) for later rehydration and use. In general, rehydration of the fiber of the present invention may be accomplished by mixing the fiber with a solvent for the fiber-forming material.
When the fiber is used to preserve a hormone, the solvent will optimally be a medically acceptable compound.
It is not intended that the present invention be limited to the method by which the electrospun hormone(s) is administered. However, in a preferred embodiment, the hormone(s) is administered at or in the skin. In a particularly preferred embodiment, the electrospun polymer/hormone(s) material is delivered on microneedles or on a patch such that hormone(s) is released into the skin.
In a non-limiting embodiment, the hormones(s) is (are) contained in an ionically cross-linked macromolecular assembly such as those hereinabove described, including but not limited to a hydrogel, such as those hereinabove described.
lonically cross-linked macromolecular assemblies of the present invention comprise a substance to be delivered such as one or more hormones. The formulation containing the pharmaceutically active substance can be in the form of an ionically cross-linked three dimensional film, sphere, tube, fiber, or in any other, geometrical shape and is attached the surface of the device by chemical or physical means.
It is contemplated that the ionically cross-linked macromolecular assembly/drug(s) preparation can be deposited on a surface (in a uniform or non-uniform manner). In one embodiment, the preparation is deposited (e.g. by dipping, coating, spin coating, spraying, or by suitable applicator) on an array of microprojections or microneedles for transdermal, intradermal or transmucosal delivery of the hormone(s).
In one embodiment, the present invention contemplates a method of administering one or more hormones to a patient comprising the steps of penetrating at least an outer layer of the skin of the patient with one or more asperities such as those hereinabove described, such as microprojections or microneedles extending from a front surface of a substrate, at least one of the one or more microneedles (or portion thereof) contacted or coated (uniformly or non-uniformly) by an hormone preparation (discussed above), and releasing at least one of the one or more hormones into the patient.
Other applications for spatially controlled deposition of electrospun fibers:
Appropriate nanofibers could be applied to the edge of a blade, such as a razor blade, or on or between multiple blades or to the piercing edges of a syringe needle. The fibers could aid in the lubrication, prevent corrosion, or minimize bleeding for example.
The needle could be coated with the fibers. These fibers may be adjuvant polymers, such as PVP. Upon injection of the vaccine, the adjuvant During injection, the coating provides lubrication during the insertion. The same or another kind of fiber can also serve as an adjuvant.
Multiple layers of fibers or composites that have varied chemistries, like the NO delivering patches, with Vitamin C spun out on one pin and nitrite spun out on another, or fibers containing each are spun onto the same needle The fibers deliver the NO when moisture from the skin, or from a puncture of the skin activates the reagents. For some applications the reagents may be placed on the separate pins which are inserted at the same time.
The spinning methods utilized in the present invention can also be used to coat only the surface of a stent, without forming a web between the struts of a stent. Only the metal is coated;
thus there is not made a stent graft but a fibrous coating that allows fluids to flow through the open interstices of the stent during insertion, and fluids can have direct access to the interior surface of the blood vessel through these interstices after the stent is inserted The steerable (directable) nature of the jets used in this invention can improve application of fibers to skin. Fine details of the wound can be coated with less "bridging"
than when a typical bending and coiling jet is used. Before when it was attempted to spin out fibers in attempts to control bleeding wounds, such as, for example, when fibers were spun onto a liver wound on a dog, the fibers tented over the wound surface. Now the fibers may be delivered directly to a specific surface, such as a grounded surface on a wound, where one would want only to deliver a polymer containing a small quantity of growth factor to enhance healing of the wound.
This may be useful in plastic surgery, where only a small incision is treated in this way. A small wire may be laid on top of the incision, and function as the target or ground, that provides even greater control of the place at which the fiber is attached to the wound.
Controlled jets of the sort described in this invention can be used in laparoscopic surgery to cover, protect. medicate, mechanically stabilize or treat tissues to which a surgeon has only very limited access.
In another embodiment, the asperities coated with nanofibers in accordance with the present invention may be employed as ion and fluid transport membranes for utilization of hierarchical structures of multiwall nanotubes on carbon nanofibers.
The hierarchical structure described includes, in its simplest concept, carbon nanofibers with radial branches which may or may not have metal particles at the end of each radial branch. Each radial branch is connected electrically through a path that is a part of the carbon hierarchical structure, to an external electrical circuit. The methods described in this invention can be used to coat the end of each branch and metal particle with a porous network of polymer nanofibers. If these pores are filled with an ionized network this network can function as a selective ion transport membrane, which is an essential component of a fuel cell. Thus, in one embodiment, the present invention makes it possible to make radical new designs for fuel cells, batteries, and bioelectric contacts. It could also lead to new designs for electrochemical sensors which depend on the motion of ions in the vicinity of an electrode, which is a large class of sensors.
The ability to deposit one kind of nanofiber at the tips of the carbon nanotube branches and other kinds of nanofibers to span the interstices between the tips of the branches makes it feasible to consider new ways of creating essential paths for the flow of gases and liquids through the hierarchical structures of carbon and other materials, including the electrically conducting variations of titanium oxide known as Magneli phases, and other such conducting or semiconducting materials, some of which are listed in the following reference by J. R. Smith, et al.
The use of electrospun nanofibers to form durable ion transport membranes is also an enabling technology for the manufacture of light emitting diodes and photoelectric diodes that depend on the motion of ions in the vicinity of asperities on a surface.
("Electrodes Based on Magnelipahse Titanium Oxides", J. R. Smith, F. C. Walsh, and R L Clarke, Journal of Applied Electrochemistry, Vol. 28 (1988), pages 1021-1033. Reviews in Applied ElectrochemisU, Number 50).
EXAMPLES
The invention now will be described with respect to the following examples, however, the scope of the present invention is not intended to be limited thereby.
Construction And Expression Of C. botulinum C Fragment Fusion Proteins The C. botulinum type A neurotoxin gene has been cloned and sequenced [Thompson, et al., Eur. J. Biochem. 189:73 (1990)]. The nucleotide sequence of the toxin gene is available from the EMBL/GenBank sequence data banks under the accession number X52066; the nucleotide sequence of the coding region is set forth in Figure 22. The amino acid sequence of the C. botulinum type A
neurotoxin is shown in Figure 16. The type A neurotoxin gene is synthesized as a single polypeptide chain which is processed to form a dimer composed of a light and a heavy chain linked via disulfide bonds. The 50 kD carboxy-terminal portion of the heavy chain is referred to as the C
fragment or the Hc domain.
A number of attempts by others to express polypeptides comprising the C
fragment of C.
botulinum type A toxin as a native polypeptide (e.g., not as a fusion protein) in E. coli have been unsuccessful [H.F. LaPenotiere, et al. in Botulinum and Tetanus Neurotoxins, DasGupta, Ed., Plenum Press, New York (1993), pp. 463-466]. Expression of the C fragment as a fusion with the E.
coli MBP was reported to result in the production of insoluble protein (H.F.
