CA2325016A1 - Hepatitis c virus ns5b compositions and methods of use thereof - Google Patents
Hepatitis c virus ns5b compositions and methods of use thereof Download PDFInfo
- Publication number
- CA2325016A1 CA2325016A1 CA002325016A CA2325016A CA2325016A1 CA 2325016 A1 CA2325016 A1 CA 2325016A1 CA 002325016 A CA002325016 A CA 002325016A CA 2325016 A CA2325016 A CA 2325016A CA 2325016 A1 CA2325016 A1 CA 2325016A1
- Authority
- CA
- Canada
- Prior art keywords
- seq
- protein
- hepatitis
- sequence
- virus
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 238000000034 method Methods 0.000 title claims abstract description 129
- 108700008776 hepatitis C virus NS-5 Proteins 0.000 title claims abstract description 103
- 239000000203 mixture Substances 0.000 title abstract description 23
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 179
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 178
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 138
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 138
- 241000711549 Hepacivirus C Species 0.000 claims description 242
- 108090000623 proteins and genes Proteins 0.000 claims description 214
- 235000018102 proteins Nutrition 0.000 claims description 172
- 210000004027 cell Anatomy 0.000 claims description 100
- 230000000694 effects Effects 0.000 claims description 94
- 235000001014 amino acid Nutrition 0.000 claims description 86
- 229940024606 amino acid Drugs 0.000 claims description 78
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 74
- 150000001413 amino acids Chemical class 0.000 claims description 69
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 67
- 229920001184 polypeptide Polymers 0.000 claims description 54
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 50
- 108091032973 (ribonucleotides)n+m Proteins 0.000 claims description 42
- 101800001554 RNA-directed RNA polymerase Proteins 0.000 claims description 42
- 108020004705 Codon Proteins 0.000 claims description 35
- 108091034117 Oligonucleotide Proteins 0.000 claims description 30
- 241000700605 Viruses Species 0.000 claims description 29
- 150000001875 compounds Chemical class 0.000 claims description 29
- 230000014509 gene expression Effects 0.000 claims description 29
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 27
- 239000013598 vector Substances 0.000 claims description 26
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 23
- 125000000539 amino acid group Chemical group 0.000 claims description 23
- 230000000295 complement effect Effects 0.000 claims description 22
- 238000000338 in vitro Methods 0.000 claims description 21
- 208000015181 infectious disease Diseases 0.000 claims description 21
- 238000012360 testing method Methods 0.000 claims description 21
- 239000000463 material Substances 0.000 claims description 19
- 238000001514 detection method Methods 0.000 claims description 18
- 230000010076 replication Effects 0.000 claims description 18
- 230000003612 virological effect Effects 0.000 claims description 17
- 230000002458 infectious effect Effects 0.000 claims description 15
- 239000002773 nucleotide Substances 0.000 claims description 15
- 125000003729 nucleotide group Chemical group 0.000 claims description 15
- 239000000427 antigen Substances 0.000 claims description 14
- 108091007433 antigens Proteins 0.000 claims description 14
- 102000036639 antigens Human genes 0.000 claims description 14
- 230000028993 immune response Effects 0.000 claims description 14
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 claims description 12
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 12
- 241000238631 Hexapoda Species 0.000 claims description 11
- 230000001580 bacterial effect Effects 0.000 claims description 11
- 235000004279 alanine Nutrition 0.000 claims description 10
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 claims description 9
- -1 .beta.-galactosidase Proteins 0.000 claims description 8
- 208000005176 Hepatitis C Diseases 0.000 claims description 8
- 108060001084 Luciferase Proteins 0.000 claims description 8
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 claims description 8
- 230000003042 antagnostic effect Effects 0.000 claims description 8
- 230000000692 anti-sense effect Effects 0.000 claims description 8
- 238000004587 chromatography analysis Methods 0.000 claims description 8
- 230000001419 dependent effect Effects 0.000 claims description 8
- 230000003993 interaction Effects 0.000 claims description 8
- 230000001270 agonistic effect Effects 0.000 claims description 7
- 239000011159 matrix material Substances 0.000 claims description 7
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 claims description 6
- 235000009582 asparagine Nutrition 0.000 claims description 6
- 229960001230 asparagine Drugs 0.000 claims description 6
- 239000012472 biological sample Substances 0.000 claims description 6
- 229960002685 biotin Drugs 0.000 claims description 6
- 235000020958 biotin Nutrition 0.000 claims description 6
- 239000011616 biotin Substances 0.000 claims description 6
- 239000000284 extract Substances 0.000 claims description 6
- 239000002245 particle Substances 0.000 claims description 6
- 238000012216 screening Methods 0.000 claims description 6
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 claims description 5
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 claims description 5
- 229920001519 homopolymer Polymers 0.000 claims description 5
- 239000004474 valine Substances 0.000 claims description 5
- 102000002260 Alkaline Phosphatase Human genes 0.000 claims description 4
- 108020004774 Alkaline Phosphatase Proteins 0.000 claims description 4
- 229920002101 Chitin Polymers 0.000 claims description 4
- 102000005720 Glutathione transferase Human genes 0.000 claims description 4
- 108010070675 Glutathione transferase Proteins 0.000 claims description 4
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 claims description 4
- 241000712431 Influenza A virus Species 0.000 claims description 4
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 claims description 4
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 claims description 4
- 239000005089 Luciferase Substances 0.000 claims description 4
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 claims description 4
- 241001465754 Metazoa Species 0.000 claims description 4
- 101710135898 Myc proto-oncogene protein Proteins 0.000 claims description 4
- 102100038895 Myc proto-oncogene protein Human genes 0.000 claims description 4
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 claims description 4
- 101710150448 Transcriptional regulator Myc Proteins 0.000 claims description 4
- 235000003704 aspartic acid Nutrition 0.000 claims description 4
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 claims description 4
- 102000028861 calmodulin binding Human genes 0.000 claims description 4
- 108091000084 calmodulin binding Proteins 0.000 claims description 4
- 239000001913 cellulose Substances 0.000 claims description 4
- 229920002678 cellulose Polymers 0.000 claims description 4
- 230000002538 fungal effect Effects 0.000 claims description 4
- 229960002897 heparin Drugs 0.000 claims description 4
- 229920000669 heparin Polymers 0.000 claims description 4
- 229920002704 polyhistidine Polymers 0.000 claims description 4
- 230000008569 process Effects 0.000 claims description 4
- 238000001890 transfection Methods 0.000 claims description 4
- 230000009466 transformation Effects 0.000 claims description 4
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 claims description 3
- YKCWQPZFAFZLBI-UHFFFAOYSA-N cibacron blue Chemical compound C1=2C(=O)C3=CC=CC=C3C(=O)C=2C(N)=C(S(O)(=O)=O)C=C1NC(C=C1S(O)(=O)=O)=CC=C1NC(N=1)=NC(Cl)=NC=1NC1=CC=CC=C1S(O)(=O)=O YKCWQPZFAFZLBI-UHFFFAOYSA-N 0.000 claims description 3
- 238000004128 high performance liquid chromatography Methods 0.000 claims description 3
- 230000001900 immune effect Effects 0.000 claims description 3
- 210000004962 mammalian cell Anatomy 0.000 claims description 3
- 238000003199 nucleic acid amplification method Methods 0.000 claims description 3
- 238000000638 solvent extraction Methods 0.000 claims description 3
- 238000010361 transduction Methods 0.000 claims description 3
- 230000026683 transduction Effects 0.000 claims description 3
- 239000000556 agonist Substances 0.000 claims description 2
- 230000003321 amplification Effects 0.000 claims description 2
- 239000005557 antagonist Substances 0.000 claims description 2
- 238000005119 centrifugation Methods 0.000 claims description 2
- 238000001556 precipitation Methods 0.000 claims description 2
- 230000002441 reversible effect Effects 0.000 claims description 2
- 239000013603 viral vector Substances 0.000 claims 6
- 239000007787 solid Substances 0.000 claims 5
- 125000000524 functional group Chemical group 0.000 claims 3
- 210000003494 hepatocyte Anatomy 0.000 claims 3
- 108020004999 messenger RNA Proteins 0.000 claims 3
- 230000001902 propagating effect Effects 0.000 claims 3
- 150000003839 salts Chemical class 0.000 claims 3
- MZVQCMJNVPIDEA-UHFFFAOYSA-N [CH2]CN(CC)CC Chemical group [CH2]CN(CC)CC MZVQCMJNVPIDEA-UHFFFAOYSA-N 0.000 claims 2
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 claims 2
- 239000007853 buffer solution Substances 0.000 claims 2
- 241001529936 Murinae Species 0.000 claims 1
- 238000001042 affinity chromatography Methods 0.000 claims 1
- 230000008484 agonism Effects 0.000 claims 1
- 230000008485 antagonism Effects 0.000 claims 1
- 239000008366 buffered solution Substances 0.000 claims 1
- 238000004113 cell culture Methods 0.000 claims 1
- 230000009920 chelation Effects 0.000 claims 1
- 238000012258 culturing Methods 0.000 claims 1
- 238000001962 electrophoresis Methods 0.000 claims 1
- 238000000605 extraction Methods 0.000 claims 1
- 238000005194 fractionation Methods 0.000 claims 1
- 238000002523 gelfiltration Methods 0.000 claims 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 claims 1
- 238000001114 immunoprecipitation Methods 0.000 claims 1
- 238000004255 ion exchange chromatography Methods 0.000 claims 1
- 238000001155 isoelectric focusing Methods 0.000 claims 1
- 238000002218 isotachophoresis Methods 0.000 claims 1
- 210000005229 liver cell Anatomy 0.000 claims 1
- 238000005374 membrane filtration Methods 0.000 claims 1
- 239000000693 micelle Substances 0.000 claims 1
- 239000013641 positive control Substances 0.000 claims 1
- 239000011535 reaction buffer Substances 0.000 claims 1
- 230000009257 reactivity Effects 0.000 claims 1
- 230000003381 solubilizing effect Effects 0.000 claims 1
- 230000001131 transforming effect Effects 0.000 claims 1
- 108091005461 Nucleic proteins Proteins 0.000 abstract description 2
- 108020004414 DNA Proteins 0.000 description 67
- 108060004795 Methyltransferase Proteins 0.000 description 56
- 239000013615 primer Substances 0.000 description 35
- 239000003795 chemical substances by application Substances 0.000 description 26
- 238000003556 assay Methods 0.000 description 25
- 239000000523 sample Substances 0.000 description 25
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 22
- 241000880493 Leptailurus serval Species 0.000 description 20
- RXGLHDWAZQECBI-SRVKXCTJSA-N Leu-Leu-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O RXGLHDWAZQECBI-SRVKXCTJSA-N 0.000 description 19
- 108010018006 histidylserine Proteins 0.000 description 18
- 238000006467 substitution reaction Methods 0.000 description 18
- 108091035707 Consensus sequence Proteins 0.000 description 17
- 108010086434 alanyl-seryl-glycine Proteins 0.000 description 16
- 238000009396 hybridization Methods 0.000 description 16
- LIINDKYIGYTDLG-PPCPHDFISA-N Leu-Ile-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LIINDKYIGYTDLG-PPCPHDFISA-N 0.000 description 14
- 230000002255 enzymatic effect Effects 0.000 description 14
- TTXMOJWKNRJWQJ-FXQIFTODSA-N Ala-Arg-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)C)CCCN=C(N)N TTXMOJWKNRJWQJ-FXQIFTODSA-N 0.000 description 13
- ZMYCLHFLHRVOEA-HEIBUPTGSA-N Thr-Thr-Ser Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O ZMYCLHFLHRVOEA-HEIBUPTGSA-N 0.000 description 13
- 108010047495 alanylglycine Proteins 0.000 description 13
- 238000006243 chemical reaction Methods 0.000 description 13
- 239000013612 plasmid Substances 0.000 description 13
- 239000012634 fragment Substances 0.000 description 12
- KLSUAWUZBMAZCL-RHYQMDGZSA-N Leu-Thr-Pro Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(O)=O KLSUAWUZBMAZCL-RHYQMDGZSA-N 0.000 description 11
- 239000003153 chemical reaction reagent Substances 0.000 description 11
- 239000011780 sodium chloride Substances 0.000 description 11
- 241000701447 unidentified baculovirus Species 0.000 description 11
- 102000004190 Enzymes Human genes 0.000 description 10
- 108090000790 Enzymes Proteins 0.000 description 10
- 238000007792 addition Methods 0.000 description 10
- 108010016616 cysteinylglycine Proteins 0.000 description 10
- 238000004519 manufacturing process Methods 0.000 description 10
- 108010051242 phenylalanylserine Proteins 0.000 description 10
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 10
- 238000011282 treatment Methods 0.000 description 10
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 9
- 230000006819 RNA synthesis Effects 0.000 description 9
- BDMWLJLPPUCLNV-XGEHTFHBSA-N Ser-Thr-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O BDMWLJLPPUCLNV-XGEHTFHBSA-N 0.000 description 9
- 108010093581 aspartyl-proline Proteins 0.000 description 9
- 201000010099 disease Diseases 0.000 description 9
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 9
- 229930182817 methionine Natural products 0.000 description 9
- 239000000126 substance Substances 0.000 description 9
- WKOBSJOZRJJVRZ-FXQIFTODSA-N Ala-Glu-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O WKOBSJOZRJJVRZ-FXQIFTODSA-N 0.000 description 8
- SOBIAADAMRHGKH-CIUDSAMLSA-N Ala-Leu-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O SOBIAADAMRHGKH-CIUDSAMLSA-N 0.000 description 8
- YBIAYFFIVAZXPK-AVGNSLFASA-N Arg-His-Arg Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O YBIAYFFIVAZXPK-AVGNSLFASA-N 0.000 description 8
- KXOPYFNQLVUOAQ-FXQIFTODSA-N Arg-Ser-Ala Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O KXOPYFNQLVUOAQ-FXQIFTODSA-N 0.000 description 8
- UTSMXMABBPFVJP-SZMVWBNQSA-N Arg-Val-Trp Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N UTSMXMABBPFVJP-SZMVWBNQSA-N 0.000 description 8
- ANAHQDPQQBDOBM-UHFFFAOYSA-N Arg-Val-Tyr Natural products CC(C)C(NC(=O)C(N)CCNC(=N)N)C(=O)NC(Cc1ccc(O)cc1)C(=O)O ANAHQDPQQBDOBM-UHFFFAOYSA-N 0.000 description 8
- MKJBPDLENBUHQU-CIUDSAMLSA-N Asn-Ser-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O MKJBPDLENBUHQU-CIUDSAMLSA-N 0.000 description 8
- IXIWEFWRKIUMQX-DCAQKATOSA-N Asp-Arg-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H](N)CC(O)=O IXIWEFWRKIUMQX-DCAQKATOSA-N 0.000 description 8
- ZCKYZTGLXIEOKS-CIUDSAMLSA-N Asp-Asp-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)O)N ZCKYZTGLXIEOKS-CIUDSAMLSA-N 0.000 description 8
- JRHPEMVLTRADLJ-AVGNSLFASA-N Gln-Lys-Lys Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)N)N JRHPEMVLTRADLJ-AVGNSLFASA-N 0.000 description 8
- VEYGCDYMOXHJLS-GVXVVHGQSA-N Gln-Val-Leu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O VEYGCDYMOXHJLS-GVXVVHGQSA-N 0.000 description 8
- HUWSBFYAGXCXKC-CIUDSAMLSA-N Glu-Ala-Met Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(O)=O HUWSBFYAGXCXKC-CIUDSAMLSA-N 0.000 description 8
- SOEPMWQCTJITPZ-SRVKXCTJSA-N Glu-Met-Lys Chemical compound CSCC[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)O)N SOEPMWQCTJITPZ-SRVKXCTJSA-N 0.000 description 8
- VIVSWEBJUHXCDS-DCAQKATOSA-N His-Asn-Met Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCSC)C(O)=O VIVSWEBJUHXCDS-DCAQKATOSA-N 0.000 description 8
- PMGDADKJMCOXHX-UHFFFAOYSA-N L-Arginyl-L-glutamin-acetat Natural products NC(=N)NCCCC(N)C(=O)NC(CCC(N)=O)C(O)=O PMGDADKJMCOXHX-UHFFFAOYSA-N 0.000 description 8
- FJUKMPUELVROGK-IHRRRGAJSA-N Leu-Arg-His Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N FJUKMPUELVROGK-IHRRRGAJSA-N 0.000 description 8
- YBAFDPFAUTYYRW-UHFFFAOYSA-N N-L-alpha-glutamyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCC(O)=O YBAFDPFAUTYYRW-UHFFFAOYSA-N 0.000 description 8
- FKKHDBFNOLCYQM-FXQIFTODSA-N Pro-Cys-Ala Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CS)C(=O)N[C@@H](C)C(O)=O FKKHDBFNOLCYQM-FXQIFTODSA-N 0.000 description 8
- ULIWFCCJIOEHMU-BQBZGAKWSA-N Pro-Gly-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1 ULIWFCCJIOEHMU-BQBZGAKWSA-N 0.000 description 8
- BBFRBZYKHIKFBX-GMOBBJLQSA-N Pro-Ile-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@@H]1CCCN1 BBFRBZYKHIKFBX-GMOBBJLQSA-N 0.000 description 8
- FYKUEXMZYFIZKA-DCAQKATOSA-N Pro-Pro-Gln Chemical compound [H]N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(O)=O FYKUEXMZYFIZKA-DCAQKATOSA-N 0.000 description 8
- 108010079005 RDV peptide Proteins 0.000 description 8
- BRKHVZNDAOMAHX-BIIVOSGPSA-N Ser-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CO)N BRKHVZNDAOMAHX-BIIVOSGPSA-N 0.000 description 8
- RNMRYWZYFHHOEV-CIUDSAMLSA-N Ser-Gln-Arg Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O RNMRYWZYFHHOEV-CIUDSAMLSA-N 0.000 description 8
- XUDRHBPSPAPDJP-SRVKXCTJSA-N Ser-Lys-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CO XUDRHBPSPAPDJP-SRVKXCTJSA-N 0.000 description 8
- UNURFMVMXLENAZ-KJEVXHAQSA-N Thr-Arg-Tyr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O UNURFMVMXLENAZ-KJEVXHAQSA-N 0.000 description 8
- MICSYKFECRFCTJ-IHRRRGAJSA-N Tyr-Arg-Asp Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC(=O)O)C(=O)O)N)O MICSYKFECRFCTJ-IHRRRGAJSA-N 0.000 description 8
- YKNOJPJWNVHORX-UNQGMJICSA-N Val-Phe-Thr Chemical compound CC(C)[C@H](N)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)O)C(O)=O)CC1=CC=CC=C1 YKNOJPJWNVHORX-UNQGMJICSA-N 0.000 description 8
- PDDJTOSAVNRJRH-UNQGMJICSA-N Val-Thr-Phe Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)NC(=O)[C@H](C(C)C)N)O PDDJTOSAVNRJRH-UNQGMJICSA-N 0.000 description 8
- QPJSIBAOZBVELU-BPNCWPANSA-N Val-Tyr-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](C(C)C)N QPJSIBAOZBVELU-BPNCWPANSA-N 0.000 description 8
- 108010008355 arginyl-glutamine Proteins 0.000 description 8
- 108010080575 glutamyl-aspartyl-alanine Proteins 0.000 description 8
- 108010073628 glutamyl-valyl-phenylalanine Proteins 0.000 description 8
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 8
- 108010051307 glycyl-glycyl-proline Proteins 0.000 description 8
- 108010045126 glycyl-tyrosyl-glycine Proteins 0.000 description 8
- 108010028295 histidylhistidine Proteins 0.000 description 8
- 108010044374 isoleucyl-tyrosine Proteins 0.000 description 8
- 108010060857 isoleucyl-valyl-tyrosine Proteins 0.000 description 8
- 210000000056 organ Anatomy 0.000 description 8
- 108010064486 phenylalanyl-leucyl-valine Proteins 0.000 description 8
- 238000002360 preparation method Methods 0.000 description 8
- 239000002987 primer (paints) Substances 0.000 description 8
- 108010090894 prolylleucine Proteins 0.000 description 8
- 238000000746 purification Methods 0.000 description 8
- 108010048397 seryl-lysyl-leucine Proteins 0.000 description 8
- 210000001519 tissue Anatomy 0.000 description 8
- 108010015385 valyl-prolyl-proline Proteins 0.000 description 8
- 108010073969 valyllysine Proteins 0.000 description 8
- SGYSTDWPNPKJPP-GUBZILKMSA-N Arg-Ala-Arg Chemical compound NC(=N)NCCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O SGYSTDWPNPKJPP-GUBZILKMSA-N 0.000 description 7
- VBFJESQBIWCWRL-DCAQKATOSA-N Arg-Ala-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCNC(N)=N VBFJESQBIWCWRL-DCAQKATOSA-N 0.000 description 7
- MFAMTAVAFBPXDC-LPEHRKFASA-N Arg-Asp-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCN=C(N)N)N)C(=O)O MFAMTAVAFBPXDC-LPEHRKFASA-N 0.000 description 7
- FTMRPIVPSDVGCC-GUBZILKMSA-N Arg-Val-Cys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N FTMRPIVPSDVGCC-GUBZILKMSA-N 0.000 description 7
- WHLDJYNHXOMGMU-JYJNAYRXSA-N Arg-Val-Tyr Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 WHLDJYNHXOMGMU-JYJNAYRXSA-N 0.000 description 7
- DWOGMPWRQQWPPF-GUBZILKMSA-N Asp-Leu-Glu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O DWOGMPWRQQWPPF-GUBZILKMSA-N 0.000 description 7
- 102000053602 DNA Human genes 0.000 description 7
- UFPXDFOYHVEIPI-BYPYZUCNSA-N Gly-Gly-Asp Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CC(O)=O UFPXDFOYHVEIPI-BYPYZUCNSA-N 0.000 description 7
- DNAZKGFYFRGZIH-QWRGUYRKSA-N Gly-Tyr-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CC1=CC=C(O)C=C1 DNAZKGFYFRGZIH-QWRGUYRKSA-N 0.000 description 7
- VOEGKUNRHYKYSU-XVYDVKMFSA-N His-Asp-Ala Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(O)=O VOEGKUNRHYKYSU-XVYDVKMFSA-N 0.000 description 7
- JSLIXOUMAOUGBN-JUKXBJQTSA-N Ile-Tyr-His Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)N JSLIXOUMAOUGBN-JUKXBJQTSA-N 0.000 description 7
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 7
- LJHGALIOHLRRQN-DCAQKATOSA-N Leu-Ala-Arg Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCCN=C(N)N LJHGALIOHLRRQN-DCAQKATOSA-N 0.000 description 7
- MJOZZTKJZQFKDK-GUBZILKMSA-N Leu-Ala-Gln Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCC(N)=O MJOZZTKJZQFKDK-GUBZILKMSA-N 0.000 description 7
- DLCOFDAHNMMQPP-SRVKXCTJSA-N Leu-Asp-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O DLCOFDAHNMMQPP-SRVKXCTJSA-N 0.000 description 7
- AUEJLPRZGVVDNU-UHFFFAOYSA-N N-L-tyrosyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CC1=CC=C(O)C=C1 AUEJLPRZGVVDNU-UHFFFAOYSA-N 0.000 description 7
- RYAUPBMDRMJVRM-BVSLBCMMSA-N Phe-Met-Trp Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@H](CC3=CC=CC=C3)N RYAUPBMDRMJVRM-BVSLBCMMSA-N 0.000 description 7
- CDHURCQGUDNBMA-UBHSHLNASA-N Phe-Val-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CC1=CC=CC=C1 CDHURCQGUDNBMA-UBHSHLNASA-N 0.000 description 7
- QGOZJLYCGRYYRW-KKUMJFAQSA-N Pro-Glu-Tyr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O QGOZJLYCGRYYRW-KKUMJFAQSA-N 0.000 description 7
- WSTIOCFMWXNOCX-YUMQZZPRSA-N Ser-Gly-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CO)N WSTIOCFMWXNOCX-YUMQZZPRSA-N 0.000 description 7
- YUJLIIRMIAGMCQ-CIUDSAMLSA-N Ser-Leu-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O YUJLIIRMIAGMCQ-CIUDSAMLSA-N 0.000 description 7
- OQSQCUWQOIHECT-YJRXYDGGSA-N Ser-Tyr-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O OQSQCUWQOIHECT-YJRXYDGGSA-N 0.000 description 7
- PMTWIUBUQRGCSB-FXQIFTODSA-N Ser-Val-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O PMTWIUBUQRGCSB-FXQIFTODSA-N 0.000 description 7
- ZESGVALRVJIVLZ-VFCFLDTKSA-N Thr-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@@H]1C(=O)O)N)O ZESGVALRVJIVLZ-VFCFLDTKSA-N 0.000 description 7
- DMWNPLOERDAHSY-MEYUZBJRSA-N Tyr-Leu-Thr Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O DMWNPLOERDAHSY-MEYUZBJRSA-N 0.000 description 7
- SYFHQHYTNCQCCN-MELADBBJSA-N Tyr-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CC2=CC=C(C=C2)O)N)C(=O)O SYFHQHYTNCQCCN-MELADBBJSA-N 0.000 description 7
- SZTTYWIUCGSURQ-AUTRQRHGSA-N Val-Glu-Glu Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O SZTTYWIUCGSURQ-AUTRQRHGSA-N 0.000 description 7
- AEMPCGRFEZTWIF-IHRRRGAJSA-N Val-Leu-Lys Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(O)=O AEMPCGRFEZTWIF-IHRRRGAJSA-N 0.000 description 7
- 108010070944 alanylhistidine Proteins 0.000 description 7
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 7
- 108010060035 arginylproline Proteins 0.000 description 7
- 230000001413 cellular effect Effects 0.000 description 7
- 230000008859 change Effects 0.000 description 7
- 239000012149 elution buffer Substances 0.000 description 7
- 108010078144 glutaminyl-glycine Proteins 0.000 description 7
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 7
- 238000002955 isolation Methods 0.000 description 7
- 108010057821 leucylproline Proteins 0.000 description 7
- 125000001360 methionine group Chemical class N[C@@H](CCSC)C(=O)* 0.000 description 7
- 239000002243 precursor Substances 0.000 description 7
- 108010015796 prolylisoleucine Proteins 0.000 description 7
- 230000001225 therapeutic effect Effects 0.000 description 7
- 108010003137 tyrosyltyrosine Proteins 0.000 description 7
- XVZCXCTYGHPNEM-IHRRRGAJSA-N (2s)-1-[(2s)-2-[[(2s)-2-amino-4-methylpentanoyl]amino]-4-methylpentanoyl]pyrrolidine-2-carboxylic acid Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(O)=O XVZCXCTYGHPNEM-IHRRRGAJSA-N 0.000 description 6
- JBVSSSZFNTXJDX-YTLHQDLWSA-N Ala-Ala-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](C)N JBVSSSZFNTXJDX-YTLHQDLWSA-N 0.000 description 6
- KQFRUSHJPKXBMB-BHDSKKPTSA-N Ala-Ala-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](C)NC(=O)[C@@H](N)C)C(O)=O)=CNC2=C1 KQFRUSHJPKXBMB-BHDSKKPTSA-N 0.000 description 6
- QDRGPQWIVZNJQD-CIUDSAMLSA-N Ala-Arg-Gln Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(O)=O QDRGPQWIVZNJQD-CIUDSAMLSA-N 0.000 description 6
- IORKCNUBHNIMKY-CIUDSAMLSA-N Ala-Pro-Glu Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O IORKCNUBHNIMKY-CIUDSAMLSA-N 0.000 description 6
- HOVPGJUNRLMIOZ-CIUDSAMLSA-N Ala-Ser-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](C)N HOVPGJUNRLMIOZ-CIUDSAMLSA-N 0.000 description 6
- PHQXWZGXKAFWAZ-ZLIFDBKOSA-N Ala-Trp-Lys Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@@H](N)C)C(=O)N[C@@H](CCCCN)C(O)=O)=CNC2=C1 PHQXWZGXKAFWAZ-ZLIFDBKOSA-N 0.000 description 6
- BBYTXXRNSFUOOX-IHRRRGAJSA-N Arg-Cys-Phe Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O BBYTXXRNSFUOOX-IHRRRGAJSA-N 0.000 description 6
- CVKOQHYVDVYJSI-QTKMDUPCSA-N Arg-His-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](CCCN=C(N)N)N)O CVKOQHYVDVYJSI-QTKMDUPCSA-N 0.000 description 6
- ULBHWNVWSCJLCO-NHCYSSNCSA-N Arg-Val-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCCN=C(N)N ULBHWNVWSCJLCO-NHCYSSNCSA-N 0.000 description 6
- ZWASIOHRQWRWAS-UGYAYLCHSA-N Asn-Asp-Ile Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O ZWASIOHRQWRWAS-UGYAYLCHSA-N 0.000 description 6
- IPPFAOCLQSGHJV-WFBYXXMGSA-N Asn-Trp-Ala Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](C)C(O)=O IPPFAOCLQSGHJV-WFBYXXMGSA-N 0.000 description 6
- YIDFBWRHIYOYAA-LKXGYXEUSA-N Asp-Ser-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O YIDFBWRHIYOYAA-LKXGYXEUSA-N 0.000 description 6
- XABFFGOGKOORCG-CIUDSAMLSA-N Cys-Asp-Leu Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O XABFFGOGKOORCG-CIUDSAMLSA-N 0.000 description 6
- DZSICRGTVPDCRN-YUMQZZPRSA-N Cys-Gly-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CS)N DZSICRGTVPDCRN-YUMQZZPRSA-N 0.000 description 6
- ABLJDBFJPUWQQB-DCAQKATOSA-N Cys-Leu-Arg Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)NC(=O)[C@H](CS)N ABLJDBFJPUWQQB-DCAQKATOSA-N 0.000 description 6
- WVLZTXGTNGHPBO-SRVKXCTJSA-N Cys-Leu-Leu Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O WVLZTXGTNGHPBO-SRVKXCTJSA-N 0.000 description 6
- ZALVANCAZFPKIR-GUBZILKMSA-N Cys-Pro-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CS)N ZALVANCAZFPKIR-GUBZILKMSA-N 0.000 description 6
- GFAPBMCRSMSGDZ-XGEHTFHBSA-N Cys-Thr-Met Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCSC)C(=O)O)NC(=O)[C@H](CS)N)O GFAPBMCRSMSGDZ-XGEHTFHBSA-N 0.000 description 6
- 241000588724 Escherichia coli Species 0.000 description 6
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 6
- RDPOETHPAQEGDP-ACZMJKKPSA-N Glu-Asp-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(O)=O RDPOETHPAQEGDP-ACZMJKKPSA-N 0.000 description 6
- PVBBEKPHARMPHX-DCAQKATOSA-N Glu-Gln-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCC(O)=O PVBBEKPHARMPHX-DCAQKATOSA-N 0.000 description 6
- KRRFFAHEAOCBCQ-SIUGBPQLSA-N Glu-Ile-Tyr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O KRRFFAHEAOCBCQ-SIUGBPQLSA-N 0.000 description 6
- OQXDUSZKISQQSS-GUBZILKMSA-N Glu-Lys-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O OQXDUSZKISQQSS-GUBZILKMSA-N 0.000 description 6
- ZGEJRLJEAMPEDV-SRVKXCTJSA-N Glu-Lys-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)N ZGEJRLJEAMPEDV-SRVKXCTJSA-N 0.000 description 6
- BPLNJYHNAJVLRT-ACZMJKKPSA-N Glu-Ser-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O BPLNJYHNAJVLRT-ACZMJKKPSA-N 0.000 description 6
- SYAYROHMAIHWFB-KBIXCLLPSA-N Glu-Ser-Ile Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O SYAYROHMAIHWFB-KBIXCLLPSA-N 0.000 description 6
- HZISRJBYZAODRV-XQXXSGGOSA-N Glu-Thr-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O HZISRJBYZAODRV-XQXXSGGOSA-N 0.000 description 6
- FKJQNJCQTKUBCD-XPUUQOCRSA-N Gly-Ala-His Chemical compound NCC(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)O FKJQNJCQTKUBCD-XPUUQOCRSA-N 0.000 description 6
- DTRUBYPMMVPQPD-YUMQZZPRSA-N Gly-Gln-Arg Chemical compound [H]NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O DTRUBYPMMVPQPD-YUMQZZPRSA-N 0.000 description 6
- HQRHFUYMGCHHJS-LURJTMIESA-N Gly-Gly-Arg Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CCCN=C(N)N HQRHFUYMGCHHJS-LURJTMIESA-N 0.000 description 6
- XVYKMNXXJXQKME-XEGUGMAKSA-N Gly-Ile-Tyr Chemical compound NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 XVYKMNXXJXQKME-XEGUGMAKSA-N 0.000 description 6
- WMGHDYWNHNLGBV-ONGXEEELSA-N Gly-Phe-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)CN)CC1=CC=CC=C1 WMGHDYWNHNLGBV-ONGXEEELSA-N 0.000 description 6
- YYXJFBMCOUSYSF-RYUDHWBXSA-N Gly-Phe-Gln Chemical compound [H]NCC(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(N)=O)C(O)=O YYXJFBMCOUSYSF-RYUDHWBXSA-N 0.000 description 6
- CQMFNTVQVLQRLT-JHEQGTHGSA-N Gly-Thr-Gln Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O CQMFNTVQVLQRLT-JHEQGTHGSA-N 0.000 description 6
- IITVUURPOYGCTD-NAKRPEOUSA-N Ile-Pro-Ala Chemical compound CC[C@H](C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O IITVUURPOYGCTD-NAKRPEOUSA-N 0.000 description 6
- 102000006992 Interferon-alpha Human genes 0.000 description 6
- 108010047761 Interferon-alpha Proteins 0.000 description 6
- FGNQZXKVAZIMCI-CIUDSAMLSA-N Leu-Asp-Cys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CS)C(=O)O)N FGNQZXKVAZIMCI-CIUDSAMLSA-N 0.000 description 6
- XZNJZXJZBMBGGS-NHCYSSNCSA-N Leu-Val-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O XZNJZXJZBMBGGS-NHCYSSNCSA-N 0.000 description 6
- TUIOUEWKFFVNLH-DCAQKATOSA-N Leu-Val-Cys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CS)C(O)=O TUIOUEWKFFVNLH-DCAQKATOSA-N 0.000 description 6
- VMTYLUGCXIEDMV-QWRGUYRKSA-N Lys-Leu-Gly Chemical compound OC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCCCN VMTYLUGCXIEDMV-QWRGUYRKSA-N 0.000 description 6
- RBEATVHTWHTHTJ-KKUMJFAQSA-N Lys-Leu-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(O)=O RBEATVHTWHTHTJ-KKUMJFAQSA-N 0.000 description 6
- FDGAMQVRGORBDV-GUBZILKMSA-N Met-Ser-Met Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCSC FDGAMQVRGORBDV-GUBZILKMSA-N 0.000 description 6
- NUZHSNLQJDYSRW-BZSNNMDCSA-N Pro-Arg-Trp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O NUZHSNLQJDYSRW-BZSNNMDCSA-N 0.000 description 6
- ZAUHSLVPDLNTRZ-QXEWZRGKSA-N Pro-Val-Asn Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O ZAUHSLVPDLNTRZ-QXEWZRGKSA-N 0.000 description 6
- TYYBJUYSTWJHGO-ZKWXMUAHSA-N Ser-Asn-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(O)=O TYYBJUYSTWJHGO-ZKWXMUAHSA-N 0.000 description 6
- MOVJSUIKUNCVMG-ZLUOBGJFSA-N Ser-Cys-Ser Chemical compound C([C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)O)N)O MOVJSUIKUNCVMG-ZLUOBGJFSA-N 0.000 description 6
- CXBFHZLODKPIJY-AAEUAGOBSA-N Ser-Gly-Trp Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CO)N CXBFHZLODKPIJY-AAEUAGOBSA-N 0.000 description 6
- OLKICIBQRVSQMA-SRVKXCTJSA-N Ser-Ser-Tyr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O OLKICIBQRVSQMA-SRVKXCTJSA-N 0.000 description 6
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 6
- 239000004473 Threonine Substances 0.000 description 6
- SEXRBCGSZRCIPE-LYSGOOTNSA-N Trp-Thr-Gly Chemical compound C[C@H]([C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)N)O SEXRBCGSZRCIPE-LYSGOOTNSA-N 0.000 description 6
- MNMYOSZWCKYEDI-JRQIVUDYSA-N Tyr-Asp-Thr Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O MNMYOSZWCKYEDI-JRQIVUDYSA-N 0.000 description 6
- CWQZAUYFWRLITN-AVGNSLFASA-N Tyr-Gln-Cys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CS)C(=O)O)N)O CWQZAUYFWRLITN-AVGNSLFASA-N 0.000 description 6
- WDGDKHLSDIOXQC-ACRUOGEOSA-N Tyr-Leu-Phe Chemical compound C([C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=C(O)C=C1 WDGDKHLSDIOXQC-ACRUOGEOSA-N 0.000 description 6
- DNOOLPROHJWCSQ-RCWTZXSCSA-N Val-Arg-Thr Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O DNOOLPROHJWCSQ-RCWTZXSCSA-N 0.000 description 6
- FOADDSDHGRFUOC-DZKIICNBSA-N Val-Glu-Phe Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N FOADDSDHGRFUOC-DZKIICNBSA-N 0.000 description 6
- XXROXFHCMVXETG-UWVGGRQHSA-N Val-Gly-Val Chemical compound CC(C)[C@H](N)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O XXROXFHCMVXETG-UWVGGRQHSA-N 0.000 description 6
- PYPZMFDMCCWNST-NAKRPEOUSA-N Val-Ile-Cys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](C(C)C)N PYPZMFDMCCWNST-NAKRPEOUSA-N 0.000 description 6
- DOFAQXCYFQKSHT-SRVKXCTJSA-N Val-Pro-Pro Chemical compound CC(C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 DOFAQXCYFQKSHT-SRVKXCTJSA-N 0.000 description 6
- UVHFONIHVHLDDQ-IFFSRLJSSA-N Val-Thr-Glu Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@H](C(C)C)N)O UVHFONIHVHLDDQ-IFFSRLJSSA-N 0.000 description 6
- 108010070783 alanyltyrosine Proteins 0.000 description 6
- 108010062796 arginyllysine Proteins 0.000 description 6
- 108010004073 cysteinylcysteine Proteins 0.000 description 6
- 230000002950 deficient Effects 0.000 description 6
- 230000006870 function Effects 0.000 description 6
- 108010049041 glutamylalanine Proteins 0.000 description 6
- 239000003112 inhibitor Substances 0.000 description 6
- 108010005942 methionylglycine Proteins 0.000 description 6
- 102000040430 polynucleotide Human genes 0.000 description 6
- 108091033319 polynucleotide Proteins 0.000 description 6
- 239000002157 polynucleotide Substances 0.000 description 6
- 238000011160 research Methods 0.000 description 6
- FJVAQLJNTSUQPY-CIUDSAMLSA-N Ala-Ala-Lys Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCCCN FJVAQLJNTSUQPY-CIUDSAMLSA-N 0.000 description 5
- XAGIMRPOEJSYER-CIUDSAMLSA-N Ala-Cys-Lys Chemical compound C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)O)N XAGIMRPOEJSYER-CIUDSAMLSA-N 0.000 description 5
- RGQCNKIDEQJEBT-CQDKDKBSSA-N Ala-Leu-Tyr Chemical compound C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 RGQCNKIDEQJEBT-CQDKDKBSSA-N 0.000 description 5
- MDNAVFBZPROEHO-DCAQKATOSA-N Ala-Lys-Val Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O MDNAVFBZPROEHO-DCAQKATOSA-N 0.000 description 5
- MDNAVFBZPROEHO-UHFFFAOYSA-N Ala-Lys-Val Natural products CC(C)C(C(O)=O)NC(=O)C(NC(=O)C(C)N)CCCCN MDNAVFBZPROEHO-UHFFFAOYSA-N 0.000 description 5
- FFZJHQODAYHGPO-KZVJFYERSA-N Ala-Pro-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)N FFZJHQODAYHGPO-KZVJFYERSA-N 0.000 description 5
- XSLGWYYNOSUMRM-ZKWXMUAHSA-N Ala-Val-Asn Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O XSLGWYYNOSUMRM-ZKWXMUAHSA-N 0.000 description 5
- GIVATXIGCXFQQA-FXQIFTODSA-N Arg-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCN=C(N)N GIVATXIGCXFQQA-FXQIFTODSA-N 0.000 description 5
- KJGNDQCYBNBXDA-GUBZILKMSA-N Arg-Arg-Cys Chemical compound C(C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CS)C(=O)O)N)CN=C(N)N KJGNDQCYBNBXDA-GUBZILKMSA-N 0.000 description 5
- BVBKBQRPOJFCQM-DCAQKATOSA-N Arg-Asn-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O BVBKBQRPOJFCQM-DCAQKATOSA-N 0.000 description 5
- DNUKXVMPARLPFN-XUXIUFHCSA-N Arg-Leu-Ile Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O DNUKXVMPARLPFN-XUXIUFHCSA-N 0.000 description 5
- GRRXPUAICOGISM-RWMBFGLXSA-N Arg-Lys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CCCN=C(N)N)N)C(=O)O GRRXPUAICOGISM-RWMBFGLXSA-N 0.000 description 5
- JBIRFLWXWDSDTR-CYDGBPFRSA-N Arg-Met-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCN=C(N)N)N JBIRFLWXWDSDTR-CYDGBPFRSA-N 0.000 description 5
- DMLSCRJBWUEALP-LAEOZQHASA-N Asn-Glu-Val Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O DMLSCRJBWUEALP-LAEOZQHASA-N 0.000 description 5
- AYFVRYXNDHBECD-YUMQZZPRSA-N Asp-Leu-Gly Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O AYFVRYXNDHBECD-YUMQZZPRSA-N 0.000 description 5
- IVPNEDNYYYFAGI-GARJFASQSA-N Asp-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC(=O)O)N IVPNEDNYYYFAGI-GARJFASQSA-N 0.000 description 5
- 241000196324 Embryophyta Species 0.000 description 5
- PRBLYKYHAJEABA-SRVKXCTJSA-N Gln-Arg-Leu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(O)=O PRBLYKYHAJEABA-SRVKXCTJSA-N 0.000 description 5
- RGAOLBZBLOJUTP-GRLWGSQLSA-N Gln-Ile-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)O)NC(=O)[C@H](CCC(=O)N)N RGAOLBZBLOJUTP-GRLWGSQLSA-N 0.000 description 5
- HMIXCETWRYDVMO-GUBZILKMSA-N Gln-Pro-Glu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O HMIXCETWRYDVMO-GUBZILKMSA-N 0.000 description 5
- SYWCGQOIIARSIX-SRVKXCTJSA-N Glu-Pro-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(O)=O SYWCGQOIIARSIX-SRVKXCTJSA-N 0.000 description 5
- FUTAPPOITCCWTH-WHFBIAKZSA-N Gly-Asp-Asp Chemical compound [H]NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O FUTAPPOITCCWTH-WHFBIAKZSA-N 0.000 description 5
- BAYQNCWLXIDLHX-ONGXEEELSA-N Gly-Val-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)CN BAYQNCWLXIDLHX-ONGXEEELSA-N 0.000 description 5
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 5
- RGPWUJOMKFYFSR-QWRGUYRKSA-N His-Gly-Leu Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)NCC(=O)N[C@@H](CC(C)C)C(O)=O RGPWUJOMKFYFSR-QWRGUYRKSA-N 0.000 description 5
- UQTKYYNHMVAOAA-HJPIBITLSA-N His-Ile-His Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CC2=CN=CN2)N UQTKYYNHMVAOAA-HJPIBITLSA-N 0.000 description 5
- SGLXGEDPYJPGIQ-ACRUOGEOSA-N His-Phe-Phe Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC2=CC=CC=C2)C(=O)O)NC(=O)[C@H](CC3=CN=CN3)N SGLXGEDPYJPGIQ-ACRUOGEOSA-N 0.000 description 5
- 241000282412 Homo Species 0.000 description 5
- YKRIXHPEIZUDDY-GMOBBJLQSA-N Ile-Asn-Arg Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(O)=O)CCCN=C(N)N YKRIXHPEIZUDDY-GMOBBJLQSA-N 0.000 description 5
- UOPBQSJRBONRON-STECZYCISA-N Ile-Met-Tyr Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 UOPBQSJRBONRON-STECZYCISA-N 0.000 description 5
- 108060003951 Immunoglobulin Proteins 0.000 description 5
- ZYLJULGXQDNXDK-GUBZILKMSA-N Leu-Gln-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O ZYLJULGXQDNXDK-GUBZILKMSA-N 0.000 description 5
- HFBCHNRFRYLZNV-GUBZILKMSA-N Leu-Glu-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O HFBCHNRFRYLZNV-GUBZILKMSA-N 0.000 description 5
- JVTYXRRFZCEPPK-RHYQMDGZSA-N Leu-Met-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(C)C)N)O JVTYXRRFZCEPPK-RHYQMDGZSA-N 0.000 description 5
- CNWDWAMPKVYJJB-NUTKFTJISA-N Leu-Trp-Ala Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@@H](N)CC(C)C)C(=O)N[C@@H](C)C(O)=O)=CNC2=C1 CNWDWAMPKVYJJB-NUTKFTJISA-N 0.000 description 5
- WSXTWLJHTLRFLW-SRVKXCTJSA-N Lys-Ala-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(O)=O WSXTWLJHTLRFLW-SRVKXCTJSA-N 0.000 description 5
- IWWMPCPLFXFBAF-SRVKXCTJSA-N Lys-Asp-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O IWWMPCPLFXFBAF-SRVKXCTJSA-N 0.000 description 5