LaPenotiere, et al., supra).
In order to produce soluble recombinant C fragment proteins in E. coli, Dr.
Williams has shown that it is desirable to construct fusion proteins comprising a synthetic C fragment gene derived from the C. botulinum type A toxin and either a portion of the C.
difficile toxin protein or the MBP. See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
a) Construction Of Plasmids Encoding C Fragment Fusion Proteins Fusion proteins comprising a fusion between the MBP, portions of the C.
difficile toxin A repeat domain (shown to be expressed as a soluble fusion protein) and the C
fragment of the C. botulinum type A toxin have been described. See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference). A fusion protein comprising the C fragment of the C.
botulinum type A toxin and the MBP was also constructed by Dr. Williams.
Figure 23 provides a schematic representation of the botulinal fusion proteins along with the donor constructs containing the C. difficile toxin A sequences or C. botulinum C fragment sequences which were used to generate the botulinal fusion proteins. In Figure 23, the solid boxes represent C. difficile toxin A gene sequences, the open boxes represent C.
botulinum C fragment sequences and the solid black ovals represent the E. coil MBP. When the name for a restriction enzyme appears inside parenthesis, this indicates that the restriction site was destroyed during construction. An asterisk appearing with the name for a restriction enzyme indicates that this restriction site was recreated at the cloning junction.
In Figure 23, a restriction map of the pMA1870-2680 and pPA1100-2680 constructs which contain sequences derived from the C. difficile toxin A repeat domain are shown; these constructs can be used as the source of C. difficile toxin A gene sequences for the construction of plasmids encoding fusions between the C. botulinum C fragment gene and the C. difficile toxin A gene. Dr.
Williams demonstrated that the pMA 1870-2680 expression construct expresses high levels of soluble, intact fusion protein (20 mg/liter culture) which can be affinity purified on an amylose column. See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference). The pAlterBot construct was used by Dr. Williams as the source of C. botulinum C
fragment gene sequences for the botulinal fusion proteins (obtained from J. Middlebrook and R. Lemley at the U.S.
Department of Defense). pAlterBot contains a synthetic C. botulinum C fragment inserted in to the pALTER-1 vector (Promega). This synthetic C fragment gene encodes the same amino acids as does the naturally occurring C fragment gene. The naturally occurring C fragment sequences, like most clostridial genes, are extremely A/T rich (Thompson et al., supra). This high A/T content creates expression difficulties in E. coli and yeast due to altered codon usage frequency and fortuitous polyadenylation sites, respectively. In order to improve the expression of C
fragment proteins in E.
coli, a synthetic version of the gene was created by Dr. Williams in which the non-preferred codons were replaced with preferred codons. See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
The nucleotide sequence of the C. botulinum C fragment gene sequences contained within pAlterBot is shown in Figure 24. The first six nucleotides (ATGGCT) encode methionine and alanine residues, respectively. These two amino acids result from the insertion of the C. botulinum C fragment sequences into the pALTER vector and provide the initiator methionine residue. The amino acid sequence of the C. botulinum C fragment encoded by the sequences contained within pAlterBot is shown in Figure 17. The first two amino acids (Met Ala) are encoded by vector-derived sequences. From the third amino acid residue onward (Arg), the amino acid sequence is identical to that found in the C. botulinum type A toxin gene.
. The pMA1870-2680, pPA1100-2680 and pAlterBot constructs were used by Dr.
Williams as progenitor plasmids to make expression constructs in which fragments of the C.
difficile toxin A
repeat domain were expressed as genetic fusions with the C. botulinum C
fragment gene using the pMAL-c expression vector (New England BioLabs). See Williams et al., U.S.
Patent 5,919,665 (hereby incorporated by reference). The pMAL-c expression vector generates fusion proteins which contain the MBP at the amino-terminal end of the protein. A construct, pMBot, in which the C.
botulinum C fragment gene was expressed as a fusion with only the MBP was constructed by Dr.
Williams (Figure 23). Fusion protein expression can be induced from E. coli strains harboring the above plasmids, and induced protein was affinity purified on an amylose resin column.
i) Construction Of pBlueBot In order to facilitate the cloning of the C. botulinum C fragment gene sequences into a number of desired constructs, the botulinal gene sequences can be removed from pAlterBot and were inserted into the pBluescript plasmid (Stratagene) to generate pBlueBot (Figure 23). pBlueBot was constructed by Dr. Williams as follows. Bacteria containing the pAlterBot plasmid were grown in medium containing tetracycline and plasmid DNA was isolated using the QlAprep-spin Plasmid Kit (Qiagen). One microgram of pAlterBot DNA was digested with Ncol and the resulting 3' recessed sticky end was made blunt using the Klenow fragment of DNA polymerase I (here after the Klenow fragment). The pAlterBot DNA was then digested with Hindlll to release the botulinal gene sequences (the Bot insert) as a blunt (filled Nco1 site)-Hind111 fragment.
pBluescript vector DNA
was prepared by digesting 200 ng of pBluescript DNA with SmaI and.HindIIl. The digestion products from both plasmids were resolved on an agarose gel. The appropriate fragments were removed from the gel, mixed and purified utilizing the Prep-a-Gene kit (BioRad). The eluted DNA
was then ligated using T4 DNA ligase and used to transform competent DH5a cells (Gibco-BRL).
Host cells were made competent for transformation using the calcium chloride protocol of Sambrook et al., supra at 1.82-1.83. Recombinant clones were isolated and confirmed by restriction digestion using standard recombinant molecular biology techniques (Sambrook et al, supra). The resultant clone, pBlueBot, contains several useful unique restriction sites flanking the Bot insert (i.e., the C. botulinum C fragment sequences derived from pAlterBot) as shown in Figure 23. See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
ii) Construction Of C. difficile/C. botulinum/MBP Fusion Proteins Constructs encoding fusions between the C. difficile toxin A gene and the C. botulinum C
fragment gene and the MBP were made by Dr. Williams utilizing the same recombinant DNA
methodology outlined above; these fusion proteins contained varying amounts of the C. difficile toxin A repeat domain.
See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
The pMABot clone contains a 2.4 kb insert derived from the C. difficile toxin A gene fused to the Bot insert (i.e, the C. botulinum C fragment sequences derived from pAlterBot). pMABot (Figure 23) was constructed by mixing gel-purified DNA from NotUHindII1 digested pBlueBot (the 1.2 kb Bot fragment), SpeI/NotI digested pPA1100-2680 (the 2.4 kb C. difficile toxin A repeat fragment) and XbaUHindlll digested pMAL-c vector. Recombinant clones were isolated by Dr.
Williams, confirmed by restriction digestion and purified using the QlAprep-spin Plasmid Kit (Qiagen). This clone expresses the toxin A repeats and the botulinal C
fragment protein sequences as an in-frame fusion with the MBP.
The pMCABot construct contains a 1.0 kb insert derived from the C. difficile toxin A gene fused to the Bot insert (i.e, the C. botulinum C fragment sequences derived from pAlterBot).
pMCABot was constructed by digesting the pMABot clone with EcoRl to remove the 5' end of the C. difficile toxin A repeat (see Figure 23, the pMAL-c vector contains a EcoRI
site 5' to the C.
difficile insert in the pMABot clone). The restriction sites were filled and religated together after gel purification. The resultant clone (pMCABot, Figure 23) generated an in-frame fusion between the MBP and the remaining 3' portion of the C. difficile toxin A repeat domain fused to the Bot gene.
See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
The pMNABot clone contains the I kb SpeUEcoRI (filled) fragment from the C.
difficile toxin A repeat domain (derived from clone pPA 1100-2680) and the 1.2 kb C.
botulinum C fragment gene as a Ncol (filled)/HindI1l fragment (derived from pAlterBot). These two fragments were inserted by Dr. Williams into the pMAL-c vector digested with XbaUHindI1l. The two insert fragments were generated by digestion of the appropriate plasmid with EcoRI
(pPA 1100-2680) or Ncol (pAlterBot) followed by treatment with the Klenow fragment. After treatment with the Klenow fragment, the plasmids were digested with the second enzyme (either Spel or HindIII). All three fragments were gel purified, mixed and Prep-a-Gene purified prior to ligation. Following ligation and transformation, putative recombinants were analyzed by restriction analysis; the EcoRl site was found to be regenerated at the fusion junction, as was predicted for a fusion between the filled EcoRI and Ncol sites. See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
A construct encoding a fusion protein between the botulinal C fragment gene and the MBP
gene was constructed (i.e., this fusion lacks any C. difficile toxin A gene sequences) and termed pMBot. The pMBot construct was made by Dr. Williams by removal of the C.
difficile toxin A
sequences from the pMABot construct and fusing the C fragment gene sequences to the MBP. This was accomplished by digestion of pMABot DNA with Stul (located in the pMALc polylinker 5' to the Xbal site) and Xbal (located 3' to the Notl site at the toxA-Bot fusion junction), filling in the Xbal site using the Kienow fragment, gel purifying the desired restriction fragment, and ligating the blunt ends to circularize the plasmid. Following ligation and transformation, putative recombinants were analyzed by restriction mapping of the Bot insert (i.e., the C. botulinum C fragment sequences). See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
b) Expression Of C. botulinum C Fragment Fusion Proteins In E. coli Large scale (I liter) cultures of the pMAL-c vector, and each recombinant construct described above in (a) can be grown, induced, and soluble protein fractions isolated as described in Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference), who reported yields in excess of 20 mg fusion protein per liter culture.
Production Of Soluble C. botulinum C Fragment Protein Substantially Free Of Endotoxin Contamination In order to determine if the solubility of the botulinal C fragment was enhanced by expressing the C fragment protein as a native protein, an N-terminal His-tagged protein or as a fusion with glutathione-S-transferase (GST), alternative expression plasmids have been constructed.
See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
Figure 25 provides a schematic representation of the vectors described below.
In Figure 25, the following abbreviations are used. pP refers to the pET23 vector. pHIS
refers to the pETHisa vector. pBlue refers to the pBluescript vector. pM
refers to the pMAL-c vector and pG refers to the pGEX3T vector. The solid black lines represent C.
botulinum C fragment gene sequences; the solid black ovals represent the MBP; the hatched ovals represent GST; "HHHHH"
represents the poly-histidine tag. In Figure 25, when the name for a restriction enzyme appears inside parenthesis, this indicates that the restriction site was destroyed during construction. An asterisk appearing with the name for a restriction enzyme indicates that this restriction site was recreated at a cloning junction.
i) Construction Of pPBot In order to express the C. botulinum C fragment as a native (i.e., non-fused) protein, the pPBot plasmid (shown schematically in Figure 25) was constructed by Dr.
Williams as follows. The C fragment sequences present in pAlterBot were removed by digestion of pAlterBot with NcoI and Hindlll. The NcoUHindll l C fragment insert was ligated to pETHisa vector which was digested with Ncol and HindIII. This ligation creates an expression construct in which the Ncol-encoded methionine of the botulinal C fragment is the initiator codon and directs expression of the native botulinal C fragment. The ligation products were used to transform competent BL21(DE3)pLysS
cells (Novagen). Recombinant clones were identified by restriction mapping.
See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
ii) Construction Of pHisBot In order to express the C. botulinum C fragment containing a poly-histidine tag at the amino-terminus of the recombinant protein, the pHisBot plasmid (shown schematically in Figure 8) was constructed by Dr. Williams as follows. The NcoUHindlll botulinal C fragment insert from pAlterbot was ligated into the pETHisa vector which was digested with Nhel and Hindill. The Ncol (on the C fragment insert) and Nhel (on the pETHisa vector) sites were filled in using the Klenow fragment prior to ligation; these sites were then blunt end ligated (the Ndel site was regenerated at the clone junction as predicted). The ligation products were used to transform competent BL21(DE3)pLysS cells and recombinant clones were identified by restriction mapping. See Williams et at., U.S. Patent 5,919,665 (hereby incorporated by reference).
The resulting pHisBot 'clone expresses the botulinal C fragment protein with a histidine-tagged N-terminal extension having the following sequence:
MetGlyHisHisHisHisHisHisHisHisHisHisSerSerGlyHislleGluGlyArgHisMetAla; the amino acids encoded by the botulinal C fragment gene are underlined and the vector encoded amino acids are presented in plain type. The nucleotide sequence present in the pETHisa vector which encodes the pHisBot fusion protein is set forth in Figure 26. The amino acid sequence of the pHisBot protein is set forth in Figure 27.
iii) Construction Of pGBot The botulinal C fragment protein was expressed as a fusion with the glutathione-S-transferase protein by constructing the pGBot plasmid (shown schematically in Figure 24). This expression construct was created by Dr. Williams by cloning the NotUSall C
fragment insert present in pBlueBot into the pGEX3T vector which was digested with Smal and Xhol. The Notl site (present on the botulinal fragment) was made blunt prior to ligation using the Klenow fragment. The ligation products were used to transform competent BL21 cells. See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference).
iv) solubility and purification The pGBot protein was almost entirely insoluble under the utilized conditions, while the pHisBot protein was soluble. See Williams et al., U.S. Patent 5,919,665 (hereby incorporated by reference). For improved affinity purification of the soluble pHisBot protein (in terms of both yield and purity), an alternative poly-histidine binding affinity resin (Ni-NTA
resin; Qiagen) is desirable.