- GKFNXYMAMKJSKD-NHCYSSNCSA-N Lys-Asp-Val Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O GKFNXYMAMKJSKD-NHCYSSNCSA-N 0.000 description 5
- ISHNZELVUVPCHY-ZETCQYMHSA-N Lys-Gly-Gly Chemical compound NCCCC[C@H](N)C(=O)NCC(=O)NCC(O)=O ISHNZELVUVPCHY-ZETCQYMHSA-N 0.000 description 5
- MSSJJDVQTFTLIF-KBPBESRZSA-N Lys-Phe-Gly Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(O)=O MSSJJDVQTFTLIF-KBPBESRZSA-N 0.000 description 5
- QAHFGYLFLVGBNW-DCAQKATOSA-N Met-Ala-Lys Chemical compound CSCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCCCN QAHFGYLFLVGBNW-DCAQKATOSA-N 0.000 description 5
- OWCLJDXHHZUNEL-IHRRRGAJSA-N Phe-Cys-Val Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CS)C(=O)N[C@@H](C(C)C)C(O)=O OWCLJDXHHZUNEL-IHRRRGAJSA-N 0.000 description 5
- JFNPBBOGGNMSRX-CIUDSAMLSA-N Pro-Gln-Ala Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(O)=O JFNPBBOGGNMSRX-CIUDSAMLSA-N 0.000 description 5
- VYWNORHENYEQDW-YUMQZZPRSA-N Pro-Gly-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1 VYWNORHENYEQDW-YUMQZZPRSA-N 0.000 description 5
- AQSMZTIEJMZQEC-DCAQKATOSA-N Pro-His-Ser Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N[C@@H](CO)C(=O)O AQSMZTIEJMZQEC-DCAQKATOSA-N 0.000 description 5
- AQGUSRZKDZYGGV-GMOBBJLQSA-N Pro-Ile-Asp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(O)=O)C(O)=O AQGUSRZKDZYGGV-GMOBBJLQSA-N 0.000 description 5
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 5
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 5
- IDQFQFVEWMWRQQ-DLOVCJGASA-N Ser-Ala-Phe Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O IDQFQFVEWMWRQQ-DLOVCJGASA-N 0.000 description 5
- RNFKSBPHLTZHLU-WHFBIAKZSA-N Ser-Cys-Gly Chemical compound C([C@@H](C(=O)N[C@@H](CS)C(=O)NCC(=O)O)N)O RNFKSBPHLTZHLU-WHFBIAKZSA-N 0.000 description 5
- RIAKPZVSNBBNRE-BJDJZHNGSA-N Ser-Ile-Leu Chemical compound OC[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(O)=O RIAKPZVSNBBNRE-BJDJZHNGSA-N 0.000 description 5
- IUXGJEIKJBYKOO-SRVKXCTJSA-N Ser-Leu-His Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CO)N IUXGJEIKJBYKOO-SRVKXCTJSA-N 0.000 description 5
- CRJZZXMAADSBBQ-SRVKXCTJSA-N Ser-Lys-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CO CRJZZXMAADSBBQ-SRVKXCTJSA-N 0.000 description 5
- OZPDGESCTGGNAD-CIUDSAMLSA-N Ser-Ser-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CO OZPDGESCTGGNAD-CIUDSAMLSA-N 0.000 description 5
- NADLKBTYNKUJEP-KATARQTJSA-N Ser-Thr-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O NADLKBTYNKUJEP-KATARQTJSA-N 0.000 description 5
- FVFUOQIYDPAIJR-XIRDDKMYSA-N Ser-Trp-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)NC(=O)[C@H](CO)N FVFUOQIYDPAIJR-XIRDDKMYSA-N 0.000 description 5
- VVKVHAOOUGNDPJ-SRVKXCTJSA-N Ser-Tyr-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(O)=O VVKVHAOOUGNDPJ-SRVKXCTJSA-N 0.000 description 5
- LSHUNRICNSEEAN-BPUTZDHNSA-N Ser-Val-Trp Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@H](CO)N LSHUNRICNSEEAN-BPUTZDHNSA-N 0.000 description 5
- XOTBWOCSLMBGMF-SUSMZKCASA-N Thr-Glu-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O XOTBWOCSLMBGMF-SUSMZKCASA-N 0.000 description 5
- NHQVWACSJZJCGJ-FLBSBUHZSA-N Thr-Thr-Ile Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O NHQVWACSJZJCGJ-FLBSBUHZSA-N 0.000 description 5
- QPOUERMDWKKZEG-HJPIBITLSA-N Tyr-Ser-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 QPOUERMDWKKZEG-HJPIBITLSA-N 0.000 description 5
- AZSHAZJLOZQYAY-FXQIFTODSA-N Val-Ala-Ser Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O AZSHAZJLOZQYAY-FXQIFTODSA-N 0.000 description 5
- JVGHIFMSFBZDHH-WPRPVWTQSA-N Val-Met-Gly Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCSC)C(=O)NCC(=O)O)N JVGHIFMSFBZDHH-WPRPVWTQSA-N 0.000 description 5
- PMKQKNBISAOSRI-XHSDSOJGSA-N Val-Tyr-Pro Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N2CCC[C@@H]2C(=O)O)N PMKQKNBISAOSRI-XHSDSOJGSA-N 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 239000002299 complementary DNA Substances 0.000 description 5
- 238000012217 deletion Methods 0.000 description 5
- 230000037430 deletion Effects 0.000 description 5
- 238000011161 development Methods 0.000 description 5
- 238000005516 engineering process Methods 0.000 description 5
- 230000002068 genetic effect Effects 0.000 description 5
- 208000006454 hepatitis Diseases 0.000 description 5
- 210000000987 immune system Anatomy 0.000 description 5
- 102000018358 immunoglobulin Human genes 0.000 description 5
- 239000003999 initiator Substances 0.000 description 5
- 238000012545 processing Methods 0.000 description 5
- 108010077112 prolyl-proline Proteins 0.000 description 5
- 108010026333 seryl-proline Proteins 0.000 description 5
- 229960005486 vaccine Drugs 0.000 description 5
- NYDBKUNVSALYPX-NAKRPEOUSA-N Ala-Ile-Arg Chemical compound C[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CCCN=C(N)N NYDBKUNVSALYPX-NAKRPEOUSA-N 0.000 description 4
- PMQXMXAASGFUDX-SRVKXCTJSA-N Ala-Lys-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@H](C)N)CCCCN PMQXMXAASGFUDX-SRVKXCTJSA-N 0.000 description 4
- YYAVDNKUWLAFCV-ACZMJKKPSA-N Ala-Ser-Gln Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(O)=O YYAVDNKUWLAFCV-ACZMJKKPSA-N 0.000 description 4
- ZUNMTUPRQMWMHX-LSJOCFKGSA-N Asp-Val-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(O)=O ZUNMTUPRQMWMHX-LSJOCFKGSA-N 0.000 description 4
- KKCUFHUTMKQQCF-SRVKXCTJSA-N Glu-Arg-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(O)=O KKCUFHUTMKQQCF-SRVKXCTJSA-N 0.000 description 4
- BGVYNAQWHSTTSP-BYULHYEWSA-N Gly-Asn-Ile Chemical compound [H]NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O BGVYNAQWHSTTSP-BYULHYEWSA-N 0.000 description 4
- HFPVRZWORNJRRC-UWVGGRQHSA-N Gly-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)CN HFPVRZWORNJRRC-UWVGGRQHSA-N 0.000 description 4
- JBCLFWXMTIKCCB-UHFFFAOYSA-N H-Gly-Phe-OH Natural products NCC(=O)NC(C(O)=O)CC1=CC=CC=C1 JBCLFWXMTIKCCB-UHFFFAOYSA-N 0.000 description 4
- POZULHZYLPGXMR-ONGXEEELSA-N Leu-Gly-Val Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O POZULHZYLPGXMR-ONGXEEELSA-N 0.000 description 4
- XNKDCYABMBBEKN-IUCAKERBSA-N Lys-Gly-Gln Chemical compound NCCCC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCC(N)=O XNKDCYABMBBEKN-IUCAKERBSA-N 0.000 description 4
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 4
- 108010076039 Polyproteins Proteins 0.000 description 4
- 108700008625 Reporter Genes Proteins 0.000 description 4
- MUJQWSAWLLRJCE-KATARQTJSA-N Ser-Leu-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O MUJQWSAWLLRJCE-KATARQTJSA-N 0.000 description 4
- OJRNZRROAIAHDL-LKXGYXEUSA-N Thr-Asn-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O OJRNZRROAIAHDL-LKXGYXEUSA-N 0.000 description 4
- NBIIPOKZPUGATB-BWBBJGPYSA-N Thr-Ser-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O)N)O NBIIPOKZPUGATB-BWBBJGPYSA-N 0.000 description 4
- CNLKDWSAORJEMW-KWQFWETISA-N Tyr-Gly-Ala Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(=O)N[C@@H](C)C(O)=O CNLKDWSAORJEMW-KWQFWETISA-N 0.000 description 4
- GGXUDPQWAWRINY-XEGUGMAKSA-N Tyr-Ile-Gly Chemical compound OC(=O)CNC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 GGXUDPQWAWRINY-XEGUGMAKSA-N 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 4
- 230000005714 functional activity Effects 0.000 description 4
- XBGGUPMXALFZOT-UHFFFAOYSA-N glycyl-L-tyrosine hemihydrate Natural products NCC(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 XBGGUPMXALFZOT-UHFFFAOYSA-N 0.000 description 4
- 231100000283 hepatitis Toxicity 0.000 description 4
- 238000012203 high throughput assay Methods 0.000 description 4
- 230000005764 inhibitory process Effects 0.000 description 4
- 108010012058 leucyltyrosine Proteins 0.000 description 4
- 239000006166 lysate Substances 0.000 description 4
- 238000005259 measurement Methods 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 230000002265 prevention Effects 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- 238000013519 translation Methods 0.000 description 4
- YNJBWRMUSHSURL-UHFFFAOYSA-N trichloroacetic acid Chemical compound OC(=O)C(Cl)(Cl)Cl YNJBWRMUSHSURL-UHFFFAOYSA-N 0.000 description 4
- UWQJHXKARZWDIJ-ZLUOBGJFSA-N Ala-Ala-Cys Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(O)=O UWQJHXKARZWDIJ-ZLUOBGJFSA-N 0.000 description 3
- RTZCUEHYUQZIDE-WHFBIAKZSA-N Ala-Ser-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O RTZCUEHYUQZIDE-WHFBIAKZSA-N 0.000 description 3
- PZBSKYJGKNNYNK-ULQDDVLXSA-N Arg-Leu-Tyr Chemical compound CC(C)C[C@H](NC(=O)[C@@H](N)CCCN=C(N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(O)=O PZBSKYJGKNNYNK-ULQDDVLXSA-N 0.000 description 3
- YGHCVNQOZZMHRZ-DJFWLOJKSA-N Asn-His-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](CC(=O)N)N YGHCVNQOZZMHRZ-DJFWLOJKSA-N 0.000 description 3
- UGXYFDQFLVCDFC-CIUDSAMLSA-N Asn-Ser-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O UGXYFDQFLVCDFC-CIUDSAMLSA-N 0.000 description 3
- SBHUBSDEZQFJHJ-CIUDSAMLSA-N Asp-Asp-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC(O)=O SBHUBSDEZQFJHJ-CIUDSAMLSA-N 0.000 description 3
- 108090001008 Avidin Proteins 0.000 description 3
- 108091026890 Coding region Proteins 0.000 description 3
- SZQCDCKIGWQAQN-FXQIFTODSA-N Cys-Arg-Ala Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(O)=O SZQCDCKIGWQAQN-FXQIFTODSA-N 0.000 description 3
- BSFFNUBDVYTDMV-WHFBIAKZSA-N Cys-Gly-Asn Chemical compound [H]N[C@@H](CS)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O BSFFNUBDVYTDMV-WHFBIAKZSA-N 0.000 description 3
- YKKHFPGOZXQAGK-QWRGUYRKSA-N Cys-Gly-Tyr Chemical compound SC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 YKKHFPGOZXQAGK-QWRGUYRKSA-N 0.000 description 3
- UGPCUUWZXRMCIJ-KKUMJFAQSA-N Cys-Tyr-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](CS)N UGPCUUWZXRMCIJ-KKUMJFAQSA-N 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- KFMBRBPXHVMDFN-UWVGGRQHSA-N Gly-Arg-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CCCNC(N)=N KFMBRBPXHVMDFN-UWVGGRQHSA-N 0.000 description 3
- FMNHBTKMRFVGRO-FOHZUACHSA-N Gly-Asn-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)CN FMNHBTKMRFVGRO-FOHZUACHSA-N 0.000 description 3
- GNPVTZJUUBPZKW-WDSKDSINSA-N Gly-Gln-Ser Chemical compound [H]NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O GNPVTZJUUBPZKW-WDSKDSINSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- JGFWUKYIQAEYAH-DCAQKATOSA-N His-Ser-Val Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O JGFWUKYIQAEYAH-DCAQKATOSA-N 0.000 description 3
- NULSANWBUWLTKN-NAKRPEOUSA-N Ile-Arg-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CO)C(=O)O)N NULSANWBUWLTKN-NAKRPEOUSA-N 0.000 description 3
- CDGLBYSAZFIIJO-RCOVLWMOSA-N Ile-Gly-Gly Chemical compound CC[C@H](C)[C@H]([NH3+])C(=O)NCC(=O)NCC([O-])=O CDGLBYSAZFIIJO-RCOVLWMOSA-N 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- LZDNBBYBDGBADK-UHFFFAOYSA-N L-valyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)C(N)C(C)C)C(O)=O)=CNC2=C1 LZDNBBYBDGBADK-UHFFFAOYSA-N 0.000 description 3
- JKSIBWITFMQTOA-XUXIUFHCSA-N Leu-Ile-Val Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(O)=O JKSIBWITFMQTOA-XUXIUFHCSA-N 0.000 description 3
- QNBVTHNJGCOVFA-AVGNSLFASA-N Leu-Leu-Glu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CCC(O)=O QNBVTHNJGCOVFA-AVGNSLFASA-N 0.000 description 3
- BRTVHXHCUSXYRI-CIUDSAMLSA-N Leu-Ser-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O BRTVHXHCUSXYRI-CIUDSAMLSA-N 0.000 description 3
- LFSQWRSVPNKJGP-WDCWCFNPSA-N Leu-Thr-Glu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CCC(O)=O LFSQWRSVPNKJGP-WDCWCFNPSA-N 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- UWKNTTJNVSYXPC-CIUDSAMLSA-N Lys-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN UWKNTTJNVSYXPC-CIUDSAMLSA-N 0.000 description 3
- IRNSXVOWSXSULE-DCAQKATOSA-N Lys-Ala-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN IRNSXVOWSXSULE-DCAQKATOSA-N 0.000 description 3
- QYOXSYXPHUHOJR-GUBZILKMSA-N Lys-Asn-Glu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O QYOXSYXPHUHOJR-GUBZILKMSA-N 0.000 description 3
- WUGMRIBZSVSJNP-UHFFFAOYSA-N N-L-alanyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)C(N)C)C(O)=O)=CNC2=C1 WUGMRIBZSVSJNP-UHFFFAOYSA-N 0.000 description 3
- 108010066427 N-valyltryptophan Proteins 0.000 description 3
- VXCHGLYSIOOZIS-GUBZILKMSA-N Pro-Ala-Arg Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1 VXCHGLYSIOOZIS-GUBZILKMSA-N 0.000 description 3
- VTFXTWDFPTWNJY-RHYQMDGZSA-N Pro-Leu-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O VTFXTWDFPTWNJY-RHYQMDGZSA-N 0.000 description 3
- 238000010240 RT-PCR analysis Methods 0.000 description 3
- VRUFCJZQDACGLH-UVOCVTCTSA-N Thr-Leu-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O VRUFCJZQDACGLH-UVOCVTCTSA-N 0.000 description 3
- VTMGKRABARCZAX-OSUNSFLBSA-N Thr-Pro-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)[C@@H](C)O VTMGKRABARCZAX-OSUNSFLBSA-N 0.000 description 3
- 229920004890 Triton X-100 Polymers 0.000 description 3
- 239000013504 Triton X-100 Substances 0.000 description 3
- KRCPXGSWDOGHAM-XIRDDKMYSA-N Trp-Lys-Asp Chemical compound [H]N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(O)=O KRCPXGSWDOGHAM-XIRDDKMYSA-N 0.000 description 3
- XJPXTYLVMUZGNW-IHRRRGAJSA-N Tyr-Pro-Asp Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C(O)=O XJPXTYLVMUZGNW-IHRRRGAJSA-N 0.000 description 3
- UUYCNAXCCDNULB-QXEWZRGKSA-N Val-Arg-Asn Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC(N)=O)C(O)=O UUYCNAXCCDNULB-QXEWZRGKSA-N 0.000 description 3
- AGKDVLSDNSTLFA-UMNHJUIQSA-N Val-Gln-Pro Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N1CCC[C@@H]1C(=O)O)N AGKDVLSDNSTLFA-UMNHJUIQSA-N 0.000 description 3
- YQMILNREHKTFBS-IHRRRGAJSA-N Val-Phe-Cys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CS)C(=O)O)N YQMILNREHKTFBS-IHRRRGAJSA-N 0.000 description 3
- 239000003443 antiviral agent Substances 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 108010063718 gamma-glutamylaspartic acid Proteins 0.000 description 3
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 3
- 229940072221 immunoglobulins Drugs 0.000 description 3
- 238000010348 incorporation Methods 0.000 description 3
- 230000000977 initiatory effect Effects 0.000 description 3
- 108010034529 leucyl-lysine Proteins 0.000 description 3
- 108010064235 lysylglycine Proteins 0.000 description 3
- 238000010369 molecular cloning Methods 0.000 description 3
- 238000007857 nested PCR Methods 0.000 description 3
- 239000002777 nucleoside Substances 0.000 description 3
- 229920000642 polymer Polymers 0.000 description 3
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 3
- 108010070643 prolylglutamic acid Proteins 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 108091008146 restriction endonucleases Proteins 0.000 description 3
- 238000002741 site-directed mutagenesis Methods 0.000 description 3
- 239000007858 starting material Substances 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 230000002103 transcriptional effect Effects 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- 239000001226 triphosphate Substances 0.000 description 3
- 235000011178 triphosphate Nutrition 0.000 description 3
- 230000029812 viral genome replication Effects 0.000 description 3
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 2
- KVWLTGNCJYDJET-LSJOCFKGSA-N Ala-Arg-His Chemical compound C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N KVWLTGNCJYDJET-LSJOCFKGSA-N 0.000 description 2
- FSBCNCKIQZZASN-GUBZILKMSA-N Ala-Arg-Met Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(O)=O FSBCNCKIQZZASN-GUBZILKMSA-N 0.000 description 2
- WJRXVTCKASUIFF-FXQIFTODSA-N Ala-Cys-Arg Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O WJRXVTCKASUIFF-FXQIFTODSA-N 0.000 description 2
- QUIGLPSHIFPEOV-CIUDSAMLSA-N Ala-Lys-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O QUIGLPSHIFPEOV-CIUDSAMLSA-N 0.000 description 2
- YCRAFFCYWOUEOF-DLOVCJGASA-N Ala-Phe-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)C)CC1=CC=CC=C1 YCRAFFCYWOUEOF-DLOVCJGASA-N 0.000 description 2
- FEGOCLZUJUFCHP-CIUDSAMLSA-N Ala-Pro-Gln Chemical compound [H]N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(O)=O FEGOCLZUJUFCHP-CIUDSAMLSA-N 0.000 description 2
- DCVYRWFAMZFSDA-ZLUOBGJFSA-N Ala-Ser-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O DCVYRWFAMZFSDA-ZLUOBGJFSA-N 0.000 description 2
- AUFACLFHBAGZEN-ZLUOBGJFSA-N Ala-Ser-Cys Chemical compound N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O AUFACLFHBAGZEN-ZLUOBGJFSA-N 0.000 description 2
- HJAICMSAKODKRF-GUBZILKMSA-N Arg-Cys-Arg Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O HJAICMSAKODKRF-GUBZILKMSA-N 0.000 description 2
- FEZJJKXNPSEYEV-CIUDSAMLSA-N Arg-Gln-Ala Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(O)=O FEZJJKXNPSEYEV-CIUDSAMLSA-N 0.000 description 2
- WMEVEPXNCMKNGH-IHRRRGAJSA-N Arg-Leu-His Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N WMEVEPXNCMKNGH-IHRRRGAJSA-N 0.000 description 2
- JOTRDIXZHNQYGP-DCAQKATOSA-N Arg-Ser-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCN=C(N)N)N JOTRDIXZHNQYGP-DCAQKATOSA-N 0.000 description 2
- JEPNYDRDYNSFIU-QXEWZRGKSA-N Asn-Arg-Val Chemical compound CC(C)[C@H](NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H](N)CC(N)=O)C(O)=O JEPNYDRDYNSFIU-QXEWZRGKSA-N 0.000 description 2
- XHTUGJCAEYOZOR-UBHSHLNASA-N Asn-Ser-Trp Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O XHTUGJCAEYOZOR-UBHSHLNASA-N 0.000 description 2
- JBDLMLZNDRLDIX-HJGDQZAQSA-N Asn-Thr-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O JBDLMLZNDRLDIX-HJGDQZAQSA-N 0.000 description 2
- GBSUGIXJAAKZOW-GMOBBJLQSA-N Asp-Ile-Arg Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O GBSUGIXJAAKZOW-GMOBBJLQSA-N 0.000 description 2
- JNNVNVRBYUJYGS-CIUDSAMLSA-N Asp-Leu-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(O)=O JNNVNVRBYUJYGS-CIUDSAMLSA-N 0.000 description 2
- MJJIHRWNWSQTOI-VEVYYDQMSA-N Asp-Thr-Arg Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O MJJIHRWNWSQTOI-VEVYYDQMSA-N 0.000 description 2
- GWWSUMLEWKQHLR-NUMRIWBASA-N Asp-Thr-Glu Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@H](CC(=O)O)N)O GWWSUMLEWKQHLR-NUMRIWBASA-N 0.000 description 2
- RSMZEHCMIOKNMW-GSSVUCPTSA-N Asp-Thr-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O RSMZEHCMIOKNMW-GSSVUCPTSA-N 0.000 description 2
- 102000053642 Catalytic RNA Human genes 0.000 description 2
- 108090000994 Catalytic RNA Proteins 0.000 description 2
- 108020004635 Complementary DNA Proteins 0.000 description 2
- IDFVDSBJNMPBSX-SRVKXCTJSA-N Cys-Lys-Leu Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O IDFVDSBJNMPBSX-SRVKXCTJSA-N 0.000 description 2
- LHJDLVVQRJIURS-SRVKXCTJSA-N Cys-Phe-Asp Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CS)N LHJDLVVQRJIURS-SRVKXCTJSA-N 0.000 description 2
- 206010016654 Fibrosis Diseases 0.000 description 2
- JSYULGSPLTZDHM-NRPADANISA-N Gln-Ala-Val Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(O)=O JSYULGSPLTZDHM-NRPADANISA-N 0.000 description 2
- LJEPDHWNQXPXMM-NHCYSSNCSA-N Gln-Arg-Val Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(O)=O LJEPDHWNQXPXMM-NHCYSSNCSA-N 0.000 description 2
- KYFSMWLWHYZRNW-ACZMJKKPSA-N Gln-Asp-Cys Chemical compound C(CC(=O)N)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CS)C(=O)O)N KYFSMWLWHYZRNW-ACZMJKKPSA-N 0.000 description 2
- GNDJOCGXGLNCKY-ACZMJKKPSA-N Gln-Cys-Cys Chemical compound N[C@@H](CCC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(O)=O GNDJOCGXGLNCKY-ACZMJKKPSA-N 0.000 description 2
- CGOHAEBMDSEKFB-FXQIFTODSA-N Glu-Glu-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O CGOHAEBMDSEKFB-FXQIFTODSA-N 0.000 description 2
- OCJRHJZKGGSPRW-IUCAKERBSA-N Glu-Lys-Gly Chemical compound NCCCC[C@@H](C(=O)NCC(O)=O)NC(=O)[C@@H](N)CCC(O)=O OCJRHJZKGGSPRW-IUCAKERBSA-N 0.000 description 2
- QNJNPKSWAHPYGI-JYJNAYRXSA-N Glu-Phe-Leu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(O)=O)CC1=CC=CC=C1 QNJNPKSWAHPYGI-JYJNAYRXSA-N 0.000 description 2
- JBRBACJPBZNFMF-YUMQZZPRSA-N Gly-Ala-Lys Chemical compound NCC(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCCCN JBRBACJPBZNFMF-YUMQZZPRSA-N 0.000 description 2
- STVHDEHTKFXBJQ-LAEOZQHASA-N Gly-Glu-Ile Chemical compound [H]NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O STVHDEHTKFXBJQ-LAEOZQHASA-N 0.000 description 2
- NNCSJUBVFBDDLC-YUMQZZPRSA-N Gly-Leu-Ser Chemical compound NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O NNCSJUBVFBDDLC-YUMQZZPRSA-N 0.000 description 2
- KAXZXLSXFWSNNZ-XVYDVKMFSA-N His-Ser-Ala Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O KAXZXLSXFWSNNZ-XVYDVKMFSA-N 0.000 description 2
- MTONDYJJCIBZTK-PEDHHIEDSA-N Ile-Ile-Met Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)O)N MTONDYJJCIBZTK-PEDHHIEDSA-N 0.000 description 2
- FCWFBHMAJZGWRY-XUXIUFHCSA-N Ile-Leu-Met Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)O)N FCWFBHMAJZGWRY-XUXIUFHCSA-N 0.000 description 2
- MASWXTFJVNRZPT-NAKRPEOUSA-N Ile-Met-Ala Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)O)N MASWXTFJVNRZPT-NAKRPEOUSA-N 0.000 description 2
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- YOZCKMXHBYKOMQ-IHRRRGAJSA-N Leu-Arg-Lys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCCN)C(=O)O)N YOZCKMXHBYKOMQ-IHRRRGAJSA-N 0.000 description 2
- FMEICTQWUKNAGC-YUMQZZPRSA-N Leu-Gly-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O FMEICTQWUKNAGC-YUMQZZPRSA-N 0.000 description 2
- OYQUOLRTJHWVSQ-SRVKXCTJSA-N Leu-His-Ser Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(O)=O OYQUOLRTJHWVSQ-SRVKXCTJSA-N 0.000 description 2
- ZRHDPZAAWLXXIR-SRVKXCTJSA-N Leu-Lys-Ala Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O ZRHDPZAAWLXXIR-SRVKXCTJSA-N 0.000 description 2
- SVBJIZVVYJYGLA-DCAQKATOSA-N Leu-Ser-Val Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O SVBJIZVVYJYGLA-DCAQKATOSA-N 0.000 description 2
- LINKCQUOMUDLKN-KATARQTJSA-N Leu-Thr-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC(C)C)N)O LINKCQUOMUDLKN-KATARQTJSA-N 0.000 description 2
- AHFOKDZWPPGJAZ-SRVKXCTJSA-N Lys-Lys-Cys Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)O)N AHFOKDZWPPGJAZ-SRVKXCTJSA-N 0.000 description 2
- LRALLISKBZNSKN-BQBZGAKWSA-N Met-Gly-Ser Chemical compound CSCC[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O LRALLISKBZNSKN-BQBZGAKWSA-N 0.000 description 2
- PESQCPHRXOFIPX-UHFFFAOYSA-N N-L-methionyl-L-tyrosine Natural products CSCCC(N)C(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 PESQCPHRXOFIPX-UHFFFAOYSA-N 0.000 description 2
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 2
- 108091093037 Peptide nucleic acid Proteins 0.000 description 2
- NOFBJKKOPKJDCO-KKXDTOCCSA-N Phe-Ala-Tyr Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O NOFBJKKOPKJDCO-KKXDTOCCSA-N 0.000 description 2
- ABQFNJAFONNUTH-FHWLQOOXSA-N Phe-Gln-Tyr Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)O)N ABQFNJAFONNUTH-FHWLQOOXSA-N 0.000 description 2
- WFHRXJOZEXUKLV-IRXDYDNUSA-N Phe-Gly-Tyr Chemical compound C([C@H](N)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=CC=C1 WFHRXJOZEXUKLV-IRXDYDNUSA-N 0.000 description 2
- JXQVYPWVGUOIDV-MXAVVETBSA-N Phe-Ser-Ile Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O JXQVYPWVGUOIDV-MXAVVETBSA-N 0.000 description 2
- LHALYDBUDCWMDY-CIUDSAMLSA-N Pro-Glu-Ala Chemical compound C[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CCCN1)C(O)=O LHALYDBUDCWMDY-CIUDSAMLSA-N 0.000 description 2
- WIPAMEKBSHNFQE-IUCAKERBSA-N Pro-Met-Gly Chemical compound CSCC[C@@H](C(=O)NCC(=O)O)NC(=O)[C@@H]1CCCN1 WIPAMEKBSHNFQE-IUCAKERBSA-N 0.000 description 2
- CGSOWZUPLOKYOR-AVGNSLFASA-N Pro-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 CGSOWZUPLOKYOR-AVGNSLFASA-N 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 108091081021 Sense strand Proteins 0.000 description 2
- ZUGXSSFMTXKHJS-ZLUOBGJFSA-N Ser-Ala-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(O)=O ZUGXSSFMTXKHJS-ZLUOBGJFSA-N 0.000 description 2
- MQQBBLVOUUJKLH-HJPIBITLSA-N Ser-Ile-Tyr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O MQQBBLVOUUJKLH-HJPIBITLSA-N 0.000 description 2
- RHAPJNVNWDBFQI-BQBZGAKWSA-N Ser-Pro-Gly Chemical compound OC[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O RHAPJNVNWDBFQI-BQBZGAKWSA-N 0.000 description 2
- FHXGMDRKJHKLKW-QWRGUYRKSA-N Ser-Tyr-Gly Chemical compound OC[C@H](N)C(=O)N[C@H](C(=O)NCC(O)=O)CC1=CC=C(O)C=C1 FHXGMDRKJHKLKW-QWRGUYRKSA-N 0.000 description 2
- 108091081024 Start codon Proteins 0.000 description 2
- VEWZSFGRQDUAJM-YJRXYDGGSA-N Thr-Cys-Tyr Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)N)O VEWZSFGRQDUAJM-YJRXYDGGSA-N 0.000 description 2
- CQNFRKAKGDSJFR-NUMRIWBASA-N Thr-Glu-Asn Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)N)C(=O)O)N)O CQNFRKAKGDSJFR-NUMRIWBASA-N 0.000 description 2
- UDNVOQMPQBEITB-MEYUZBJRSA-N Thr-His-Phe Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O UDNVOQMPQBEITB-MEYUZBJRSA-N 0.000 description 2
- NCXVJIQMWSGRHY-KXNHARMFSA-N Thr-Leu-Pro Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@@H]1C(=O)O)N)O NCXVJIQMWSGRHY-KXNHARMFSA-N 0.000 description 2
- ISLDRLHVPXABBC-IEGACIPQSA-N Thr-Leu-Trp Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O ISLDRLHVPXABBC-IEGACIPQSA-N 0.000 description 2
- XNTVWRJTUIOGQO-RHYQMDGZSA-N Thr-Met-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(O)=O XNTVWRJTUIOGQO-RHYQMDGZSA-N 0.000 description 2
- MROIJTGJGIDEEJ-RCWTZXSCSA-N Thr-Pro-Pro Chemical compound C[C@@H](O)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 MROIJTGJGIDEEJ-RCWTZXSCSA-N 0.000 description 2
- YGCDFAJJCRVQKU-RCWTZXSCSA-N Thr-Pro-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)[C@@H](C)O YGCDFAJJCRVQKU-RCWTZXSCSA-N 0.000 description 2
- SNJAPSVIPKUMCK-NWLDYVSISA-N Trp-Glu-Thr Chemical compound [H]N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O SNJAPSVIPKUMCK-NWLDYVSISA-N 0.000 description 2
- ULHASJWZGUEUNN-XIRDDKMYSA-N Trp-Lys-Ser Chemical compound [H]N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O ULHASJWZGUEUNN-XIRDDKMYSA-N 0.000 description 2
- OOEUVMFKKZYSRX-LEWSCRJBSA-N Tyr-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC2=CC=C(C=C2)O)N OOEUVMFKKZYSRX-LEWSCRJBSA-N 0.000 description 2
- PRONOHBTMLNXCZ-BZSNNMDCSA-N Tyr-Leu-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 PRONOHBTMLNXCZ-BZSNNMDCSA-N 0.000 description 2
- QPZMOUMNTGTEFR-ZKWXMUAHSA-N Val-Asn-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](C(C)C)N QPZMOUMNTGTEFR-ZKWXMUAHSA-N 0.000 description 2
- FPCIBLUVDNXPJO-XPUUQOCRSA-N Val-Cys-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CS)C(=O)NCC(O)=O FPCIBLUVDNXPJO-XPUUQOCRSA-N 0.000 description 2
- SYSWVVCYSXBVJG-RHYQMDGZSA-N Val-Leu-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C(C)C)N)O SYSWVVCYSXBVJG-RHYQMDGZSA-N 0.000 description 2
- LLJLBRRXKZTTRD-GUBZILKMSA-N Val-Val-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)O)N LLJLBRRXKZTTRD-GUBZILKMSA-N 0.000 description 2
- 108010087924 alanylproline Proteins 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 238000000137 annealing Methods 0.000 description 2
- 230000000840 anti-viral effect Effects 0.000 description 2
- 210000000612 antigen-presenting cell Anatomy 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 230000001684 chronic effect Effects 0.000 description 2
- 230000007882 cirrhosis Effects 0.000 description 2
- 208000019425 cirrhosis of liver Diseases 0.000 description 2
- 108091036078 conserved sequence Proteins 0.000 description 2
- 108010060199 cysteinylproline Proteins 0.000 description 2
- 108010069495 cysteinyltyrosine Proteins 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 238000004925 denaturation Methods 0.000 description 2
- 230000036425 denaturation Effects 0.000 description 2
- 210000004443 dendritic cell Anatomy 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000007876 drug discovery Methods 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 108010010147 glycylglutamine Proteins 0.000 description 2
- 108010081551 glycylphenylalanine Proteins 0.000 description 2
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 2
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 2
- 238000013537 high throughput screening Methods 0.000 description 2
- 108010036413 histidylglycine Proteins 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 238000000099 in vitro assay Methods 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 238000007689 inspection Methods 0.000 description 2
- 108010003700 lysyl aspartic acid Proteins 0.000 description 2
- 108010038320 lysylphenylalanine Proteins 0.000 description 2
- 229910001629 magnesium chloride Inorganic materials 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 239000002751 oligonucleotide probe Substances 0.000 description 2
- 108010084572 phenylalanyl-valine Proteins 0.000 description 2
- 238000003322 phosphorimaging Methods 0.000 description 2
- 230000004481 post-translational protein modification Effects 0.000 description 2
- 230000000644 propagated effect Effects 0.000 description 2
- 238000000164 protein isolation Methods 0.000 description 2
- 238000001742 protein purification Methods 0.000 description 2
- 239000011541 reaction mixture Substances 0.000 description 2
- 230000003362 replicative effect Effects 0.000 description 2
- 108091092562 ribozyme Proteins 0.000 description 2
- 102200061165 rs1441030187 Human genes 0.000 description 2
- 238000002864 sequence alignment Methods 0.000 description 2
- 150000003384 small molecules Chemical class 0.000 description 2
- FQENQNTWSFEDLI-UHFFFAOYSA-J sodium diphosphate Chemical compound [Na+].[Na+].[Na+].[Na+].[O-]P([O-])(=O)OP([O-])([O-])=O FQENQNTWSFEDLI-UHFFFAOYSA-J 0.000 description 2
- 229940048086 sodium pyrophosphate Drugs 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 238000004611 spectroscopical analysis Methods 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 235000019818 tetrasodium diphosphate Nutrition 0.000 description 2
- 239000001577 tetrasodium phosphonato phosphate Substances 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 108010080629 tryptophan-leucine Proteins 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- BFSVOASYOCHEOV-UHFFFAOYSA-N 2-diethylaminoethanol Chemical compound CCN(CC)CCO BFSVOASYOCHEOV-UHFFFAOYSA-N 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- YYSWCHMLFJLLBJ-ZLUOBGJFSA-N Ala-Ala-Ser Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YYSWCHMLFJLLBJ-ZLUOBGJFSA-N 0.000 description 1
- UCIYCBSJBQGDGM-LPEHRKFASA-N Ala-Arg-Pro Chemical compound C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1CCC[C@@H]1C(=O)O)N UCIYCBSJBQGDGM-LPEHRKFASA-N 0.000 description 1
- OBVSBEYOMDWLRJ-BFHQHQDPSA-N Ala-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@H](C)N OBVSBEYOMDWLRJ-BFHQHQDPSA-N 0.000 description 1
- FDAZDMAFZYTHGS-XVYDVKMFSA-N Ala-His-Asp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(O)=O FDAZDMAFZYTHGS-XVYDVKMFSA-N 0.000 description 1
- LBFXVAXPDOBRKU-LKTVYLICSA-N Ala-His-Tyr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O LBFXVAXPDOBRKU-LKTVYLICSA-N 0.000 description 1
- SDZRIBWEVVRDQI-CIUDSAMLSA-N Ala-Lys-Asp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(O)=O SDZRIBWEVVRDQI-CIUDSAMLSA-N 0.000 description 1
- QKHWNPQNOHEFST-VZFHVOOUSA-N Ala-Thr-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](C)N)O QKHWNPQNOHEFST-VZFHVOOUSA-N 0.000 description 1
- 108700028369 Alleles Proteins 0.000 description 1
- OOBVTWHLKYJFJH-FXQIFTODSA-N Arg-Ala-Ala Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(O)=O OOBVTWHLKYJFJH-FXQIFTODSA-N 0.000 description 1
- KMFPQTITXUKJOV-DCAQKATOSA-N Arg-Ser-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O KMFPQTITXUKJOV-DCAQKATOSA-N 0.000 description 1
- UZSQXCMNUPKLCC-FJXKBIBVSA-N Arg-Thr-Gly Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O UZSQXCMNUPKLCC-FJXKBIBVSA-N 0.000 description 1
- DDBMKOCQWNFDBH-RHYQMDGZSA-N Arg-Thr-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N)O DDBMKOCQWNFDBH-RHYQMDGZSA-N 0.000 description 1
- LOVIQNMIPQVIGT-BVSLBCMMSA-N Arg-Trp-Phe Chemical compound C([C@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CCCN=C(N)N)N)C(O)=O)C1=CC=CC=C1 LOVIQNMIPQVIGT-BVSLBCMMSA-N 0.000 description 1
- KRXIWXCXOARFNT-ZLUOBGJFSA-N Asp-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O KRXIWXCXOARFNT-ZLUOBGJFSA-N 0.000 description 1
- UWOPETAWXDZUJR-ACZMJKKPSA-N Asp-Cys-Glu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(O)=O UWOPETAWXDZUJR-ACZMJKKPSA-N 0.000 description 1
- UMHUHHJMEXNSIV-CIUDSAMLSA-N Asp-Leu-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC(O)=O UMHUHHJMEXNSIV-CIUDSAMLSA-N 0.000 description 1
- UXRVDHVARNBOIO-QSFUFRPTSA-N Asp-Val-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(=O)O)N UXRVDHVARNBOIO-QSFUFRPTSA-N 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 206010008909 Chronic Hepatitis Diseases 0.000 description 1
- 208000006154 Chronic hepatitis C Diseases 0.000 description 1
- ZEXHDOQQYZKOIB-ACZMJKKPSA-N Cys-Glu-Ser Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O ZEXHDOQQYZKOIB-ACZMJKKPSA-N 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 229920002271 DEAE-Sepharose Polymers 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 1
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 1
- 102100038132 Endogenous retrovirus group K member 6 Pro protein Human genes 0.000 description 1
- 101710091045 Envelope protein Proteins 0.000 description 1
- 241000710781 Flaviviridae Species 0.000 description 1
- 241000710831 Flavivirus Species 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- CGVWDTRDPLOMHZ-FXQIFTODSA-N Gln-Glu-Asp Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O CGVWDTRDPLOMHZ-FXQIFTODSA-N 0.000 description 1
- QKCZZAZNMMVICF-DCAQKATOSA-N Gln-Leu-Glu Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O QKCZZAZNMMVICF-DCAQKATOSA-N 0.000 description 1
- MFHVAWMMKZBSRQ-ACZMJKKPSA-N Gln-Ser-Cys Chemical compound C(CC(=O)N)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O)N MFHVAWMMKZBSRQ-ACZMJKKPSA-N 0.000 description 1
- UTKICHUQEQBDGC-ACZMJKKPSA-N Glu-Ala-Cys Chemical compound C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCC(=O)O)N UTKICHUQEQBDGC-ACZMJKKPSA-N 0.000 description 1
- UMZHHILWZBFPGL-LOKLDPHHSA-N Glu-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCC(=O)O)N)O UMZHHILWZBFPGL-LOKLDPHHSA-N 0.000 description 1
- JXYMPBCYRKWJEE-BQBZGAKWSA-N Gly-Arg-Ala Chemical compound [H]NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(O)=O JXYMPBCYRKWJEE-BQBZGAKWSA-N 0.000 description 1
- XBWMTPAIUQIWKA-BYULHYEWSA-N Gly-Asp-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)CN XBWMTPAIUQIWKA-BYULHYEWSA-N 0.000 description 1
- BUEFQXUHTUZXHR-LURJTMIESA-N Gly-Gly-Pro zwitterion Chemical compound NCC(=O)NCC(=O)N1CCC[C@H]1C(O)=O BUEFQXUHTUZXHR-LURJTMIESA-N 0.000 description 1
- CVFOYJJOZYYEPE-KBPBESRZSA-N Gly-Lys-Tyr Chemical compound [H]NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O CVFOYJJOZYYEPE-KBPBESRZSA-N 0.000 description 1
- UMRIXLHPZZIOML-OALUTQOASA-N Gly-Trp-Phe Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)O)NC(=O)[C@H](CC2=CNC3=CC=CC=C32)NC(=O)CN UMRIXLHPZZIOML-OALUTQOASA-N 0.000 description 1
- GWNIGUKSRJBIHX-STQMWFEESA-N Gly-Tyr-Arg Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)NC(=O)CN)O GWNIGUKSRJBIHX-STQMWFEESA-N 0.000 description 1
- HQSKKSLNLSTONK-JTQLQIEISA-N Gly-Tyr-Gly Chemical compound OC(=O)CNC(=O)[C@@H](NC(=O)CN)CC1=CC=C(O)C=C1 HQSKKSLNLSTONK-JTQLQIEISA-N 0.000 description 1
- GJHWILMUOANXTG-WPRPVWTQSA-N Gly-Val-Arg Chemical compound [H]NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O GJHWILMUOANXTG-WPRPVWTQSA-N 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 241000711557 Hepacivirus Species 0.000 description 1
- 206010019663 Hepatic failure Diseases 0.000 description 1
- PDSUIXMZYNURGI-AVGNSLFASA-N His-Arg-Arg Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H](N)CC1=CN=CN1 PDSUIXMZYNURGI-AVGNSLFASA-N 0.000 description 1
- GIRSNERMXCMDBO-GARJFASQSA-N His-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CC2=CN=CN2)N)C(=O)O GIRSNERMXCMDBO-GARJFASQSA-N 0.000 description 1
- GYAFMRQGWHXMII-IUKAMOBKSA-N Ile-Asp-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)O)N GYAFMRQGWHXMII-IUKAMOBKSA-N 0.000 description 1
- LDRALPZEVHVXEK-KBIXCLLPSA-N Ile-Cys-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N LDRALPZEVHVXEK-KBIXCLLPSA-N 0.000 description 1
- XLCZWMJPVGRWHJ-KQXIARHKSA-N Ile-Glu-Pro Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N1CCC[C@@H]1C(=O)O)N XLCZWMJPVGRWHJ-KQXIARHKSA-N 0.000 description 1
- RIVKTKFVWXRNSJ-GRLWGSQLSA-N Ile-Ile-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N RIVKTKFVWXRNSJ-GRLWGSQLSA-N 0.000 description 1
- PRTZQMBYUZFSFA-XEGUGMAKSA-N Ile-Tyr-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)NCC(=O)O)N PRTZQMBYUZFSFA-XEGUGMAKSA-N 0.000 description 1
- DLEBSGAVWRPTIX-PEDHHIEDSA-N Ile-Val-Ile Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)[C@@H](C)CC DLEBSGAVWRPTIX-PEDHHIEDSA-N 0.000 description 1
- 108020005350 Initiator Codon Proteins 0.000 description 1
- 108010065920 Insulin Lispro Proteins 0.000 description 1
- SITWEMZOJNKJCH-UHFFFAOYSA-N L-alanine-L-arginine Natural products CC(N)C(=O)NC(C(O)=O)CCCNC(N)=N SITWEMZOJNKJCH-UHFFFAOYSA-N 0.000 description 1
- 150000008575 L-amino acids Chemical group 0.000 description 1
- BGZCJDGBBUUBHA-KKUMJFAQSA-N Leu-Lys-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O BGZCJDGBBUUBHA-KKUMJFAQSA-N 0.000 description 1
- BIZNDKMFQHDOIE-KKUMJFAQSA-N Leu-Phe-Asn Chemical compound CC(C)C[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(O)=O)CC1=CC=CC=C1 BIZNDKMFQHDOIE-KKUMJFAQSA-N 0.000 description 1
- XWEVVRRSIOBJOO-SRVKXCTJSA-N Leu-Pro-Gln Chemical compound [H]N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(O)=O XWEVVRRSIOBJOO-SRVKXCTJSA-N 0.000 description 1
- IDGZVZJLYFTXSL-DCAQKATOSA-N Leu-Ser-Arg Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCN=C(N)N IDGZVZJLYFTXSL-DCAQKATOSA-N 0.000 description 1
- AEDWWMMHUGYIFD-HJGDQZAQSA-N Leu-Thr-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(O)=O AEDWWMMHUGYIFD-HJGDQZAQSA-N 0.000 description 1
- GZRABTMNWJXFMH-UVOCVTCTSA-N Leu-Thr-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O GZRABTMNWJXFMH-UVOCVTCTSA-N 0.000 description 1
- WUHBLPVELFTPQK-KKUMJFAQSA-N Leu-Tyr-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(O)=O WUHBLPVELFTPQK-KKUMJFAQSA-N 0.000 description 1
- ISSAURVGLGAPDK-KKUMJFAQSA-N Leu-Tyr-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(O)=O)C(O)=O ISSAURVGLGAPDK-KKUMJFAQSA-N 0.000 description 1
- ARNIBBOXIAWUOP-MGHWNKPDSA-N Leu-Tyr-Ile Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O ARNIBBOXIAWUOP-MGHWNKPDSA-N 0.000 description 1
- 102000008072 Lymphokines Human genes 0.000 description 1
- 108010074338 Lymphokines Proteins 0.000 description 1
- KCXUCYYZNZFGLL-SRVKXCTJSA-N Lys-Ala-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(O)=O KCXUCYYZNZFGLL-SRVKXCTJSA-N 0.000 description 1
- NTSPQIONFJUMJV-AVGNSLFASA-N Lys-Arg-Val Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(O)=O NTSPQIONFJUMJV-AVGNSLFASA-N 0.000 description 1
- AIRZWUMAHCDDHR-KKUMJFAQSA-N Lys-Leu-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O AIRZWUMAHCDDHR-KKUMJFAQSA-N 0.000 description 1
- OIQSIMFSVLLWBX-VOAKCMCISA-N Lys-Leu-Thr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O OIQSIMFSVLLWBX-VOAKCMCISA-N 0.000 description 1