The Ni-NTA resin has a superior binding affinity (Kd= I x 10-13 at pH 8.0;
Qiagen user manual) relative to the His-bind resin.
Based upon the foregoing disclosure, it should now be apparent that Clostridium toxins, and in particular, C. botulinum toxins, together with polymer (e.g. in an electrospun formulation) can be used as vaccines. A particularly desirable administration approach is transdermal, via microprojections (e.g. an array of microneedles). A variety of polymers, as well as delivery vehicles, can be used without departing from the spirit of the invention. In one embodiment, the electrospun polymer/toxin(s) fiber mat is placed directly on the skin. In another embodiment, the polymer/toxin(s) fiber mat is part of a delivery vehicle (e.g. skin patch, microneedle array, etc.) Mutagenesis. To generate a complete library of Cys mutants of PA63 one can use the QuikChange (Stratagene) method to generate point mutations, in conjunction with automated systems currently used for high-throughput DNA sequencing. The pag gene encoding PA is AT rich (34% GC) and does not present significant technical hurdles. Automated systems can be used to synthesize the mutagenic oligonucleotide pairs, and the quality of mutagenic oligonucleotides can be confirmed by automated capillary electrophoresis. In this manner, a full plate can be processed in a day, and the oligonucleotides needed for complete mutagenesis of PA63 can be synthesized and checked in 12 days. After manually performing the PCR mutagenesis in 96-well plates and transforming the resulting mutated plasmids into E. coli, automation can again be used for preparing DNA from the colonies and sequencing of the region of interest. Clones bearing the desired mutation can be used for functional screens.
As noted above, researchers at the University of Oklahoma used this protocol to generate 568 mutants, corresponding to the replacement of every amino acid of PA63 with Cys. Thirty three mutants (6% of the total number of mutants tested) were both strongly defective and well expressed.
As shown in Table 3, the 33 mutations were distributed among the four domains of PA, with a majority in domain 2.
Some Inactive Mutants Are Dominant. The 33 inactive mutants were tested by the researchers at the University of Oklahoma for ability to inhibit the toxicity of a mixture of PA and LFNDTA toward CHO cells at ratios of mutated to wild-type PA up to 8:1. Those that showed measurable inhibitory activity under these conditions were defined, for the purpose of this study, as "dominant negative" (DN). Nine preparations of mutant PA were inhibitory:
1364, T380, S382, T393, K397, N399, Y41 1, N422, and F427. The present invention contemplates using such mutant protective antigens both alone and in conjugates (as described above). Like the DN mutants characterized earlier, the purified DN Cys-mutants showed defects specifically in pore formation and translocation. PA bearing T393C, T380C, or S382C showed strong DN
activity, only slightly weaker than that of the K397D + D425K double mutant characterized earlier.
N399C and N422C
showed moderate DN activity, and 1364C and Y411 C showed weak inhibitory activity.
One of the strongest of the five DN mutants, T393C, was tested by researchers at the University of Oklahoma for ability to protect Fisher 344 rats from a lethal challenge with a mixture of PA and LF. Like the other DN mutants tested, T393C prevented symptoms of intoxication until the time of death, whereas rats challenged with native toxin alone became moribund 75 rain after challenge (data not shown). In the end, 33 well-expressed mutants with defects in toxicity were described by the Oklahoma group.
In contrast to the Cys substitutions, Ala substitutions created by the Oklahoma group at selected sites gave different results: Y411A showed strong DN activity; T380A
and N399A showed weak DN activity; and N422 and S382A showed no DN activity. At position 393, Cys or Lys gave strong DN activity; Asp or Ala gave moderate DN activity; and Ser gave no DN
activity. The present invention contemplates employing these Ala substituted mutant protective antigens alone or as conjugates (as described above).
Conjugating wild-type and mutant PA to PGA. Conjugates are readily synthesized as follows. To I mg of PA in 0.5 ml phosphate-buffered saline (PBS; pH 7.0), 0.5 mg of degraded PGA can be added. After PGA has dissolved, 5 mg of I-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride should be added, and the solution mixed on a rotary shaker at 25C for 4 hours. One can monitor the conjugation process by SDS-PAGE.
Moreover, the conjugates can be purified on a PDIO column (Amersham Biosciences), verified by SDS-PAGE, and stored at -20C until use.
Alternatively, gamma-PGA polypeptides can be synthesized (with various lengths, e.g. 5, 10, 15 or 20 residues) and can be bound to carrier proteins at either the C-or N-termini (for further reactions). The various types of these polypeptides are described in U.S.
Patent Application 20060134143 to Schneerson et al. (hereby incorporated by reference) including but not limited to PGA comprising D-glutamic acid and PGA comprising L-glutamic acid:
Type I: NBrAcGly3_yDPGAn- COOH(Br-G 1 y3_7DPGA,,-C) NBrAc-GIy3--yLPGAõ-COOH(Br-GIy3--yLPGAn-C) Type II: NAc-L-Cys-G 1 y3-yDPGAn,-COOH(Cys-Gly3-yDPGA,,-C) NAc-L-Cys-G 1 y3-7LPGA,,,-COOH(Cys-GIy3-yLPGA,,-C) Type III: NAc-yDPGA,,-G I y3-L-Cys-CONH2(N- yDPGAõ-G 1 y3-Cys) NAc-yLPGAn-Gly3-L-Cys-CONH2(N-yLPGA,,-G I y3-Cys) Type IV: CHO-G 1 y3- yDPGAõ-COOH
Type V: NAc-yDPGAr,-GIy3-CO-AH
NAc-yDPGAn-CO-AH
Type VI: NAc--yDPGAõ-Cys-CONHZ
In one example, recombinant wild-type PA is derivatized with adipic acid dihydrazide and reacted with one or more of these polypeptides.
Using Y. pestis antigens. As noted above, in another embodiment, antigen from Y. pestis is contemplated in a preparation suitable for transdermal delivery. It is not intended that the present invention be limited by the particular antigens from these organisms. However, in one embodiment, an Fl capsule antigen from Y. pestis is employed in a polymer formulation (e.g. electrospun formulation) deposited on a microneedle array. In another embodiment, a protein (or fragment) from the injectisome from Y. pestis is employed. In a preferred embodiment, the LcrV protein (or fragment thereof) from the Y. pestis injectisome is similarly employed. With regard to the latter, Table 5 shows the amino acid sequence for LcrV of Y. pestis, as well as from some other sources.
Y pews IOM LdV' MIFtAYEptaPqF1YIEDL~(VFtVD~L7 GE9GõSvi L'ELV~1 VKGQQiIbISIlCYDPR~BVt Y. 8YV&O=WM I.CN MIFAY6QIPQIPIEDLEKVFCVFMR'6FK;S
YpMtMtbLCrV i9FtA IEDLEttVAt+~ T+Gi11~S81'YF2SUM
P. eatwnt7sA
Y. POWs i0M I.GYV AHRV27'DDIP.I.LIQCILATIPLP!*DATLAOGHYDHOIaGTKAVDM'L68..
SPHYOWARA
Y.OVWDMWW ICN A~KVtTDO1xLIlacI1AYPLFBII91IL~t~6i.ItEtvftEE6SS..S~l7T~IAA
Y (JB9UdfbLCYv A10RVITDOI6LL?.IQIAYYLPrLU%ILKfG}lYD20N(X4iiIlLT9..SP2MP1PLi1A
P aw*waw pav Y Q@64`9IOM li7V
EMVDIP`SLZIDRIPDDItd1;ViV1SMdiDGDAdiBXLRB8d1iBL4A8LtfIYSVIpAEIHQ(N
Y endOVOON,ia9laY
ERaP1~HPSLSADEtIDADxIdCYIVf~S~tiAGlbajLSlcLtiB8I11RLTABI;iEIYSVI(YU3ItazN
Y. pswurtoPbltrV iM PSL~DRIL~7 A9teLMASLiAS1WCiYSVICRBIM
P S&Wkrom Pc.v Elmuft ~I~I~~~~I~~LT~s+-I~-~
Y, pEbtslOM I CN iSS862IIdIffiX<CSIMkNOdLYC.YTD. E3IPPU49MYICITEFQWQTTI WD...
:... ....
YoarawmKm LAfv L488G7LNIIVRSIIVII4DI0II,YOYTD.&3IFY 4ABYi{I1~PQ{PQPF
Y Psetftb LaY IS IFTISDRSIETl3M47LYGYTD.=FKaB4BYR1 I
P. emofncw abrv I jM4[h&,YC~.~~ . . . . . . .
V. peaNafOM (.nN
cSomi4SlmoG+i*Bl1KTITGAi.CiLiQtfiYS1RlMM*IIMLSNI'ATY'CSDKSRP11lmLV80K
YaaBmG1pwc9 L.orv Ivs 8 RI ~ SY~L~lA2~CSD[i3RPLrDLVSax YpmaabdbLcrV rvsn~ s _ r~rrCSDtcsRela+nivs P. esrtlDTse R:N sI
Y. p6SVS FdM LOV TTWDITSR@WAI8l1I2RFICjLyDSt?s3tyLpD'r6GR
Y. fJ-VBIl7CIOW608 L.GYY TTQS'JDITSREN9AIF.AU@tFTQiiYDSVKiXX[ LaD7M
Y pssumbPh LcrV
P. aert,gJnxa PCtV 3 T D QiSUD3v I~
Because of the similarity between three of the organisms (but not P.
aeruginosa), the present invention contemplates, in one embodiment, using the LcrV protein (or fragment thereof) of any of these three organisms in order to generate protection against Y. pestis. If a fragment is used, typically the fragment will be at least twenty (20) amino acids and selected in a region of high conservation (see Table 5).
Where Fl capsule antigen and LcrV protein are made as a fusion protein, the fusion protein may be made by selecting appropriate coding sequences from GenBank accession No. AF07461 1.
Using F. tularensis antigens. As noted above, in another embodiment, antigen from F. tularensis is contemplated in a preparation suitable for transdermal delivery. It is not intended that the present invention be limited by the particular antigens from these organisms. However, in one embodiment, a specific sequence of the outer membrane protein (or fragment thereof) encoded by the fopA gene of F. tularensis is employed.
Alternatively, a protein (or fragment thereof) encoded by the tul4 gene is employed. The PCR primers that will conveniently amplify these genes are given below:
*tu14 primers (forward, ATTACAATGGCAGGCTCCAGA; reverse, GCCCAAGTTTTATCGTTCTTCTCA) will specifically amplify an 89-bp fragment of the tul4 gene (GenBank accession no. M32059) encoding a 17-kDa lipoprotein.
* fopA primers (forward, AACAATGGCACCTAGTAATATTTCTGG; reverse, CCACCAAAGAACCATGTTAAACC) will amplify an 86 bp fragment of the fopA gene (GenBank accession no. AF097542) which encodes a 43-kDa outer membrane protein.
The proteins can be expressed in vitro or in vivo and then formulated (e.g. in an electrospun formulation) for application to the microneedle array.
Electrospinning Anthrax Protective Antigen. In this example, the protocol for electrospinning anthrax antigen is described. Pure native PA (List Biological Laboratories) will be reconstituted in I ml of distilled water containing 0.1 % Bovine Serum Albumin (BSA) at a concentration of 1 mg/ml. 400 Al of the solution will be further diluted with equal volume of aqueous 0.1% BSA to prepare the PA solution which will be mixed appropriately with PVP as described below. The "unspun" 500 g/ml PA solution will be used as the control for the evaluation of retention of functionality (although this is not required for a vaccine).
Two electrospinning solutions will be prepared utilizing the PA solution. The first will consist of 400 l of PA solution, and 1600 Al of 0.075 mM Polyvinylpyrrolidone (PVP) dissolved in absolute ethanol, and the second will have distilled water as the solvent. Both solutions will be utilized in preparation of electrospun mats, and tested in the assay of functionality to confirm that protein activity has been retained upon introduction of polymer solution.
Because an approximate concentration of 100 g/ml of PA is required for the functionality test, and the volume needed for the cell-based assay is 1 ml, 100 mg of the material is deposited onto the collector. It is estimated that the mixture of PA and PVP in ethanol will be electrospun at 20 uUmin and 16 kV, while the completely aqueous mixture will be electrospun at 5-10 uUmin and 20 kV. From previous experiments it can be estimated that, regardless of which solution is electrospun, only 50% to"75% of the total material will be deposited on the collector. 1500 l of each solution is electrospun onto aluminum foil, coated with Teflon to ease the removal of the electrospun mat from the foil. The entire material deposited on the sheet will be peeled off and dissolved in 1 ml of MatTek tissue culture medium to provide samples for the test of functionality.
This stock solution will be further diluted with culture medium to a final estimated concentration of 10 g/ml; this concentration is 50-100 times the required amount for the test of functionality.
The cells used in this test are MonoMac 6 cells (DSMZ, Braunschweig, Germany)) maintained in RPMI 1640 (Hyclone) medium supplemented with 10% fetal bovine serum (FBS), 2mM L-glutamine, 1% non-essential amino acids, 1 mM oxaloacetate, 0.45 mM
pyruvate, 0.2 U/ml insulin (OPI media supplement, Sigma, St.Louis, MO), and 1% (v/v) penicillin streptomycin solution (final concentrations 100 IU penicilin G and 100 gg streptomycin per ml, Sigma). Cells are washed with Hank's Balanced Salt Solution (HBSS; Hyclone) at 37 C once prior to commencing experiments, which are all carried in serum free media without antibiotics.