- URGPVYGVWLIRGT-DCAQKATOSA-N Lys-Met-Ala Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(O)=O URGPVYGVWLIRGT-DCAQKATOSA-N 0.000 description 1
- SGWDZVVIRDOXSG-BPUTZDHNSA-N Met-Trp-Cys Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@@H](N)CCSC)C(=O)N[C@@H](CS)C(O)=O)=CNC2=C1 SGWDZVVIRDOXSG-BPUTZDHNSA-N 0.000 description 1
- WYBVBIHNJWOLCJ-UHFFFAOYSA-N N-L-arginyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCCN=C(N)N WYBVBIHNJWOLCJ-UHFFFAOYSA-N 0.000 description 1
- 108010079364 N-glycylalanine Proteins 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 101710144111 Non-structural protein 3 Proteins 0.000 description 1
- 108010075285 Nucleoside-Triphosphatase Proteins 0.000 description 1
- 102000008021 Nucleoside-Triphosphatase Human genes 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 241000282579 Pan Species 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 208000037581 Persistent Infection Diseases 0.000 description 1
- 241000710778 Pestivirus Species 0.000 description 1
- 102000045595 Phosphoprotein Phosphatases Human genes 0.000 description 1
- 108700019535 Phosphoprotein Phosphatases Proteins 0.000 description 1
- DZZCICYRSZASNF-FXQIFTODSA-N Pro-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1 DZZCICYRSZASNF-FXQIFTODSA-N 0.000 description 1
- VPVHXWGPALPDGP-GUBZILKMSA-N Pro-Asn-Arg Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O VPVHXWGPALPDGP-GUBZILKMSA-N 0.000 description 1
- CKXMGSJPDQXBPG-JYJNAYRXSA-N Pro-Cys-Trp Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC2=CNC3=CC=CC=C32)C(=O)O CKXMGSJPDQXBPG-JYJNAYRXSA-N 0.000 description 1
- WGAQWMRJUFQXMF-ZPFDUUQYSA-N Pro-Gln-Ile Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O WGAQWMRJUFQXMF-ZPFDUUQYSA-N 0.000 description 1
- FMLRRBDLBJLJIK-DCAQKATOSA-N Pro-Leu-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1 FMLRRBDLBJLJIK-DCAQKATOSA-N 0.000 description 1
- CLJLVCYFABNTHP-DCAQKATOSA-N Pro-Leu-Asp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O CLJLVCYFABNTHP-DCAQKATOSA-N 0.000 description 1
- DWGFLKQSGRUQTI-IHRRRGAJSA-N Pro-Lys-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1 DWGFLKQSGRUQTI-IHRRRGAJSA-N 0.000 description 1
- SVXXJYJCRNKDDE-AVGNSLFASA-N Pro-Pro-His Chemical compound C([C@@H](C(=O)O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H]1NCCC1)C1=CN=CN1 SVXXJYJCRNKDDE-AVGNSLFASA-N 0.000 description 1
- GZNYIXWOIUFLGO-ZJDVBMNYSA-N Pro-Thr-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O GZNYIXWOIUFLGO-ZJDVBMNYSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- FIXILCYTSAUERA-FXQIFTODSA-N Ser-Ala-Arg Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O FIXILCYTSAUERA-FXQIFTODSA-N 0.000 description 1
- BTKUIVBNGBFTTP-WHFBIAKZSA-N Ser-Ala-Gly Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)NCC(O)=O BTKUIVBNGBFTTP-WHFBIAKZSA-N 0.000 description 1
- XWCYBVBLJRWOFR-WDSKDSINSA-N Ser-Gln-Gly Chemical compound OC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O XWCYBVBLJRWOFR-WDSKDSINSA-N 0.000 description 1
- OJPHFSOMBZKQKQ-GUBZILKMSA-N Ser-Gln-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CO OJPHFSOMBZKQKQ-GUBZILKMSA-N 0.000 description 1
- XXXAXOWMBOKTRN-XPUUQOCRSA-N Ser-Gly-Val Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O XXXAXOWMBOKTRN-XPUUQOCRSA-N 0.000 description 1
- DJACUBDEDBZKLQ-KBIXCLLPSA-N Ser-Ile-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(O)=O DJACUBDEDBZKLQ-KBIXCLLPSA-N 0.000 description 1
- QYSFWUIXDFJUDW-DCAQKATOSA-N Ser-Leu-Arg Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O QYSFWUIXDFJUDW-DCAQKATOSA-N 0.000 description 1
- OWCVUSJMEBGMOK-YUMQZZPRSA-N Ser-Lys-Gly Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)NCC(O)=O OWCVUSJMEBGMOK-YUMQZZPRSA-N 0.000 description 1
- WGDYNRCOQRERLZ-KKUMJFAQSA-N Ser-Lys-Phe Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)N WGDYNRCOQRERLZ-KKUMJFAQSA-N 0.000 description 1
- VIIJCAQMJBHSJH-FXQIFTODSA-N Ser-Met-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CO)C(O)=O VIIJCAQMJBHSJH-FXQIFTODSA-N 0.000 description 1
- WLJPJRGQRNCIQS-ZLUOBGJFSA-N Ser-Ser-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O WLJPJRGQRNCIQS-ZLUOBGJFSA-N 0.000 description 1
- BEBVVQPDSHHWQL-NRPADANISA-N Ser-Val-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O BEBVVQPDSHHWQL-NRPADANISA-N 0.000 description 1
- 102000012479 Serine Proteases Human genes 0.000 description 1
- 108010022999 Serine Proteases Proteins 0.000 description 1
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- GLQFKOVWXPPFTP-VEVYYDQMSA-N Thr-Arg-Asp Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(O)=O GLQFKOVWXPPFTP-VEVYYDQMSA-N 0.000 description 1
- VUVCRYXYUUPGSB-GLLZPBPUSA-N Thr-Gln-Glu Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N)O VUVCRYXYUUPGSB-GLLZPBPUSA-N 0.000 description 1
- FHDLKMFZKRUQCE-HJGDQZAQSA-N Thr-Glu-Arg Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O FHDLKMFZKRUQCE-HJGDQZAQSA-N 0.000 description 1
- SLUWOCTZVGMURC-BFHQHQDPSA-N Thr-Gly-Ala Chemical compound C[C@@H](O)[C@H](N)C(=O)NCC(=O)N[C@@H](C)C(O)=O SLUWOCTZVGMURC-BFHQHQDPSA-N 0.000 description 1
- LCCSEJSPBWKBNT-OSUNSFLBSA-N Thr-Ile-Met Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCSC)C(=O)O)NC(=O)[C@H]([C@@H](C)O)N LCCSEJSPBWKBNT-OSUNSFLBSA-N 0.000 description 1
- 102000003929 Transaminases Human genes 0.000 description 1
- 108090000340 Transaminases Proteins 0.000 description 1
- 241000209140 Triticum Species 0.000 description 1
- 235000021307 Triticum Nutrition 0.000 description 1
- BIJDDZBDSJLWJY-PJODQICGSA-N Trp-Ala-Val Chemical compound [H]N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(O)=O BIJDDZBDSJLWJY-PJODQICGSA-N 0.000 description 1
- RCLOWEZASFJFEX-KKUMJFAQSA-N Tyr-Asp-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 RCLOWEZASFJFEX-KKUMJFAQSA-N 0.000 description 1
- JHORGUYURUBVOM-KKUMJFAQSA-N Tyr-His-Ser Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(O)=O JHORGUYURUBVOM-KKUMJFAQSA-N 0.000 description 1
- KHCSOLAHNLOXJR-BZSNNMDCSA-N Tyr-Leu-Leu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O KHCSOLAHNLOXJR-BZSNNMDCSA-N 0.000 description 1
- ZPFLBLFITJCBTP-QWRGUYRKSA-N Tyr-Ser-Gly Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)NCC(O)=O ZPFLBLFITJCBTP-QWRGUYRKSA-N 0.000 description 1
- AKKYBQGHUAWPJR-MNSWYVGCSA-N Tyr-Thr-Trp Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@H](CC3=CC=C(C=C3)O)N)O AKKYBQGHUAWPJR-MNSWYVGCSA-N 0.000 description 1
- HZDQUVQEVVYDDA-ACRUOGEOSA-N Tyr-Tyr-Leu Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(O)=O)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HZDQUVQEVVYDDA-ACRUOGEOSA-N 0.000 description 1
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 1
- ASQFIHTXXMFENG-XPUUQOCRSA-N Val-Ala-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(O)=O ASQFIHTXXMFENG-XPUUQOCRSA-N 0.000 description 1
- KOPBYUSPXBQIHD-NRPADANISA-N Val-Cys-Glu Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N KOPBYUSPXBQIHD-NRPADANISA-N 0.000 description 1
- PMDOQZFYGWZSTK-LSJOCFKGSA-N Val-Gly-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)C(C)C PMDOQZFYGWZSTK-LSJOCFKGSA-N 0.000 description 1
- DLLRRUDLMSJTMB-GUBZILKMSA-N Val-Ser-Met Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)O)N DLLRRUDLMSJTMB-GUBZILKMSA-N 0.000 description 1
- UJMCYJKPDFQLHX-XGEHTFHBSA-N Val-Ser-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)N)O UJMCYJKPDFQLHX-XGEHTFHBSA-N 0.000 description 1
- NZYNRRGJJVSSTJ-GUBZILKMSA-N Val-Ser-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O NZYNRRGJJVSSTJ-GUBZILKMSA-N 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 108020000999 Viral RNA Proteins 0.000 description 1
- 108010087302 Viral Structural Proteins Proteins 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000003450 affinity purification method Methods 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 238000003277 amino acid sequence analysis Methods 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 238000003149 assay kit Methods 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 230000008436 biogenesis Effects 0.000 description 1
- 239000012620 biological material Substances 0.000 description 1
- 235000014121 butter Nutrition 0.000 description 1
- 238000010804 cDNA synthesis Methods 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 210000004671 cell-free system Anatomy 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 230000001010 compromised effect Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000012926 crystallographic analysis Methods 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 231100000676 disease causative agent Toxicity 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 238000002875 fluorescence polarization Methods 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- YMAWOPBAYDPSLA-UHFFFAOYSA-N glycylglycine Chemical compound [NH3+]CC(=O)NCC([O-])=O YMAWOPBAYDPSLA-UHFFFAOYSA-N 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000010710 hepatitis C virus infection Diseases 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 108010027338 isoleucylcysteine Proteins 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 230000021633 leukocyte mediated immunity Effects 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 231100000835 liver failure Toxicity 0.000 description 1
- 208000007903 liver failure Diseases 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 150000002741 methionine derivatives Chemical class 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 230000011278 mitosis Effects 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 229910052759 nickel Inorganic materials 0.000 description 1
- 238000001668 nucleic acid synthesis Methods 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 150000002894 organic compounds Chemical class 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 230000000063 preceeding effect Effects 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 108010029020 prolylglycine Proteins 0.000 description 1
- 230000004952 protein activity Effects 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 238000001273 protein sequence alignment Methods 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 210000001995 reticulocyte Anatomy 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 239000013606 secretion vector Substances 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 150000003354 serine derivatives Chemical class 0.000 description 1
- 229910052709 silver Inorganic materials 0.000 description 1
- 239000004332 silver Substances 0.000 description 1
- 238000012868 site-directed mutagenesis technique Methods 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 150000003587 threonine derivatives Chemical class 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000017105 transposition Effects 0.000 description 1
- 108010078580 tyrosylleucine Proteins 0.000 description 1
- IBIDRSSEHFLGSD-UHFFFAOYSA-N valinyl-arginine Natural products CC(C)C(N)C(=O)NC(C(O)=O)CCCN=C(N)N IBIDRSSEHFLGSD-UHFFFAOYSA-N 0.000 description 1
- 230000007444 viral RNA synthesis Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/24011—Flaviviridae
- C12N2770/24211—Hepacivirus, e.g. hepatitis C virus, hepatitis G virus
- C12N2770/24222—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Virology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Enzymes And Modification Thereof (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
HCV NS5B nucleic acids and proteins are disclosed herein. Also provided are methods and kits utilizing the compositions of the invention.
Description
Hepatitis C Virus NSSB Compositions and Methods of Use Thereof Field of the Invention The present invention relates to hepatitis C virus (HCV), and more specifically, to the HCV NSSB gene and the encoded protein. In particular, the invention relates to novel compositions comprising HCV NSSB
sequences, functional HCV NSSB sequences, functionally improved compositions of HCV NSSB sequences, and to the use of such NSSB sequences in research, diagnostic, therapeutic and pharmaceutical applications.
Cross Reference to Related Applications This application claims priority under 35 U.S.C.
~119(e) to US Provisional Application 60/080,509 filed April 2, 1998 and US Provisional Application 60/090,356 filed June 23, 1998, the disclosures of each being incorporated by reference as though set forth herein in full .
Background of the Invention Hepatitis C virus (HCV) is a major cause of hepatitis globally. The World Health Organization estimates that 150 million people worldwide are presently infected with the virus. Most infections become persistent and about 60~ of cases develop into chronic liver disease. Chronic HCV infection can lead to development of cirrhosis, hepatocellular carcinoma and liver failure.
For treatment of hepatitis due to HCV, interferon alpha (IFN) is currently approved in the U.S. IFN
treatment is associated with improved serum enzyme response in 20-40~ of patients. The remainder are nonresponsive to IFN treatment. For responders, a sustained improvement of aminotransferase levels is seen in only 10-20~ of patients; the majority of patients relapse upon cessation of IFN treatment. While IFN
represents the first treatment of chronic hepatitis C, its effectiveness is variable, its cure rate is low, and associated adverse effects axe considerable.
Vaccines under development for HCV generally consist of recombinant versions of the putative viral structural proteins (C, E1, E2), or genes encoding these. It is believed that virus neutralizing antibodies do exist, can be elicited, and may be able to inhibit or prevent HCV infection. However, to date, no vaccine has been demonstrated safe and effective for HCV. Indeed, given the inherent genetic diversity of HCV, with virus isolates exhibiting immunologically distinct envelope proteins that are not neutralized by pre-existing antibodies, vaccine development will be a formidable task.
HCV can not yet be efficiently propagated in vitro.
This deficiency has compromised a clear understanding of several aspects of HCV replication. While numerous HCV
isolates have been molecularly cloned from infected patients and have been sequenced, much remains to be learned regarding the required sequence features and elements which facilitate efficient replication. From study of these sequences in a variety of surrogate gene expression systems, knowledge of the molecular biology of HCV has expanded greatly in recent years. These advancements, which have been facilitated by existing knowledge and understanding of the molecular biology of the related pestiviruses and flaviviruses, have yielded important insights into the virus-specified components essential for virus replication that may be suitable targets for antiviral drug discovery strategies.
As mentioned above, HCV is a genetically heterogeneous virus. It exists in nature, and in infected individuals, as a "quasispecies", which means that within the virus population from any particular source, the viral genetic material is present as a collection of closely related, but non-identical sequences. This genetic heterogeneity of HCV sequences I5 may be a consequence of natural errors introduced during the normal replication process of HCV, of selection pressures placed on the virus by the host, or others factors. It is believed that the quasispecies nature of HCV may contribute to the virus's ability to avoid elimination by the host's defense systems and establish persistent infections.
The quasispecies nature of HCV has made it difficult to define the sequence of "functional" genes and genomes, particularly in the absence of a controlled system for the efficient replication of the virus.
However, functionality of segments of HCV sequences has been studied in a variety of surrogate expression systems. Several gene products have been shown to be functional in in vitro assays in that they exhibit enzymological activities that are predicted to exist based on the presence of particular amino acid sequence motifs in these gene products. For example, the NS3 protein possesses serine proteinase, nucleoside triphosphatase and helicase activities and the NSSB
protein possesses RNA-dependent RNA polymerase (RdRp) activity.
The recent demonstration of an infectious molecular clone of HCV [Kolykhalov et al., Science 277:570-574 (1997); Yanagi et al., Proc. Natl. Acad. Sci. USA
94:8738-8743 (1997)] allows definition of a complete functional HCV genome and consequently of a sequence for a set of functional HCV gene products from this particular strain of HCV obtained from one particular source. It is noteworthy that Kolykhalov et al.
indicate that the difficulties in obtaining a functional genome included: 1) the highly variable quasispecies nature of HCV in infected patients; 2) the required in vitro amplification (cDNA synthesis and PCR
amplification) of the sequences due to the small quantities of viral RNA in clinical samples; and 3) the necessity of molecular cloning (in E. coli). Each of these aspects allows for the possibility and presentation of defective (poorly functional or nonfunctional) HCV sequences or for errors in transcribing or amplifying HCV sequences. Kolykhalov et al. indicated that RNAs produced from 34 full genome molecular clones failed to exhibit infectivity in chimpanzees. Nucleotide sequence analyses showed numerous sequence changes among the 6 full length clones that were completely sequenced. Only after a "consensus sequence" clone was generated, was positive infectivity demonstrable. Yanagi et a1. also indicated the high degree of sequence variability among individual molecular clones obtained from a single source material and the non-infectious nature of RNA transcripts from full-length molecular clones. Yanagi et al. concluded that a large proportion of HCV genomes are defective.
In fact, recent work indicates a bias toward the preferential selection of defective HCV genomes during molecular cloning procedures [Forns, et al., Proc Natl Acad Sci USA 94:13909-13914 (1997)]. Of 25 random clones derived from a control plasmid by Forns et al., only 8% were functional in polyprotein synthesis.
Thus, it is clear from these examples that mere knowledge of a sequence derived from HCV is insufficient to conclude that such a sequence encodes useful viral genes or functional viral gene products.
Regarding the NSSB gene, while many partial and complete gene sequences have been entered into various databases, only a very few of these sequences have been demonstrated to be functional based on in vitro assays of RdRp activity.
The present invention provides novel and functional, as well as functionally improved, hepatitis C virus NS5B sequences for use in research, diagnostic, therapeutic and pharmaceutical applications, and for use in assays for the identification of efficacious antiviral agents.
SUI4rIARY OF THE INVENTION
The present invention provides novel HCV NS5B
nucleotide sequences from which recombinant HCV proteins having demonstrable RdRp activity may be derived.
Sequence modifications that result in improved functional activity are also provided. Such functional recombinant HCV NSSB proteins have utility in research, diagnostic, therapeutic and pharmaceutical applications.
In particular, the recombinant HCV NSSB proteins of the invention have utility in antiviral drug discovery strategies.
In a preferred embodiment of the invention, an isolated nucleic acid molecule is provided that comprises a DNA sequence identified as SEQ ID NO: 1, which is present in clone 4 of the present invention.
An exemplary HCV NSSB protein has the amino acid sequence identified as SEQ ID NO: 2 encoded by clone 4.
Additional nucleic acid molecules that represent nucleic acid sequences related to those of SEQ ID NO: 1, including but not limited to those identified by SEQ ID
NO: 3, 4, 5, 6 and 7 encoding, respectively, the amino acid sequences identified by SEQ ID NO: 8, 9, 10, 11 and 12 of the HCV NSSB are also contemplated to be within the scope of the present invention. It is further contemplated that conservative sequence or residue substitutions of these sequences are also within the scope of the invention.
In an additional embodiment of the invention, functionally improved hepatitis C polymerase nucleic acid and amino acid sequences are provided. Exemplary sequences include those nucleic acid sequences that encode amino acid sequences related to those identified by SEQ ID NO: 2 in which particular codons have been substituted to encode particular amino acid changes in the sequence. Examples of useful changes include but are not limited to changes at amino acid positions number 75, number 177 and number 543 of the mature NSSB
protein.
In another embodiment of the invention, functionally improved hepatitis C polymerase nucleic acid and amino acid sequences are provided in which particular codons are substituted to encode particular amino acids not normally found in known sequences of NSSB. For example, changes including but not limited to residue changes at amino acid positions number 1 and number 2 of the mature NSSB protein are useful according to this invention.
As described above, nucleic acids encoding variant proteins or polypeptides are contemplated to be within the scope of the present invention. Sequence ID NO: 13 provides an example of such a variant sequence. Such variants may or may not possess HCV polymerase activity.
These variants may possess one or more changes each of which may include one or more additions, deletions, or substitutions of amino acid residues. Preferably, the changes will not affect, or substantially affect, the structure or useful properties of the polypeptide.
Thus, HCV NSSB variants may suitably possess functional NSSB activity such as those described above, or they may be poorly functional or inactive, yet contain substantially the secondary and tertiary structure of the native polypeptide. Such NSSB molecules may be used to advantage to identify agents that specifically bind to or otherwise affect the HCV NSSB activity. HCV NSSB
variants can be either naturally occurring (i.e., purified or isolated from a natural source) or synthetic (i.e., generated by biological expression of DNA that has been subjected to site-directed mutagenesis or produced by chemical synthetic techniques well known in the art ) .
The nucleic acid molecules of the invention may be cloned and expressed in vectors. Such vectors may be in the form of, for example, a plasmid, a replication competent or defective virus or phage vector or a replicon provided typically with an origin of replication, optionally a promoter for the expression of the polynucleotide and optionally a regulator of the promoter. The vector may contain one or more selectable marker genes, for example an ampicillin resistance gene in the case of a bacterial plasmid or a neomycin resistance gene for a mammalian vector. The vector may be used in vitro, for example for the production of RNA
or protein. The vector may be further used to transform, transfect, infect or transduce a host cell or an organism. The present invention further contemplates the use of host cells and organisms harboring or expressing the HCV nucleic acid sequences or polypeptides of the invention for the identification of agents that affect the activity of the HCV NSSB protein.
In yet another embodiment of the invention, methods are provided for the identification of agents that affect the HCV NSSB polymerase sequences. Such methods include high throughput screening procedures that allow assessment of large numbers of agents. The agents identified by use of the HCV NSSB nucleic acids and polypeptides of the invention, variants thereof, or methods of the invention, may be either antagonistic or agonistic in their affect on the NSSB sequences. These agents may include molecules of any number of classes including but not limited to small molecules, polymers, peptides, polypeptides, immunoglobulins or fragments thereof, oligonucleotides, antisense molecules, , peptide-nucleic acid conjugates, ribozymes, polynucleotides and the like. It is specifically contemplated that both antagonistic and agonistic molecules identified by practice of the invention have broad and multiple utilities. Such utilities for antagonists of HCV NSSB activity include, but are not limited to, uses for the inhibition of HCV replication in humans, in other living hosts and in in vitro systems such as cell, tissue and organ cultures. Agonists of HCV NSSB activity identified by practice of the invention will also have multiple utilities, both in living hosts and in in vitro systems. For example, such agents will be useful in the development of animal models of HCV infection, replication or disease and for the propagation of HCV in a living host or in cell, tissue or organ culture systems.
According to another aspect of the invention, kits are provided to facilitate the use of the compositions and methods disclosed herein. Exemplary kits would include HCV NS5B nucleic acids and polypeptides of the invention, variants thereof, alone or in association with suitable vectors. Also included would be protocols for use of the compositions of the invention for the particular application and the necessary reagents to carry out the application. The reagents of a kit may vary depending on the intended application. Such reagents may include, but are not limited to buffers, solvents, media and solutions, substrates and cofactors, vectors and host cells, and detection or reporter reagents. Other accessories may also be included such as vials, vessels and reaction chambers.
The following definitions are provided to aid in understanding the subject matter regarded as the invention.
As used herein, "hepatitis C virus" or "HCV" shall mean any representative of a diverse group of related viruses classified within the hepacivirus genus of the Flaviviridae family.
"Nucleic acid" or a "nucleic acid molecule" as used herein refers to any DNA or RNA molecule, either single or double stranded and, if single stranded, the molecule of its complementary sequence in either linear or circular form. In discussing nucleic acid molecules, a sequence or structure of a particular nucleic acid molecule may be described herein according to the normal convention of providing the sequence in the 5' to 3' direction. With reference to nucleic acids of the invention, the term "isolated nucleic acid" is sometimes used. This term, when applied to DNA, refers to a DNA
molecule that is separated from sequences with which it is immediately contiguous in the naturally occurring genome of the organism in which it originated. For example, an "isolated nucleic acid" may comprise a DNA
molecule inserted into a vector, such as a plasmid or virus vector, or integrated into the genomic DNA of a prokaryotic or eukaryotic cell or host organism.
When applied to RNA, the term "isolated nucleic acid" refers primarily to an RNA molecule encoded by an isolated DNA molecule as defined above. Alternatively, the term may refer to an RNA molecule that has been sufficiently separated from other nucleic acids with which it would be associated in its natural state (i.e., in cells or tissues). An isolated nucleic acid (either DNA or RNA) may further represent a molecule produced directly by biological or synthetic means and separated from other components present during its production.
"Natural allelic variants", "mutants" and "derivatives" of particular sequences of nucleic acids refer to nucleic acid sequences that are closely related to a particular sequence but which may possess, either naturally or by design, changes in sequence or structure. By closely related, it is meant that at least about 75°s, but often, more than 90~, of the nucleotides of the sequence match over the defined length of the nucleic acid sequence referred to using a specific SEQ ID NO. Changes or differences in nucleotide sequence between closely related nucleic acid sequences may represent nucleotide changes in the sequence that arise during the course of normal replication or duplication in nature of the particular nucleic acid sequence. Other changes may be specifically designed and introduced into the sequence for specific purposes, such as to change. an amino acid codon or sequence in a regulatory region of the nucleic acid. Such specific changes may be made in vitro using a variety of mutagenesis techniques or produced in a host organism placed under particular selection conditions that induce or select for the changes. Such sequence variants generated specifically may be referred to as "mutants" or "derivatives" of the original sequence.
The terms "percent similarity", "percent identity"
and "percent homology" when referring to a particular sequence are used as set forth in the University of Wisconsin GCG software program.
The term "NSSB" refers to a portion of the HCV
genome located near the 3' end of the viral genome that specifies the region encoding a protein, termed the "NSSB protein", "NSSB polypeptide", "NSSB polymerase" or combinations of these terms which are used interchangeably herein. NSSB in its natural state, functions as an RNA-dependent RNA polymerase (RdRp).
The nucleic acid region encoding the NSSB protein may also be referred to as the "NSSB gene". Thus, the term "NSSB" may refer to either a nucleic acid encoding the NSSB polypeptide, to an NSSB gene or to an NSSB
polypeptide, or to any portions thereof, depending on the context in which the term is used. NSSB may further refer to natural allelic variants, mutants and derivatives of either NSSB nucleic acid sequences or NSSB polypeptides. The NSSB nucleic acid, NSSB gene or NSSB protein referred to may be either functional or non-functional.
The present invention also includes active portions, fragments, derivatives and functional or non-functional mimetics of HCV NSSB polypeptides or proteins of the invention. An "active portion" of HCV
NSSB polypeptide means a peptide that is less than the full length HCV NSSB polypeptide, but which retains measurable biological activity.
A "fragment" or "portion" of the HCV NSSB
polypeptide means a stretch of amino acid residues of at least about five to seven contiguous amino acids, often at least about seven to nine contiguous amino acids, typically at least about nine to thirteen contiguous amino acids and, most preferably, at least about twenty to thirty or more contiguous amino acids. Fragments of the HCV NSSB polypeptide sequence, antigenic determinants, viral antigens or epitopes are useful for eliciting immune responses to a portion of the HCV NSSB
amino acid sequence.
A "derivative" of the HCV NSSB polypeptide or a fragment thereof means a polypeptide modified by varying the amino acid sequence of the protein, e.g. by manipulation of the nucleic acid encoding the protein or by altering the protein itself. Such derivatives-of the natural amino acid sequence may involve insertion, addition, deletion or substitution of one or more amino acids, and may or may not alter the essential activity of original the HCV NSSB polypeptide. As mentioned above, the HCV NSSB polypeptide or protein of the invention includes any analogue, fragment, derivative or mutant which is derived from a HCV NSSB
polypeptide and which retains at least one property or other characteristic of the HCV NSSB polypeptide.
Different "variants" of the HCV NSSB polypeptide exist in nature. These variants may be alleles characterized WO 99!51781 PCT/US99/07404 by differences in the nucleotide sequences of the gene coding for the protein, or may involve different RNA
processing or post-translational modifications. The skilled person can produce variants having single or multiple amino acid substitutions, deletions, additions or replacements. These variants may include inter alias (a) variants in which one or more amino acids residues are substituted with conservative or non-conservative amino acids, (b) variants in which one or more amino acids are added to the HCV NSSB polypeptide, (c) variants in which one or more amino acids include a substituent group, and (d) variants in which the HCV
NSSB polypeptide is fused with another peptide or is polypeptide such as a fusion partner, a protein tag or other chemical moiety, that may confer useful properties to the HCV NSSB polypeptide, such as, for example, an epitope for an antibody, a polyhistidine sequence, a biotin moiety and the like. Other HCV NSSB polypeptides of the invention include variants in which amino acid residues from one species are substituted for the corresponding residue in another species, either at the conserved or non-conserved positions. In another embodiment, amino acid residues at non-conserved positions are substituted with conservative or non-conservative residues. The techniques for obtaining these variants, including genetic (suppressions, deletions, mutations, etc.), chemical, and enzymatic techniques are known to the person having ordinary skill in the art.
To the extent such allelic variations, analogues, fragments, derivatives, mutants, and modifications, including alternative nucleic acid processing forms and alternative post-translational modification forms result in derivatives of the HCV NSSB polypeptide that retain any of the biological properties of the HCV NSSB
polypeptide, they are included within the scope of this invention.
The term "functional" as used herein implies that the nucleic or amino acid sequence is functional for the recited assay or purpose.
The phrase "consisting essentially of" when referring to a particular nucleotide or amino acid means a sequence having the properties of a given SEQ ID
No:. For example, when used in reference to an amino acid sequence, the phrase includes the sequence per se and molecular modifications that would not affect the basic and novel characteristics of the sequence.
A "replicon" is any genetic element, for example, a plasmid, cosmid, bacmid, phage or virus, that is capable of replication largely under its own control. A replicon may be either RNA or DNA and may be single or double stranded.
A "vector" is a replicon, such as a plasmid, cosmid, bacmid, phage or virus, to which another genetic sequence or element (either DNA or RNA) may be attached so as to bring about the replication of the attached sequence or element.
An "expression operon" refers to a nucleic acid segment that may possess transcriptional and translational control sequences, such as promoters, enhancers, translational start signals (e.g., ATG or AUG
codons), polyadenylation signals, terminators, and the like, and which facilitate the expression of a polypeptide coding sequence in a host cell or organism.
The term "oligonucleotide," as used herein refers to primers and probes of the present invention, and is defined as a nucleic acid molecule comprised of two or more ribo- or deoxyribonucleotides, preferably more than three. The exact size of the oligonucleotide will depend on various factors and on the particular application and use of the oligonucleotide.
The term "probe" as used herein refers to an oligonucleotide, polynucleotide or nucleic acid, either RNA or DNA, whether occurring naturally as in a purified restriction enzyme digest or produced synthetically, which is capable of annealing with or specifically hybridizing to a nucleic acid with sequences complementary to the probe. A probe may be either single-stranded or double-stranded. The exact length of the probe will depend upon many factors, including temperature, source of probe and use of the method. For example, for diagnostic applications, depending on the complexity of the target sequence, the oligonucleotide probe typically contains 15-25 or more nucleotides, although it may contain fewer nucleotides. The probes herein axe selected to be "substantially" complementary to different strands of a particular target nucleic acid sequence. This means that the probes must be sufficiently complementary so as to be able to "specifically hybridize" or anneal with their respective target strands under a set of pre-determined conditions.
Therefore, the probe sequence need not reflect the exact complementary sequence of the target. For example, a non-complementary nucleotide fragment may be attached to the 5' or 3' end of the probe, with the remainder of the probe sequence being complementary to the target strand.
Alternatively, non-complementary bases or longer sequences can be interspersed into the probe, provided that the probe sequence has sufficient complementarity with the sequence of the target nucleic acid to anneal therewith specfically.
The term "specifically hybridize'" refers to the association between two single-stranded nucleic acid molecules of sufficiently complementary sequence to permit such hybridization under pre-determined conditions generally used in the art (sometimes termed "substantially complementary"). In particular, the term refers to hybridization of an oligonucleotide with a substantially complementary sequence contained within a single-stranded DNA or RNA molecule of the invention, to the substantial exclusion of hybridization of the oligonucleotide with single-stranded nucleic acids of non-complementary sequence.
The term "primer" as used herein refers to an oligonucleotide, either RNA or DNA, either single-stranded or double-stranded, either derived from a biological system, generated by restriction enzyme digestion, or produced synthetically which, when placed in the proper environment, is able to functionally act as an initiator of template-dependent nucleic acid synthesis. When presented with an appropriate nucleic acid template, suitable nucleoside triphosphate precursors of nucleic acids, a polymerase enzyme, suitable cofactors and conditions such as a suitable temperature and pH, the primer may be extended at its 3' terminus by the addition of nucleotides by the action of a polymerase or similar activity to yield an primer extension product. The primer may vary in length depending on the particular conditions and requirement of the application. For example, in diagnostic applications, the oligonucleotide primer is typically 15-25 or more nucleotides in length. The primer must be of sufficient complementarity to the desired template to prime the synthesis of the desired extension product, that is, to be able anneal with the desired template strand in a manner sufficient to provide the 3' hydroxyl moiety of the primer in appropriate juxtaposition for use in the initiation of synthesis by a polymerase or similar enzyme. It is not required that the primer sequence represent an exact complement of the desired template. For example, a non-complementary nucleotide sequence may be attached to the 5' end of an otherwise complementary primer. Alternatively, non-complementary bases may be interspersed within the oligonucleotide primer sequence, provided that the primer sequence has sufficient complemeritarity with the sequence of the desired template strand to functionally provide a template-primer complex for the synthesis of the extension product. Amino acid residues described herein are preferred to be in the "L" isomeric form. However, residues in the "D" isomeric form may be substituted for any L-amino acid residue, provided the desired properties of the polypeptide are retained.