The functionality experiments are based on examination of Lethal Factor (LF) proteolytic activity in the cytosol of viable cells. We have shown in previous experiments that LF added to the surrounding medium cannot enter MonoMac 6 cells unless functionally active PA
is present to facilitate its transport from the medium into the cytosol. MonoMac 6 cells are washed with warm DPBS and are resuspended in Macrophage Serum Free Medium (Gibco) for plating at a density of 1 x 106/ml/well in 24 well microplates. After addition of each of the PA
solutions to be tested (two different dissolved electrospun preparations and an aliquot of the "unspun"
solution) and a 100 ng/mi solution of LF (List Biolabs) to separate wells of cells, the cells are incubated for different periods of time, and at each designated time point a 200 Rl aliquot of cell suspension is removed.
Cells are pelleted by centrifugation and are then lysed in a buffer containing 0.1% Nonidet P-40 (NP40), 150 mM NaCI, 40 mM Tris @H 7.2), 10% 5 glycerol, 5 mM NaF, 1 mM Na pyrophosphate, 1mM Na o-vanadate, 10 mM ophenanthroline, and 100 ng/ml phenylmethyl sulfonyl fluoride (PMSF) at 70 C for 10 min.
The lysates are separated by SDS-polyacrylamide gel electrophoresis and the presence of intact or cleaved MEK-2 is quantitated by immunoblotting. Aliquots of 7.5-10 ug total cell lysate protein per well are loaded onto 10% SDS gels (Novex) and electrophoresed followed by transfer to nitrocellulose membranes in an electrotransfer apparatus (Novex) for 1 h at 30 V. The membranes are blocked with 5% low-fat milk in This-buffered saline buffer, pH 7.6, containing 0.1% Tween 20 for 1 h at room temperature and then probed with anti-MEK-2 rabbit polyclonal antibody (Santa Cruz) at a dilution of 1:2000. Goat anti-rabbit IgG is used at a dilution of 1:2000 as the secondary antibody.
Blots are washed after probing and processed with the Enhanced Chemiluminescence detection kit according to the manufacturer's directions.
The predicted results for a successful delivery of LF are illustrated in Figure 28.
As can be seen in Figure 28, it is expected that after 4 hours of incubation of MonoMac 6 cells with LF alone or with PA alone, there is no degradation of the MAP
Kinase MEK-2 detected in an immunoblot, or "Western blot," of the cell lysates, whereas when LF and PA
are both present, MEK-2 is destroyed within the cells in 4 hours. If the electrospun PA behaves in a~manner similar to unspun PA (as is to be expected), one can anticipate seeing MEK-2 cleavage as shown in Figure 28.
Delivering Electrospun PA To A Tissue Model. In this example, the protocol for delivering electrospun PA through MatTek EpiDerm 200 epidermal equivalent tissue, using 600 um microspike-bearing silicon chips and collecting the surrounding medium from the base of the MatTek units for challenge with LF and MonoMac 6 cells, is described.
Testing Antigenicity of Electrospun PA. In this example, the protocol for testing for preservation of antigenicity of the electrospun PA using a commercially available polyclonal goat anti-PA antibody from List Biological Laboratories is described. This antibody recognizes PA even after it has been subjected to SDS-polyacrylamide gel electrophoresis, indicating that, at least in goats, the PA can be prepared as an immunogen to generate a robust immune response. Aliquots of the dissolved samples of electrospun PA generated from the two solvent systems will be separated by SDS polyacrylamide gel electrophoresis along with aliquots of the "unspun"
PA control and transferred to nitrocellulose membranes as described above. The membranes will be probed with an appropriate dilution of the goat anti-PA antibody, while a rabbit anti-goat polyclonal antibody will be used as the secondary antibody. The membranes will then be examined by enhanced chemiluminescence as described above. This test is less stringent than the functionality assay (and all that is needed for a vaccine) because even PA which has been denatured by the electrospinning protocol (which is not expected) will retain its capacity to be recognized by the goat antibody.
However, we can still quantitate the delivery of immunoreactive PA after electrospinning and even after delivery across an epidermal equivalent model by using a semiquantitative immunoblotting procedure known as a "slot blot." The slot-blot apparatus allows direct application of samples collected after electrospinning, or after delivery through a skin equivalent, onto a nitrocelulose membrane. The apparatus can accommodate 48 samples at a time, including a series of sequential dilutions of the "unspun" PA control, the PA concentrations of which are all precisely known. After all the samples are applied, the membrane is removed and incubated with goat anti-PA primary antibody and rabbit-antigoat secondary antibody, and examined by enhanced chemiluminescence as described above.
Based upon the foregoing disclosure, it should now be apparent that anthrax antigens, and in particular, certain conjugates of two anthrax antigens (one of which being a mutant), taken alone or together with polymer (e.g. in an electrospun formulation) can be used as vaccines. A particularly desirable administration approach is transdermal, via microprojections (e.g.
an array of microneedles). A variety of polymers and mutants, as well as delivery vehicles, can be used without departing from the spirit of the invention. In one embodiment, the electrospun polymer/antigen(s) fiber mat is placed directly on the skin. In another embodiment, the polymer/antigen(s) fiber mat is part of a delivery vehicle (e.g. skin patch, microneedle array, etc.) Parathyroid Hormone (PTH 1-34) Polyvinylpyrrolidone (PVP) molecular weight of -1,300,000 from Sigma-Aldrich was dissolved at a concentration of 0.075mM in 0.4% Human Serum Albumin (HSA) in water and magnetically stirred for 3 hours. A 550 pg/ml peptide solution supplied by Immunotopics as part of its PTH 1-34 Elisa kit was used as the hormone source. The electrospinning PTH 1-34 solution was prepared by mixing the PVP and PTH
solutions at an 80% /
20% (v/v) PVP/PTH ratio. The electrospinning method was utilized to deposit a nanocomposite of the solution onto the substrates. A total of 1.0 ml was electrospun onto the target. The coating was created at the flow rate of 80min, voltage of 20 kV, and a distance between the collector and needle of 10 cm. The coated devices were attached to microcentrifuge tubes with crazy glue to add stability, and ease the handling process. The transdermal delivery experiments were carried out using EpiDerm Full Thickness (EFT-300) tissue models from MatTek Corporation.
The samples were placed on top of the tissue model units with sufficient pressure to ensure that the spikes had entered the tissue, thereby beginning the time release study. At each time point the tissue model its with the devices in place were moved into pre-warmed media, and supernatant was collected. After the 24 hour harvest, the devices were removed, the tissue was cut out of the holders and homogenized into 500 l of tissue culture media in a microfuge tube using a small motor-driven pestle. The ground tissue was centrifuged, and analysis of the supernatant medium was performed.