All amino-acid residue sequences represented herein conform to the conventional left-to-right amino-terminus to carboxy-terminus orientation.
The term "isolated protein" or "isolated and purified protein" is sometimes used herein. This term refers primarily to a protein produced by expression of an isolated nucleic acid molecule of the invention.
Alternatively, this term may refer to a protein that has been sufficiently separated from other proteins with which it would naturally be associated, so as to exist in "substantially pure" form. "Isolated" is not meant to exclude artificial or synthetic mixtures with other compounds or materials, or the presence of impurities that do not interfere with the fundamental activity, and that may be present, for example, due to incomplete purification, addition of stabilizers, or compounding into, for example, immunogenic preparations or pharmaceutically acceptable preparations.
The term "substantially pure" refers to a preparation comprising at least 50-60~ by weight of a given material (e. g., nucleic acid, oligonucleotide, protein, etc.). More preferably, the preparation comprises at least 75% by weight, and most preferably 90-95% by weight of the given compound. Purity is measured by methods appropriate for the given compound (e. g. chromatographic methods, agarose or polyacrylamide gel electrophoresis, HPLC analysis, and the like).
"Mature protein" or "mature polypeptide" shall mean a polypeptide possessing the sequence of the polypeptide after any processing events that normally occur to the polypeptide during the course of its genesis, such as protoelytic processing from a polyprotein precursor. In designating the sequence or boundaries of a mature protein, the first amino of the mature protein sequence is designated as amino acid residue 1. In the case of the mature NSSB protein, its normal biogenesis entails its proteolytic cleavage from a precursor polyprotein.
Thus, the first amino acid residue of the mature NSSB
protein represents a serine residue for all known HCV
sequences. As used herein, any amino acid residues associated with a mature protein not naturally found associated with that protein that precedes amino acid 1 are designated amino acid -1, -2, -3 and so on. For recombinant expression systems, a methionine initiator codon is often utilized for purposes of efficient translation. Thus, in the case of NSSB, a methionine codon may be place immediately proceeding the serine codon. This methionine residue in the resulting polypeptide, as used herein, would be positioned at -1 relative to the mature NS5B protein sequence.
The term "tag," "tag sequence" or "protein tag"
refers to a chemical moiety, either a nucleotide, oligonucleotide, polynucleotide or an amino acid, peptide or protein or other chemical, that when added to another sequence, provides additional utility or confers useful properties, particularly in the detection or isolation, to that sequence. Thus, for example, a homopolymer nucleic acid sequence or a nucleic acid sequence complementary to a capture oligonucleotide may be added to a primer or probe sequence to facilitate the subsequent isolation of an extension product or hybridized product. In the case of protein tags, histidine residues (e. g., 4 to 8 consecutive histidine residues) may be added to either the amino- or carboxy-terminus of a protein to facilitate protein isolation by chelating metal chromatography.
Alternatively, amino acid sequences, peptides, proteins or fusion partners representing epitopes or binding determinants reactive with specific antibody molecules or other molecules (e. g., flag epitope, c-myc epitope, transmembrane epitope of the influenza A virus hemaglutinin protein, protein A, cellulose binding domain, calmodulin binding protein, maltose binding protein, chitin binding domain, glutathione S-transferase, and the like) may be added to proteins to facilitate protein isolation by procedures such as affinity or immunoaffinity chromatography. Chemical tag moieties include such molecules as biotin, which may be added to either nucleic acids or proteins and facilitates isolation or detection by interaction with avidin reagents, and the like. Numerous other tag moieties are known to, and can be envisioned by, the trained artisan, and are contemplated to be within the scope of this definition.
As used herein, the terms "reporter," "reporter system", "reporter gene," or "reporter gene product"
shall mean an operative genetic system in which a nucleic acid comprises a gene that encodes a product that when expressed produces a reporter signal that is a readily measurable, e.g., by biological assay, immunoassay, radioimmunoassay, or by colorimetric, fluorogenic, chemiluminescent or other methods. The nucleic acid may be either RNA or DNA, linear or circular, single or double stranded, antisense or sense polarity, and is operatively linked to the necessary control elements for the expression of the reporter gene product. The required control elements will vary according to the nature of the reporter system and whether the reporter gene is in the form of DNA or RNA, but may include, but not be limited to, such elements as promoters, enhancers, translational control sequences, poly A addition signals, transcriptional termination signals and the like.
The terms "transform", "transfect", "transduce", shall refer to any method or means by which a nucleic acid is introduced into a cell or host organism and may be used interchangeably to convey the same meaning.
Such methods include, but are not limited to, transfection, electroporation, microinjection, PEG-fusion and the like.
The introduced nucleic acid may or may not be integrated (covalently linked) into nucleic acid of the recipient cell or organism. In bacterial, yeast, plant and mammalian cells, for example, the introduced nucleic acid may be maintained as an episomal element or independent replicon such as a plasmid. Alternatively, the introduced nucleic acid may become integrated into the nucleic acid of the recipient cell or organism and be stably maintained in that cell or organism and further passed on or inherited to progeny cells or organisms of the recipient cell or organism. In other manners, the introduced nucleic acid may exist in the recipient cell or host organism only transiently.
A "clone" or "clonal cell population" is a population of cells derived from a single cell or common ancestor by mitosis.
A "cell line" is a clone of a primary cell or cell population that is capable of stable growth in vitro for many generations.
An "immune response" signifies any reaction produced by an antigen, such as a viral antigen, in a _ host having a functioning immune system. Immune responses may be either humoral in nature, that is, involve production of immunoglobulins or antibodies, or cellular in nature, involving various types of B and T
lymphocytes, dendritic cells, macrophages, antigen presenting cells and the like, or both. Immune responses may also involve the production or elaboration of various effector molecules such as cytokines, lymphokines and the like. Immune responses may be measured both in in vitro and in various cellular or animal systems. Such immune responses may be important in protecting the host from disease and may be used prophylactically and therapeutically.
A "viral antigen" shall be any peptide, polypeptide or protein sequence, segment or epitope that is derived from a virus that has the potential to cause a functioning immune system of a host to react to said viral antigen.
An "antibody" or "antibody molecule" is any immunoglobulin, including antibodies and fragments thereof, that binds to a specific antigen. The term includes polyclonal, monoclonal, chimeric, and bispecific antibodies. As used herein, antibody or antibody molecule contemplates both an intact immunoglobulin molecule and an immunologically active portion of an immunloglobulin molecule such as those portions known in the art as Fab, Fab', F(ab')2 and F (v) .
As used herein, the term "living host" shall mean any non-human autonomous being.
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1 shows an alignment of the amino acid sequences of several NSSB proteins of the invention.
The approximate positions of conserved sequence motifs present in RdRp enzymes identified by Koonin (J Gen Virol. (1991) 72:2197-206] (Roman numerals) and Poch et a1. [EMBO J. (1989) 8:3867-74] (letters) are indicated above the clone 4 sequence.
Figure 2 shows the purification of the HCV NSSB
protein. Sf9 cells infected with a recombinant baculovirus expressing the HCV NSSB gene were harvested and lysed. Cleared lysate was subjected to a series of protein purification steps. Samples for each step of the purification procedure were electrophoresed on an SDS-containing polyacrylamide gel, which was then silver-stained. Lane l: cleared cell lysate; lane 2, flow-through material from DEAE column; lane 3, material from heparin column; lane 4, material from Cibracron blue column. M = molecular mass standards; numbers in kilodaltons.
Figure 3 is an alignment of the clone 4 NSSB
sequence of the invention with the genotype la consensus NSSB sequence derived from an infectious clone (GenBank Accession Number AF009606) and a genotype la NSSB
sequence (PCT WO 97/12033) previously shown to have RdRp activity. The dashed lines indicate amino acid residue identity.
Figure 4 shows an alignment of the clone 4 NSSB
sequence of the invention with a genotype lb "consensus"
amino acid sequence derived from sequences of HCV NSSB
sequences obtained from the GenBank database and with genotype lb NSSB sequences previously shown to be functional (GenBank Accession Numbers M58335 and 297730). The dashed lines indicate amino acid residue identity.
Figure 5 shows a protein sequence alignment of the HCV genotype lb NSSB gene reported by Yanagi et al.
[Virology (1998) 244:161-172; GenBank Accession Number AF054247] and clone 4 of the present invention. The dashed lines indicate amino acid residue identity.
Figure 6 shows results of a high throughput assay for HCV NSSB RdRp activity.
Figure 7 shows the sequence of SEQ ID NO: 1.
Figure 8 shows the sequence of SEQ ID NO: 3.
Figure 9 shows the sequence of SEQ ID NO: 4.
Figure 10 shows the sequence of SEQ ID NO: 5.
Figure 11 shows the sequence of SEQ ID NO: 6.
Figure 12 shows the sequence of SEQ TD NO: 7.
Figure 13 shows the amino acid sequence of clone 20(V-1M), SEQ ID NO: 13.
DETAILED DESCRIPTION OF THE INVENTION
HCV is the major causative agent of transfusion-associated and sporadic non-A, non-B hepatitis. A high number of HCV-infected patients develop chronic hepatitis that eventually leads to cirrhosis and often progresses to hepatocellular carcinoma. There is an urgent need for new effective treatments of this disease.
HCV is an enveloped virus with a (+) stranded linear RNA genome of approximately 9.4 kilobases. This nucleic acid encodes a large polyprotein that is processed by viral and cellular proteases into at least 9 different viral polypeptides.
In one of its aspects, the present invention provides HCV genetic material derived from an HCV-infected patient. The invention further provides HCV
recombinant NSSB proteins expressed from these sequences and sequences that have RdRp actitrity.
Expression of recombinant HCV NS58 gene sequences may be carried out in a variety of systems including but not limited to bacterial, yeast, mammalian, insect and plant cell systems, as well as in organisms such as infected, transfected, transduced or transgenic insects, animals or plants. In one embodiment of the invention, recombinant baculoviruses were constructed to express HCV NSSB gene sequences in insect cells following infection in culture.
RNA extracted from the serum of a patient infected with HCV was subjected to a reverse transcriptase-nested polymerase chain reaction procedure using primer oligonucleotides designed to amplify the NSSB gene sequences. Primers for the nested PCR reaction allowed direct cloning of the NSSB gene into a baculovirus expression transfer vector, providing an initiator methonine codon immediately preceeding the first amino acid of the authentic NSSB coding sequence. The NSSB
gene from several transfer vector clones was sequenced and used to generate recombinant baculoviruses.
Infection of Sf9 cells with these viruses, followed by Western immunoblotting with HCV NSSB sequence-specific antiserum, showed clear production of the 68 kilodalton NS5B protein.
In another aspect of the invention, NSSB sequences that are expressed, purified and evaluated for RdRp activity may possess varying levels of RdRp activity, from highly active to little or no activity, and may thus represent functional, poorly functional or non-functional sequences, respectively. Such sequences would also be assessed for activity in accordance with the present invention.
In a further aspect of the invention, HCV NSSB
proteins may be modified by particular changes in nucleotide and amino acid sequence that result in RdRp enzymes with altered functionality. Such changes may be subtle and represent conservative substitutions such as in the case of nucleotide sequences, changes in the codon sequence that do or do not alter the encoded amino acid, or for amino acid sequences, changes that result in conservative residue substitutions, additions or deletions.
In yet a further aspect of the invention, NSSB
nucleic acids and polypeptides derived from sequences of the invention have utility in numerous methods, assays and kits involving research, diagnostic, therapeutic and pharmaceutical applications, and in the development of antiviral strategies for the prevention and treatment of HCV disease.
Based on the discoveries described herein, it is demonstrated that simple knowledge of, or mere inspection of, a nucleotide or amino acid sequence of an NSSB gene or protein is insufficient to enable one to deduce or predict that the particular NS58 sequence represents a sequence that has enzymatic activity or functional utility.
Preparation of HCV NS58 Nucleic Acid Molecules and HCV
NS58 Proteins and Uses Thereof in Assay Methods and Kits A. Nucleic Acid Molecules Nucleic acid molecules encoding the HCV NS5B
proteins of the invention may be prepared by two general methods: (1) They may be synthesized from appropriate chemical starting materials, or (2) they may be isolated from biological sources. Both methods utilize protocols well known in the art.
The availability of nucleotide sequence information, such as that provided herein for HCV NSSB
sequences, enables preparation of an isolated nucleic acid molecule of the invention by oligonucleotide synthesis. Synthetic oligonucleotides may be prepared by the phosphoramadite method employed in the Applied Biosystems 38A DNA Synthesizer or similar devices. The resultant construct may be purified according to methods known in the art, such as high performance liquid chromatography (HPLC). Long, double-stranded polynucleotides, such as a DNA molecule of the present invention, must be synthesized in stages due to the size limitations inherent in current oligonucleotide synthetic methods. Thus, for example, a 3 kilobase double-stranded molecule may be synthesized as several smaller segments of appropriate complementarity.
Complementary segments thus produced may be ligated such that each segment possesses appropriate cohesive termini for attachment of an adjacent segment. Adjacent segments may be ligated by annealing cohesive termini in the presence of DNA ligase to construct an entire 3 kilobase double-stranded molecule. A synthetic DNA
molecule so constructed may then be cloned and amplified in an appropriate vector.
Nucleic acid sequences encoding HCV NSSB proteins may be isolated from appropriate biological sources using methods known in the art. For example, RNA
isolated from the serum of an HCV infected patient may be used as a suitable starting material for the generation of cDNA molecules encoding HCV NSSB proteins.
In accordance with the present invention, nucleic acids having the appropriate level of sequence homology WO 99/51781 PCT/tJS99/07404 with the protein coding region of the DNA molecules of the present invention may be identified by using hybridization and washing conditions of appropriate stringency. For example, hybridizations may be performed, using a hybridization solution comprising, for example, 5X SSC, 5X Denhardt's reagent, 1.0% SDS, 100 ,ug/ml denatured, fragmented salmon sperm DNA, 0.05%
sodium pyrophosphate and up to 50% formamide.
Hybridization is carried out at 37-42°C for at least six hours. Following hybridization, filters are washed as follows: (1) 5 minutes at room temperature in 2X SSC and 1% SDS; (2) 15 minutes at room temperature in 2X SSC and 0.1% SDS; (3) 30 minutes-1 hour at 37°C in 1X SSC and 1%
SDS; (4) 2 hours at 42-65°C in 1X SSC and 1% SDS, changing the solution every 30 minutes.
One common formula for calculating the stringency conditions required to achieve hybridization between nucleic acid molecules of a specified sequence homology is as follows (Sambrook et al., 1989):
Tm = 81.5°C + 16.6Log [Na+] + 0.41(% G+C) - 0.63 (% formamide) -600/#bp in duplex As an illustration of the above formula, using [Na+] -[0.368] and 50% formamide, with GC content of 42% and an average probe size of 200 bases, the Tm is 57°C. The Tm of a DNA duplex decreases by 1-1.5°C with every 1%
decrease in homology. Thus, targets with greater than about 75% sequence identity would be observed using a hybridization temperature of 42°C. Such a sequence would be considered substantially homologous to the sequences of the present invention.
Nucleic acids of the invention may be maintained as DNA in any convenient cloning vector. In one embodiment, clones are maintained in plasmid cloning/expression vectors, such as pBluescript plasmids (Stratagene, La Jolla, CA) or recombinant baculovirus transfer vectors such as pFastBac vectors (Gibco-BRL, Gaithersburg, MD) that are propagated in suitable E.
coli host cells.
The nucleic acids of the invention may also be used as starting materials for the generation of sequence variants of the nucleic acids of the invention using any number of synthetic and molecular biologic procedures well known in the art including but not limited to site-directed mutagenesis techniques. Particular mutations may give rise to HCV NSSB proteins with altered characteristics such as increased enzymatic activity.
HCV NSSB protein-encoding nucleic acid molecules of the invention include cDNA, genomic DNA, RNA, and fragments thereof, which may be single- or double-stranded in nature. Thus, this invention provides oligonucleotides (sense or antisense strands of DNA or RNA) having sequences capable of hybridizing with at least one sequence of a nucleic acid molecule of the present invention, such as selected segments of the cDNA
having substantially the sequence of any of the sequences identified in the present invention. Such oligonucleotides are further useful as probes and primers for detecting or isolating additional HCV NSSB
encoding nucleic acids.
B. Proteins HCV NSSB proteins of the present invention may be prepared in a variety of ways, according to any number of known methods. The protein may be purified from appropriate sources, e.g., cultured cells, tissues or organs, by a variety of techniques that may include partitioning and precipitation procedures, affinity purification methods, conventional chromatography procedures, high performance chromatography techniques and the like.
The availability of nucleic acids molecules encoding HCV NSSB protein enables production of the protein using in vitro expression methods known in the art. For example, a cDNA or gene may be cloned into an appropriate in vitro transcription vector, such as pSP64 or pSP65 for in vitro RNA synthesis, followed by cell-free translation of the RNA in a suitable cell-free translation system, such as extracts of wheat germ, rabbit reticulocytes or HeLa cells. In vitro transcription and translation systems are commercially available (e.g., Promega Biotech, Madison, WI;
Gibco-BRL, Gaithersburg, MD).
Alternatively, according to a preferred embodiment of the invention, larger quantities of HCV NS5B protein may be produced by expression in suitable prokaryotic or eukaryotic systems such as bacterial, fungal, mammalian or plant systems. For example, part or all of a DNA
molecule, such as a cDNA may be inserted into a plasmid vector adapted for expression in a bacterial cell, such as E. coli, or into a baculovirus vector for expression in an insect cell. Such vectors comprise the regulatory elements necessary for expression of the DNA in the host cell (e. g., E. coli or insect cell), positioned in such a manner as to permit expression of the DNA in the host cell. Such regulatory elements required for expression may include promoter sequences, transcriptional initiation and termination sequences, enhancer sequences, translational control sequences and the like.
The HCV NSSB proteins or derivatives thereof produced by gene expression in a recombinant prokaryotic or eukaryotic system may be purified according to methods known in the art. In one embodiment, a commercially available expression/secretion system can be used, whereby the recombinant protein is expressed and thereafter secreted from the host cell, to be easily purified from the surrounding medium. If expression/secretion vectors are not used, an alternative approach involves purifying the recombinant protein from extracts of expressing cells, tissues or organs by standard protein purification techniques or by affinity separation techniques, such as by immunological interaction with antibodies that bind specifically to the recombinant protein or by nickel columns for isolation of recombinant proteins tagged with 5-8 histidine residues at their N-terminus or C-terminus.
Such methods are commonly used by skilled practitioners.
The HCV NSSB proteins of the invention, prepared by the aforementioned methods, may be analyzed according to standard procedures. For example, such proteins may be subjected to electrophoretic analyses and to amino acid sequence analyses, as well as to crystallographic analyses for structure determination according to known methods. Such analyses provide useful information regarding the functionality of the NSSB protein and on means to affect that functionality, such as in the design of molecules that may inhibit the function of the NSSB protein.
C. Assay Methods and Kits The HCV NSSB sequences of the invention may be used in a variety of ways having utility in research, diagnostic, therapeutic and pharmaceutical applications.
Representative methods of use for the compositions of the invention are described below.
In one aspect, the nucleic acid sequences of the invention, and sequences complementary to these, may be used as probes or primers for the detection, labeling, identification or isolation of related nucleic acids in biological or synthetic preparations. For example, nucleic acid sequences of the invention may be used as hybridization probes to detect the presence of HCV in samples. Such hybridization probes may further be used to isolate the nucleic acids to which they are hybridized by techniques well known in the art.
Additionally, the nucleic acid sequences of the invention may be used as primers for the detection or isolation of HCV or related nucleic acids using techniques such as reverse transcriptase-polymerase chain reaction (RT-PCR). Appropriate primers pairs may be further used in nested PCR applications. Such primers, primer pairs and probes may represent any portion of the NSSB sequences of the invention. The actual sequence of the NSSB gene used will vary according to the specific application. Moreover, additional sequences may be added to the HCV primer or probe sequence, such as homopolymer tails (tags), sequences that represent useful restriction enzyme recognition sites, sequences encoding particular amino acid residues, initiation or termination codons or other sequences that may be useful fox the particular application at hand. Typically, oligonucleotides of from 10 to 80 nucleotides in length that are either the same as or complementary to the sequences of the invention are useful as hybridization probes or as primers in RT-PCR applications. Alternatively, the entire NSSB sequence may be employed as a capture hybridization probe, for example.
Several examples of useful oligonucleotide primers and probes of the invention comprise sequences set forth in Table 1, sequences complementary to these and potions of these sequences.
Table 1 Oligonucleotides useful as probes and primers 5'-TCAATGTCCTACACATGGAC-3' SEQ IDNO: 14 5'-CTACACATGG-3' SEQ IDNO: 15 2 5 5'-CTCTGATTACACCATGCGCTGCGGAGGAGAGCAAGCTGCCC-3'SEQ IDNO: 16 5'-AATGCGCTGAGCAACTCTTTGCTGCGCC-3' SEQ IDN0: 17 5'-CCATAACATGGTCTATGCCACAACATCCCGCAGCGCAAGCCAGCGGC-3' IDNO: 18 SEQ
5'-GAAGAAGGTAACTTTTGACAGG-3' SEQ IDNO: 19 5'-CAAGTCCTGGATGACCACTACCG-3' SEQ IDN0: 20 3 O 5'-GACGTGCTCAAGGA-3' SEQ IDNO: 21 5'-ATGAAGGCGAAGGCGTCC-3' SEQ IDN0: 22 5'-GGAAGAAGCCTGTAAG-3' SEQ IDN0: 23 5'-GAACCTATCCAGCAAGGCCGTTAA-3' SEQ IDNO: 24 5'-ACCAGAGAAAGGAGGCCGC-3' SEQ ID NO:25 5'-ACCCAGACTTGGGG-3' SEQ ID NO:26 5'-TCTCCACCCTTCCTCAGGCT-3' SEQ ID NO:27 5'-CGAGTTCCTGGTGAATGCC-3' SEQ ID NO:28 5'-TGCCCTATGGGCTTCGCATATGAC-3' SEQ ID NO:29 5'-TTTCGACTCAACGGTCACCGAGAAT-3' SEQ ID NO:30 5'-GTTGAGGAGTCAATT-3' SEQ ID NO:31 5'-TTGGCCCCCGAAGCCAGACA-3' SEQ ID NO:32 5'-AAGGTCGCTTACAGAGC-3' SEQ ID NO:33 5'-ATCGGGGGTCCCCTGAC-3' SEQ ID NO:34 5'-TAACTCAAAAGGGCAGAG-3' SEQ ID NO:35 5'-ATGTTACTTGAAGGCCTCT-3' SEQ ID NO:36 5'-GATGCTTGTGTGCGGAGACGACCTC-3' SEQ ID NO:37 5'-GGTCGCGCACGATGCATCTGGCAAAAGGGTA-3' SEQ ID NO:38 5'-CACCACCCCTCTTGCGCGG-3' SEQ ID NO:39 5'-CTCCATCCTTCTAGCTCAGGAGCAA-3' SEQ ID NO:40 5'-AGTTACTGTCCCAGGGGGGG-3' SEQ ID NO:41 5'-TCCGGCTGCGTCCCAGT-3' SEQ ID NO:42 5'-CCGACCCCGCTGGTTCATGTGGTGCC-3' SEQ ID NO:43 2 5'-CTACCTGCTCCCGAACCGA-3' SEQ ID NO:44 5'-CTACCTGCTCCCCAACCGA-3' SEQ ID NO:45 Additionally, the nucleic acid sequences of the invention may be used as primers for the generation of variants or mutants of the sequences of the invention using a variety of methodologies known in the art, including site-directed mutagenesis procedures.
In another aspect, the nucleic acid sequences of the invention may be used in the construction or generation of, or incorporated into, infectious viruses, vectors or replicons. Provision or substitution of the functionally superior NSSB sequences of the invention for poorly functional or non-functional counterparts will serve to improve the infectious and replicative characteristics of the resulting virus or replicating unit. For example, Rice et al. (PCT WO 98/39031) provide an infectious nucleic acid of HCV. The NSSB
polymerase encoded by this infectious clone is shown in the present invention to be substantially inferior in its RdRp activity to those of the present invention.
Therefore, substitution of the NSSB encoding gene of Rice et al. with those of the present invention would be expected to result in improved virus replication due to the improved characteristics of the NSSB gene and encoded protein of the present invention. Such substitutions may be carried out by standard genetic engineering procedures well known in the art. The resulting infectious nucleic acid would have considerable advantages over current infectious clones of HCV, including, but not limited to, improved or higher level viral RNA synthesis, improved levels of infectious virus production and improved virus replication in living hosts and in in vitro systems.
Use in other systems in which the function of the HCV
NSSB polymerase is important, such as in complementing or trans-complementing systems, replicon systems, defective viruses, defective interfering particles and the like, would also benefit from the use of the nucleic acid sequences of the invention.
In another embodiment, the nucleic acid sequences of the invention may be used in methods to elicit immune responses to the HCV NSSB protein. For example, the NSSB-encoding nucleic acid sequences of the invention operationally linked to an expression operon may introduced directly into cells, particularly into antigen presenting cells such as dendritic cells, of a living host or human possessing a functioning immune system. Introduction of the sequences may utilize transfection, transformation, or transduction methods, or involve the physical uptake of particles coated with the NSSB nucleic acid sequences, such as plasmid-coated gold particles. Once inside cells, the NSSB sequences are expressed, processed and presented to the host's immune system. Such methods are useful in the elicitation of humoral and cellular immune responses in a living host and in humans and in vaccines for HCV.
The nucleic acid sequences of the invention may be further used in the generation of cell lines or cellular systems that express the HCV NSSB protein. Such cell lines in which a functional NSSB protein is expressed from the NSSB genes of the invention will have utility in methods for assaying materials for antagonistic or agonistic activity toward HCV. For example, assays may be established whereby intact cells expressing an HCV
NSSB protein of the invention are contacted with agents or materials suspected of affecting the intracellular activity of the HCV NSSB protein, and the affect of such agents on the HCV NSSB activity is measured. The affect of such agents on the HCV NSSB activity may be measured in any number of ways. For example, RNA synthesis that is directly or indirectly dependent on the HCV NSSB
polymerase activity may be quantified. In one manner, the amount of a radiolabeled precursor of RNA (e.g., 3H-uridine) that is incorporated into trichloroacetic acid-precipitable RNA that is dependent on NSSB activity may be measured.
Alternatively, such cell systems may utilize a reporter system in which the production of the reporter signal is dependent on RNA synthesis by the HCV NSSB
polymerase. In one embodiment, a RNA substrate of the HCV NSSB polymerase is provided that is the antisense strand of an mRNA, the sense strand (mRNA) of which is effectively translated to produce a polypeptide capable of being detected or of producing a detectable signal (the reporter). For example, an RNA molecule is provided comprising the sequence complementary to the coding sequence of luciferase (antisense strand). The activity of the HCV NSSB polymerase on this RNA results in the production of the sense strand of the luciferase gene, which is then translated by the cellular translational system to produce luciferase protein. The luciferase protein then may be detected by antibodies to the luciferase protein or by measurement of luciferase enzymatic activity in intact cells or in cellular extracts using a luminometer or other similar device.
Numerous other reporters may serve equally well in this application including but not limited to, ~i-galactosidase, alkaline phosphatase, fluorescent green protein and the like. Furthermore, the cell systems that may be used in this method of the invention may be of bacterial, fungal, insect, avian, mammalian or plant origin.
Further, the nucleic acid sequences of the invention may be used in assays to identify agents or materials capable of interacting with or affecting the HCV NSSB nucleic acid sequences. For example, assays may be established in which nucleic acid sequences of the invention are provided and then contacted with agents or materials suspected of interacting with such sequences. Agents identified in such interaction assays would then have potential diagnostic utility and uses in the detection of HCV in, for example, biological samples. Such agents would also have potential utility in applications involving the prevention or treatment of HCV disease in an affected living host, including humans, and for the inhibition or enhancement of HCV
replication or propagation in living hosts and in in vitro systems such as cell, tissue and organ cultures.
Additional applications may be envisioned once the nature of the particular agent is clear.
The HCV NSSB protein compositions of the invention also have broad utility. In diagnostic applications, for example, the NSSB proteins, or peptides thereof, may be used in assays for the detection of immune responses to the same. For example, protein sequences or peptides of the invention rnay be used in assays in which said sequences are immobilized on a matrix and used to capture antibodies directed to said sequences.
Additionally, protein sequences or peptides of the invention may be used to detect or measure cell-mediated immune responses to the protein, such as in immune cell proliferation assays.
The HCV NSSB protein compositions of the invention also have potential utility in the elicitation of immune responses, such as in vaccines. For example, provision of the NSSB proteins of the invention, or peptides thereof, to a living organism with a functioning immune system will cause such organism to mount an immune response to the NSSB sequences. The NSSB sequences may be presented to the living organism in any number of assays well known to those trained in the art and include, but are not limited to, providing free protein or peptides, formulated protein or peptides, adjuvanted protein or peptides, protein or peptides in the context of intact or disrupted cells in which NSSB sequences are present and other such manners. Immune responses so elicited may be either humoral or cellular in nature, or both. Such immune responses may be important in protecting living hosts from HCV disease and may also provide or serve as a source of useful immunological reagents such as antibodies, that may further have therapeutic or diagnostic utility. The NS5B proteins of the invention, or peptide portions thereof, may further be used to select or purify such antibodies to NSSB.
For example, NSSB protein may be immobilized and used to bind antibodies specific to the NSSB protein, and thus enrich for such antibodies. Furthermore, the NSSB
proteins and peptides of the invention may be used to produce monoclonal antibodies to the NSSB protein using standard techniques known in the art. Antibodies to the NSSB protein, whether polyclonal or monoclonal, may be further evaluated for their ability to affect the enzymatic activity of the NSSB RdRp activity.
Several examples of portions of the NSSB protein sequences useful in the above applications comprise sequences or portions thereof, provided in Table 2.
Table 2 Peptides Useful in Methods of the Invention SMSYTWTGALITPCAAEESKLPINALSNSLLRHHNMVYATTSRSASQRQK
lO KVTFDRLQVLDDHYRDVLKEMKAKASTVKA SEQ ID NO: 46 SVEEACKLTPPHSARSKFGYGAKDVRNLSSKAVNHIHSVWKDLLEDT SEQ ID NO: 47 ETPIDTTIMAKNEVFCVQPEKGGRKPARLIVYPDLGVRVC SEQ ID NO: 48 SSYGFQYSPGQRVEFLVNAWKSKKCPMGFAYDTRCFDSTVTENDIRVEESIY
QCCDLAPEARQAIRSLTERLYIGGPLTNSKGQSCGYRRCRASGVLTTSCG SEQ ID NO: 49 CTMLVCGDDLWICESAGTQEDAASLRVFTEAMTRYSAPPGDPPQPEYDLELITSC
SEQ ID NO: 50 2 O SVAHDASGKRWYLTRDPTTPLARAAWETARHTPVNS SEQ ID NO: 51 CLRKLGVPPLRVWRHRARSVRAKLLSQGG SEQ ID NO: 52 FVAGYSGGDIYHSLSRARPRWFMWC SEQ ID NO:' 53 The protein compositions of the invention have utility in assays for the detection and identification of agents capable of interacting with or affecting the HCV NSSB protein. Assays may be established in which HCV NSSB polypeptide sequences of the invention are provided and then contacted with agents or materials suspected of interacting with such sequences. For example, upon provision of the HCV NS5B protein of the invention, or fragment or portion thereof, contacted agents may be assessed for their ability to bind specifically to the protein. Such binding agents would then have potential diagnostic utility and uses in the detection of HCV in, for example, biological samples.
Such binding agents may further affect the functional activity of the HCV protein, such as either inhibiting or enhancing the HCV NS58 function. Agents that inhibit the function of the NSSB protein would have potential utility in applications involving the prevention or treatment of HCV disease in an affected living host or for the inhibition of HCV replication or propagation in living hosts, including humans, in in vitro systems such as cell, tissue and organ cultures or in biological materials. Agents that enhance the function of the NSSB
protein would have potential utility in applications involving the replication, propagation or production of HCV in living hosts, such as in animal models of HCV
replication, and in in vitro systems such as cell, tissue and organ cultures.
In another embodiment, methods of assay are provided in which the HCV NSSB polymerase activity furnished by an enzymatically active NSSB protein of the invention is measured directly. Agents placed in contact with said enzymatically active NSSB polymerase may be assessed for their ability to specifically affect this enzymatic activity. Such enzymatically active polymerase may be provided in an extract or lysate of a cell in which the polypeptide was produced, in an in vitro cell-free expression system or in an enriched or purified form.
There are numerous means by which the enzymatic activity of the HCV NSSB protein provided in an extract, cell-free system or enriched form may be assessed, and these are well known in the art. NSSB-dependent RNA synthesis typically requires certain reaction components including minimally a buffered medium, a divalent ration, precursors of RNA (nucleoside triphosphates, NTPs), an RNA template and a primer for RNA synthesis on that template. Additional components may include monovalent rations, reducing agents, stabilizers, cofactors and inhibitors of activities unrelated to the NSSB RdRp activity such as inhibitors of RNase, phosphatase, kinase, phosphotransferase and similar activities.
Measurement of NSSB-dependent RNA synthesis may be assessed in numerous manners. In one example, the incorporation of a precursor of RNA into a polymer of RNA is measured, such as the incorporation of a radiolabeled NTP into trichloroacetic acid-precipitable RNA, which may then be quantified by scintillation spectrometry or phosphorimaging technologies. Such precursors may alternatively be tagged with other moieties to allow their ready detection such as with biotin for detection with avidin reagents including various avidin conjugates such alkaline phosphatase and the like or with fluorescently-labeled NTPs for detection using fluorescent technologies such as fluorescence polarization.
NSSB-dependent RNA synthesis may also be assessed by measuring the extension of a pre-labeled or tagged primer of RNA synthesis such as a radiolabeled or biotin-tagged oligonucleotide that is used by the polymerase to initiate RNA synthesis on a template RNA
molecule. Extension of the primer may be assessed by quantifying the addition of nucleoside triphosphates to the primer, by determining the length of the primer product, or by other methods known in the art.
Alternatively, the product of NSSB RdRp activity may be detected and quantified by capture of the product RNA using hybridization techniques. For example, an oligonucleotide complementary to the product of the NSSB
RdRp reaction may be introduced during or after the reaction and hybridized to the product. The extent of hybridization of the added oligonucleotide may be used as a measure of the amount of product RNA present in the mixture and may be assessed by various means known in the art.
Other means of detection of the products of NSSB
RdRp activity are readily known to, or can be envisioned by, the skilled artisan and are fully contemplated here.
Assays involving the nucleic acid and polypeptide compositions of the invention may be formatted in any number of configurations. Particularly useful for evaluating large numbers of agents and materials are high throughput screening formats. Traditionally such assays were typically formatted in 96 well plates.
However, 384, 864 and 1536 well plates may be used in such high throughput assay systems. These systems are often automated using robotics technologies to allow manipulation and processing of large numbers of samples.
The agents or materials that may be evaluated in the various assay methods of the invention for potential antagonistic or agonistic affects include but are not limited to small molecules, polymers, peptides, polypeptides, proteins, immunoglobulins or fragments thereof, oligonucleotides, antisense molecules, peptide-nucleic acid conjugates, ribozymes, polynucleotides and the like. The potential utility of agents or materials identified using the compositions and assay methods of the invention will be broad and will include uses for the detection and isolation of HCV nucleic acids and polypeptides, for the detection or diagnosis of HCV, for the prevention and treatment of HCV disease in an affected living host, including humans, and for the inhibition or enhancement of HCV replication or propagation in living hosts and in in vitro systems such as cell, tissue and organ cultures, as well as for other uses the may be envisioned once the nature of the agent is clear.
Another feature of the invention includes kits to facilitate the use of the compositions and methods disclosed herein. Exemplary kits would include HCV NSSB
nucleic acids and polypeptides of the invention, and/or variants thereof, alone or in suitable vectors. Also included would be protocols for use of the compositions of the invention for the particular application and the necessary reagents to carry out the application. Such reagents may include, but not be limited to, buffers, solvents, media and solutions, substrates and cofactors, vectors and host cells, and detection or reporter reagents. Accessory items may include vials, vessels, reaction chambers and instruction sheets.
The following examples are provided to describe the invention in further detail. These examples, which set forth the preferred mode presently contemplated for carrying out the invention, are intended to illustrate and not to limit the invention.
Cloning and Expression of IiCV NSSB Genes RNA isolated from the serum of an HCV-infected patient was used to amplify the HCV NSSB gene using an RT-nested PCR protocol. Using the following first round primers: 5'-TGA GGA TGT CGT CTG CTG CTC AAT GTC C-3' and 5'-GGG ATG GCC TAT TGG CCT GGA GT-3', the RT
reaction was performed at 50°C for 50 minutes followed by a 1 minute 94°C denaturation, followed by 40 cycles of first round PCR, 15 cycles of 94°C for 30 seconds, 50°C for 30 seconds 68°C for 2 minutes and 25 cycles of 94°C for 30 seconds, 50°C for 30 seconds, 68°C for 2 minutes.
A portion of first round PCR reaction mixture was then used in the second round PCR reaction in which the following nested primers were incorporated: 5'-AAC AGA
TCT GAA TTC TTA TAA ATA TGT CAA TGT CCT ACA CAT GGA C-3' and 5'-TGC TCT AGA GCG GCC GCT CAT CAT CGG TTG GGG AGC
AGG TAG-3', which included EcoRI and NotI restriction sites, respectively (underlined) for subsequent cloning purposes. The second round PCR involved an initial denaturation at 94°C for 1 minute, followed by 10 cycles of 94°C for 45 seconds, 50°C for 30 seconds, 68°C for 2 minutes and 20 cycles of 94°C for 30 seconds, 50°C for 30 seconds, 68°C for 2 minutes.
The resultant PCR product was purified, digested with EcoRI and NotI and ligated to pFastBac plasmid (Gibco-BRL) previously digested with EcoRI and NotI.
The ligation mixture was transformed into DH5 E. coli cells. Plasmids from bacterial colonies containing the HCV NSSB gene were used to generate a recombinant baculovirus by the transposition method of the Bac-to-Bac system (Gibco-BRL). After transformation of the HCV NSSB gene-containing pFastBac plasmid DNA into E. coli DHlOBac cells, several colonies containing bacmid DNA were transfected into Sf9 insect cells according to the protocol supplied by the manufacturer.
NSSB protein expression in recombinant baculovirus-infected cells was verified by Western immunoblot analysis with antiserum specific to the HCV
NSSB sequences.
Six independently isolated clones (clones 4, 14, 21, 11, 16 and 20) of the HCV NSSB gene from a single RNA preparation derived from one patient were sequenced.
The nucleotide sequences of these clones are provided by SEQ ID NO: 1, 3, 4, 5, 6 and 7, respectively. All six sequences were derived from a genotype lb virus and are closely related, but not identical, to one another.
Each of the sequences set forth above is unique and novel sequence, not presently listed in the GenBank database. The deduced amino acid sequences of nucleotide sequences identified by SEQ ID NO: l, 3, 4, 5, 6 and 7 are provided by SEQ ID NO: 2, 8, 9, 10, 11 and 12, respectively. These NSSH amino acid sequences are aligned relative to clone 4 (SEQ ID NO: 2) in Figure 1. As revealed in this alignment, the sequence of the NSSB protein of clones 14, 21, 11, 16 and 20 differs from that of clone 4 by 2, 5, 3, 4 and 3 amino acids, respectively.
Purification of HCV NS5B Proteins HCV NSSB proteins may be obtained in purified form from recombinant protein-expressing cell systems by any number of procedures known to the trained artisan, several of which are exemplified in Current Protocols in Molecular Biology, Frederick M. Ausubel et al. eds., John Wiley & Sons, 1995 which is incorporated by reference herein.
In the case of the present example, baculovirus clone 4-infected insect cells were disrupted in lysis butter (50~ glycerol, 20 mM Tris-HC1, pH 7.5, 10 mM
dithiothreitol (DTT), 0.5 M NaCl, 1 mM EDTA, 2~ Triton X-100) supplemented with a Complete Protease Inhibitor tablet (Boehringer Mannheim). MgCl2 was then added to a final concentration of 10 mM, followed by 10 units DNase I (RQ-1, Promega). After 30 minutes on ice, the lysate was clarified by centrifugation at 35,000 rpm for 35 minutes at 4°C.
The clarified lysate was diluted to a final NaCl concentration of 0.3 M with elution buffer (205 glycerol, 20 mM Tris-HC1, pH 7.5, 10 mM DTT, 1 mM EDTA, 0.5~ Triton X-100), and incubated with DEAE Sepharose equilibrated in elution buffer containing 0.3 M NaCl at 4°C. The mixture was then poured into a column, and flow-through material was collected. Flow-through material was diluted to a final NaCl concentration of 0.2 M with elution buffer and loaded onto a heparin Sepharose column equilibrated in elution buffer containing 0.2 M NaCl. Bound proteins were eluted with a linear gradient of NaCl (200 mM to 1 M NaCl in elution buffer) while fractions were collected.
NSSB-containing fractions were pooled and loaded onto a Cibacron Blue column equilibrated in elution buffer containing 0.4 M NaCl. Bound proteins were eluted with a linear gradient of NaCl (400 mM to 4M NaCl in elution buffer) while fractions were collected.
NSSB-containing fractions were pooled and dialyzed against 50~ glycerol, 10 mM Tris-HC1, pH 7.2, 50 mM
NaCl, 1 mM EDTA, 0.01 Triton X-100 and stored at -20°C.
Typical purification results are shown in Figure 2.
Enzymatic Activity of Purified HCV NSSH Proteins There are numerous methodologies for the measurement of RNA-dependent RNA polymerase activity that are well known to one of ordinary skill in the art.
One approach for measuring the HCV NSSB RdRp activity uses a purified recombinant NSSB protein in an in vitro RdRp assay. For example, Behrens et a1. [EMBO
J. 15:12-22 (1996)] describe the baculovirus expression, purification and enzymatic activity of the HCV NSSB RdRp derived from the BK strain of HCV. In another example, PCT WO 97/12033 [PCT/US96/15571] discloses the bacterial expression, purification and enzymatic activity of the HCV NSSB RdRp derived from an HCV sample obtained from the Centers for Disease Control and several truncated and modified versions of this sequence. Another example is Lohmann et al. [J Virol 71:8416-8428 (1997)], in which the NSSB gene derived from a chronically infected patient was expressed with recombinant baculoviruses in insect cells, purified and enzymatically evaluated. Yet another example is Yuan et al. [Biochem Biophys Res Comm 232:231-235 (1997)], in which the bacterial expression, purification and enzymatic activity of the HCV NS5B RdRp derived from a patient with chronic sporadic hepatitis is described.
Purified NSSB protein prepared according to Example 2 was incubated in a 10 ,uL standard reaction mixture consisting of 20 mM HEPES, pH 7.5, 3 mM MgCl2, 1 mM
dithiothreitol, 400U/mL RNasin (Gibco/BRL), 0.5 mM each of UTP, ATP and CTP, 0 . 1 ,uM [3zP] GTP and 0 . 03 ,ug pOF1213 RNA at 30°C for 60 minutes. The reaction is terminated by the addition of cold trichloroacetic acid (TCA) and sodium pyrophosphate. The TCA-precipitable radioactivity was then quantified to determine the extent of RdRp activity.
In addition to the NSSB proteins derived from clones 4, I4, 21, 11, 16 and 20 of the invention, the NSSB gene of the sequence derived from the genotype la consensus sequence infectious clone as described by Kolykhalov et al. (GenBank Accession Number AF009606) was expressed and purified in the same manner as the proteins of the invention. Table 3 presents a direct comparison of the enzymatic activities of the NSSB
proteins of the invention and the consensus sequence protein of Kolykhalov.
Table 3 Comparison of RdRp Activities of Various HCV NSSB
Proteins specific amino acid changes Protein activity* relative to clone clone 4 (SEQID N0:2) 9.3 --2 0 clone 14(SEQID NO:8) 1.7 2 clone 21(SEQID NO:9) 1.9 5 clone 11(SEQID NO:10) 0.2 3 clone 16(SEQID NO:11) 0.1 4 clone 20(SEQID NO:12) <0.1 3 AF009606 0.9 71 * pmole NTP incorporated per E.cg NSSB protein per 60 minutes under standard reaction conditions.
Surprisingly, a considerable range of enzymatic activities was observed among these distinct NSSB
proteins. The NSSB protein derived from clone 4 possessed the greatest activity in this comparison, while the activities of clone 14 and 21 were moderate, those of clone 11 and 16 were minimal and that of clone 20 was undetectable. The activity of the genotype la consensus NSSB protein of Kolykhalov was substantially less than that clone 4 of the invention. Lohmann et al.
reported a specific activity of their genotype lb NSSB
protein on a heteropolymeric RNA template to be 1.7 pmol//.cg/120 minutes, similar to the activity reported here for the Kolykhalov enzyme, but also significantly below that of the clone 4 enzyme.
This example demonstrates a range of functional activities among cloned and expressed NSSB sequences, from very active to inactive. In this analysis of 6 NSSB proteins of the invention, there are three instances (clones 11, 16 and 20) of NSSB proteins that are poorly functional or non-functional and three instances (clones 4, 14 and 21) of NSSB proteins that are functional.
It is further revealed here that surprisingly very few changes in amino acid sequence can be sufficient to dramatically alter the enzymatic activity of the NSSB
protein. While sequence changes within known or predicted active sites or conserved sequence motifs of an enzyme might be expected to effect an enzyme's activity, most amino acid changes among the 6 NSSB
sequences of this comparison lie outside consensus motifs of RdRp enzyme identified by Koonin [J. Gen.
Virol. 72:2197-2206 (1991)] and Poch et al. [EMBO J.
8:3867-3874 (1989)]. The two exceptions to this are as follows. Clone 16 possesses a single residue change within motif III and VI, and clone 21 possesses a single conservative amino acid change within motif VI (Figure 1). This notwithstanding, the effect of these amino acid changes, and of the others among the NSSB sequences of this example, on the RdRp activity of the NSSB
protein is surprising and could not have been anticipated from prior art.
The data presented in this example also demonstrate that the NSSB RdRp activity derived from clone 4 has dramatically superior activity over that of the NS5B
derived from the infectious clone identified by GenBank Accession Number AF009606. This result indicates that the mere generation of a consensus sequence of an NSSB
protein does not necessarily provide an NSSB protein with optimal functionality.
HCV NSSB Sequence Alignments The NSSB sequences of the invention are distinct from NSSB sequences previously characterized as functional. This is demonstrated by the sequence alignments presented in Figures 3, 4 and 5.
The sequence disclosed by Kolykhalov et al.
(GenBank Accession Number AF009606) represents a consensus sequence of known NSSB sequences derived from genotype la HCV. Figure 3 shows an alignment of the amino acid sequence of clone 4 (SEQ ID NO: 2) of the invention with that of this genotype la consensus sequence. There are 71 amino acid differences between these two sequences (excluding the initiator methionine residue in clone 4). This demonstrates that the clone 4 NS5B sequence of the invention is distinct from the genotype la consensus sequence. Alignment of this genotype 1a consensus sequence with all other sequences of the invention similarly demonstrates the distinct nature of the sequences of the invention. Also included in the alignment in Figure 3 is the genotype la sequence disclosed in PCT WO 97/12033, the NSSB protein from which was demonstrated to possess RdRp activity.
Inspection of this alignment reveals 72 amino acid differences between the sequences, again demonstrating the unique nature of the sequences of the invention.
The sequences of the invention are also distinct from a genotype lb consensus sequence. A genotype lb consensus sequence was generated based on alignment of 29 genotype lb NSSB sequences found in the GenBank database. Comparison of this consensus sequence with that of the clone 4 (SEQ ID NO: 2) of the invention shows that these sequences are distinct (Figure 4).
After the initiator methionine (at position -1), the clone 4 sequence differs from this genotype lb consensus sequence by 13 amino acids. Alignment of this genotype lb consensus sequence with all other sequences of the invention similarly demonstrates the distinct nature of the sequences of the invention. Also included in the alignment in Figure 4 are the genotype lb sequences disclosed by Behrens et a1. (GenBank Accession Number M58335) and by Lohmann et al. (GenBank Accession Number 297730). The NSSB proteins encoded by these sequences have been previously demonstrated to possess RdRp activity. Clone 4 is again distinct in that it possesses 17 amino acid changes relative to M58335 and 12 changes relative to 297730.
The sequences of the invention are further distinct from a genotype lb sequence derived from an infectious clone (Yanagi et al. Virology 244:161-172 (1998);
SS
GenBank Accession Number AF054247~. As shown in alignment presented in Figure 5, the clone 4 sequence (SEQ ID NO: 2) differs by 25 amino acid residues, excluding the methionine residue at position ~~1 in clone 4.
These alignments reveal the unique nature of sequences of the invention relative to these genotype lb sequences.
Therefore, based on comparisons with both genotype la and genotype lb consensus sequences, the NSSB
sequences of the invention do not represent a consensus sequence. Thus, based on the consensus sequence method for deducing sequence functionality, it would not be apparent that clone 4 is a functional RdRp or a functionally superior RdRp. Moreover, based on comparisons with NSSB sequences previously demonstrated to have functional RdRp activity, the sequence of clone 4 and of the other sequences of the invention are distinct from these RdRp sequences, and again, would not a priori be assumed to possess RdRp activity, and further not suspected of possessing superior RdRp activity.
HCV N85B Proteins with Improved Activity Based on sequence comparisons among NSSB sequences of the invention, a number of modified NSSB sequences were constructed in which particular amino acids were changed. These modified sequences were generated by standard site-specific mutagenesis procedures [Picard et a1. Nucleic Acid Res. 22:2587-2591 (1994)). Modified genes were engineered in the baculovirus expression system as described in Example 1, purified according to Example 2 and evaluated for RdRp activity according to Example 4.
The sequence of clone 20 differs from that of clone 4 at three amino acid residues. The presence of a valine (V) residue at position -1 of the clone 20 NSSB
protein instead of an initiator methionine (M) suggests that the NSSB protein produced from clone 20 is initiated at the methionine at position 2, and further, that protein produced from this methionine residue is inactive. The V change in clone 20 is likely an artifact of molecular cloning procedures (mistaken sequence in a primer oligonucleotide). The V residue position -1 in clone 20 was changed to M, yielding clone 20(V-1M), identified by SEQ ID NO: 13, which now differs from the sequence of clone 20 by one amino acid (at residue -1) and from clone 4 by two amino acids (at residues 177 and 543). The RdRp activity of the purified NSSB protein derived from clone 20(V-1M) was dramatically increased over that of clone 20 and significantly improved over that of clone 4 (Table 4).
Additional residue changes among the NSSB sequences of the invention can lead to useful and functional proteins. For example, when the alanine (A) residue at position 75 in clone 4 is changed to valine (V), the residue found at this position in clone 14, the resulting clone, clone (A75V), shows considerable RdRp activity (Table 4). In another example, the asparagine (N) residue in clone 4 at position 177 was changed to aspartic acid (D), the residue found at this position in all other clones of the invention, yielding clone 4(N177D). This clone showed very good RdRp activity (Table 4). In a third example, when the serine (S) at position 543 in clone 4 is changed to proline (P), as is found in clone 20, yielding clone 4(S543P), a functional RdRp is generated (Table 4).
Table 4 RdRp Activities of Various HCV NS5B Proteins Protein# specific activity clone 20 (SEQ ID NO: 12) < 0.1 clone 20(V-1M) (SEQ ID NO: 13) 23.5 clone 4 (SEQ ID NO: 2) 9.3 clone 4(A75V) (SEQ ID NO: 54) 3.5 clone 4(N177D) (SEQ ID NO: 55) 7.2 clone 4(S543P) (SEQ ID NO: 56) 3.5 * pmole NTP incorporated per E.cg NS5B protein per 60 minutes under standard reaction conditions.
# All of the changes in table 4 may also be made to the other NSSH encoding amino acid sequences set forth herein i.e. SEQ
ID NOS: 8, 9, 10, 11, 12, 13. and thus are contemplated to be within the scope of the invention.
This example demonstrates that amino acid residue changes may be made in the sequence of the NS5B protein and that such changes may maintain the functional activity of the resulting protein. Moreover, the amino acid substitutions may be either conservative or non-conservative in nature.
Additional changes of the amino acid residues among the NSSB sequences of the invention in various combinations are contemplated to be within the scope of the invention.
Novel HCV N85B Proteins with Improved Activity Another strategy for investigating functional NSSB
sequences involves the introduction of unique amino acid substitutions at positions where amino acid residues are conserved in known NSSB sequences. For example, all known NSSB sequences have as the amino terminal amino acid (position 1) a serine residue. Several modified versions of clone 4 were constructed in which this serine was substituted with either alanine [clone 4(S1A)], glycine [clone 4(S1G)] or threonine [clone 4(S1T)]. Surprisingly, all of the NSSB proteins derived from these novel sequences exhibited substantial RdRp activity. However, substitution at this position with tyrosine (Y) [clone 4{S1Y)] yielded an inactive NSSB
protein (Table 5).
Similarly, all known NSSB sequences have a methionine residue at position 2. Modified versions of clone 4 were constructed in which this methionine was substituted with either alanine [clone 4(M2A)], leucine [clone 4 (M2L) ] or threonine [clone 4 (M2T) ] .
Surprisingly, all of these novel NSSB proteins exhibited substantial RdRp activity.
In a final example, addition of an amino acid residue prior to the first residue of the mature NSSB
protein {serine at position 1), as in clone 4(MAS), in which an alanine residue is inserted before the serine residue, yields a substantially functional NSSB RdRp (Table 5).
These findings, in which amino acid substitutions are made at residues for which there is no naturally occurring variation and that result in the generation of functional, as well as dramatically improved functional, NSSB proteins, were totally unanticipated.
Moreover, these data demonstrate that the nature of amino acid residue changes capable of giving rise to functional variants of NSSB is not limited to conservative amino acid substitutions. For example, while a substitution of threonine for serine at position 1 can be viewed as a conservative amino acid substitution, the substitution with glycine represents a dramatic change in the chemical nature of the amino acid side-chain. Similarly, substitution of the methionine residue at position 2 with leucine represents a conservative change. However, replacement with threonine, a clear non-conservative change, yields a functional and functionally improved NSSB protein.
Based on these discoveries, it is therefore fully contemplated here that additional changes of the amino acid residues among the NSSB sequences of the invention, both conservative and non=conservative in nature, at various residue positions and in various combinations will yield useful NSSB compositions and are therefore within the scope of the invention.
Table 5 RdRp Activities of Various HCV NSSB Proteins Protein# specific activity clone 4 (SEQ IDNO: 2) 9.3 clone 4(S1G) (SEQ IDNO: 57) 23.0 clone 4(S1A) (SEQ IDNO: 58) 3.5 clone 4(S1T) (SEQ IDNO: 59) 3.8 clone 4(S1Y) (SEQ IDN0: 60) <0.1 clone 4(M2A) (SEQ IDN0: 61) 14.0 clone 4(M2L) (SEQ IDNO: 62) 13.0 clone 4(M2T) (SEQ IDN0: 64) 22.3 clone 4(MAS) (SEQ IDNO: 65) 15.0 * pmole NTP incorporated NSSB er 60 minutes per E.cg protein p under standard reaction conditions.
# while changes to SEQ N02 exemplifiedherein, the ID are recited alterations may also bemade to other NSSB amino the 2 acid sequences, i.e. SEQ 8, 9, 11, 12, 13.
0 ID NOS: 10, Thus, sequences so altered are also contemplated to be within the scope of the invention While Examples 5 and 6 demonstrate that various changes in the amino acid sequence of SEQ ID NO: 2 may be made to advantage, it is fully contemplated that the residue changes exemplified here will also have similar utility, either singly or in various combinations, in other NSSB sequences, including sequences of the invention (e.g., 8, 9, 10, 11 and 13, those of Tables 4 and 5), any natural allelic variants, mutants and derivatives of these and other NSSB sequences. That is to say, the changes described in Examples 5 and 6, when introduced into any NSSB sequence, will likely provide a functional or functionally improved NSSB, and are fully contemplated to be within the scope of the present invention.
Several examples of nucleic acid sequences encoding variant NSSB protein sequences useful in the practice of the invention comprise sequences provided in Table 6.
Table 6 Nucleic acid sequences encoding variant N858 Proteins*
Parental SEO ID Codon Position/Chanae SEQ ID~.NO: A codon encoding alanine at position 75 to any codon encoding valine SEQ IDNO:1 A codon encoding asparagine at positionto any codon encoding aspartic acid SEQ IDNO:1 A codon encoding serine at position 543 to any codon encoding proline SEQ IDNO:1 A codon encoding serine at position codon 1 to any encoding glycine SEQ IDNO:1 A codon encoding serine at position codon 1 to any encoding alanine SEQ IDNO:1 A codon encoding serine at position codon 1 to any encoding threonine SEQ IDNO:1 A codon encoding serine at position codon 1 to any encoding tyrosine SEQ IDNO:1 A codon encoding methionine at positionany codon 2 to encoding alanine SEQ IDNO:1 A codon encoding methionine at positionany codon 2 to encoding leucine SEQ IDNO:1 A codon encoding methionine at positionany codon 2 to encoding threonine SEQ IDN0:1 Insertion of any codon encoding alanine at -1 2 0 * While SEQ ID NO: 1 is exemplified in this table, the alterations recited may also be introduced into other NSSB encoding nucleic acid sequences set forth herein, i.e., SEQ ID NOS: 3, 4, 5, 6 and 7. Such altered nucleic acid sequences are also contemplated for use in the present invention.
The examples of Table 6 demonstrate various beneficial changes in the nucleic acid sequence of SEQ
ID N0: 1. In view of these results, it is expected that the changes exemplified in SEQ ID NO:1 will also have similar utility, either singly or in various combinations, in other NSSB sequences, including sequences of the invention (e.g., 3, 4, 5, 6 and 7,), WO 99/51781 . PCT/US99/07404 any natural allelic variants, mutants and derivatives of these and other NSSB sequences. That is to say, the changes described in this Table 6, when introduced into any NSSB sequence, will likely provide a functional or functionally improved NSSB, and are thus included in the scope of the present invention.
Utility of HCV NSSB Protein for Discovery of Antiviral Compositions The discovery of novel inhibitors of viral polymerases and related proteins often times requires the screening of large numbers of chemical compounds or mixtures of chemical compounds. Thus, an assay for polymerase activity that is capable of high volume screening, in other words, a high throughput assay, is desirable. There are a variety of assay methodologies well known to the trained artisan that allow the efficient screening of large numbers of samples [see, for example, Cole, JL, in Meth. Enzymology 275:310-328 (1996)], and may utilize any number of activity detection and measurement technologies including, but not limited to, radiometric, colorimetric, fluorogenic, or chemiluminescent, any one of which may be suitable in the case of the HCV NSSB RdRp activity.
In one approach, a high throughput assay of the RdRp activity of the functional HCV NSSB proteins of the invention is provided to enable the screening of large numbers of chemicals or other potential inhibitors for activity against the enzyme. The assay is formatted in 96-well microplates and measures polymerase activity on an RNA template-primer by the incorporation of radiolabeled NTP into trichloroacetic acid (TCA)-precipitable RNA product. Radioactivity may be quantified by either direct scintillation spectrometry or phosphorimaging technology. A phosphorimage of assay results obtained with the NSSB protein of Example 4 [clone 4] for one screening plate is presented in Fig.
6. The first (1) and last (12) columns of the plate contain activity and background controls and a titration of a reference inhibitor compound. Thus, wells A1, B1, A12 and B12 show the activity of the enzyme in the absence of any test compound (100% of the expected activity). In columns 1 and 12, wells C through F, a compound that was discovered to inhibit the HCV RdRp activity by use of the methods of the invention is included in decreasing concentrations. Wells H1 and H12 lack the HCV enzyme and illustrate the background (0%
RdRp activity) in the assay. In this example, the remaining 80 wells contain a collection of small organic compounds that were tested for their ability to affect the RdRp activity of the HCV NSSB protein. Thus, it can be seen that the material in wells G2, D10 and F10 represent potent inhibitors of the HCV RdRp activity.
This example demonstrates that HCV NSSB proteins may be used to advantage to identify and assess agents or materials that may affect the HCV RdRp and HCV
replication.
In summary, the disclosure of the present invention demonstrates that simple knowledge of an HCV NSSB
sequence is insufficient to allow one to conclude, or even reliably predict that such sequence is a functional sequence or has functional utility. Additionally, an HCV NSSB consensus sequence is not the only, and not necessarily the optimal, functional NS5B protein encoding sequence. The present invention provides novel NSSB sequences with unanticipated functionality.
Additionally, the present invention demonstrates that particular sequence changes in HCV NSSB can lead to unanticipated and significantly improved functionality.
In light of the foregoing, the NSSB sequences of the invention represent novel sequences with demonstrated functionality and utility and unique improvements over prior art. Finally, the HCV NSSB sequences of the invention have broad utility in research, diagnostic, therapeutic and pharmaceutical applications.
While certain embodiments of the present invention have been described and/or exemplified above, various other embodiments will be apparent to those skilled in the art from the foregoing disclosure. The present invention is, therefore, not limited to the particular embodiments described and/or exemplified, but is capable of considerable modification without departure from the scope of the appended claims.
SEQUENCE LISTING
<110> Viropharma, Incorporated <120> Hepatitis C Virus NS58 Compositions and Methods of Use Thereof <130> HEPPOL
<150> 60/080,509 <151> 1998-04-02 <150> 60/090,356 <151> 1998-06-23 <160> 53 <170> FastSEQ for Windows Version 3.0 <210> 1 <211> 1779 <212> DNA
<213> Hepatitis C Virus <400>
atgtcaatgtcctacacatggacaggcgctctgattacaccatgcgctgcggaggagagc 60 aagctgcccatcaatgcgctgagcaactctttgctgcgccaccataacatggtctatgcc 120 acaacatcccgcagcgcaagccagcggcagaagaaggtaacttttgacaggctgcaagtc 180 ctggatgaccactaccgggacgtgctcaaggagatgaaggcgaaggcgtccacagtcaag 240 gctaaacttctatccgtggaagaagcctgtaagctgacgcccccacattcagccagatcc 300 aaatttggctatggggcgaaggacgtccggaacctatccagcaaggccgttaaccacatc 360 cactccgtgtggaaggacttgctggaagacactgagacaccaattgacaccaccatcatg 420 gcaaaaaatgaggttttctgcgttcaaccagagaaaggaggccgcaagccagctcgccta 480 atcgtgtacccagacttgggggttcgcgtgtgcgagaaaatggccctctacaacgtggtc 540 tccacccttcctcaggctgtgatgggctcctcatacggattccagtactctcctggacag 600 cgggtcgagttcctggtgaatgcctggaagtcaaagaaatgccctatgggcttcgcatat 660 gacacccgctgtttcgactcaacggtcaccgagaatgacatccgtgttgaggagtcaatt 720 taccaatgttgtgacttggcccccgaagccagacaggccataaggtcgcttacagagcgg 780 ctttatatcgggggtcccctgactaactcaaaagggcagagctgcggttatcgccggtgc 840 cgtgcgagcggcgtactgacgactagctgcggtaataccctcacatgttacttgaaggcc 900 tctgcagcctgtcgagctgcaaagctccaggactgcacgatgcttgtgtgcggagacgac 960 ctcgtcgttatctgtgaaagcgcgggaacccaagaggacgcggcgagcctacgagtcttc 1020 acggaggctatgactaggtactctgccccccctggggacccgccccaaccagaatacgac 1080 ttggagctaataacatcatgctcctccaacgtgtcggtcgcgcacgatgcatctggcaaa 1140 agggtatactacctcacccgtgaccccaccacccctcttgcgcgggctgcgtgggagaca 1200 gctagacacactccagttaactcctggctaggcaacatcatcatgtatgcgcccactctg 1260 tgggcaaggatgattctgatgactcacttcttctccatccttctagctcaggagcaactt 1320 gaaaaagccctagattgtgagatctacggggcccactactccattgagccacttgaccta 1380 cctcagatcattcaacgactccatggtcttagcgcgttttcactccacagttactctcca 1440 ggtgaaatcaatagggtggcttcatgcctcaggaagcttggggtaccacccttgcgagtc 1500 tggagacatcgggccagaagcgtccgcgctaagttactgtcccagggggggagggctgcc 1560 acttgtggcaagtacctcttcaactgggcagtaaggaccaagcttaaactcactccaatt 1620 ccggctgcgtcccagttggacttatccggctggttcgttgctggttacagcgggggagac 1680 atatatcacagcctgtctcgtgcccgaccccgctggttcatgtggtgcctactcctactt 1740 tctgtaggggtaggcatctacctgctcccgaaccgatga 177g <210> 2 <211> 592 <212> PRT
<213> Hepatitis C Virus <400> 2 Met Ser Met Ser Tyr Thr Trp Thr Gly Ala Leu Ile Thr Pro Cys Ala Ala Glu Glu Ser Lys Leu Pro Ile Asn Ala Leu Ser Asn Ser Leu Leu Arg His His Asn Met Val Tyr Ala Thr Thr Ser Arg Ser Ala Ser Gln Arg Gln Lys Lys Val Thr Phe Asp Arg Leu Gln Val Leu Asp Asp His Tyr Arg Asp Val Leu Lys Glu Met Lys Ala Lys Ala Ser Thr Val Lys Ala Lys Leu Leu Ser Val Glu Glu Ala Cys Lys Leu Thr Pro Pro His Ser Ala Arg Ser Lys Phe Gly Tyr Gly Ala Lys Asp Val Arg Asn Leu Ser Ser Lys Ala Val Asn His Ile His Ser Val Trp Lys Asp Leu Leu Glu Asp Thr Glu Thr Pro Ile Asp Thr Thr Ile Met Ala Lys Asn Glu Val Phe Cys Val Gln Pro Glu Lys Gly Gly Arg Lys Pro Ala Arg Leu Ile Val Tyr Pro Asp Leu Gly Val Arg Val Cys Glu Lys Met Ala Leu Tyr Asn Val Val Ser Thr Leu Pro Gln Ala Val Met Gly Ser Ser Tyr Gly Phe Gln Tyr Ser Pro Gly Gln Arg Val Glu Phe Leu Val Asn Ala Trp Lys Ser Lys Lys Cys Pro Met Gly Phe Ala Tyr Asp Thr Arg Cys Phe Asp Ser Thr Val Thr Glu Asn Asp Ile Arg Val Glu Glu Ser Ile Tyr Gln Cys Cys Asp Leu Ala Pro Glu Ala Arg Gln Ala Ile Arg Ser Leu Thr Glu Arg Leu Tyr Ile Gly Gly Pro Leu Thr Asn Ser Lys Gly Gln Ser Cys Gly Tyr Arg Arg Cys Arg Ala Ser Gly Val Leu Thr Thr Ser Cys Gly Asn Thr Leu Thr Cys Tyr Leu Lys Ala Ser Ala Ala Cys Arg Ala Ala Lys Leu Gln Asp Cys Thr Met Leu Val Cys Gly Asp Asp Leu Val Val Ile Cys Glu Ser Ala Gly Thr Gln Glu Asp Ala Ala Ser Leu Arg Val Phe Thr Glu Ala Met Thr Arg Tyr Ser Ala Pro Pro Gly Asp Pro Pro Gln Pro Glu Tyr Asp Leu Glu Leu Ile Thr Ser Cys Ser Ser Asn Val Ser Val Ala His Asp Ala Ser Gly Lys Arg Val Tyr Tyr Leu Thr Arg Asp Pro Thr Thr Pro Leu Ala Arg Ala Ala Trp Glu Thr Ala Arg His Thr Pro Val Asn Ser Trp Leu Gly Asn Ile Ile Met Tyr Ala Pro Thr Leu Trp Ala Arg Met Ile Leu Met Thr His Phe Phe Ser Ile Leu Leu Ala Gln Glu Gln Leu Glu Lys Ala Leu Asp Cys Glu Ile Tyr Gly Ala His Tyr Ser Ile Glu Pro Leu Asp Leu Pro Gln Ile Ile WO 99/51781 PCTlUS99/07404 Gln Arg Leu His Gly Leu Ser Ala Phe Ser Leu His Ser Tyr Ser Pro Gly Glu Ile Asn Arg Val Ala Ser Cys Leu Arg Lys Leu Gly Val Pro Pro Leu Arg Val Trp Arg His Arg Ala Arg Ser Val Arg Ala Lys Leu Leu Ser Gln Gly Gly Arg Ala Ala Thr Cys Gly Lys Tyr Leu Phe Asn Trp Ala Val Arg Thr Lys Leu Lys Leu Thr Pro Ile Pro Ala Ala Ser Gln Leu Asp Leu Ser Gly Trp Phe Val Ala Gly Tyr Ser Gly Gly Asp Ile Tyr His Ser Leu Ser Arg Ala Arg Pro Arg Trp Phe Met Trp Cys Leu Leu Leu Leu Ser Val Giy Val Gly Ile Tyr Leu Leu Pro Asn Arg 580 585 59p <210> 3 <211> 1779 <212> DNA
<213> Hepatitis C Virus <400>
atgtcaatgtcctacacatggacaggcgctctgattacaccatgcgctgcggaggagagc 60 aagctgcccatcaatgcgctgagcaactctttgctgcgccaccataacatggtctatgcc 120 acaacatcccgcagcgcaagccagcggcagaagaaggtaacttttgacaggctgcaagtc 180 ctggatgaccactaccgggacgtgctcaaggagatgaaggcgaaggtgtccacagtcaag 240 gctaaacttctatccgtggaagaagcctgtaagctgacgcccccacattcagccagatcc 300 aaatttggctatggggcgaaggacgtccggaacctatccagcaaggccgttaaccacatc 360 cactccgtgtggaaggacttgctggaagacactgagacaccaattgacaccaccatcatg 420 gcaaaaaatgaggttttctgcgttcaaccagagaaaggaggccgcaagccagctcgccta 480 atcgtgtacccagacttgggggttcgcgtgtgcgagaaaatggccctctacgacgtggtc 540 tccacccttcctcaggctgtgatgggctcctcatacggattccagtactctcctggacag 600 cgggtcgagttcctggtgaatgcctggaagtcaaagaaatgccctatgggcttcgcatat 660 gacacccgctgtttcgactcaacggtcaccgagaatgacatccgtgttgaggagtcaatt 720 taccaatgttgtgacttggcccccgaagccagacaggccataaggtcgcttacagagcgg 780 ctttatatcgggggtcccctgactaactcaaaagggcagagctgcggttatcgccggtgc 840 cgtgcgagcggcgtactgacgactagctgcggtaataccctcacatgttacttgaaggcc 900 tctgcagcctgtcgagctgcaaagctccaggactgcacgatgcttgtgtgcggagacgac 960 ctcgtcgttatctgtgaaagcgcgggaacccaagaggacgcggcgagcctacgagtcttc 1020 acggaggctatgactaggtactctgccccccctggggacccgccccaaccagaatacgac 1080 ttggagctaataacatcatgctcctccaacgtgtcggtcgcgcacgatgcatctggcaaa 1140 agggtatactacctcacccgtgaccccaccacccctcttgcgcgggctgcgtgggagaca 1200 gctagacacactccagttaactcctggctaggcaacatcatcatgtatgcgcccactctg 1260 tgggcaaggatgattctgatgactcacttcttctccatccttctagctcaggagcaactt 1320 gaaaaagccctagattgtgagatctacggggcccactactccattgagccacttgaccta 1380 cctcagatcattcaacgactccatggtcttagcgcgttttcactccacagttactctcca 1440 ggtgaaatcaatagggtggcttcatgcctcaggaagcttggggtaccacccttgcgagtc 1500 tggagacatcgggccagaagcgtccgcgctaagttactgtcccagggggggagggctgcc 1560 acttgtggcaagtacctcttcaactgggcagtaaggaccaagcttaaactcactccaatt 1620 ccggctgcgtcccagttggacttatccggctggttcgttgctggttacagcgggggagac 1680 atatatcacagcctgtctcgtgcccgaccccgctggttcatgtggtgcctactcctactt 1740 tctgtaggggtaggcatctacctgctccccaaccgatga 1778 <210> 4 <211> 1779 <212> DNA
<213> Hepatitis C Virus <400> 4 atgtcaatgt cctacacatg gacaggcgct ctgattacac catgcgctgc ggaggagagc 60 aagctgcccatcaatgcgctgagcaactctttgctgcgccaccataacatggtctatgcc120 acaacatcccgcagcgcaagccagcggcagaagaaggtaacttttgacaggctgcaagtc180 ctggatgaccactaccgggacgtgctcaaggagatgaaggcgaaggcgtccacagtcaag240 gctaaacttctatccgtggaagaagcctgtaagctgacgcccccacattcagccagatcc300 aaatttggctatggggcgaaggacgtccggaacctatccagcaaggccgttaaccacatc360 cactccgtgtggaaggacttgctggaagacactgagacaccaattgacaccaccatcatg420 gcaaaaaatgaggttttctgcgttcaaccagagaaaggaggccgcaagccagctcgccta480 atcgtgtacccagacttgggggttcgcgtgtgcgagaaaatggccctctacgacgtgatc540 tccacccttcctcaggctgtgatgggctcctcatacggattccagtactctcctggacag600 cgggtcgagttcctggtgaatgcctggaagtcaaagaaatgccctatgggcttcgcatat660 gacacccgctgtttcgactcgacggtcaccgagaatgacatccgtgttgaggagtcaatt720 taccaatgttgtgacttggcccccgaagccagacaggccataaggtcgcttacagagcgg780 ctttatatcgggggtcccctgactaactcaaaagggcagagctgcggtcatcgccggtgc840 cgtgcgagcggcgtactgacgactagctgcggtaataccctcacatgttacttgaaggcc900 tctgcagcctgtcgagctgcaaagctccaggactgcacgatgcttgtgtgcggagacgac960 ctcatcgttatctgtgaaagcgcgggaacccaagaggacgcggcgagcctacgagtcttc1020 acggaggctatgactaggtactctgccccccctggggacccgccccaaccagaatacgac1080 ttggagctaataacatcatgctcctccaacgtgtcggtcgcgcacgatgcatctggcaaa1140 agggtatactacctcacccgtgaccccaccacccctcttgcgcgggctgcgtgggagaca1200 gctagacacactccagttaactcctggctaggcaacatcatcatgtatgcgcccactctg1260 tgggcaaggatgattctgatgactcacttcttctccatccttctagctcaggagcaactt1320 gaaaaagccctagattgtgagatctacggggcccactactccattgagccacttgaccta1380 cctcagatcattcaacgactccatggtcttagcgcgttttcactccacagttactctcca1440 ggtgaaatcaatagggtggcttcatgcctcaggaagcttggggtaccacccttgcgagtc1500 tggagacatcgggccagaagcgtccgcgctaagttactgtcccagggggggagggctgcc1560 acttgtggcaagtacctcttcaactgggcagtaaggaccaagcttaaactcactccaatt1620 ccggctgcgtcccagttggacttatccggctggttcgttgctggttacagcgggggagac1680 atataccacagcctgtctcgtgcccgaccctgctggttcatgtggtgcctactcctactt1740 tctgtaggggtaggcatctacctgctccccaaccgatga 1779 <210> 5 <211> 1779 <212> DNA
<213> Hepatitis C Virus <400>
atgtcaatgtcctacacatggacaggcgctctgattacaccatgcgctgcggaggagagc60 aagctgcccatcaatgcgctgagcaactctttgctgcgccaccataacatggtctatgcc120 acaacatcccgcagcgcaagccagcggcagaagaaggtaacttttgacaggctgcaagtc180 ctggatgaccactaccgggacgtgctcaaggagatgaaggcgaaggcgtccacagtcaag240 gctaaacttctatccgtggaagaagcctgtaagctgacgcccccacattcagccagatcc300 aaatttggctatggggcgaaggacgtccggaacctatccagcaaggccgttaaccacatc360 cactccgtgtggaaggacttgctggaagacactgagacaccaattgacaccaccatcatg420 gcaaaaaatgaggttttctgcgttcaaccagagaaaggaggccgcaagccagctcgccta480 atcgtgtacccagacttgggggttcgcgtgtgcgagaaaatggccctctacgacgtggtc540 tccacccttcctcaggctgtgatgggctcctcatacggattccagtactcccctggacag600 cgggtcgagttcctggtgaatgcctggaagccaaagaaatgccctatgggcttcgcatat660 gacacccgctgtttcgactcaacggtcaccgagaatgacatccgtgttgaggagtcaatt720 taccaatgttgtgacttggcccccgaagccagacaggccataaggtcgcttacagagcgg780 ctttatatcgggggtcccctgactaactcaaaagggcagagctgcggttatcgccggtgc840 cgtgcgagcggcgtactgacgactagctgcggtaataccctcacatgttacttgaaggcc900 tctgcagcctgtcgagctgcaaagctccaggactgcacgatgcttgtgtgcggagacgac960 ctcgtcgttatctgtgaaagcgcgggaacccaagaggacgcggcgagcctacgagtcttc1020 acggaggctatgactaggtactctgccccccctggggacccgccccaaccagaatacgac1080 ttggagctaataacatcatgctcctccaacgtgtcggtcgcgcacgatgcatctggcaaa1140 agggtatactacctcacccgtgaccccaccacccctcttgcgcgggctgcgtgggagaca1200 gctagacacactccagttaactcctggctaggcaacaccatcatgtatgcgcccactctg1260 tgggcaaggatgattctgatgactcacttcttctccatccttctagctcaggagcaactt1320 gaaaaagccctagattgtgagatctacggggcccactactccattgagccacttgaccta1380 cctcagatcattcaacgactccatggtcttagcgcgttttcactccacagttactctcca1440 ggtgaaatcaatagggtggcttcatgcctcaggaagcttggggtaccacccttgcgagtc1500 tggagacatcgggccagaagcgtccgcgctaagttactgtcccagggggggagggctgcc 1560 acttgtggcaagtacctcttcaactgggcagtaaggaccaagcttaaactcactccaatt 1620 ccggctgcgtcccagttggacttatccggctggttcgttgctggttacagcgggggagac 1680 atatatcacagcctgtctcgtgcccgaccccgctggttcatgtggtgcctactcctactt 1740 tctgtaggggtaggcatctacctgctccccaaccgatga 1779 <210> 6 <211> 1779 <212> DNA