To test tissue viability after the 24 hour time point, mitochondrial dehydrogenase activity was assayed using Alamar Blue reduction. Due to this assay's interaction with the HRP assay only two tissue model units from each set were examined for viability.
Based upon the foregoing disclosure, it should now be apparent that hormones, and in particular, PTH(1-34), together with polymer (e.g. in an electrospun formulation) can be used prophylatically (to prevent) or therapeutically (to treat) bone loss. A
particularly desirable administration approach is transdermal, via microprojections (e.g. an array of microneedles). A
variety of polymers and hormones (or hormone combinations), as well as delivery vehicles, can be used without departing from the spirit of the invention. For example, iIn one embodiment, the electrospun polymer/hormone(s) fiber mat is placed directly on the skin. In another embodiment, the polymer/hormone(s) fiber mat is part of a delivery vehicle (e.g. skin patch, microneedle array, etc.).
The disclosures of all patents and publications (including published patent applications) are hereby incorporated by reference to the same extent as if each patent and publication were individually and specifically incorporated by reference.
Although the invention has been described in detail with particular reference to certain embodiments detailed herein, other embodiments can achieve the same results.
Variations and modifications of the present invention will be obvious to those skilled in the art and the present invention is intended to cover in the appended claims all such modifications and equivalents.
Claims (13)
1. A device, comprising:
a substrate comprising a surface and a plurality of asperities extending from said surface; and an electrospun material in contact with said substrate.
a substrate comprising a surface and a plurality of asperities extending from said surface; and an electrospun material in contact with said substrate.
2. The device of Claim 1 wherein said asperties are microneedles.
3. The device of Claim 1 wherein said electrospun material is in the form of nanofibers.
4. The device of Claim 1 wherein said electrospun material comprises at least one carrier substance capable of carrying a biologically active agent, and at least one biologically active agent.
5. The device of Claim 4 wherein said carrier material is a water-soluble polymer.
6. The device of Claim 5 wherein said polymer is selected from the group consisiting of PVP, carboxymethyl cellulose,0 hydroxyethylcellulose, hydroxypropylcellulose, alginic acid, and chitosan.
7. The device of Claim 4 wherein said at least one biologically active agent is a therapeutic protein.
8. The device of Claim 4 wherein said biologically active agent is a cytokine.
9. The device of Claim 4 wherein said biologically active agent is a Clostridium toxin.
10. The device of claim 4 wherein said biologically active agent is an anthrax antigen.
11. The device of Claim 4 wherein said biologically active agent is a hormone.
12. A method of administering a biologically active agent, comprising:
contacting a subject with the device of Claim 4 under conditions such that at least a portion of said agent is released from said device.
contacting a subject with the device of Claim 4 under conditions such that at least a portion of said agent is released from said device.
13. The method of Claim 12 wherein said contacting comprises piercing the skin of said subject with said asperities.
Applications Claiming Priority (13)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US79892806P | 2006-05-09 | 2006-05-09 | |
US60/798,928 | 2006-05-09 | ||
US84821306P | 2006-09-29 | 2006-09-29 | |
US84850406P | 2006-09-29 | 2006-09-29 | |
US84850506P | 2006-09-29 | 2006-09-29 | |
US84850706P | 2006-09-29 | 2006-09-29 | |
US84850606P | 2006-09-29 | 2006-09-29 | |
US60/848,213 | 2006-09-29 | ||
US60/848,504 | 2006-09-29 | ||
US60/848,506 | 2006-09-29 | ||
US60/848,505 | 2006-09-29 | ||
US60/848,507 | 2006-09-29 | ||
PCT/US2007/011228 WO2008024141A2 (en) | 2006-05-09 | 2007-05-09 | Nanofiber structures on asperities for sequestering, carrying and transferring substances |
Publications (1)
Publication Number | Publication Date |
---|---|
CA2650197A1 true CA2650197A1 (en) | 2008-02-28 |
Family
ID=39107260
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA002650197A Abandoned CA2650197A1 (en) | 2006-05-09 | 2007-05-09 | Nanofiber structures on asperities for sequestering, carrying and transferring substances |
Country Status (4)
Country | Link |
---|---|
EP (1) | EP2015803A4 (en) |
AU (1) | AU2007288442A1 (en) |
CA (1) | CA2650197A1 (en) |
WO (1) | WO2008024141A2 (en) |
Families Citing this family (29)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU2008241470B2 (en) | 2007-04-16 | 2013-11-07 | Corium Pharma Solutions, Inc. | Solvent-cast microneedle arrays containing active |
WO2009048607A1 (en) | 2007-10-10 | 2009-04-16 | Corium International, Inc. | Vaccine delivery via microneedle arrays |
JP2012509106A (en) * | 2008-11-18 | 2012-04-19 | スリーエム イノベイティブ プロパティズ カンパニー | Hollow microneedle array and method |
JP5860453B2 (en) | 2010-04-28 | 2016-02-16 | キンバリー クラーク ワールドワイド インコーポレイテッド | Composite microneedle array with nanostructures on the surface |
AU2015271878B2 (en) * | 2010-04-28 | 2017-05-11 | Sorrento Therapeutics, Inc. | Device for delivery of rheumatoid arthritis medication |
US9586044B2 (en) | 2010-04-28 | 2017-03-07 | Kimberly-Clark Worldwide, Inc. | Method for increasing the permeability of an epithelial barrier |
CN102985131B (en) | 2010-04-28 | 2016-06-29 | 金伯利-克拉克环球有限公司 | For delivering the medical treatment device of siRNA |
PT2563450T (en) | 2010-04-28 | 2017-08-28 | Kimberly Clark Co | Device for delivery of rheumatoid arthritis medication |
AU2011248108B2 (en) | 2010-05-04 | 2016-05-26 | Corium Pharma Solutions, Inc. | Method and device for transdermal delivery of parathyroid hormone using a microprojection array |
WO2012130193A1 (en) * | 2011-03-31 | 2012-10-04 | Zentiva, K.S. | Non-covalent soluble complexes of teriparatide with polysaccharides and a dosage form of teriparatide for oral administration |
PL3542851T3 (en) | 2011-10-27 | 2022-04-25 | Sorrento Therapeutics, Inc. | Implantable devices for delivery of bioactive agents |