<2I3> Hepatitis C Virus <400> 6 atgtcaatgtcctacacatggagaggcgctctgattacaccatgcgctgcggaggagagc 60 aagctgcccatcaatgcgctgagcaactctttgctgcgccaccataacatggtctatgcc 120 acaacatcccgcagcgcaagccagcggcagaagaaggtaacttttgacaggctgcaagtc 180 ctggatgaccactaccgggacgtgctcaaggagatgaaggcgaaggcgtccacagtcaag 240 gccaaacttctatccgtggaagaagcctgtaagctgacgcccccacattcagccagatcc 300 aaatttggctatggggcgaaggacgtccggaacctatccagcaaggccgttaaccacatc 360 cactccgtgtggaaggacttgctggaagacactgagacaccaattgacaccaccatcatg 420 gcaaaaaatgaggtcttctgcgttcaaccagagaaaggaggccgcaagccagctcgccta 480 atcgtgtacccagacttgggggttcgcgtgtgcgagaaaatggccctctacgacgtggtc 540 tccacccttcctcaggctgtgatgggctcctcatacggattccagcactctcctggacag 600 cgggtcgagttcctggtgaatgcctggaagtcaaagaaatgccctatgggcttcgcatat 660 gacacccgctgtttcgactcaacggtcaccgagaatgacatccgtgttgaggagtcaatt 720 taccaatgttgtgacttggcccccgaagccagacaggccataaggtcgcttacagagcgg 780 ctttatatcgggggtcccctgactaactcaaaagggcagagctgcggttatcgccggtgc 840 cgtgcgagcggcgtactgacgactagctgcggtaataccctcacatgttacttgaaggcc 900 tctgcagcctgtcgagctgcaaagctccaggactgcacgatgcttgtgtgcggagacgac 960 ttcgtcgttatctgtgaaagcgcgggaacccaagaggacgcggcgagcctacgagtcttc 1020 acggaggctatgactaggtactctgccccccctggggacccgccccaaccagaatacgac 1080 ttggagctaataacatcatgctcctccaacgtgtcggtcgcgcacgatgcatctggcaaa 1140 agggtatactacctcacccgtgaccccaccacccctcttgcgcgggctgcgtgggagaca 1200 gctagacacactccagttaactcctggctaggcaacatcatcatgtatgcgcccactctg 1260 tgggcaaggatgattctgatgactcacttcttctccatccttctagctcaggagcaactt 1320 gaaaaagccctagattgtgagatctacggggcccactactccattgagccacttgaccta 1380 cctcagatcattcaacgactccatggtcttagcgcgttttcactccacagttactctcca 1440 ggtgaaatcaatagggtggcttcatgcctcaggaagcttggggtaccacccttgcgagtc 1500 tggagacatcgggccagaagcgtccgcgctaagttactgtcccagggggggagggctgcc 1560 acttgtggcaagtacctcttcaactgggcagtaaggaccaagcttaaactcactccaatt 1620 ccggctgcgtcccagttggacttatccggctggttcgttgctggttacagcgggggagac 1680 atatatcacagcctgtctcgtgcccgaccccgctggttcatgtggtgcctactcctactt 1740 tctgtaggggtaggcatctacctgctccccaaccgatga 1779 <210> 7 <211> 1779 <212> DNA
<213> Hepatitis C Virus <400> 7 gtgtcaatgtcctacacatggacaggcgctctgattacaccatgcgctgcggaggagagc 60 aagctgcccatcaatgcgctgagcaactctttgctgcgccaccataacatggtctatgcc 120 acaacatcccgcagcgcaagccagcggcagaagaaggtaacttttgacaggctgcaagtc 180 ctggatgaccactaccgggacgtgctcaaggagatgaaggcgaaggcgtccacagtcaag 240 gctaaacttctatccgtggaagaagcctgtaagctgacgcccccacattcagccagatcc 300 aaatttggctatggggcgaaggacgtccggaacctatccagcaaggccgttaaccacatc 360 cactccgtgtggaaggacttgctggaagacactgagacaccaattgacaccaccatcatg 420 gcaaaaaatgaggttttctgcgttcaaccagagaaaggaggccgcaagccagctcgccta 480 atcgtgtacccagacttgggggttcgcgtgtgcgagaaaatggccctctacgacgtggtc 540 tccacccttcctcaggctgtgatgggctcctcatacggattccagtactctcctggacag 600 cgggtcgagttcctggtgaatgcctggaagtcaaagaaatgccctatgggcttcgcatat 660 gacactcgctgtttcgactcaacggtcaccgagaat~acatccgtgttgaggagtcaatt 720 taccaatgttgtgacttggcccccgaagccagacaggccataaggtcgcttacagagcgg 780 ctttatatcgggggtcccctgactaactcaaaagggcagagctgcggttatcgccggtgc 840 cgtgcgagcggcgtactgacgactagctgcggtaataccctcacatgttacttgaaggcc 900 tctgcagcctgtcgagctgcaaagctccaggactgcacgatgcttgtgtgcggagacgac 960 ctcgtcgttatctgtgaaagcgcgggaacccaagaggacgcggcgagcctacgagtcttc 1020 acggaggctatgactaggtactctgccccccctggggacccgccccaaccagaatacgac 1080 ttggagctaataacatcatgctcctccaacgtgtcggtcgcgcacgatgcatctggcaaa 1140 agggtatactacctcacccgtgaccccaccacccctcttgcgcgggctgcgtgggagaca 1200 gctagacacactccagttaactcctggctaggcaacatcatcatgtatgcgcccactctg 1260 tgggcaaggatgattctgatgactcacttcttctccatccttctagctcaggagcaactt 1320 gaaaaagccctagattgtgagatctacggggcccactactccattgagccacttgaccta 1380 cctcagatcattcaacgactccatggtcttagcgcgttttcactccacagttactctcca 1440 ggtgaaatcaatagggtggcttcatgcctcaggaagcttggggtaccacccttgcgagtc 1500 tggagacatcgggccagaagcgtccgcgctaagttactgtcccagggggggagggctgcc 1560 acttgtggcaagtacctcttcaactgggcagtaaggaccaagcttaaactcactccaatt 1620 ccggctgcgccccagttggacttatccggctggttcgttgctggttacagcgggggagac 1680 atatatcacagcctgtctcgtgcccgaccccgctggttcatgtggtgcctactcctactt 1740 tctgtaggggtaggcatctacctgctccccaaccgatga 1778 <210> 8 <211> 592 <212> PRT
<213> Hepatitis C Virus <400> 8 Met Ser Met Ser Tyr Thr Trp Thr Gly Ala Leu Ile Thr Pro Cys Ala Ala Glu Glu Ser Lys Leu Pro Ile Asn Ala Leu Ser Asn Ser Leu Leu Arg His His Asn Met Val Tyr Ala Thr Thr Ser Arg Ser Ala Ser Gln Arg Gln Lys Lys Val Thr Phe Asp Arg Leu Gln Val Leu Asp Asp His Tyr Arg Asp Val Leu Lys Glu Met Lys Ala Lys Val Ser Thr Val Lys Ala Lys Leu Leu Ser Val Glu Glu Ala Cys Lys Leu Thr Pro Pro His Ser Ala Arg Ser Lys Phe Gly Tyr Gly A1a Lys Asp Val Arg Asn Leu Ser Ser Lys Ala Val Asn His Ile His Ser Val Trp Lys Asp Leu Leu Glu Asp Thr Glu Thr Pro Ile Asp Thr Thr Ile Met Ala Lys Asn Glu Val Phe Cys Val Gln Pro Glu Lys Gly Gly Arg Lys Pro Ala Arg Leu Ile Val Tyr Pro Asp Leu Gly Val Arg Val Cys Glu Lys Met Ala Leu Tyr Asp Val Val Ser Thr Leu Pro Gln Ala Val Met Gly Ser Ser Tyr Gly Phe Gln Tyr Ser Pro Gly Gln Arg Val Glu Phe Leu Val Asn Ala Trp Lys Ser Lys Lys Cys Pro Met Gly Phe Ala Tyr Asp Thr Arg Cys Phe Asp Ser Thr Val Thr Glu Asn Asp Ile Arg Val Glu Glu Ser Ile Tyr Gln Cys Cys Asp Leu Ala Pro Glu Ala Arg Gln Ala Ile Arg Ser Leu Thr Glu Arg Leu Tyr Ile Gly Gly Pro Leu Thr Asn Ser Lys Gly Gln Ser Cys Gly Tyr Arg Arg Cys Arg Ala Ser Gly Val Leu Thr Thr Ser Cys Gly Asn Thr Leu Thr Cys Tyr Leu Lys Ala Ser Ala Ala Cys Arg Ala Ala Lys Leu Gln Asp Cys Thr Met Leu Val Cys Gly Asp Asp Leu Val Val Ile Cys Glu Ser Ala Gly Thr Gln Glu Asp Ala Ala Ser Leu Arg Val Phe Thr Glu Ala Met Thr Arg Tyr Ser Ala Pro Pro Gly Asp Pro Pro Gln Pro Glu Tyr Asp Leu Glu Leu Ile Thr Ser Cys Ser Ser Asn Val Ser Val Ala His Asp Ala Ser Gly Lys Arg Val Tyr Tyr Leu Thr Arg Asp Pro Thr Thr Pro Leu Ala Arg Ala Ala Trp Glu Thr Ala Arg His Thr Pro Val Asn Ser Trp Leu Gly Asn Ile Ile Met Tyr Ala Pro Thr Leu Trp Ala Arg Met Ile Leu Met Thr His Phe Phe Ser Ile Leu Leu Ala Gln Glu Gln Leu Glu Lys Ala Leu Asp Cys Glu Ile Tyr Gly Ala His Tyr Ser Ile Glu Pro Leu Asp Leu Pro Gln Ile Ile Gln Arg Leu His Gly Leu Ser Ala Phe Ser Leu His Ser Tyr Ser Pro Gly Glu Ile Asn Arg Val Ala Ser Cys Leu Arg Lys Leu Gly Val Pro Pro Leu Arg Val Trp Arg His Arg Ala Arg Ser Val Arg Ala Lys Leu Leu Ser Gln Gly Gly Arg Ala Ala Thr Cys Gly Lys Tyr Leu Phe Asn Trp Ala Val Arg Thr Lys Leu Lys Leu Thr Pro Ile Pro Ala Ala Ser Gln Leu Asp Leu Ser Gly Trp Phe Val Ala Gly Tyr Ser Gly Gly Asp Ile Tyr His Ser Leu Ser Arg Ala Arg Pro Arg Trp Phe Met Trp Cys Leu Leu Leu Leu Ser Val Gly Val Gly Ile Tyr Leu Leu Pro Asn Arg <210> 9 <211> 592 <212> PRT
<213> Hepatitis C Virus <400> 9 Met Ser Met Ser Tyr Thr Trp Thr Gly Ala Leu Ile Thr Pro Cys Ala Ala Glu Glu Ser Lys Leu Pro Ile Asn Ala Leu Ser Asn Ser Leu Leu Arg His His Asn Met Val Tyr Ala Thr Thr Ser Arg Ser Ala Ser Gln Arg Gln Lys Lys Val Thr Phe Asp Arg Leu Gln Val Leu Asp Asp His Tyr Arg Asp Val Leu Lys Glu Met Lys Ala Lys Val Ser Thr Val Lys Ala Lys Leu Leu Ser Val Glu Glu Ala Cys Lys Leu Thr Pro Pro His Ser Ala Arg Ser Lys Phe Gly Tyr Gly Ala Lys Asp Val Arg Asn Leu Ser Ser Lys Ala Val Asn His Ile His Ser Val Trp Lys Asp Leu Leu Glu Asp Thr Glu Thr Pro Ile Asp Thr Thr Ile Met Ala Lys Asn Glu Val Phe Cys Val Gln Pro Glu Lys Gly Gly Arg Lys Pro Ala Arg Leu Ile Val Tyr Pro Asp Leu Gly Val Arg Val Cys Glu Lys Met Ala Leu Tyr Asp Val Ile Ser Thr Leu Pro Gln Ala Val Met Gly Ser Ser Tyr Gly Phe Gln Tyr Ser Pro Gly Gln Arg Val Glu Phe Leu Val Asn Ala Trp Lys Ser Lys Lys Cys Pro Met Gly Phe Ala Tyr Asp Thr Arg Cys Phe Asp Ser Thr Val Thr Glu Asn Asp Ile Arg Val Glu Glu Ser Ile Tyr Gln Cys Cys Asp Leu Ala Pro Glu Ala Arg Gln Ala Ile Arg Ser Leu Thr Glu Arg Leu Tyr Ile Gly Gly Pro Leu Thr Asn Ser Lys Gly Gln Ser Cys Gly His Arg Arg Cys Arg Ala Ser Gly Val Leu Thr Thr Ser Cys Gly Asn Thr Leu Thr Cys Tyr Leu Lys Ala Ser Ala Ala Cys Arg Ala Ala Lys Leu Gln Asp Cys Thr Met Leu Val Cys Gly Asp Asp Leu Ile Val Ile Cys Glu Ser Ala Gly Thr Gln Glu Asp Ala Ala Ser Leu Arg Val Phe Thr Glu Ala Met Thr Arg Tyr Ser Ala Pro Pro Gly Asp Pro Pro Gln Pro Glu Tyr Asp Leu Glu Leu Ile Thr Ser Cys Ser Ser Asn Val Ser Val Ala His Asp Ala Ser Gly Lys Arg Val Tyr Tyr Leu Thr Arg Asp Pro Thr Thr Pro Leu Ala Arg Ala Aia Trp Glu Thr Ala Arg His Thr Pro Val Asn Ser Trp Leu Gly Asn Ile Ile Met Tyr Ala Pro Thr Leu Trp Ala Arg Met Ile Leu Met Thr His Phe Phe Ser Ile Leu Leu Ala Gln Glu Gln Leu Glu Lys Ala Leu Asp Cys Glu Ile Tyr Gly Ala His Tyr Ser Ile Glu Pro Leu Asp Leu Pro Gln Ile Ile Gln Arg Leu His Gly Leu Ser Ala Phe Ser Leu His Ser Tyr Ser Pro Gly Glu Ile Asn Arg Val Ala Ser Cys Leu Arg Lys Leu Gly Val Pro Pro Leu Arg Val Trp Arg His Arg Ala Arg Ser Val Arg Ala Lys Leu Leu Ser Gln Gly Gly Arg Ala Ala Thr Cys Gly Lys Tyr Leu Phe Asn Trp Ala Val Arg Thr Lys Leu Lys Leu Thr Pro Ile Pro Ala Ala Ser Gln Leu Asp Leu Ser Gly Trp Phe Val Ala Gly Tyr Ser Gly Gly Asp Ile Tyr His Ser Leu Ser Arg Ala Arg Pro Cys Trp Phe Met Trp Cys Leu Leu Leu Leu Ser Val Gly Val Gly Ile Tyr Leu Leu Pro Asn Arg <210> 10 <211> 592 <212> PRT
<213> Hepatitis C Virus <400> 10 Met Ser Met Ser Tyr Thr Trp Thr Gly Ala Leu Ile Thr Pro Cys Ala Ala Glu Glu Ser Lys Leu Pro Ile Asn Ala Leu Ser Asn Ser Leu Leu Arg His His Asn Met Val Tyr Ala Thr Thr Ser Arg Ser Ala Ser Gln Arg Gln Lys Lys Val Thr Phe Asp Arg Leu Gln Val Leu Asp Asp His Tyr Arg Asp Val Leu Lys Glu Met Lys Ala Lys Val Ser Thr Val Lys Ala Lys Leu Leu Ser Val Glu Glu Ala Cys Lys Leu Thr Pro Pro His Ser Ala Arg Ser Lys Phe Gly Tyr Gly Ala Lys Asp Val Arg Asn Leu Ser Ser Lys Ala Val Asn His Ile His Ser Val Trp Lys Asp Leu Leu Glu Asp Thr Glu Thr Pro Ile Asp Thr Thr Ile Met Ala Lys Asn Glu Val Phe Cys Val Gln Pro Glu Lys Gly Gly Arg Lys Pro Ala Arg Leu Ile Val Tyr Pro Asp Leu Gly Val Arg Val Cys Glu Lys Met Ala Leu Tyr Asp Val Val Ser Thr Leu Pro Gln Ala Val Met Gly Ser Ser Tyr 180 185 19b Gly Phe Gln Tyr Ser Pro Gly Gln Arg Val Glu Phe Leu Val Asn Ala Trp Lys Pro Lys Lys Cys Pro Met Gly Phe Ala Tyr Asp Thr Arg Cys Phe Asp Ser Thr Val Thr Glu Asn Asp Ile Arg Val Glu Glu Ser Ile Tyr Gln Cys Cys Asp Leu Ala Pro Glu Ala Arg Gln Ala Ile Arg Ser Leu Thr Glu Arg Leu Tyr Ile Gly Gly Pro Leu Thr Asn Ser Lys Gly Gln Ser Cys Gly Tyr Arg Arg Cys Arg Ala Ser Gly Val Leu Thr Thr Ser Cys Giy Asn Thr Leu Thr Cys Tyr Leu Lys Ala Ser Ala Ala Cys Arg Ala Ala Lys Leu Gln Asp Cys Thr Met Leu Val Cys Gly Asp Asp Leu Val Val Ile Cys Glu Ser Ala Gly Thr Gln Glu Asp Ala Ala Ser Leu Arg Val Phe Thr Glu Ala Met Thr Arg Tyr Ser Ala Pro Pro Gly Asp Pro Pro Gln Pro Glu Tyr Asp Leu Glu Leu Ile Thr Ser Cys Ser Ser Asn Val Ser Val Ala His Asp Ala Ser Gly Lys Arg Val Tyr Tyr Leu Thr Arg Asp Pro Thr Thr Pro Leu Ala Arg Ala Ala Trp Glu Thr Ala Arg His Thr Pro Val Asn Ser Trp Leu Gly Asn Thr Ile Met Tyr Ala Pro Thr Leu Trp Ala Arg Met Ile Leu Met Thr His Phe Phe Ser Ile Leu Leu Ala Gln Glu Gln Leu Glu Lys Ala Leu Asp Cys Glu Ile Tyr Gly Ala His Tyr Sex Ile Glu Pro Leu Asp Leu Pro Gln Ile Ile WO 99/51781 PCTlUS99/07404 Gin Arg Leu His Gly Leu Ser Ala Phe Ser Leu His Ser Tyr Ser Pro Gly Glu Ile Asn Arg Val Ala Ser Cys Leu Arg Lys Leu Gly Val Pro Pro Leu Arg Val Trp Arg His Arg Ala Arg Ser Val Arg Ala Lys Leu Leu Ser Gln Gly Gly Arg Ala Ala Thr Cys Gly Lys Tyr Leu Phe Asn Trp Ala Val Arg Thr Lys Leu Lys Leu Thr Pro Ile Pro Ala Ala Ser Gln Leu Asp Leu Ser Gly Trp Phe Val Ala Gly Tyr Ser Gly Gly Asp Ile Tyr His Ser Leu Ser Arg Ala Arg Pro Arg Trp Phe Met Trp Cys Leu Leu Leu Leu Ser Val Gly Val Gly Ile Tyr Leu Leu Pro Asn Arg <210> 11 <211> 592 <212> PRT
<213> Hepatitis C Virus <400> 11 Met Ser Met Ser Tyr Thr Arg Thr Gly Ala Leu Ile Thr Pro Cys Ala Ala Glu Glu Ser Lys Leu Pro Ile Asn Ala Leu Ser Asn Ser Leu Leu Arg His His Asn Met Val Tyr Ala Thr Thr Ser Arg Ser Ala Ser Gln Arg Gln Lys Lys Val Thr Phe Asp Arg Leu Gln Val Leu Asp Asp His Tyr Arg Asp Val Leu Lye Glu Met Lys Ala Lye Val Ser Thr Val Lys 65 70 75 g0 Ala Lys Leu Leu Ser Val Glu Glu Ala Cys Lys Leu Thr Pro Pro His Ser Ala Arg Ser Lys Phe Gly Tyr Gly Ala Lys Asp Val Arg Asn Leu Ser Ser Lys Ala Val Asn His Ile His Ser Val Trp Lys Asp Leu Leu Glu Asp Thr Glu Thr Pro Ile Asp Thr Thr Ile Met Ala Lys Asn Glu Val Phe Cys Val Gln Pro Glu Lys Gly Gly Arg Lys Pro Ala Arg Leu Ile Val Tyr Pro Asp Leu Gly Val Arg Val Cys Glu Lys Met Ala Leu Tyr Asp Val Val Ser Thr Leu Pro Gln Ala Val Met Gly Ser Ser Tyr Gly Phe Gln His Ser Pro Gly Gln Arg Val Glu Phe Leu Val Asn Ala Trp Lys Ser Lys Lys Cys Pro Met Gly Phe Ala Tyr Asp Thr Arg Cys Phe Asp Ser Thr Val Thr Glu Asn Asp Ile Arg Val Glu Glu Ser Ile Tyr Gln Cys Cys Asp Leu Ala Pro Glu Ala Arg Gln Ala Ile Arg Ser Leu Thr Glu Arg Leu Tyr Ile Gly Gly Pro Leu Thr Asn Ser Lys Gly Gln Ser Cys Gly Tyr Arg Arg Cys Arg Ala Ser Gly Val Leu Thr Thr Ser Cys Gly Asn Thr Leu Thr Cys Tyr Leu Lys Ala Ser Ala Ala Cys Arg Ala Ala Lys Leu Gln Asp Cys Thr Met Leu Val Cys Gly Asp Asp Phe Val Val Ile Cys Glu Ser Ala Gly Thr Gln Glu Asp Ala Ala Ser Leu Arg Val Phe Thr Glu Ala Met Thr Arg Tyr Ser Ala Pro Pro Gly Asp Pro Pro Gln Pro Glu Tyr Asp Leu Glu Leu Ile Thr Ser Cys Ser Ser Asn Val Ser Val Ala His Asp Ala Ser Gly Lys Arg Val Tyr Tyr Leu Thr Arg Asp Pro Thr Thr Pro Leu Ala Arg Ala Ala Trp Glu Thr Ala Arg His Thr Pro Val Asn Ser Trp Leu Gly Asn Ile Ile Met Tyr Ala Pro Thr Leu Trp Ala Arg Met Ile Leu Met Thr His Phe Phe Ser Ile Leu Leu Ala Gln Glu Gln Leu Glu Lys Ala Leu Asp Cys Glu Ile Tyr Gly Ala His Tyr Ser Ile Glu Pro Leu Asp Leu Pro Gln Ile Ile Gln Arg Leu His Gly Leu Ser Ala Phe Ser Leu His Ser Tyr Ser Pro Gly Glu Ile Asn Arg Val Ala Ser Cys Leu Arg Lys Leu Gly Val Pro Pro Leu Arg Val Trp Arg His Arg Ala Arg Ser Val Arg Ala Lys Leu Leu Ser Gln Gly Gly Arg Ala Ala Thr Cys Gly Lys Tyr Leu Phe Asn Trp Ala Val Arg Thr Lys Leu Lys Leu Thr Pro Ile Pro Ala Ala Ser Gln Leu Asp Leu Ser Gly Trp Phe Val Ala Gly Tyr Ser Gly Gly Asp Ile Tyr His Ser Leu Ser Arg Ala Arg Pro Arg Trp Phe Met Trp Cys Leu Leu Leu Leu Ser Val Gly Val Gly Ile Tyr Leu Leu Pro Asn Arg <210> 12 <211> 592 <212> PRT
<213> Hepatitis C Virus <400> 12 Val Ser Met Ser Tyr Thr Trp Thr Gly A1a Leu Ile Thr Pro Cys Ala Ala Glu Glu Ser Lys Leu Pro Ile Asn Ala Leu Ser Asn Ser Leu Leu Arg His His Asn Met Val Tyr Ala Thr Thr Ser Arg Ser Ala Ser Gln Arg Gln Lys Lys Val Thr Phe Asp Arg Leu Gln Val Leu Asp Asp His Tyr Arg Asp Val Leu Lys Glu Met Lys Ala Lys Val Ser Thr Val Lys Ala Lys Leu Leu Ser Val Glu Glu Ala Cys Lys Leu Thr Pro Pro His Ser Ala Arg Ser Lys Phe Gly Tyr Gly Ala Lys Asp Val Arg Asn Leu Ser Ser Lys Ala Val Asn His Ile His Ser Val Trp Lys Asp Leu Leu Glu Asp Thr Glu Thr Pro Ile Asp Thr Thr Ile Met Ala Lys Asn Glu Val Phe Cys Val Gln Pro Glu Lys Gly Gly Arg Lys Pro Ala Arg Leu Ile Val Tyr Pro Asp Leu Gly Val Arg Val Cys Glu Lys Met Ala Leu Tyr Asp Val Val Ser Thr Leu Pro Gln Ala Val Met Gly Ser Ser Tyr Gly Phe Gln Tyr Ser Pro Gly Gln Arg Val Glu Phe Leu Val Asn Ala Trp Lys Ser Lys Lys Cys Pro Met Gly Phe Ala Tyr Asp Thr Arg Cys Phe Asp Ser Thr Val Thr Glu Asn Asp Ile Arg Val Glu Glu Ser Ile Tyr Gln Cys Cys Asp Leu Ala Pro Glu Ala Arg Gln Ala Tle Arg Ser Leu Thr Glu Arg Leu Tyr Ile Gly Gly Pro Leu Thr Asn Ser Lys Gly Gln Ser Cys Gly Tyr Arg Arg Cys Arg Ala Ser Gly Val Leu Thr Thr Ser Cys Gly Asn Thr Leu Thr Cys Tyr Leu Lys Ala Ser Ala Ala Cys Arg Ala Ala Lys Leu Gln Asp Cys Thr Met Leu Val Cys Gly Asp Asp Leu Val Val Ile Cys Glu Ser Ala Gly Thr Gln Glu Asp Ala Ala Ser Leu Arg Val Phe Thr Glu Ala Met Thr Arg Tyr Ser Ala Pro Pro Gly Asp Pro Pro Gln Pro Glu Tyr Asp Leu Glu Leu Ile Thr Ser Cys Ser Ser Asn Val Ser Val Ala His Asp Ala Ser Gly Lys Arg Val Tyr Tyr Leu Thr Arg Asp Pro Thr Thr Pro Leu Ala Arg Ala Ala Trp Glu Thr Ala Arg His Thr Pro Val Asn Ser Trp Leu Gly Asn Ile Ile Met Tyr Ala Pro Thr Leu Trp Ala Arg Met Ile Leu Met Thr His Phe Phe Ser Ile Leu Leu Ala Gln G1u Gln Leu Glu Lys Ala Leu Asp Cys Glu Ile Tyr Gly Ala His Tyr Ser Ile Glu Pro Leu Asp Leu Pro Gln Ile Ile Gln Arg Leu His Gly Leu Ser Ala Phe Ser Leu His Ser Tyr Ser Pro Gly Glu Ile Asn Arg Val Ala Ser Cys Leu Arg Lys Leu Gly Val Pro Pro Leu Arg Val Trp Arg His Arg Ala Arg Ser Val Arg Ala Lys Leu Leu Ser Gln Gly Gly Arg Ala Ala Thr Cys Gly Lys Tyr Leu Phe Asn Trp Ala Val Arg Thr Lys Leu Lys Leu Thr Pro Ile Pro Ala Ala Pro Gln Leu Asp Leu Ser Gly Trp Phe Val Ala Gly Tyr Ser Gly Gly Asp Ile Tyr His Ser Leu Ser Arg Ala Arg Pro Arg Trp Phe Met Trp Cys Leu Leu Leu Leu Ser Val Gly Val Gly Ile Tyr Leu Leu Pro Asn Arg <210> 13 <211> 592 <212> PRT
<213> Hepatitis C Virus <400> 13 Met Ser Met Ser Tyr Thr Trp Thr Gly Ala Leu Ile Thr Pro Cys Ala Ala Glu Glu Ser Lys Leu Pro Ile Asn Ala Leu Ser Asn Ser Leu Leu Arg His His Asn Met Val Tyr Ala Thr Thr Ser Arg Ser Ala Ser Gln Arg Gln Lys Lys Val Thr Phe Asp Arg Leu Gln Val Leu Asp Asp His Tyr Arg Asp Val Leu Lys Glu Met Lys Ala Lys Val Ser Thr Val Lys 65 70 75 g0 Ala Lys Leu Leu Ser Val Glu Glu Ala Cys Lys Leu Thr Pro Pro His Ser Ala Arg Ser Lys Phe Gly Tyr Gly Ala Lys Asp Val Arg Asn Leu Ser Ser Lys Ala Val Asn His Ile His Ser Val Trp Lys Asp Leu Leu Glu Asp Thr Glu Thr Pro Ile Asp Thr Thr Ile Met Ala Lys Asn Glu Val Phe Cys Val Gln Pro Glu Lys Gly Gly Arg Lys Pro Ala Arg Leu Ile Val Tyr Pro Asp Leu Gly Val Arg Val Cys Glu Lys Met Ala Leu Tyr Asp Val Val Ser Thr Leu Pro Gln Ala Val Met Gly Ser Ser Tyr Gly Phe Gln Tyr Ser Pro Gly Gln Arg Val Glu Phe Leu Val Asn Ala Trp Lys Ser Lys Lys Cys Pro Met Gly Phe Ala Tyr Asp Thr Arg Cys Phe Asp Ser Thr Val Thr Glu Asn Asp Ile Arg Val Glu Glu Ser Ile Tyr Gln Cys Cys Asp Leu Ala Pro Glu Ala Arg Gln Ala Ile Arg Ser Leu Thr Glu Arg Leu Tyr Ile Gly Gly Pro Leu Thr Asn Ser Lys Gly Gln Ser Cys Gly Tyr Arg Arg Cys Arg Ala Ser Gly Val Leu Thr Thr Ser Cys Gly Asn Thr Leu Thr Cys Tyr Leu Lys Ala Ser Ala Ala Cys Arg Ala Ala Lys Leu Gln Asp Cys Thr Met Leu Val Cys Gly Asp Asp Leu Val Val Ile Cys Glu Ser Ala Gly Thr Gln Glu Asp Ala Ala Ser Leu Arg Val Phe Thr Glu Ala Met Thr Arg Tyr Ser Ala Pro Pro Gly Asp Pro Pro Gln Pro Giu Tyr Asp Leu Glu Leu Tle Thr Ser Cys Ser Ser Asn Val Ser Val Ala His Asp Ala Ser Gly Lys Arg Val Tyr Tyr Leu Thr Arg Asp Pro Thr Thr Pro Leu Ala Arg Ala Ala Trp Glu Thr Ala Arg His Thr Pro Val Asn Ser Trp Leu Gly Asn Ile Ile Met Tyr Ala Pro Thr Leu Trp Ala Arg Met Ile Leu Met Thr His Phe Phe Ser Ile Leu Leu Ala Gln Glu Gln Leu Glu Lys Ala Leu Asp Cys Glu Ile Tyr Gly Ala His Tyr Ser Ile Glu Pro Leu Asp Leu Pro Gln Ile Ile Gln Arg Leu His Gly Leu Ser Ala Phe Ser Leu His Ser Tyr Ser Pro Gly Glu Ile Asn Arg Val Ala Ser Cys Leu Arg Lys Leu Gly Val Pro Pro Leu Arg Val Trp Arg His Arg Ala Arg Ser Val Arg Ala Lys Leu Leu Ser Gln Gly Gly Arg Ala Ala Thr Cys Gly Lys Tyr Leu Phe Asn Trp Ala Val Arg Thr Lys Leu Lys Leu Thr Pro Ile Pro Ala Ala Pro Gln Leu Asp Leu Ser Gly Trp Phe Val Ala Gly Tyr Ser Gly Gly Asp Ile Tyr His Ser Leu Ser Arg Ala Arg Pro Arg Trp Phe Met Trp Cys Leu Leu Leu Leu Ser Val Gly Val Gly Ile Tyr Leu Leu Pro Asn Arg <210> 14 <211> 20 <212> DNA
<213> Hepatitis C Virus <400> 14 tcaatgtcct acacatggac 20 <210> 15 <211> 10 <212> DNA
<213> Hepatitis C Virus <400> 15 ctacacatgg 10 <210> 16 <211> 41 <212> DNA
<213> Hepatitis C Virus <400> 16 ctctgattac accatgcgct gcggaggaga gcaagctgcc c 41 <210> 17 <211> 28 <212> DNA
<213> Hepatitis C Virus <400> 17 aatgcgctga gcaactcttt gctgcgcc <210> 18 <211> 47 <212> DNA
<213> Hepatitis C Virus <400> 18 ccataacatg gtctatgcca caacatcccg cagcgcaagc cagcggc 47 <210> 19 <211> 22 <212> DNA
<213> Hepatitis C Virus <400> 19 gaagaaggta acttttgacagg 22 <210> 20 <211> 23 <212> DNA
<213> Hepatitis C Virus <400> 20 caagtcctgg atgaccactaccg 23 <210> 21 <211> 14 <212> DNA
<213> Hepatitis C Virus <400> 21 gacgtgctca agga 14 <210> 22 <211> 18 <212> DNA
<213> Hepatitis C Virus <400> 22 atgaaggcga aggcgtcc <210> 23 <211> 16 <212> DNA
<213> Hepatitis C Virus <400> 23 ggaagaagcc tgtaag 16 <210> 24 <211> 24 <212> DNA
<213> Hepatitis C Virus <400> 24 gaacctatcc agcaaggccgttaa 24 <210> 25 <211> 19 <212> DNA
<213> Hepatitis C Virus <400> 25 accagagaaa ggaggccgc 19 <210> 26 <211> 14 <212> DNA
<213> Hepatitis C Virus <400> 26 acccagactt gggg 14 <210> 27 <211> 20 <212> DNA
<213> Hepatitis C Virus <400> 27 tctccaccct tcctcaggct 20 <210> 28 <211> 19 <212> DNA
<213> Hepatitis C Virus <400> 28 cgagttcctg gtgaatgcc <210> 29 <211> 24 <212> DNA
<213> Hepatitis C Virus <400> 29 tgccctatgg gcttcgcatatgac 24 <210> 30 <211> 25 <212> DNA
<213> Hepatitis C Virus <400> 30 tttcgactca acggtcaccgagaat 25 <210> 31 <211> 15 <212> DNA
<213> Hepatitis C Virus <400> 31 gttgaggagt caatt <210> 32 <211> 20 <212> DNA
<213> Hepatitis C Virus <400> 32 ttggcccccg aagccagaca 20 <210> 33 <211> 17 <212> DNA
<213> Hepatitis C virus <400> 33 aaggtcgctt acagagc 17 <210> 34 <211> 17 <212> DNA
<213> Hepatitis C Virus <400> 34 atcgggggtc ccctgac WO 99/51781 ] ~ / 20 PCT/US99/07404 <210> 35 <211> 18 <212> DNA
<2I3> Hepatitis C Virus <400> 35 taactcaaaa gggcagag 18 <210> 36 <211> 19 <212> DNA
<213> Hepatitis C Virus <400> 36 atgttacttg aaggcctct 19 <210> 37 <211> 25 <212> DNA
<213> Hepatitis C Virus <400> 37 gatgcttgtg tgcggagacgacctc 25 <210> 38 <211> 31 <212> DNA
<213> Hepatitis C Virus <400> 38 ggtcgcgcac gatgcatctggcaaaagggt a 31 <210> 39 <211> 19 <212> DNA
<213> Hepatitis C Virus <400> 39 caccacccct cttgcgcgg 19 <210> 40 <211> 25 <212> DNA
<213> Hepatitis C Virus <400> 40 ctccatcctt ctagctcaggagcaa 25 <210> 41 <211> 20 <212> DNA
<213> Hepatitis C Virus <400> 41 agttactgtc ccaggggggg 20 <210> 42 <211> 17 <212> DNA
<213> Hepatitis C Virus W099/51781 1g / 20 PCT/US99/07404 <400> 42 tccggctgcg tcccagt 17 <210> 43 <211> 26 <212> DNA
<213> Hepatitis C Virus <400> 43 ccgaccccgc tggttcatgt ggtgcc 26 <210> 44 <211> 19 <212> DNA
<213> Hepatitis C Virus <400> 44 ctacctgctc ccgaaccga lg <210> 45 <211> 19 <212> DNA
<213> Hepatitis C Virus <400> 45 ctacctgctc cccaaccga 19 <210> 46 <211> 80 <212> PRT
<213> cHepatitis C Virus <400> 46 Ser Met Ser Tyr Thr Trp Thr Gly Ala Leu Ile Thr Pro Cys Ala Ala Glu Glu Ser Lys Leu Pro Ile Asn Ala Leu Ser Asn Ser Leu Leu Arg His His Asn Met Val Tyr Ala Thr Thr Ser Arg Ser Ala Ser Gln Arg Gln Lys Lys Val Thr Phe Asp Arg Leu Gln Val Leu Asp Asp His Tyr Arg Asp Val Leu Lys Glu Met Lys Ala Lys Ala Ser Thr Val Lys Ala <210> 47 <211> 47 <212> PRT
<213> cHepatitis C Virus <400> 47 Ser Val Glu Glu Ala Cys Lys Leu Thr Pro Pro His Ser Ala Arg Ser Lys Phe Gly Tyr Gly Ala Lys Asp Val Arg Asn Leu Ser Ser Lys Ala Val Asn His Ile His Ser Val Trp Lys Asp Leu Leu Glu Asp Thr <210> 48 <211> 40 <212> PRT
<213> cHepatitis C Virus <400> 48 Glu Thr Pro Ile Asp Thr Thr Ile Met AIa Lys Asn Glu Val Phe Cys Val Gln Pro Glu Lys GIy Gly Arg Lys Pro Ala Arg Leu Ile Val Tyr Pro Asp Leu Gly Val Arg Val Cys <210> 49 <2I1> 102 <212> PRT
<213> cHepatitis C Virus <400> 49 Ser Ser Tyr Gly Phe Gln Tyr Ser Pro Gly Gln Arg Val Glu Phe Leu Val Asn Ala Trp Lys Ser Lys Lys Cys Pro Met Gly Phe Ala Tyr Asp Thr Arg Cys Phe Asp Ser Thr Val Thr Glu Asn Asp Ile Arg Val Glu Glu Ser Ile Tyr Gln Cys Cys Asp Leu Ala Pro Glu Ala Arg Gln Ala Ile Arg Ser Leu Thr Glu Arg Leu Tyr Ile Gly Gly Pro Leu Thr Asn Ser Lys Gly Gln Ser Cys Gly Tyr Arg Arg Cys Arg Ala Ser Gly Val Leu Thr Thr Ser Cys Gly <210> 50 <211> 56 <212> PRT
<213> cHepatitis C Virus <400> 50 Cys Thr Met Leu Val Cys GIy Asp Asp Leu Val VaI Ile Cys Glu Ser Ala Gly Thr Gln Glu Asp Ala Ala Ser Leu Arg Val Phe Thr Glu Ala Met Thr Arg Tyr Ser Ala Pro Pro Gly Asp Pro Pro Gln Pro Glu Tyr Asp Leu Glu Leu IIe Thr Ser Cys <210> 51 <211> 37 <212> PRT
<213> cHepatitis C Virus <400> 51 Ser Val Ala His Asp Ala Ser Gly Lys Arg Val Tyr Tyr Leu Thr Arg Asp Pro Thr Thr Pro Leu Ala Arg Ala Ala Trp Glu Thr Ala Arg His Thr Pro Val Asn Ser <210> 52 <211> 29 <212> PRT
<213> cHepatitis C Virus <400> 52 Cys Leu Arg Lys Leu Gly Val Pro Pro Leu Arg Val Trp Arg His Arg Ala Arg Ser Val Arg Ala Lys Leu Leu Ser Gln Gly Gly <210> 53 <211> 25 <212> PRT
<213> Hepatitis C Virus <400> 53 Phe Val Ala Gly Tyr Ser Gly Gly Asp Ile Tyr His Ser Leu Ser Arg Ala Arg Pro Arg Trp Phe Met Trp Cys
sequences, functional HCV NSSB sequences, functionally improved compositions of HCV NSSB sequences, and to the use of such NSSB sequences in research, diagnostic, therapeutic and pharmaceutical applications.
Cross Reference to Related Applications This application claims priority under 35 U.S.C.
~119(e) to US Provisional Application 60/080,509 filed April 2, 1998 and US Provisional Application 60/090,356 filed June 23, 1998, the disclosures of each being incorporated by reference as though set forth herein in full .
Background of the Invention Hepatitis C virus (HCV) is a major cause of hepatitis globally. The World Health Organization estimates that 150 million people worldwide are presently infected with the virus. Most infections become persistent and about 60~ of cases develop into chronic liver disease. Chronic HCV infection can lead to development of cirrhosis, hepatocellular carcinoma and liver failure.
For treatment of hepatitis due to HCV, interferon alpha (IFN) is currently approved in the U.S. IFN
treatment is associated with improved serum enzyme response in 20-40~ of patients. The remainder are nonresponsive to IFN treatment. For responders, a sustained improvement of aminotransferase levels is seen in only 10-20~ of patients; the majority of patients relapse upon cessation of IFN treatment. While IFN
represents the first treatment of chronic hepatitis C, its effectiveness is variable, its cure rate is low, and associated adverse effects axe considerable.
Vaccines under development for HCV generally consist of recombinant versions of the putative viral structural proteins (C, E1, E2), or genes encoding these. It is believed that virus neutralizing antibodies do exist, can be elicited, and may be able to inhibit or prevent HCV infection. However, to date, no vaccine has been demonstrated safe and effective for HCV. Indeed, given the inherent genetic diversity of HCV, with virus isolates exhibiting immunologically distinct envelope proteins that are not neutralized by pre-existing antibodies, vaccine development will be a formidable task.
HCV can not yet be efficiently propagated in vitro.
This deficiency has compromised a clear understanding of several aspects of HCV replication. While numerous HCV
isolates have been molecularly cloned from infected patients and have been sequenced, much remains to be learned regarding the required sequence features and elements which facilitate efficient replication. From study of these sequences in a variety of surrogate gene expression systems, knowledge of the molecular biology of HCV has expanded greatly in recent years. These advancements, which have been facilitated by existing knowledge and understanding of the molecular biology of the related pestiviruses and flaviviruses, have yielded important insights into the virus-specified components essential for virus replication that may be suitable targets for antiviral drug discovery strategies.
As mentioned above, HCV is a genetically heterogeneous virus. It exists in nature, and in infected individuals, as a "quasispecies", which means that within the virus population from any particular source, the viral genetic material is present as a collection of closely related, but non-identical sequences. This genetic heterogeneity of HCV sequences I5 may be a consequence of natural errors introduced during the normal replication process of HCV, of selection pressures placed on the virus by the host, or others factors. It is believed that the quasispecies nature of HCV may contribute to the virus's ability to avoid elimination by the host's defense systems and establish persistent infections.
The quasispecies nature of HCV has made it difficult to define the sequence of "functional" genes and genomes, particularly in the absence of a controlled system for the efficient replication of the virus.
However, functionality of segments of HCV sequences has been studied in a variety of surrogate expression systems. Several gene products have been shown to be functional in in vitro assays in that they exhibit enzymological activities that are predicted to exist based on the presence of particular amino acid sequence motifs in these gene products. For example, the NS3 protein possesses serine proteinase, nucleoside triphosphatase and helicase activities and the NSSB
protein possesses RNA-dependent RNA polymerase (RdRp) activity.
The recent demonstration of an infectious molecular clone of HCV [Kolykhalov et al., Science 277:570-574 (1997); Yanagi et al., Proc. Natl. Acad. Sci. USA
94:8738-8743 (1997)] allows definition of a complete functional HCV genome and consequently of a sequence for a set of functional HCV gene products from this particular strain of HCV obtained from one particular source. It is noteworthy that Kolykhalov et al.
indicate that the difficulties in obtaining a functional genome included: 1) the highly variable quasispecies nature of HCV in infected patients; 2) the required in vitro amplification (cDNA synthesis and PCR
amplification) of the sequences due to the small quantities of viral RNA in clinical samples; and 3) the necessity of molecular cloning (in E. coli). Each of these aspects allows for the possibility and presentation of defective (poorly functional or nonfunctional) HCV sequences or for errors in transcribing or amplifying HCV sequences. Kolykhalov et al. indicated that RNAs produced from 34 full genome molecular clones failed to exhibit infectivity in chimpanzees. Nucleotide sequence analyses showed numerous sequence changes among the 6 full length clones that were completely sequenced. Only after a "consensus sequence" clone was generated, was positive infectivity demonstrable. Yanagi et a1. also indicated the high degree of sequence variability among individual molecular clones obtained from a single source material and the non-infectious nature of RNA transcripts from full-length molecular clones. Yanagi et al. concluded that a large proportion of HCV genomes are defective.
In fact, recent work indicates a bias toward the preferential selection of defective HCV genomes during molecular cloning procedures [Forns, et al., Proc Natl Acad Sci USA 94:13909-13914 (1997)]. Of 25 random clones derived from a control plasmid by Forns et al., only 8% were functional in polyprotein synthesis.
Thus, it is clear from these examples that mere knowledge of a sequence derived from HCV is insufficient to conclude that such a sequence encodes useful viral genes or functional viral gene products.
Regarding the NSSB gene, while many partial and complete gene sequences have been entered into various databases, only a very few of these sequences have been demonstrated to be functional based on in vitro assays of RdRp activity.
The present invention provides novel and functional, as well as functionally improved, hepatitis C virus NS5B sequences for use in research, diagnostic, therapeutic and pharmaceutical applications, and for use in assays for the identification of efficacious antiviral agents.
SUI4rIARY OF THE INVENTION
The present invention provides novel HCV NS5B
nucleotide sequences from which recombinant HCV proteins having demonstrable RdRp activity may be derived.
Sequence modifications that result in improved functional activity are also provided. Such functional recombinant HCV NSSB proteins have utility in research, diagnostic, therapeutic and pharmaceutical applications.
In particular, the recombinant HCV NSSB proteins of the invention have utility in antiviral drug discovery strategies.
In a preferred embodiment of the invention, an isolated nucleic acid molecule is provided that comprises a DNA sequence identified as SEQ ID NO: 1, which is present in clone 4 of the present invention.
An exemplary HCV NSSB protein has the amino acid sequence identified as SEQ ID NO: 2 encoded by clone 4.
Additional nucleic acid molecules that represent nucleic acid sequences related to those of SEQ ID NO: 1, including but not limited to those identified by SEQ ID
NO: 3, 4, 5, 6 and 7 encoding, respectively, the amino acid sequences identified by SEQ ID NO: 8, 9, 10, 11 and 12 of the HCV NSSB are also contemplated to be within the scope of the present invention. It is further contemplated that conservative sequence or residue substitutions of these sequences are also within the scope of the invention.
In an additional embodiment of the invention, functionally improved hepatitis C polymerase nucleic acid and amino acid sequences are provided. Exemplary sequences include those nucleic acid sequences that encode amino acid sequences related to those identified by SEQ ID NO: 2 in which particular codons have been substituted to encode particular amino acid changes in the sequence. Examples of useful changes include but are not limited to changes at amino acid positions number 75, number 177 and number 543 of the mature NSSB
protein.
In another embodiment of the invention, functionally improved hepatitis C polymerase nucleic acid and amino acid sequences are provided in which particular codons are substituted to encode particular amino acids not normally found in known sequences of NSSB. For example, changes including but not limited to residue changes at amino acid positions number 1 and number 2 of the mature NSSB protein are useful according to this invention.
As described above, nucleic acids encoding variant proteins or polypeptides are contemplated to be within the scope of the present invention. Sequence ID NO: 13 provides an example of such a variant sequence. Such variants may or may not possess HCV polymerase activity.
These variants may possess one or more changes each of which may include one or more additions, deletions, or substitutions of amino acid residues. Preferably, the changes will not affect, or substantially affect, the structure or useful properties of the polypeptide.
Thus, HCV NSSB variants may suitably possess functional NSSB activity such as those described above, or they may be poorly functional or inactive, yet contain substantially the secondary and tertiary structure of the native polypeptide. Such NSSB molecules may be used to advantage to identify agents that specifically bind to or otherwise affect the HCV NSSB activity. HCV NSSB
variants can be either naturally occurring (i.e., purified or isolated from a natural source) or synthetic (i.e., generated by biological expression of DNA that has been subjected to site-directed mutagenesis or produced by chemical synthetic techniques well known in the art ) .
The nucleic acid molecules of the invention may be cloned and expressed in vectors. Such vectors may be in the form of, for example, a plasmid, a replication competent or defective virus or phage vector or a replicon provided typically with an origin of replication, optionally a promoter for the expression of the polynucleotide and optionally a regulator of the promoter. The vector may contain one or more selectable marker genes, for example an ampicillin resistance gene in the case of a bacterial plasmid or a neomycin resistance gene for a mammalian vector. The vector may be used in vitro, for example for the production of RNA
or protein. The vector may be further used to transform, transfect, infect or transduce a host cell or an organism. The present invention further contemplates the use of host cells and organisms harboring or expressing the HCV nucleic acid sequences or polypeptides of the invention for the identification of agents that affect the activity of the HCV NSSB protein.
In yet another embodiment of the invention, methods are provided for the identification of agents that affect the HCV NSSB polymerase sequences. Such methods include high throughput screening procedures that allow assessment of large numbers of agents. The agents identified by use of the HCV NSSB nucleic acids and polypeptides of the invention, variants thereof, or methods of the invention, may be either antagonistic or agonistic in their affect on the NSSB sequences. These agents may include molecules of any number of classes including but not limited to small molecules, polymers, peptides, polypeptides, immunoglobulins or fragments thereof, oligonucleotides, antisense molecules, , peptide-nucleic acid conjugates, ribozymes, polynucleotides and the like. It is specifically contemplated that both antagonistic and agonistic molecules identified by practice of the invention have broad and multiple utilities. Such utilities for antagonists of HCV NSSB activity include, but are not limited to, uses for the inhibition of HCV replication in humans, in other living hosts and in in vitro systems such as cell, tissue and organ cultures. Agonists of HCV NSSB activity identified by practice of the invention will also have multiple utilities, both in living hosts and in in vitro systems. For example, such agents will be useful in the development of animal models of HCV infection, replication or disease and for the propagation of HCV in a living host or in cell, tissue or organ culture systems.
According to another aspect of the invention, kits are provided to facilitate the use of the compositions and methods disclosed herein. Exemplary kits would include HCV NS5B nucleic acids and polypeptides of the invention, variants thereof, alone or in association with suitable vectors. Also included would be protocols for use of the compositions of the invention for the particular application and the necessary reagents to carry out the application. The reagents of a kit may vary depending on the intended application. Such reagents may include, but are not limited to buffers, solvents, media and solutions, substrates and cofactors, vectors and host cells, and detection or reporter reagents. Other accessories may also be included such as vials, vessels and reaction chambers.
The following definitions are provided to aid in understanding the subject matter regarded as the invention.
As used herein, "hepatitis C virus" or "HCV" shall mean any representative of a diverse group of related viruses classified within the hepacivirus genus of the Flaviviridae family.
"Nucleic acid" or a "nucleic acid molecule" as used herein refers to any DNA or RNA molecule, either single or double stranded and, if single stranded, the molecule of its complementary sequence in either linear or circular form. In discussing nucleic acid molecules, a sequence or structure of a particular nucleic acid molecule may be described herein according to the normal convention of providing the sequence in the 5' to 3' direction. With reference to nucleic acids of the invention, the term "isolated nucleic acid" is sometimes used. This term, when applied to DNA, refers to a DNA
molecule that is separated from sequences with which it is immediately contiguous in the naturally occurring genome of the organism in which it originated. For example, an "isolated nucleic acid" may comprise a DNA
molecule inserted into a vector, such as a plasmid or virus vector, or integrated into the genomic DNA of a prokaryotic or eukaryotic cell or host organism.
When applied to RNA, the term "isolated nucleic acid" refers primarily to an RNA molecule encoded by an isolated DNA molecule as defined above. Alternatively, the term may refer to an RNA molecule that has been sufficiently separated from other nucleic acids with which it would be associated in its natural state (i.e., in cells or tissues). An isolated nucleic acid (either DNA or RNA) may further represent a molecule produced directly by biological or synthetic means and separated from other components present during its production.
"Natural allelic variants", "mutants" and "derivatives" of particular sequences of nucleic acids refer to nucleic acid sequences that are closely related to a particular sequence but which may possess, either naturally or by design, changes in sequence or structure. By closely related, it is meant that at least about 75°s, but often, more than 90~, of the nucleotides of the sequence match over the defined length of the nucleic acid sequence referred to using a specific SEQ ID NO. Changes or differences in nucleotide sequence between closely related nucleic acid sequences may represent nucleotide changes in the sequence that arise during the course of normal replication or duplication in nature of the particular nucleic acid sequence. Other changes may be specifically designed and introduced into the sequence for specific purposes, such as to change. an amino acid codon or sequence in a regulatory region of the nucleic acid. Such specific changes may be made in vitro using a variety of mutagenesis techniques or produced in a host organism placed under particular selection conditions that induce or select for the changes. Such sequence variants generated specifically may be referred to as "mutants" or "derivatives" of the original sequence.
The terms "percent similarity", "percent identity"
and "percent homology" when referring to a particular sequence are used as set forth in the University of Wisconsin GCG software program.
The term "NSSB" refers to a portion of the HCV
genome located near the 3' end of the viral genome that specifies the region encoding a protein, termed the "NSSB protein", "NSSB polypeptide", "NSSB polymerase" or combinations of these terms which are used interchangeably herein. NSSB in its natural state, functions as an RNA-dependent RNA polymerase (RdRp).
The nucleic acid region encoding the NSSB protein may also be referred to as the "NSSB gene". Thus, the term "NSSB" may refer to either a nucleic acid encoding the NSSB polypeptide, to an NSSB gene or to an NSSB
polypeptide, or to any portions thereof, depending on the context in which the term is used. NSSB may further refer to natural allelic variants, mutants and derivatives of either NSSB nucleic acid sequences or NSSB polypeptides. The NSSB nucleic acid, NSSB gene or NSSB protein referred to may be either functional or non-functional.
The present invention also includes active portions, fragments, derivatives and functional or non-functional mimetics of HCV NSSB polypeptides or proteins of the invention. An "active portion" of HCV
NSSB polypeptide means a peptide that is less than the full length HCV NSSB polypeptide, but which retains measurable biological activity.
A "fragment" or "portion" of the HCV NSSB
polypeptide means a stretch of amino acid residues of at least about five to seven contiguous amino acids, often at least about seven to nine contiguous amino acids, typically at least about nine to thirteen contiguous amino acids and, most preferably, at least about twenty to thirty or more contiguous amino acids. Fragments of the HCV NSSB polypeptide sequence, antigenic determinants, viral antigens or epitopes are useful for eliciting immune responses to a portion of the HCV NSSB
amino acid sequence.
A "derivative" of the HCV NSSB polypeptide or a fragment thereof means a polypeptide modified by varying the amino acid sequence of the protein, e.g. by manipulation of the nucleic acid encoding the protein or by altering the protein itself. Such derivatives-of the natural amino acid sequence may involve insertion, addition, deletion or substitution of one or more amino acids, and may or may not alter the essential activity of original the HCV NSSB polypeptide. As mentioned above, the HCV NSSB polypeptide or protein of the invention includes any analogue, fragment, derivative or mutant which is derived from a HCV NSSB
polypeptide and which retains at least one property or other characteristic of the HCV NSSB polypeptide.
Different "variants" of the HCV NSSB polypeptide exist in nature. These variants may be alleles characterized WO 99!51781 PCT/US99/07404 by differences in the nucleotide sequences of the gene coding for the protein, or may involve different RNA
processing or post-translational modifications. The skilled person can produce variants having single or multiple amino acid substitutions, deletions, additions or replacements. These variants may include inter alias (a) variants in which one or more amino acids residues are substituted with conservative or non-conservative amino acids, (b) variants in which one or more amino acids are added to the HCV NSSB polypeptide, (c) variants in which one or more amino acids include a substituent group, and (d) variants in which the HCV
NSSB polypeptide is fused with another peptide or is polypeptide such as a fusion partner, a protein tag or other chemical moiety, that may confer useful properties to the HCV NSSB polypeptide, such as, for example, an epitope for an antibody, a polyhistidine sequence, a biotin moiety and the like. Other HCV NSSB polypeptides of the invention include variants in which amino acid residues from one species are substituted for the corresponding residue in another species, either at the conserved or non-conserved positions. In another embodiment, amino acid residues at non-conserved positions are substituted with conservative or non-conservative residues. The techniques for obtaining these variants, including genetic (suppressions, deletions, mutations, etc.), chemical, and enzymatic techniques are known to the person having ordinary skill in the art.
To the extent such allelic variations, analogues, fragments, derivatives, mutants, and modifications, including alternative nucleic acid processing forms and alternative post-translational modification forms result in derivatives of the HCV NSSB polypeptide that retain any of the biological properties of the HCV NSSB
polypeptide, they are included within the scope of this invention.
The term "functional" as used herein implies that the nucleic or amino acid sequence is functional for the recited assay or purpose.
The phrase "consisting essentially of" when referring to a particular nucleotide or amino acid means a sequence having the properties of a given SEQ ID
No:. For example, when used in reference to an amino acid sequence, the phrase includes the sequence per se and molecular modifications that would not affect the basic and novel characteristics of the sequence.
A "replicon" is any genetic element, for example, a plasmid, cosmid, bacmid, phage or virus, that is capable of replication largely under its own control. A replicon may be either RNA or DNA and may be single or double stranded.
A "vector" is a replicon, such as a plasmid, cosmid, bacmid, phage or virus, to which another genetic sequence or element (either DNA or RNA) may be attached so as to bring about the replication of the attached sequence or element.
An "expression operon" refers to a nucleic acid segment that may possess transcriptional and translational control sequences, such as promoters, enhancers, translational start signals (e.g., ATG or AUG
codons), polyadenylation signals, terminators, and the like, and which facilitate the expression of a polypeptide coding sequence in a host cell or organism.
The term "oligonucleotide," as used herein refers to primers and probes of the present invention, and is defined as a nucleic acid molecule comprised of two or more ribo- or deoxyribonucleotides, preferably more than three. The exact size of the oligonucleotide will depend on various factors and on the particular application and use of the oligonucleotide.
The term "probe" as used herein refers to an oligonucleotide, polynucleotide or nucleic acid, either RNA or DNA, whether occurring naturally as in a purified restriction enzyme digest or produced synthetically, which is capable of annealing with or specifically hybridizing to a nucleic acid with sequences complementary to the probe. A probe may be either single-stranded or double-stranded. The exact length of the probe will depend upon many factors, including temperature, source of probe and use of the method. For example, for diagnostic applications, depending on the complexity of the target sequence, the oligonucleotide probe typically contains 15-25 or more nucleotides, although it may contain fewer nucleotides. The probes herein axe selected to be "substantially" complementary to different strands of a particular target nucleic acid sequence. This means that the probes must be sufficiently complementary so as to be able to "specifically hybridize" or anneal with their respective target strands under a set of pre-determined conditions.
Therefore, the probe sequence need not reflect the exact complementary sequence of the target. For example, a non-complementary nucleotide fragment may be attached to the 5' or 3' end of the probe, with the remainder of the probe sequence being complementary to the target strand.
Alternatively, non-complementary bases or longer sequences can be interspersed into the probe, provided that the probe sequence has sufficient complementarity with the sequence of the target nucleic acid to anneal therewith specfically.
The term "specifically hybridize'" refers to the association between two single-stranded nucleic acid molecules of sufficiently complementary sequence to permit such hybridization under pre-determined conditions generally used in the art (sometimes termed "substantially complementary"). In particular, the term refers to hybridization of an oligonucleotide with a substantially complementary sequence contained within a single-stranded DNA or RNA molecule of the invention, to the substantial exclusion of hybridization of the oligonucleotide with single-stranded nucleic acids of non-complementary sequence.
The term "primer" as used herein refers to an oligonucleotide, either RNA or DNA, either single-stranded or double-stranded, either derived from a biological system, generated by restriction enzyme digestion, or produced synthetically which, when placed in the proper environment, is able to functionally act as an initiator of template-dependent nucleic acid synthesis. When presented with an appropriate nucleic acid template, suitable nucleoside triphosphate precursors of nucleic acids, a polymerase enzyme, suitable cofactors and conditions such as a suitable temperature and pH, the primer may be extended at its 3' terminus by the addition of nucleotides by the action of a polymerase or similar activity to yield an primer extension product. The primer may vary in length depending on the particular conditions and requirement of the application. For example, in diagnostic applications, the oligonucleotide primer is typically 15-25 or more nucleotides in length. The primer must be of sufficient complementarity to the desired template to prime the synthesis of the desired extension product, that is, to be able anneal with the desired template strand in a manner sufficient to provide the 3' hydroxyl moiety of the primer in appropriate juxtaposition for use in the initiation of synthesis by a polymerase or similar enzyme. It is not required that the primer sequence represent an exact complement of the desired template. For example, a non-complementary nucleotide sequence may be attached to the 5' end of an otherwise complementary primer. Alternatively, non-complementary bases may be interspersed within the oligonucleotide primer sequence, provided that the primer sequence has sufficient complemeritarity with the sequence of the desired template strand to functionally provide a template-primer complex for the synthesis of the extension product. Amino acid residues described herein are preferred to be in the "L" isomeric form. However, residues in the "D" isomeric form may be substituted for any L-amino acid residue, provided the desired properties of the polypeptide are retained.
All amino-acid residue sequences represented herein conform to the conventional left-to-right amino-terminus to carboxy-terminus orientation.
The term "isolated protein" or "isolated and purified protein" is sometimes used herein. This term refers primarily to a protein produced by expression of an isolated nucleic acid molecule of the invention.
Alternatively, this term may refer to a protein that has been sufficiently separated from other proteins with which it would naturally be associated, so as to exist in "substantially pure" form. "Isolated" is not meant to exclude artificial or synthetic mixtures with other compounds or materials, or the presence of impurities that do not interfere with the fundamental activity, and that may be present, for example, due to incomplete purification, addition of stabilizers, or compounding into, for example, immunogenic preparations or pharmaceutically acceptable preparations.
The term "substantially pure" refers to a preparation comprising at least 50-60~ by weight of a given material (e. g., nucleic acid, oligonucleotide, protein, etc.). More preferably, the preparation comprises at least 75% by weight, and most preferably 90-95% by weight of the given compound. Purity is measured by methods appropriate for the given compound (e. g. chromatographic methods, agarose or polyacrylamide gel electrophoresis, HPLC analysis, and the like).
"Mature protein" or "mature polypeptide" shall mean a polypeptide possessing the sequence of the polypeptide after any processing events that normally occur to the polypeptide during the course of its genesis, such as protoelytic processing from a polyprotein precursor. In designating the sequence or boundaries of a mature protein, the first amino of the mature protein sequence is designated as amino acid residue 1. In the case of the mature NSSB protein, its normal biogenesis entails its proteolytic cleavage from a precursor polyprotein.
Thus, the first amino acid residue of the mature NSSB
protein represents a serine residue for all known HCV
sequences. As used herein, any amino acid residues associated with a mature protein not naturally found associated with that protein that precedes amino acid 1 are designated amino acid -1, -2, -3 and so on. For recombinant expression systems, a methionine initiator codon is often utilized for purposes of efficient translation. Thus, in the case of NSSB, a methionine codon may be place immediately proceeding the serine codon. This methionine residue in the resulting polypeptide, as used herein, would be positioned at -1 relative to the mature NS5B protein sequence.
The term "tag," "tag sequence" or "protein tag"
refers to a chemical moiety, either a nucleotide, oligonucleotide, polynucleotide or an amino acid, peptide or protein or other chemical, that when added to another sequence, provides additional utility or confers useful properties, particularly in the detection or isolation, to that sequence. Thus, for example, a homopolymer nucleic acid sequence or a nucleic acid sequence complementary to a capture oligonucleotide may be added to a primer or probe sequence to facilitate the subsequent isolation of an extension product or hybridized product. In the case of protein tags, histidine residues (e. g., 4 to 8 consecutive histidine residues) may be added to either the amino- or carboxy-terminus of a protein to facilitate protein isolation by chelating metal chromatography.
Alternatively, amino acid sequences, peptides, proteins or fusion partners representing epitopes or binding determinants reactive with specific antibody molecules or other molecules (e. g., flag epitope, c-myc epitope, transmembrane epitope of the influenza A virus hemaglutinin protein, protein A, cellulose binding domain, calmodulin binding protein, maltose binding protein, chitin binding domain, glutathione S-transferase, and the like) may be added to proteins to facilitate protein isolation by procedures such as affinity or immunoaffinity chromatography. Chemical tag moieties include such molecules as biotin, which may be added to either nucleic acids or proteins and facilitates isolation or detection by interaction with avidin reagents, and the like. Numerous other tag moieties are known to, and can be envisioned by, the trained artisan, and are contemplated to be within the scope of this definition.
As used herein, the terms "reporter," "reporter system", "reporter gene," or "reporter gene product"
shall mean an operative genetic system in which a nucleic acid comprises a gene that encodes a product that when expressed produces a reporter signal that is a readily measurable, e.g., by biological assay, immunoassay, radioimmunoassay, or by colorimetric, fluorogenic, chemiluminescent or other methods. The nucleic acid may be either RNA or DNA, linear or circular, single or double stranded, antisense or sense polarity, and is operatively linked to the necessary control elements for the expression of the reporter gene product. The required control elements will vary according to the nature of the reporter system and whether the reporter gene is in the form of DNA or RNA, but may include, but not be limited to, such elements as promoters, enhancers, translational control sequences, poly A addition signals, transcriptional termination signals and the like.
The terms "transform", "transfect", "transduce", shall refer to any method or means by which a nucleic acid is introduced into a cell or host organism and may be used interchangeably to convey the same meaning.
Such methods include, but are not limited to, transfection, electroporation, microinjection, PEG-fusion and the like.
The introduced nucleic acid may or may not be integrated (covalently linked) into nucleic acid of the recipient cell or organism. In bacterial, yeast, plant and mammalian cells, for example, the introduced nucleic acid may be maintained as an episomal element or independent replicon such as a plasmid. Alternatively, the introduced nucleic acid may become integrated into the nucleic acid of the recipient cell or organism and be stably maintained in that cell or organism and further passed on or inherited to progeny cells or organisms of the recipient cell or organism. In other manners, the introduced nucleic acid may exist in the recipient cell or host organism only transiently.
A "clone" or "clonal cell population" is a population of cells derived from a single cell or common ancestor by mitosis.
A "cell line" is a clone of a primary cell or cell population that is capable of stable growth in vitro for many generations.
An "immune response" signifies any reaction produced by an antigen, such as a viral antigen, in a _ host having a functioning immune system. Immune responses may be either humoral in nature, that is, involve production of immunoglobulins or antibodies, or cellular in nature, involving various types of B and T
lymphocytes, dendritic cells, macrophages, antigen presenting cells and the like, or both. Immune responses may also involve the production or elaboration of various effector molecules such as cytokines, lymphokines and the like. Immune responses may be measured both in in vitro and in various cellular or animal systems. Such immune responses may be important in protecting the host from disease and may be used prophylactically and therapeutically.
A "viral antigen" shall be any peptide, polypeptide or protein sequence, segment or epitope that is derived from a virus that has the potential to cause a functioning immune system of a host to react to said viral antigen.
An "antibody" or "antibody molecule" is any immunoglobulin, including antibodies and fragments thereof, that binds to a specific antigen. The term includes polyclonal, monoclonal, chimeric, and bispecific antibodies. As used herein, antibody or antibody molecule contemplates both an intact immunoglobulin molecule and an immunologically active portion of an immunloglobulin molecule such as those portions known in the art as Fab, Fab', F(ab')2 and F (v) .
As used herein, the term "living host" shall mean any non-human autonomous being.
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1 shows an alignment of the amino acid sequences of several NSSB proteins of the invention.
The approximate positions of conserved sequence motifs present in RdRp enzymes identified by Koonin (J Gen Virol. (1991) 72:2197-206] (Roman numerals) and Poch et a1. [EMBO J. (1989) 8:3867-74] (letters) are indicated above the clone 4 sequence.
Figure 2 shows the purification of the HCV NSSB
protein. Sf9 cells infected with a recombinant baculovirus expressing the HCV NSSB gene were harvested and lysed. Cleared lysate was subjected to a series of protein purification steps. Samples for each step of the purification procedure were electrophoresed on an SDS-containing polyacrylamide gel, which was then silver-stained. Lane l: cleared cell lysate; lane 2, flow-through material from DEAE column; lane 3, material from heparin column; lane 4, material from Cibracron blue column. M = molecular mass standards; numbers in kilodaltons.
Figure 3 is an alignment of the clone 4 NSSB
sequence of the invention with the genotype la consensus NSSB sequence derived from an infectious clone (GenBank Accession Number AF009606) and a genotype la NSSB
sequence (PCT WO 97/12033) previously shown to have RdRp activity. The dashed lines indicate amino acid residue identity.
Figure 4 shows an alignment of the clone 4 NSSB
sequence of the invention with a genotype lb "consensus"
amino acid sequence derived from sequences of HCV NSSB
sequences obtained from the GenBank database and with genotype lb NSSB sequences previously shown to be functional (GenBank Accession Numbers M58335 and 297730). The dashed lines indicate amino acid residue identity.
Figure 5 shows a protein sequence alignment of the HCV genotype lb NSSB gene reported by Yanagi et al.
[Virology (1998) 244:161-172; GenBank Accession Number AF054247] and clone 4 of the present invention. The dashed lines indicate amino acid residue identity.
Figure 6 shows results of a high throughput assay for HCV NSSB RdRp activity.
Figure 7 shows the sequence of SEQ ID NO: 1.
Figure 8 shows the sequence of SEQ ID NO: 3.
Figure 9 shows the sequence of SEQ ID NO: 4.
Figure 10 shows the sequence of SEQ ID NO: 5.
Figure 11 shows the sequence of SEQ ID NO: 6.
Figure 12 shows the sequence of SEQ TD NO: 7.
Figure 13 shows the amino acid sequence of clone 20(V-1M), SEQ ID NO: 13.
DETAILED DESCRIPTION OF THE INVENTION
HCV is the major causative agent of transfusion-associated and sporadic non-A, non-B hepatitis. A high number of HCV-infected patients develop chronic hepatitis that eventually leads to cirrhosis and often progresses to hepatocellular carcinoma. There is an urgent need for new effective treatments of this disease.
HCV is an enveloped virus with a (+) stranded linear RNA genome of approximately 9.4 kilobases. This nucleic acid encodes a large polyprotein that is processed by viral and cellular proteases into at least 9 different viral polypeptides.
In one of its aspects, the present invention provides HCV genetic material derived from an HCV-infected patient. The invention further provides HCV
recombinant NSSB proteins expressed from these sequences and sequences that have RdRp actitrity.
Expression of recombinant HCV NS58 gene sequences may be carried out in a variety of systems including but not limited to bacterial, yeast, mammalian, insect and plant cell systems, as well as in organisms such as infected, transfected, transduced or transgenic insects, animals or plants. In one embodiment of the invention, recombinant baculoviruses were constructed to express HCV NSSB gene sequences in insect cells following infection in culture.
RNA extracted from the serum of a patient infected with HCV was subjected to a reverse transcriptase-nested polymerase chain reaction procedure using primer oligonucleotides designed to amplify the NSSB gene sequences. Primers for the nested PCR reaction allowed direct cloning of the NSSB gene into a baculovirus expression transfer vector, providing an initiator methonine codon immediately preceeding the first amino acid of the authentic NSSB coding sequence. The NSSB
gene from several transfer vector clones was sequenced and used to generate recombinant baculoviruses.
Infection of Sf9 cells with these viruses, followed by Western immunoblotting with HCV NSSB sequence-specific antiserum, showed clear production of the 68 kilodalton NS5B protein.
In another aspect of the invention, NSSB sequences that are expressed, purified and evaluated for RdRp activity may possess varying levels of RdRp activity, from highly active to little or no activity, and may thus represent functional, poorly functional or non-functional sequences, respectively. Such sequences would also be assessed for activity in accordance with the present invention.
In a further aspect of the invention, HCV NSSB
proteins may be modified by particular changes in nucleotide and amino acid sequence that result in RdRp enzymes with altered functionality. Such changes may be subtle and represent conservative substitutions such as in the case of nucleotide sequences, changes in the codon sequence that do or do not alter the encoded amino acid, or for amino acid sequences, changes that result in conservative residue substitutions, additions or deletions.
In yet a further aspect of the invention, NSSB
nucleic acids and polypeptides derived from sequences of the invention have utility in numerous methods, assays and kits involving research, diagnostic, therapeutic and pharmaceutical applications, and in the development of antiviral strategies for the prevention and treatment of HCV disease.
Based on the discoveries described herein, it is demonstrated that simple knowledge of, or mere inspection of, a nucleotide or amino acid sequence of an NSSB gene or protein is insufficient to enable one to deduce or predict that the particular NS58 sequence represents a sequence that has enzymatic activity or functional utility.
Preparation of HCV NS58 Nucleic Acid Molecules and HCV
NS58 Proteins and Uses Thereof in Assay Methods and Kits A. Nucleic Acid Molecules Nucleic acid molecules encoding the HCV NS5B
proteins of the invention may be prepared by two general methods: (1) They may be synthesized from appropriate chemical starting materials, or (2) they may be isolated from biological sources. Both methods utilize protocols well known in the art.
The availability of nucleotide sequence information, such as that provided herein for HCV NSSB
sequences, enables preparation of an isolated nucleic acid molecule of the invention by oligonucleotide synthesis. Synthetic oligonucleotides may be prepared by the phosphoramadite method employed in the Applied Biosystems 38A DNA Synthesizer or similar devices. The resultant construct may be purified according to methods known in the art, such as high performance liquid chromatography (HPLC). Long, double-stranded polynucleotides, such as a DNA molecule of the present invention, must be synthesized in stages due to the size limitations inherent in current oligonucleotide synthetic methods. Thus, for example, a 3 kilobase double-stranded molecule may be synthesized as several smaller segments of appropriate complementarity.
Complementary segments thus produced may be ligated such that each segment possesses appropriate cohesive termini for attachment of an adjacent segment. Adjacent segments may be ligated by annealing cohesive termini in the presence of DNA ligase to construct an entire 3 kilobase double-stranded molecule. A synthetic DNA
molecule so constructed may then be cloned and amplified in an appropriate vector.
Nucleic acid sequences encoding HCV NSSB proteins may be isolated from appropriate biological sources using methods known in the art. For example, RNA
isolated from the serum of an HCV infected patient may be used as a suitable starting material for the generation of cDNA molecules encoding HCV NSSB proteins.
In accordance with the present invention, nucleic acids having the appropriate level of sequence homology WO 99/51781 PCT/tJS99/07404 with the protein coding region of the DNA molecules of the present invention may be identified by using hybridization and washing conditions of appropriate stringency. For example, hybridizations may be performed, using a hybridization solution comprising, for example, 5X SSC, 5X Denhardt's reagent, 1.0% SDS, 100 ,ug/ml denatured, fragmented salmon sperm DNA, 0.05%
sodium pyrophosphate and up to 50% formamide.
Hybridization is carried out at 37-42°C for at least six hours. Following hybridization, filters are washed as follows: (1) 5 minutes at room temperature in 2X SSC and 1% SDS; (2) 15 minutes at room temperature in 2X SSC and 0.1% SDS; (3) 30 minutes-1 hour at 37°C in 1X SSC and 1%
SDS; (4) 2 hours at 42-65°C in 1X SSC and 1% SDS, changing the solution every 30 minutes.
One common formula for calculating the stringency conditions required to achieve hybridization between nucleic acid molecules of a specified sequence homology is as follows (Sambrook et al., 1989):
Tm = 81.5°C + 16.6Log [Na+] + 0.41(% G+C) - 0.63 (% formamide) -600/#bp in duplex As an illustration of the above formula, using [Na+] -[0.368] and 50% formamide, with GC content of 42% and an average probe size of 200 bases, the Tm is 57°C. The Tm of a DNA duplex decreases by 1-1.5°C with every 1%
decrease in homology. Thus, targets with greater than about 75% sequence identity would be observed using a hybridization temperature of 42°C. Such a sequence would be considered substantially homologous to the sequences of the present invention.
Nucleic acids of the invention may be maintained as DNA in any convenient cloning vector. In one embodiment, clones are maintained in plasmid cloning/expression vectors, such as pBluescript plasmids (Stratagene, La Jolla, CA) or recombinant baculovirus transfer vectors such as pFastBac vectors (Gibco-BRL, Gaithersburg, MD) that are propagated in suitable E.
coli host cells.
The nucleic acids of the invention may also be used as starting materials for the generation of sequence variants of the nucleic acids of the invention using any number of synthetic and molecular biologic procedures well known in the art including but not limited to site-directed mutagenesis techniques. Particular mutations may give rise to HCV NSSB proteins with altered characteristics such as increased enzymatic activity.
HCV NSSB protein-encoding nucleic acid molecules of the invention include cDNA, genomic DNA, RNA, and fragments thereof, which may be single- or double-stranded in nature. Thus, this invention provides oligonucleotides (sense or antisense strands of DNA or RNA) having sequences capable of hybridizing with at least one sequence of a nucleic acid molecule of the present invention, such as selected segments of the cDNA
having substantially the sequence of any of the sequences identified in the present invention. Such oligonucleotides are further useful as probes and primers for detecting or isolating additional HCV NSSB
encoding nucleic acids.
B. Proteins HCV NSSB proteins of the present invention may be prepared in a variety of ways, according to any number of known methods. The protein may be purified from appropriate sources, e.g., cultured cells, tissues or organs, by a variety of techniques that may include partitioning and precipitation procedures, affinity purification methods, conventional chromatography procedures, high performance chromatography techniques and the like.
The availability of nucleic acids molecules encoding HCV NSSB protein enables production of the protein using in vitro expression methods known in the art. For example, a cDNA or gene may be cloned into an appropriate in vitro transcription vector, such as pSP64 or pSP65 for in vitro RNA synthesis, followed by cell-free translation of the RNA in a suitable cell-free translation system, such as extracts of wheat germ, rabbit reticulocytes or HeLa cells. In vitro transcription and translation systems are commercially available (e.g., Promega Biotech, Madison, WI;
Gibco-BRL, Gaithersburg, MD).
Alternatively, according to a preferred embodiment of the invention, larger quantities of HCV NS5B protein may be produced by expression in suitable prokaryotic or eukaryotic systems such as bacterial, fungal, mammalian or plant systems. For example, part or all of a DNA
molecule, such as a cDNA may be inserted into a plasmid vector adapted for expression in a bacterial cell, such as E. coli, or into a baculovirus vector for expression in an insect cell. Such vectors comprise the regulatory elements necessary for expression of the DNA in the host cell (e. g., E. coli or insect cell), positioned in such a manner as to permit expression of the DNA in the host cell. Such regulatory elements required for expression may include promoter sequences, transcriptional initiation and termination sequences, enhancer sequences, translational control sequences and the like.
The HCV NSSB proteins or derivatives thereof produced by gene expression in a recombinant prokaryotic or eukaryotic system may be purified according to methods known in the art. In one embodiment, a commercially available expression/secretion system can be used, whereby the recombinant protein is expressed and thereafter secreted from the host cell, to be easily purified from the surrounding medium. If expression/secretion vectors are not used, an alternative approach involves purifying the recombinant protein from extracts of expressing cells, tissues or organs by standard protein purification techniques or by affinity separation techniques, such as by immunological interaction with antibodies that bind specifically to the recombinant protein or by nickel columns for isolation of recombinant proteins tagged with 5-8 histidine residues at their N-terminus or C-terminus.
Such methods are commonly used by skilled practitioners.
The HCV NSSB proteins of the invention, prepared by the aforementioned methods, may be analyzed according to standard procedures. For example, such proteins may be subjected to electrophoretic analyses and to amino acid sequence analyses, as well as to crystallographic analyses for structure determination according to known methods. Such analyses provide useful information regarding the functionality of the NSSB protein and on means to affect that functionality, such as in the design of molecules that may inhibit the function of the NSSB protein.
C. Assay Methods and Kits The HCV NSSB sequences of the invention may be used in a variety of ways having utility in research, diagnostic, therapeutic and pharmaceutical applications.
Representative methods of use for the compositions of the invention are described below.
In one aspect, the nucleic acid sequences of the invention, and sequences complementary to these, may be used as probes or primers for the detection, labeling, identification or isolation of related nucleic acids in biological or synthetic preparations. For example, nucleic acid sequences of the invention may be used as hybridization probes to detect the presence of HCV in samples. Such hybridization probes may further be used to isolate the nucleic acids to which they are hybridized by techniques well known in the art.
Additionally, the nucleic acid sequences of the invention may be used as primers for the detection or isolation of HCV or related nucleic acids using techniques such as reverse transcriptase-polymerase chain reaction (RT-PCR). Appropriate primers pairs may be further used in nested PCR applications. Such primers, primer pairs and probes may represent any portion of the NSSB sequences of the invention. The actual sequence of the NSSB gene used will vary according to the specific application. Moreover, additional sequences may be added to the HCV primer or probe sequence, such as homopolymer tails (tags), sequences that represent useful restriction enzyme recognition sites, sequences encoding particular amino acid residues, initiation or termination codons or other sequences that may be useful fox the particular application at hand. Typically, oligonucleotides of from 10 to 80 nucleotides in length that are either the same as or complementary to the sequences of the invention are useful as hybridization probes or as primers in RT-PCR applications. Alternatively, the entire NSSB sequence may be employed as a capture hybridization probe, for example.
Several examples of useful oligonucleotide primers and probes of the invention comprise sequences set forth in Table 1, sequences complementary to these and potions of these sequences.
Table 1 Oligonucleotides useful as probes and primers 5'-TCAATGTCCTACACATGGAC-3' SEQ IDNO: 14 5'-CTACACATGG-3' SEQ IDNO: 15 2 5 5'-CTCTGATTACACCATGCGCTGCGGAGGAGAGCAAGCTGCCC-3'SEQ IDNO: 16 5'-AATGCGCTGAGCAACTCTTTGCTGCGCC-3' SEQ IDN0: 17 5'-CCATAACATGGTCTATGCCACAACATCCCGCAGCGCAAGCCAGCGGC-3' IDNO: 18 SEQ
5'-GAAGAAGGTAACTTTTGACAGG-3' SEQ IDNO: 19 5'-CAAGTCCTGGATGACCACTACCG-3' SEQ IDN0: 20 3 O 5'-GACGTGCTCAAGGA-3' SEQ IDNO: 21 5'-ATGAAGGCGAAGGCGTCC-3' SEQ IDN0: 22 5'-GGAAGAAGCCTGTAAG-3' SEQ IDN0: 23 5'-GAACCTATCCAGCAAGGCCGTTAA-3' SEQ IDNO: 24 5'-ACCAGAGAAAGGAGGCCGC-3' SEQ ID NO:25 5'-ACCCAGACTTGGGG-3' SEQ ID NO:26 5'-TCTCCACCCTTCCTCAGGCT-3' SEQ ID NO:27 5'-CGAGTTCCTGGTGAATGCC-3' SEQ ID NO:28 5'-TGCCCTATGGGCTTCGCATATGAC-3' SEQ ID NO:29 5'-TTTCGACTCAACGGTCACCGAGAAT-3' SEQ ID NO:30 5'-GTTGAGGAGTCAATT-3' SEQ ID NO:31 5'-TTGGCCCCCGAAGCCAGACA-3' SEQ ID NO:32 5'-AAGGTCGCTTACAGAGC-3' SEQ ID NO:33 5'-ATCGGGGGTCCCCTGAC-3' SEQ ID NO:34 5'-TAACTCAAAAGGGCAGAG-3' SEQ ID NO:35 5'-ATGTTACTTGAAGGCCTCT-3' SEQ ID NO:36 5'-GATGCTTGTGTGCGGAGACGACCTC-3' SEQ ID NO:37 5'-GGTCGCGCACGATGCATCTGGCAAAAGGGTA-3' SEQ ID NO:38 5'-CACCACCCCTCTTGCGCGG-3' SEQ ID NO:39 5'-CTCCATCCTTCTAGCTCAGGAGCAA-3' SEQ ID NO:40 5'-AGTTACTGTCCCAGGGGGGG-3' SEQ ID NO:41 5'-TCCGGCTGCGTCCCAGT-3' SEQ ID NO:42 5'-CCGACCCCGCTGGTTCATGTGGTGCC-3' SEQ ID NO:43 2 5'-CTACCTGCTCCCGAACCGA-3' SEQ ID NO:44 5'-CTACCTGCTCCCCAACCGA-3' SEQ ID NO:45 Additionally, the nucleic acid sequences of the invention may be used as primers for the generation of variants or mutants of the sequences of the invention using a variety of methodologies known in the art, including site-directed mutagenesis procedures.
In another aspect, the nucleic acid sequences of the invention may be used in the construction or generation of, or incorporated into, infectious viruses, vectors or replicons. Provision or substitution of the functionally superior NSSB sequences of the invention for poorly functional or non-functional counterparts will serve to improve the infectious and replicative characteristics of the resulting virus or replicating unit. For example, Rice et al. (PCT WO 98/39031) provide an infectious nucleic acid of HCV. The NSSB
polymerase encoded by this infectious clone is shown in the present invention to be substantially inferior in its RdRp activity to those of the present invention.
Therefore, substitution of the NSSB encoding gene of Rice et al. with those of the present invention would be expected to result in improved virus replication due to the improved characteristics of the NSSB gene and encoded protein of the present invention. Such substitutions may be carried out by standard genetic engineering procedures well known in the art. The resulting infectious nucleic acid would have considerable advantages over current infectious clones of HCV, including, but not limited to, improved or higher level viral RNA synthesis, improved levels of infectious virus production and improved virus replication in living hosts and in in vitro systems.
Use in other systems in which the function of the HCV
NSSB polymerase is important, such as in complementing or trans-complementing systems, replicon systems, defective viruses, defective interfering particles and the like, would also benefit from the use of the nucleic acid sequences of the invention.
In another embodiment, the nucleic acid sequences of the invention may be used in methods to elicit immune responses to the HCV NSSB protein. For example, the NSSB-encoding nucleic acid sequences of the invention operationally linked to an expression operon may introduced directly into cells, particularly into antigen presenting cells such as dendritic cells, of a living host or human possessing a functioning immune system. Introduction of the sequences may utilize transfection, transformation, or transduction methods, or involve the physical uptake of particles coated with the NSSB nucleic acid sequences, such as plasmid-coated gold particles. Once inside cells, the NSSB sequences are expressed, processed and presented to the host's immune system. Such methods are useful in the elicitation of humoral and cellular immune responses in a living host and in humans and in vaccines for HCV.
The nucleic acid sequences of the invention may be further used in the generation of cell lines or cellular systems that express the HCV NSSB protein. Such cell lines in which a functional NSSB protein is expressed from the NSSB genes of the invention will have utility in methods for assaying materials for antagonistic or agonistic activity toward HCV. For example, assays may be established whereby intact cells expressing an HCV
NSSB protein of the invention are contacted with agents or materials suspected of affecting the intracellular activity of the HCV NSSB protein, and the affect of such agents on the HCV NSSB activity is measured. The affect of such agents on the HCV NSSB activity may be measured in any number of ways. For example, RNA synthesis that is directly or indirectly dependent on the HCV NSSB
polymerase activity may be quantified. In one manner, the amount of a radiolabeled precursor of RNA (e.g., 3H-uridine) that is incorporated into trichloroacetic acid-precipitable RNA that is dependent on NSSB activity may be measured.
Alternatively, such cell systems may utilize a reporter system in which the production of the reporter signal is dependent on RNA synthesis by the HCV NSSB
polymerase. In one embodiment, a RNA substrate of the HCV NSSB polymerase is provided that is the antisense strand of an mRNA, the sense strand (mRNA) of which is effectively translated to produce a polypeptide capable of being detected or of producing a detectable signal (the reporter). For example, an RNA molecule is provided comprising the sequence complementary to the coding sequence of luciferase (antisense strand). The activity of the HCV NSSB polymerase on this RNA results in the production of the sense strand of the luciferase gene, which is then translated by the cellular translational system to produce luciferase protein. The luciferase protein then may be detected by antibodies to the luciferase protein or by measurement of luciferase enzymatic activity in intact cells or in cellular extracts using a luminometer or other similar device.
Numerous other reporters may serve equally well in this application including but not limited to, ~i-galactosidase, alkaline phosphatase, fluorescent green protein and the like. Furthermore, the cell systems that may be used in this method of the invention may be of bacterial, fungal, insect, avian, mammalian or plant origin.