EP3574950B1 (en) | 2011-10-27 | 2021-02-17 | Sorrento Therapeutics, Inc. | Transdermal delivery of high viscosity bioactive agents |
US20170246439A9 (en) | 2011-10-27 | 2017-08-31 | Kimberly-Clark Worldwide, Inc. | Increased Bioavailability of Transdermally Delivered Agents |
WO2013086731A1 (en) * | 2011-12-16 | 2013-06-20 | London Metropolitan University (Lmu) | Delivery apparatus |
BR102012031954A2 (en) * | 2012-12-14 | 2015-01-20 | Instituto De Pesquisas Tecnológicas Do Est S. Paulo S/A Ipt | ACTIVE SUBSTANCE NANOFIBERS FOR COSMETIC APPLICATION OF CONTROLLED RELEASE OBTAINED BY ELECTROPHIATION AND PROCESS |
BR102012031955A2 (en) * | 2012-12-14 | 2014-10-07 | Instituto De Pesquisas Tecnológicas Do Est S. Paulo S/A Ipt | NANOFIBRAS CONTAINING ACTIVE SUBSTANCE WITH CONTROLLED RELEASE FOR DONTOLOGICAL APPLICATION AND PROCESS |
KR102265808B1 (en) | 2012-12-21 | 2021-06-16 | 코리움, 인크. | Microarray for delivery of therapeutic agent and methods of use |
JP6487899B2 (en) | 2013-03-12 | 2019-03-20 | コリウム インターナショナル, インコーポレイテッド | Microprojection applicator |
EP4194028A1 (en) | 2013-03-15 | 2023-06-14 | Corium Pharma Solutions, Inc. | Multiple impact microprojection applicators |
AU2014233541B2 (en) | 2013-03-15 | 2018-11-22 | Corium Pharma Solutions, Inc. | Microarray for delivery of therapeutic agent, methods of use, and methods of making |
MX2015012933A (en) | 2013-03-15 | 2016-09-19 | Corium Int Inc | Microarray for delivery of therapeutic agent and methods of use. |
JP2016514133A (en) | 2013-03-15 | 2016-05-19 | コリウム インターナショナル, インコーポレイテッド | MICROARRAY CONTAINING FINE STRUCTURE CONTAINING NO POLYMER, MANUFACTURING METHOD AND USE METHOD |
KR101527469B1 (en) * | 2013-11-04 | 2015-06-11 | 연세대학교 산학협력단 | A Method for Fabrication of Porous fiber microstructure with various 3-dimensional Structures |
EP3188714A1 (en) | 2014-09-04 | 2017-07-12 | Corium International, Inc. | Microstructure array, methods of making, and methods of use |
US10857093B2 (en) | 2015-06-29 | 2020-12-08 | Corium, Inc. | Microarray for delivery of therapeutic agent, methods of use, and methods of making |
EP3570821B1 (en) | 2017-01-23 | 2021-07-21 | AFYX Therapeutics A/S | Method for fabrication of a two-layered product based on electrospun fibres |
DE102017112573A1 (en) * | 2017-06-07 | 2018-12-13 | Lts Lohmann Therapie-Systeme Ag | Microneedle system for the application of glucagon-like peptide analogues |
WO2021072113A1 (en) * | 2019-10-08 | 2021-04-15 | Afyx Therapeutics A/S | Compositions for the delivery of proteins |
EP4104862A4 (en) * | 2020-02-07 | 2024-05-22 | Kao Corporation | Skin composition for external use |
Family Cites Families (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6743211B1 (en) * | 1999-11-23 | 2004-06-01 | Georgia Tech Research Corporation | Devices and methods for enhanced microneedle penetration of biological barriers |
US20050196380A1 (en) * | 2004-03-08 | 2005-09-08 | Mikszta John A. | Method for delivering therapeutic proteins to the intradermal compartment |
US7786086B2 (en) * | 2004-09-08 | 2010-08-31 | Ramot At Tel-Aviv University Ltd. | Peptide nanostructures containing end-capping modified peptides and methods of generating and using the same |
US20060057165A1 (en) * | 2004-09-10 | 2006-03-16 | Dimitrios Dimitrakoudis | Clostridium botulinum toxin formulation and method for reducing weight |
US20060085063A1 (en) * | 2004-10-15 | 2006-04-20 | Shastri V P | Nano- and micro-scale engineering of polymeric scaffolds for vascular tissue engineering |
-
2007
- 2007-05-09 EP EP07835752A patent/EP2015803A4/en not_active Withdrawn
- 2007-05-09 CA CA002650197A patent/CA2650197A1/en not_active Abandoned
- 2007-05-09 WO PCT/US2007/011228 patent/WO2008024141A2/en active Application Filing
- 2007-05-09 AU AU2007288442A patent/AU2007288442A1/en not_active Abandoned
Also Published As
Publication number | Publication date |
---|---|
AU2007288442A1 (en) | 2008-02-28 |
WO2008024141A8 (en) | 2009-07-09 |
WO2008024141A3 (en) | 2008-04-24 |
EP2015803A2 (en) | 2009-01-21 |
WO2008024141A2 (en) | 2008-02-28 |
EP2015803A4 (en) | 2009-05-06 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CA2650197A1 (en) | Nanofiber structures on asperities for sequestering, carrying and transferring substances | |
US11419816B2 (en) | Method and device for transdermal delivery of parathyroid hormone using a microprojection array | |
KR101866005B1 (en) | Microneedle-coating composition and microneedle device | |
JP5242415B2 (en) | Pharmacological composition with high stability | |
JP2021535928A (en) | Implantable sustained release fine needle patch and its preparation method | |
Fonseca et al. | A compendium of current developments on polysaccharide and protein-based microneedles | |
US20200197286A1 (en) | Soluble microneedle for delivering proteins or peptides | |
JPWO2010074239A1 (en) | Microneedle device | |
TW201400140A (en) | Embeddable patch for transdermal drug delivery and method of manufacturing the same | |
CA2691836A1 (en) | Coating formulations including polyphosphazene polyelectrolytes and biologically active agents and asperities coated with such formulations | |
WO2019029154A1 (en) | Transdermal composition and use thereof in preparation of transdermal formulation | |
CN100566669C (en) | The transdermal release device of parathyroid hormone agents | |
US10792400B2 (en) | Microstructure formulation techniques for botulinum toxin | |
Mašek et al. | Nanofibers in mucosal drug and vaccine delivery | |
US10525111B2 (en) | Microstructure formulation techniques for botulinum toxin | |
KR20160119679A (en) | Soluble Microneedle for protein or peptide delivery | |
CN109646673A (en) | The micro-structure preparation technique of botulin toxin | |
EP2533771A2 (en) | Transdermal therapeutic system for the administration of peptides | |
EP4052753A1 (en) | Microstructure formulation technique for botulinum toxin | |
Dillon et al. | Development of Novel Transdermal Drug Delivery Technologies for Therapeutic Peptides | |
KR20230107137A (en) | Stable composition comprising botulinum toxin and microstructure comprising thereof | |
CN117083075A (en) | Dermatological composition and use thereof | |
Chen et al. | Poly-c-glutamic acid microneedles with as | |
Mittal | Exploring the follicular route for transcutaneous vaccination using nanoparticles |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
FZDE | Discontinued |