Further, the nucleic acid sequences of the invention may be used in assays to identify agents or materials capable of interacting with or affecting the HCV NSSB nucleic acid sequences. For example, assays may be established in which nucleic acid sequences of the invention are provided and then contacted with agents or materials suspected of interacting with such sequences. Agents identified in such interaction assays would then have potential diagnostic utility and uses in the detection of HCV in, for example, biological samples. Such agents would also have potential utility in applications involving the prevention or treatment of HCV disease in an affected living host, including humans, and for the inhibition or enhancement of HCV
replication or propagation in living hosts and in in vitro systems such as cell, tissue and organ cultures.
Additional applications may be envisioned once the nature of the particular agent is clear.
The HCV NSSB protein compositions of the invention also have broad utility. In diagnostic applications, for example, the NSSB proteins, or peptides thereof, may be used in assays for the detection of immune responses to the same. For example, protein sequences or peptides of the invention rnay be used in assays in which said sequences are immobilized on a matrix and used to capture antibodies directed to said sequences.
Additionally, protein sequences or peptides of the invention may be used to detect or measure cell-mediated immune responses to the protein, such as in immune cell proliferation assays.
The HCV NSSB protein compositions of the invention also have potential utility in the elicitation of immune responses, such as in vaccines. For example, provision of the NSSB proteins of the invention, or peptides thereof, to a living organism with a functioning immune system will cause such organism to mount an immune response to the NSSB sequences. The NSSB sequences may be presented to the living organism in any number of assays well known to those trained in the art and include, but are not limited to, providing free protein or peptides, formulated protein or peptides, adjuvanted protein or peptides, protein or peptides in the context of intact or disrupted cells in which NSSB sequences are present and other such manners. Immune responses so elicited may be either humoral or cellular in nature, or both. Such immune responses may be important in protecting living hosts from HCV disease and may also provide or serve as a source of useful immunological reagents such as antibodies, that may further have therapeutic or diagnostic utility. The NS5B proteins of the invention, or peptide portions thereof, may further be used to select or purify such antibodies to NSSB.
For example, NSSB protein may be immobilized and used to bind antibodies specific to the NSSB protein, and thus enrich for such antibodies. Furthermore, the NSSB
proteins and peptides of the invention may be used to produce monoclonal antibodies to the NSSB protein using standard techniques known in the art. Antibodies to the NSSB protein, whether polyclonal or monoclonal, may be further evaluated for their ability to affect the enzymatic activity of the NSSB RdRp activity.
Several examples of portions of the NSSB protein sequences useful in the above applications comprise sequences or portions thereof, provided in Table 2.
Table 2 Peptides Useful in Methods of the Invention SMSYTWTGALITPCAAEESKLPINALSNSLLRHHNMVYATTSRSASQRQK
lO KVTFDRLQVLDDHYRDVLKEMKAKASTVKA SEQ ID NO: 46 SVEEACKLTPPHSARSKFGYGAKDVRNLSSKAVNHIHSVWKDLLEDT SEQ ID NO: 47 ETPIDTTIMAKNEVFCVQPEKGGRKPARLIVYPDLGVRVC SEQ ID NO: 48 SSYGFQYSPGQRVEFLVNAWKSKKCPMGFAYDTRCFDSTVTENDIRVEESIY
QCCDLAPEARQAIRSLTERLYIGGPLTNSKGQSCGYRRCRASGVLTTSCG SEQ ID NO: 49 CTMLVCGDDLWICESAGTQEDAASLRVFTEAMTRYSAPPGDPPQPEYDLELITSC
SEQ ID NO: 50 2 O SVAHDASGKRWYLTRDPTTPLARAAWETARHTPVNS SEQ ID NO: 51 CLRKLGVPPLRVWRHRARSVRAKLLSQGG SEQ ID NO: 52 FVAGYSGGDIYHSLSRARPRWFMWC SEQ ID NO:' 53 The protein compositions of the invention have utility in assays for the detection and identification of agents capable of interacting with or affecting the HCV NSSB protein. Assays may be established in which HCV NSSB polypeptide sequences of the invention are provided and then contacted with agents or materials suspected of interacting with such sequences. For example, upon provision of the HCV NS5B protein of the invention, or fragment or portion thereof, contacted agents may be assessed for their ability to bind specifically to the protein. Such binding agents would then have potential diagnostic utility and uses in the detection of HCV in, for example, biological samples.
Such binding agents may further affect the functional activity of the HCV protein, such as either inhibiting or enhancing the HCV NS58 function. Agents that inhibit the function of the NSSB protein would have potential utility in applications involving the prevention or treatment of HCV disease in an affected living host or for the inhibition of HCV replication or propagation in living hosts, including humans, in in vitro systems such as cell, tissue and organ cultures or in biological materials. Agents that enhance the function of the NSSB
protein would have potential utility in applications involving the replication, propagation or production of HCV in living hosts, such as in animal models of HCV
replication, and in in vitro systems such as cell, tissue and organ cultures.
In another embodiment, methods of assay are provided in which the HCV NSSB polymerase activity furnished by an enzymatically active NSSB protein of the invention is measured directly. Agents placed in contact with said enzymatically active NSSB polymerase may be assessed for their ability to specifically affect this enzymatic activity. Such enzymatically active polymerase may be provided in an extract or lysate of a cell in which the polypeptide was produced, in an in vitro cell-free expression system or in an enriched or purified form.
There are numerous means by which the enzymatic activity of the HCV NSSB protein provided in an extract, cell-free system or enriched form may be assessed, and these are well known in the art. NSSB-dependent RNA synthesis typically requires certain reaction components including minimally a buffered medium, a divalent ration, precursors of RNA (nucleoside triphosphates, NTPs), an RNA template and a primer for RNA synthesis on that template. Additional components may include monovalent rations, reducing agents, stabilizers, cofactors and inhibitors of activities unrelated to the NSSB RdRp activity such as inhibitors of RNase, phosphatase, kinase, phosphotransferase and similar activities.
Measurement of NSSB-dependent RNA synthesis may be assessed in numerous manners. In one example, the incorporation of a precursor of RNA into a polymer of RNA is measured, such as the incorporation of a radiolabeled NTP into trichloroacetic acid-precipitable RNA, which may then be quantified by scintillation spectrometry or phosphorimaging technologies. Such precursors may alternatively be tagged with other moieties to allow their ready detection such as with biotin for detection with avidin reagents including various avidin conjugates such alkaline phosphatase and the like or with fluorescently-labeled NTPs for detection using fluorescent technologies such as fluorescence polarization.
NSSB-dependent RNA synthesis may also be assessed by measuring the extension of a pre-labeled or tagged primer of RNA synthesis such as a radiolabeled or biotin-tagged oligonucleotide that is used by the polymerase to initiate RNA synthesis on a template RNA
molecule. Extension of the primer may be assessed by quantifying the addition of nucleoside triphosphates to the primer, by determining the length of the primer product, or by other methods known in the art.
Alternatively, the product of NSSB RdRp activity may be detected and quantified by capture of the product RNA using hybridization techniques. For example, an oligonucleotide complementary to the product of the NSSB
RdRp reaction may be introduced during or after the reaction and hybridized to the product. The extent of hybridization of the added oligonucleotide may be used as a measure of the amount of product RNA present in the mixture and may be assessed by various means known in the art.
Other means of detection of the products of NSSB
RdRp activity are readily known to, or can be envisioned by, the skilled artisan and are fully contemplated here.
Assays involving the nucleic acid and polypeptide compositions of the invention may be formatted in any number of configurations. Particularly useful for evaluating large numbers of agents and materials are high throughput screening formats. Traditionally such assays were typically formatted in 96 well plates.
However, 384, 864 and 1536 well plates may be used in such high throughput assay systems. These systems are often automated using robotics technologies to allow manipulation and processing of large numbers of samples.
The agents or materials that may be evaluated in the various assay methods of the invention for potential antagonistic or agonistic affects include but are not limited to small molecules, polymers, peptides, polypeptides, proteins, immunoglobulins or fragments thereof, oligonucleotides, antisense molecules, peptide-nucleic acid conjugates, ribozymes, polynucleotides and the like. The potential utility of agents or materials identified using the compositions and assay methods of the invention will be broad and will include uses for the detection and isolation of HCV nucleic acids and polypeptides, for the detection or diagnosis of HCV, for the prevention and treatment of HCV disease in an affected living host, including humans, and for the inhibition or enhancement of HCV replication or propagation in living hosts and in in vitro systems such as cell, tissue and organ cultures, as well as for other uses the may be envisioned once the nature of the agent is clear.
Another feature of the invention includes kits to facilitate the use of the compositions and methods disclosed herein. Exemplary kits would include HCV NSSB
nucleic acids and polypeptides of the invention, and/or variants thereof, alone or in suitable vectors. Also included would be protocols for use of the compositions of the invention for the particular application and the necessary reagents to carry out the application. Such reagents may include, but not be limited to, buffers, solvents, media and solutions, substrates and cofactors, vectors and host cells, and detection or reporter reagents. Accessory items may include vials, vessels, reaction chambers and instruction sheets.
The following examples are provided to describe the invention in further detail. These examples, which set forth the preferred mode presently contemplated for carrying out the invention, are intended to illustrate and not to limit the invention.
Cloning and Expression of IiCV NSSB Genes RNA isolated from the serum of an HCV-infected patient was used to amplify the HCV NSSB gene using an RT-nested PCR protocol. Using the following first round primers: 5'-TGA GGA TGT CGT CTG CTG CTC AAT GTC C-3' and 5'-GGG ATG GCC TAT TGG CCT GGA GT-3', the RT
reaction was performed at 50°C for 50 minutes followed by a 1 minute 94°C denaturation, followed by 40 cycles of first round PCR, 15 cycles of 94°C for 30 seconds, 50°C for 30 seconds 68°C for 2 minutes and 25 cycles of 94°C for 30 seconds, 50°C for 30 seconds, 68°C for 2 minutes.
A portion of first round PCR reaction mixture was then used in the second round PCR reaction in which the following nested primers were incorporated: 5'-AAC AGA
TCT GAA TTC TTA TAA ATA TGT CAA TGT CCT ACA CAT GGA C-3' and 5'-TGC TCT AGA GCG GCC GCT CAT CAT CGG TTG GGG AGC
AGG TAG-3', which included EcoRI and NotI restriction sites, respectively (underlined) for subsequent cloning purposes. The second round PCR involved an initial denaturation at 94°C for 1 minute, followed by 10 cycles of 94°C for 45 seconds, 50°C for 30 seconds, 68°C for 2 minutes and 20 cycles of 94°C for 30 seconds, 50°C for 30 seconds, 68°C for 2 minutes.
The resultant PCR product was purified, digested with EcoRI and NotI and ligated to pFastBac plasmid (Gibco-BRL) previously digested with EcoRI and NotI.
The ligation mixture was transformed into DH5 E. coli cells. Plasmids from bacterial colonies containing the HCV NSSB gene were used to generate a recombinant baculovirus by the transposition method of the Bac-to-Bac system (Gibco-BRL). After transformation of the HCV NSSB gene-containing pFastBac plasmid DNA into E. coli DHlOBac cells, several colonies containing bacmid DNA were transfected into Sf9 insect cells according to the protocol supplied by the manufacturer.
NSSB protein expression in recombinant baculovirus-infected cells was verified by Western immunoblot analysis with antiserum specific to the HCV
NSSB sequences.
Six independently isolated clones (clones 4, 14, 21, 11, 16 and 20) of the HCV NSSB gene from a single RNA preparation derived from one patient were sequenced.
The nucleotide sequences of these clones are provided by SEQ ID NO: 1, 3, 4, 5, 6 and 7, respectively. All six sequences were derived from a genotype lb virus and are closely related, but not identical, to one another.
Each of the sequences set forth above is unique and novel sequence, not presently listed in the GenBank database. The deduced amino acid sequences of nucleotide sequences identified by SEQ ID NO: l, 3, 4, 5, 6 and 7 are provided by SEQ ID NO: 2, 8, 9, 10, 11 and 12, respectively. These NSSH amino acid sequences are aligned relative to clone 4 (SEQ ID NO: 2) in Figure 1. As revealed in this alignment, the sequence of the NSSB protein of clones 14, 21, 11, 16 and 20 differs from that of clone 4 by 2, 5, 3, 4 and 3 amino acids, respectively.
Purification of HCV NS5B Proteins HCV NSSB proteins may be obtained in purified form from recombinant protein-expressing cell systems by any number of procedures known to the trained artisan, several of which are exemplified in Current Protocols in Molecular Biology, Frederick M. Ausubel et al. eds., John Wiley & Sons, 1995 which is incorporated by reference herein.
In the case of the present example, baculovirus clone 4-infected insect cells were disrupted in lysis butter (50~ glycerol, 20 mM Tris-HC1, pH 7.5, 10 mM
dithiothreitol (DTT), 0.5 M NaCl, 1 mM EDTA, 2~ Triton X-100) supplemented with a Complete Protease Inhibitor tablet (Boehringer Mannheim). MgCl2 was then added to a final concentration of 10 mM, followed by 10 units DNase I (RQ-1, Promega). After 30 minutes on ice, the lysate was clarified by centrifugation at 35,000 rpm for 35 minutes at 4°C.
The clarified lysate was diluted to a final NaCl concentration of 0.3 M with elution buffer (205 glycerol, 20 mM Tris-HC1, pH 7.5, 10 mM DTT, 1 mM EDTA, 0.5~ Triton X-100), and incubated with DEAE Sepharose equilibrated in elution buffer containing 0.3 M NaCl at 4°C. The mixture was then poured into a column, and flow-through material was collected. Flow-through material was diluted to a final NaCl concentration of 0.2 M with elution buffer and loaded onto a heparin Sepharose column equilibrated in elution buffer containing 0.2 M NaCl. Bound proteins were eluted with a linear gradient of NaCl (200 mM to 1 M NaCl in elution buffer) while fractions were collected.
NSSB-containing fractions were pooled and loaded onto a Cibacron Blue column equilibrated in elution buffer containing 0.4 M NaCl. Bound proteins were eluted with a linear gradient of NaCl (400 mM to 4M NaCl in elution buffer) while fractions were collected.
NSSB-containing fractions were pooled and dialyzed against 50~ glycerol, 10 mM Tris-HC1, pH 7.2, 50 mM
NaCl, 1 mM EDTA, 0.01 Triton X-100 and stored at -20°C.
Typical purification results are shown in Figure 2.
Enzymatic Activity of Purified HCV NSSH Proteins There are numerous methodologies for the measurement of RNA-dependent RNA polymerase activity that are well known to one of ordinary skill in the art.
One approach for measuring the HCV NSSB RdRp activity uses a purified recombinant NSSB protein in an in vitro RdRp assay. For example, Behrens et a1. [EMBO
J. 15:12-22 (1996)] describe the baculovirus expression, purification and enzymatic activity of the HCV NSSB RdRp derived from the BK strain of HCV. In another example, PCT WO 97/12033 [PCT/US96/15571] discloses the bacterial expression, purification and enzymatic activity of the HCV NSSB RdRp derived from an HCV sample obtained from the Centers for Disease Control and several truncated and modified versions of this sequence. Another example is Lohmann et al. [J Virol 71:8416-8428 (1997)], in which the NSSB gene derived from a chronically infected patient was expressed with recombinant baculoviruses in insect cells, purified and enzymatically evaluated. Yet another example is Yuan et al. [Biochem Biophys Res Comm 232:231-235 (1997)], in which the bacterial expression, purification and enzymatic activity of the HCV NS5B RdRp derived from a patient with chronic sporadic hepatitis is described.
Purified NSSB protein prepared according to Example 2 was incubated in a 10 ,uL standard reaction mixture consisting of 20 mM HEPES, pH 7.5, 3 mM MgCl2, 1 mM
dithiothreitol, 400U/mL RNasin (Gibco/BRL), 0.5 mM each of UTP, ATP and CTP, 0 . 1 ,uM [3zP] GTP and 0 . 03 ,ug pOF1213 RNA at 30°C for 60 minutes. The reaction is terminated by the addition of cold trichloroacetic acid (TCA) and sodium pyrophosphate. The TCA-precipitable radioactivity was then quantified to determine the extent of RdRp activity.
In addition to the NSSB proteins derived from clones 4, I4, 21, 11, 16 and 20 of the invention, the NSSB gene of the sequence derived from the genotype la consensus sequence infectious clone as described by Kolykhalov et al. (GenBank Accession Number AF009606) was expressed and purified in the same manner as the proteins of the invention. Table 3 presents a direct comparison of the enzymatic activities of the NSSB
proteins of the invention and the consensus sequence protein of Kolykhalov.
Table 3 Comparison of RdRp Activities of Various HCV NSSB
Proteins specific amino acid changes Protein activity* relative to clone clone 4 (SEQID N0:2) 9.3 --2 0 clone 14(SEQID NO:8) 1.7 2 clone 21(SEQID NO:9) 1.9 5 clone 11(SEQID NO:10) 0.2 3 clone 16(SEQID NO:11) 0.1 4 clone 20(SEQID NO:12) <0.1 3 AF009606 0.9 71 * pmole NTP incorporated per E.cg NSSB protein per 60 minutes under standard reaction conditions.
Surprisingly, a considerable range of enzymatic activities was observed among these distinct NSSB
proteins. The NSSB protein derived from clone 4 possessed the greatest activity in this comparison, while the activities of clone 14 and 21 were moderate, those of clone 11 and 16 were minimal and that of clone 20 was undetectable. The activity of the genotype la consensus NSSB protein of Kolykhalov was substantially less than that clone 4 of the invention. Lohmann et al.
reported a specific activity of their genotype lb NSSB
protein on a heteropolymeric RNA template to be 1.7 pmol//.cg/120 minutes, similar to the activity reported here for the Kolykhalov enzyme, but also significantly below that of the clone 4 enzyme.
This example demonstrates a range of functional activities among cloned and expressed NSSB sequences, from very active to inactive. In this analysis of 6 NSSB proteins of the invention, there are three instances (clones 11, 16 and 20) of NSSB proteins that are poorly functional or non-functional and three instances (clones 4, 14 and 21) of NSSB proteins that are functional.
It is further revealed here that surprisingly very few changes in amino acid sequence can be sufficient to dramatically alter the enzymatic activity of the NSSB
protein. While sequence changes within known or predicted active sites or conserved sequence motifs of an enzyme might be expected to effect an enzyme's activity, most amino acid changes among the 6 NSSB
sequences of this comparison lie outside consensus motifs of RdRp enzyme identified by Koonin [J. Gen.
Virol. 72:2197-2206 (1991)] and Poch et al. [EMBO J.
8:3867-3874 (1989)]. The two exceptions to this are as follows. Clone 16 possesses a single residue change within motif III and VI, and clone 21 possesses a single conservative amino acid change within motif VI (Figure 1). This notwithstanding, the effect of these amino acid changes, and of the others among the NSSB sequences of this example, on the RdRp activity of the NSSB
protein is surprising and could not have been anticipated from prior art.
The data presented in this example also demonstrate that the NSSB RdRp activity derived from clone 4 has dramatically superior activity over that of the NS5B
derived from the infectious clone identified by GenBank Accession Number AF009606. This result indicates that the mere generation of a consensus sequence of an NSSB
protein does not necessarily provide an NSSB protein with optimal functionality.
HCV NSSB Sequence Alignments The NSSB sequences of the invention are distinct from NSSB sequences previously characterized as functional. This is demonstrated by the sequence alignments presented in Figures 3, 4 and 5.
The sequence disclosed by Kolykhalov et al.
(GenBank Accession Number AF009606) represents a consensus sequence of known NSSB sequences derived from genotype la HCV. Figure 3 shows an alignment of the amino acid sequence of clone 4 (SEQ ID NO: 2) of the invention with that of this genotype la consensus sequence. There are 71 amino acid differences between these two sequences (excluding the initiator methionine residue in clone 4). This demonstrates that the clone 4 NS5B sequence of the invention is distinct from the genotype la consensus sequence. Alignment of this genotype 1a consensus sequence with all other sequences of the invention similarly demonstrates the distinct nature of the sequences of the invention. Also included in the alignment in Figure 3 is the genotype la sequence disclosed in PCT WO 97/12033, the NSSB protein from which was demonstrated to possess RdRp activity.
Inspection of this alignment reveals 72 amino acid differences between the sequences, again demonstrating the unique nature of the sequences of the invention.
The sequences of the invention are also distinct from a genotype lb consensus sequence. A genotype lb consensus sequence was generated based on alignment of 29 genotype lb NSSB sequences found in the GenBank database. Comparison of this consensus sequence with that of the clone 4 (SEQ ID NO: 2) of the invention shows that these sequences are distinct (Figure 4).
After the initiator methionine (at position -1), the clone 4 sequence differs from this genotype lb consensus sequence by 13 amino acids. Alignment of this genotype lb consensus sequence with all other sequences of the invention similarly demonstrates the distinct nature of the sequences of the invention. Also included in the alignment in Figure 4 are the genotype lb sequences disclosed by Behrens et a1. (GenBank Accession Number M58335) and by Lohmann et al. (GenBank Accession Number 297730). The NSSB proteins encoded by these sequences have been previously demonstrated to possess RdRp activity. Clone 4 is again distinct in that it possesses 17 amino acid changes relative to M58335 and 12 changes relative to 297730.
The sequences of the invention are further distinct from a genotype lb sequence derived from an infectious clone (Yanagi et al. Virology 244:161-172 (1998);
SS
GenBank Accession Number AF054247~. As shown in alignment presented in Figure 5, the clone 4 sequence (SEQ ID NO: 2) differs by 25 amino acid residues, excluding the methionine residue at position ~~1 in clone 4.
These alignments reveal the unique nature of sequences of the invention relative to these genotype lb sequences.
Therefore, based on comparisons with both genotype la and genotype lb consensus sequences, the NSSB
sequences of the invention do not represent a consensus sequence. Thus, based on the consensus sequence method for deducing sequence functionality, it would not be apparent that clone 4 is a functional RdRp or a functionally superior RdRp. Moreover, based on comparisons with NSSB sequences previously demonstrated to have functional RdRp activity, the sequence of clone 4 and of the other sequences of the invention are distinct from these RdRp sequences, and again, would not a priori be assumed to possess RdRp activity, and further not suspected of possessing superior RdRp activity.
HCV N85B Proteins with Improved Activity Based on sequence comparisons among NSSB sequences of the invention, a number of modified NSSB sequences were constructed in which particular amino acids were changed. These modified sequences were generated by standard site-specific mutagenesis procedures [Picard et a1. Nucleic Acid Res. 22:2587-2591 (1994)). Modified genes were engineered in the baculovirus expression system as described in Example 1, purified according to Example 2 and evaluated for RdRp activity according to Example 4.
The sequence of clone 20 differs from that of clone 4 at three amino acid residues. The presence of a valine (V) residue at position -1 of the clone 20 NSSB
protein instead of an initiator methionine (M) suggests that the NSSB protein produced from clone 20 is initiated at the methionine at position 2, and further, that protein produced from this methionine residue is inactive. The V change in clone 20 is likely an artifact of molecular cloning procedures (mistaken sequence in a primer oligonucleotide). The V residue position -1 in clone 20 was changed to M, yielding clone 20(V-1M), identified by SEQ ID NO: 13, which now differs from the sequence of clone 20 by one amino acid (at residue -1) and from clone 4 by two amino acids (at residues 177 and 543). The RdRp activity of the purified NSSB protein derived from clone 20(V-1M) was dramatically increased over that of clone 20 and significantly improved over that of clone 4 (Table 4).
Additional residue changes among the NSSB sequences of the invention can lead to useful and functional proteins. For example, when the alanine (A) residue at position 75 in clone 4 is changed to valine (V), the residue found at this position in clone 14, the resulting clone, clone (A75V), shows considerable RdRp activity (Table 4). In another example, the asparagine (N) residue in clone 4 at position 177 was changed to aspartic acid (D), the residue found at this position in all other clones of the invention, yielding clone 4(N177D). This clone showed very good RdRp activity (Table 4). In a third example, when the serine (S) at position 543 in clone 4 is changed to proline (P), as is found in clone 20, yielding clone 4(S543P), a functional RdRp is generated (Table 4).
Table 4 RdRp Activities of Various HCV NS5B Proteins Protein# specific activity clone 20 (SEQ ID NO: 12) < 0.1 clone 20(V-1M) (SEQ ID NO: 13) 23.5 clone 4 (SEQ ID NO: 2) 9.3 clone 4(A75V) (SEQ ID NO: 54) 3.5 clone 4(N177D) (SEQ ID NO: 55) 7.2 clone 4(S543P) (SEQ ID NO: 56) 3.5 * pmole NTP incorporated per E.cg NS5B protein per 60 minutes under standard reaction conditions.
# All of the changes in table 4 may also be made to the other NSSH encoding amino acid sequences set forth herein i.e. SEQ
ID NOS: 8, 9, 10, 11, 12, 13. and thus are contemplated to be within the scope of the invention.
This example demonstrates that amino acid residue changes may be made in the sequence of the NS5B protein and that such changes may maintain the functional activity of the resulting protein. Moreover, the amino acid substitutions may be either conservative or non-conservative in nature.
Additional changes of the amino acid residues among the NSSB sequences of the invention in various combinations are contemplated to be within the scope of the invention.
Novel HCV N85B Proteins with Improved Activity Another strategy for investigating functional NSSB
sequences involves the introduction of unique amino acid substitutions at positions where amino acid residues are conserved in known NSSB sequences. For example, all known NSSB sequences have as the amino terminal amino acid (position 1) a serine residue. Several modified versions of clone 4 were constructed in which this serine was substituted with either alanine [clone 4(S1A)], glycine [clone 4(S1G)] or threonine [clone 4(S1T)]. Surprisingly, all of the NSSB proteins derived from these novel sequences exhibited substantial RdRp activity. However, substitution at this position with tyrosine (Y) [clone 4{S1Y)] yielded an inactive NSSB
protein (Table 5).
Similarly, all known NSSB sequences have a methionine residue at position 2. Modified versions of clone 4 were constructed in which this methionine was substituted with either alanine [clone 4(M2A)], leucine [clone 4 (M2L) ] or threonine [clone 4 (M2T) ] .
Surprisingly, all of these novel NSSB proteins exhibited substantial RdRp activity.
In a final example, addition of an amino acid residue prior to the first residue of the mature NSSB
protein {serine at position 1), as in clone 4(MAS), in which an alanine residue is inserted before the serine residue, yields a substantially functional NSSB RdRp (Table 5).
These findings, in which amino acid substitutions are made at residues for which there is no naturally occurring variation and that result in the generation of functional, as well as dramatically improved functional, NSSB proteins, were totally unanticipated.
Moreover, these data demonstrate that the nature of amino acid residue changes capable of giving rise to functional variants of NSSB is not limited to conservative amino acid substitutions. For example, while a substitution of threonine for serine at position 1 can be viewed as a conservative amino acid substitution, the substitution with glycine represents a dramatic change in the chemical nature of the amino acid side-chain. Similarly, substitution of the methionine residue at position 2 with leucine represents a conservative change. However, replacement with threonine, a clear non-conservative change, yields a functional and functionally improved NSSB protein.
Based on these discoveries, it is therefore fully contemplated here that additional changes of the amino acid residues among the NSSB sequences of the invention, both conservative and non=conservative in nature, at various residue positions and in various combinations will yield useful NSSB compositions and are therefore within the scope of the invention.
Table 5 RdRp Activities of Various HCV NSSB Proteins Protein# specific activity clone 4 (SEQ IDNO: 2) 9.3 clone 4(S1G) (SEQ IDNO: 57) 23.0 clone 4(S1A) (SEQ IDNO: 58) 3.5 clone 4(S1T) (SEQ IDNO: 59) 3.8 clone 4(S1Y) (SEQ IDN0: 60) <0.1 clone 4(M2A) (SEQ IDN0: 61) 14.0 clone 4(M2L) (SEQ IDNO: 62) 13.0 clone 4(M2T) (SEQ IDN0: 64) 22.3 clone 4(MAS) (SEQ IDNO: 65) 15.0 * pmole NTP incorporated NSSB er 60 minutes per E.cg protein p under standard reaction conditions.
# while changes to SEQ N02 exemplifiedherein, the ID are recited alterations may also bemade to other NSSB amino the 2 acid sequences, i.e. SEQ 8, 9, 11, 12, 13.
0 ID NOS: 10, Thus, sequences so altered are also contemplated to be within the scope of the invention While Examples 5 and 6 demonstrate that various changes in the amino acid sequence of SEQ ID NO: 2 may be made to advantage, it is fully contemplated that the residue changes exemplified here will also have similar utility, either singly or in various combinations, in other NSSB sequences, including sequences of the invention (e.g., 8, 9, 10, 11 and 13, those of Tables 4 and 5), any natural allelic variants, mutants and derivatives of these and other NSSB sequences. That is to say, the changes described in Examples 5 and 6, when introduced into any NSSB sequence, will likely provide a functional or functionally improved NSSB, and are fully contemplated to be within the scope of the present invention.
Several examples of nucleic acid sequences encoding variant NSSB protein sequences useful in the practice of the invention comprise sequences provided in Table 6.
Table 6 Nucleic acid sequences encoding variant N858 Proteins*
Parental SEO ID Codon Position/Chanae SEQ ID~.NO: A codon encoding alanine at position 75 to any codon encoding valine SEQ IDNO:1 A codon encoding asparagine at positionto any codon encoding aspartic acid SEQ IDNO:1 A codon encoding serine at position 543 to any codon encoding proline SEQ IDNO:1 A codon encoding serine at position codon 1 to any encoding glycine SEQ IDNO:1 A codon encoding serine at position codon 1 to any encoding alanine SEQ IDNO:1 A codon encoding serine at position codon 1 to any encoding threonine SEQ IDNO:1 A codon encoding serine at position codon 1 to any encoding tyrosine SEQ IDNO:1 A codon encoding methionine at positionany codon 2 to encoding alanine SEQ IDNO:1 A codon encoding methionine at positionany codon 2 to encoding leucine SEQ IDNO:1 A codon encoding methionine at positionany codon 2 to encoding threonine SEQ IDN0:1 Insertion of any codon encoding alanine at -1 2 0 * While SEQ ID NO: 1 is exemplified in this table, the alterations recited may also be introduced into other NSSB encoding nucleic acid sequences set forth herein, i.e., SEQ ID NOS: 3, 4, 5, 6 and 7. Such altered nucleic acid sequences are also contemplated for use in the present invention.
The examples of Table 6 demonstrate various beneficial changes in the nucleic acid sequence of SEQ
ID N0: 1. In view of these results, it is expected that the changes exemplified in SEQ ID NO:1 will also have similar utility, either singly or in various combinations, in other NSSB sequences, including sequences of the invention (e.g., 3, 4, 5, 6 and 7,), WO 99/51781 . PCT/US99/07404 any natural allelic variants, mutants and derivatives of these and other NSSB sequences. That is to say, the changes described in this Table 6, when introduced into any NSSB sequence, will likely provide a functional or functionally improved NSSB, and are thus included in the scope of the present invention.
Utility of HCV NSSB Protein for Discovery of Antiviral Compositions The discovery of novel inhibitors of viral polymerases and related proteins often times requires the screening of large numbers of chemical compounds or mixtures of chemical compounds. Thus, an assay for polymerase activity that is capable of high volume screening, in other words, a high throughput assay, is desirable. There are a variety of assay methodologies well known to the trained artisan that allow the efficient screening of large numbers of samples [see, for example, Cole, JL, in Meth. Enzymology 275:310-328 (1996)], and may utilize any number of activity detection and measurement technologies including, but not limited to, radiometric, colorimetric, fluorogenic, or chemiluminescent, any one of which may be suitable in the case of the HCV NSSB RdRp activity.
In one approach, a high throughput assay of the RdRp activity of the functional HCV NSSB proteins of the invention is provided to enable the screening of large numbers of chemicals or other potential inhibitors for activity against the enzyme. The assay is formatted in 96-well microplates and measures polymerase activity on an RNA template-primer by the incorporation of radiolabeled NTP into trichloroacetic acid (TCA)-precipitable RNA product. Radioactivity may be quantified by either direct scintillation spectrometry or phosphorimaging technology. A phosphorimage of assay results obtained with the NSSB protein of Example 4 [clone 4] for one screening plate is presented in Fig.
6. The first (1) and last (12) columns of the plate contain activity and background controls and a titration of a reference inhibitor compound. Thus, wells A1, B1, A12 and B12 show the activity of the enzyme in the absence of any test compound (100% of the expected activity). In columns 1 and 12, wells C through F, a compound that was discovered to inhibit the HCV RdRp activity by use of the methods of the invention is included in decreasing concentrations. Wells H1 and H12 lack the HCV enzyme and illustrate the background (0%
RdRp activity) in the assay. In this example, the remaining 80 wells contain a collection of small organic compounds that were tested for their ability to affect the RdRp activity of the HCV NSSB protein. Thus, it can be seen that the material in wells G2, D10 and F10 represent potent inhibitors of the HCV RdRp activity.
This example demonstrates that HCV NSSB proteins may be used to advantage to identify and assess agents or materials that may affect the HCV RdRp and HCV
replication.
In summary, the disclosure of the present invention demonstrates that simple knowledge of an HCV NSSB
sequence is insufficient to allow one to conclude, or even reliably predict that such sequence is a functional sequence or has functional utility. Additionally, an HCV NSSB consensus sequence is not the only, and not necessarily the optimal, functional NS5B protein encoding sequence. The present invention provides novel NSSB sequences with unanticipated functionality.
Additionally, the present invention demonstrates that particular sequence changes in HCV NSSB can lead to unanticipated and significantly improved functionality.
In light of the foregoing, the NSSB sequences of the invention represent novel sequences with demonstrated functionality and utility and unique improvements over prior art. Finally, the HCV NSSB sequences of the invention have broad utility in research, diagnostic, therapeutic and pharmaceutical applications.
While certain embodiments of the present invention have been described and/or exemplified above, various other embodiments will be apparent to those skilled in the art from the foregoing disclosure. The present invention is, therefore, not limited to the particular embodiments described and/or exemplified, but is capable of considerable modification without departure from the scope of the appended claims.
SEQUENCE LISTING
<110> Viropharma, Incorporated <120> Hepatitis C Virus NS58 Compositions and Methods of Use Thereof <130> HEPPOL
<150> 60/080,509 <151> 1998-04-02 <150> 60/090,356 <151> 1998-06-23 <160> 53 <170> FastSEQ for Windows Version 3.0 <210> 1 <211> 1779 <212> DNA
<213> Hepatitis C Virus <400>
atgtcaatgtcctacacatggacaggcgctctgattacaccatgcgctgcggaggagagc 60 aagctgcccatcaatgcgctgagcaactctttgctgcgccaccataacatggtctatgcc 120 acaacatcccgcagcgcaagccagcggcagaagaaggtaacttttgacaggctgcaagtc 180 ctggatgaccactaccgggacgtgctcaaggagatgaaggcgaaggcgtccacagtcaag 240 gctaaacttctatccgtggaagaagcctgtaagctgacgcccccacattcagccagatcc 300 aaatttggctatggggcgaaggacgtccggaacctatccagcaaggccgttaaccacatc 360 cactccgtgtggaaggacttgctggaagacactgagacaccaattgacaccaccatcatg 420 gcaaaaaatgaggttttctgcgttcaaccagagaaaggaggccgcaagccagctcgccta 480 atcgtgtacccagacttgggggttcgcgtgtgcgagaaaatggccctctacaacgtggtc 540 tccacccttcctcaggctgtgatgggctcctcatacggattccagtactctcctggacag 600 cgggtcgagttcctggtgaatgcctggaagtcaaagaaatgccctatgggcttcgcatat 660 gacacccgctgtttcgactcaacggtcaccgagaatgacatccgtgttgaggagtcaatt 720 taccaatgttgtgacttggcccccgaagccagacaggccataaggtcgcttacagagcgg 780 ctttatatcgggggtcccctgactaactcaaaagggcagagctgcggttatcgccggtgc 840 cgtgcgagcggcgtactgacgactagctgcggtaataccctcacatgttacttgaaggcc 900 tctgcagcctgtcgagctgcaaagctccaggactgcacgatgcttgtgtgcggagacgac 960 ctcgtcgttatctgtgaaagcgcgggaacccaagaggacgcggcgagcctacgagtcttc 1020 acggaggctatgactaggtactctgccccccctggggacccgccccaaccagaatacgac 1080 ttggagctaataacatcatgctcctccaacgtgtcggtcgcgcacgatgcatctggcaaa 1140 agggtatactacctcacccgtgaccccaccacccctcttgcgcgggctgcgtgggagaca 1200 gctagacacactccagttaactcctggctaggcaacatcatcatgtatgcgcccactctg 1260 tgggcaaggatgattctgatgactcacttcttctccatccttctagctcaggagcaactt 1320 gaaaaagccctagattgtgagatctacggggcccactactccattgagccacttgaccta 1380 cctcagatcattcaacgactccatggtcttagcgcgttttcactccacagttactctcca 1440 ggtgaaatcaatagggtggcttcatgcctcaggaagcttggggtaccacccttgcgagtc 1500 tggagacatcgggccagaagcgtccgcgctaagttactgtcccagggggggagggctgcc 1560 acttgtggcaagtacctcttcaactgggcagtaaggaccaagcttaaactcactccaatt 1620 ccggctgcgtcccagttggacttatccggctggttcgttgctggttacagcgggggagac 1680 atatatcacagcctgtctcgtgcccgaccccgctggttcatgtggtgcctactcctactt 1740 tctgtaggggtaggcatctacctgctcccgaaccgatga 177g <210> 2 <211> 592 <212> PRT
<213> Hepatitis C Virus <400> 2 Met Ser Met Ser Tyr Thr Trp Thr Gly Ala Leu Ile Thr Pro Cys Ala Ala Glu Glu Ser Lys Leu Pro Ile Asn Ala Leu Ser Asn Ser Leu Leu Arg His His Asn Met Val Tyr Ala Thr Thr Ser Arg Ser Ala Ser Gln Arg Gln Lys Lys Val Thr Phe Asp Arg Leu Gln Val Leu Asp Asp His Tyr Arg Asp Val Leu Lys Glu Met Lys Ala Lys Ala Ser Thr Val Lys Ala Lys Leu Leu Ser Val Glu Glu Ala Cys Lys Leu Thr Pro Pro His Ser Ala Arg Ser Lys Phe Gly Tyr Gly Ala Lys Asp Val Arg Asn Leu Ser Ser Lys Ala Val Asn His Ile His Ser Val Trp Lys Asp Leu Leu Glu Asp Thr Glu Thr Pro Ile Asp Thr Thr Ile Met Ala Lys Asn Glu Val Phe Cys Val Gln Pro Glu Lys Gly Gly Arg Lys Pro Ala Arg Leu Ile Val Tyr Pro Asp Leu Gly Val Arg Val Cys Glu Lys Met Ala Leu Tyr Asn Val Val Ser Thr Leu Pro Gln Ala Val Met Gly Ser Ser Tyr Gly Phe Gln Tyr Ser Pro Gly Gln Arg Val Glu Phe Leu Val Asn Ala Trp Lys Ser Lys Lys Cys Pro Met Gly Phe Ala Tyr Asp Thr Arg Cys Phe Asp Ser Thr Val Thr Glu Asn Asp Ile Arg Val Glu Glu Ser Ile Tyr Gln Cys Cys Asp Leu Ala Pro Glu Ala Arg Gln Ala Ile Arg Ser Leu Thr Glu Arg Leu Tyr Ile Gly Gly Pro Leu Thr Asn Ser Lys Gly Gln Ser Cys Gly Tyr Arg Arg Cys Arg Ala Ser Gly Val Leu Thr Thr Ser Cys Gly Asn Thr Leu Thr Cys Tyr Leu Lys Ala Ser Ala Ala Cys Arg Ala Ala Lys Leu Gln Asp Cys Thr Met Leu Val Cys Gly Asp Asp Leu Val Val Ile Cys Glu Ser Ala Gly Thr Gln Glu Asp Ala Ala Ser Leu Arg Val Phe Thr Glu Ala Met Thr Arg Tyr Ser Ala Pro Pro Gly Asp Pro Pro Gln Pro Glu Tyr Asp Leu Glu Leu Ile Thr Ser Cys Ser Ser Asn Val Ser Val Ala His Asp Ala Ser Gly Lys Arg Val Tyr Tyr Leu Thr Arg Asp Pro Thr Thr Pro Leu Ala Arg Ala Ala Trp Glu Thr Ala Arg His Thr Pro Val Asn Ser Trp Leu Gly Asn Ile Ile Met Tyr Ala Pro Thr Leu Trp Ala Arg Met Ile Leu Met Thr His Phe Phe Ser Ile Leu Leu Ala Gln Glu Gln Leu Glu Lys Ala Leu Asp Cys Glu Ile Tyr Gly Ala His Tyr Ser Ile Glu Pro Leu Asp Leu Pro Gln Ile Ile WO 99/51781 PCTlUS99/07404 Gln Arg Leu His Gly Leu Ser Ala Phe Ser Leu His Ser Tyr Ser Pro Gly Glu Ile Asn Arg Val Ala Ser Cys Leu Arg Lys Leu Gly Val Pro Pro Leu Arg Val Trp Arg His Arg Ala Arg Ser Val Arg Ala Lys Leu Leu Ser Gln Gly Gly Arg Ala Ala Thr Cys Gly Lys Tyr Leu Phe Asn Trp Ala Val Arg Thr Lys Leu Lys Leu Thr Pro Ile Pro Ala Ala Ser Gln Leu Asp Leu Ser Gly Trp Phe Val Ala Gly Tyr Ser Gly Gly Asp Ile Tyr His Ser Leu Ser Arg Ala Arg Pro Arg Trp Phe Met Trp Cys Leu Leu Leu Leu Ser Val Giy Val Gly Ile Tyr Leu Leu Pro Asn Arg 580 585 59p <210> 3 <211> 1779 <212> DNA
<213> Hepatitis C Virus <400>
atgtcaatgtcctacacatggacaggcgctctgattacaccatgcgctgcggaggagagc 60 aagctgcccatcaatgcgctgagcaactctttgctgcgccaccataacatggtctatgcc 120 acaacatcccgcagcgcaagccagcggcagaagaaggtaacttttgacaggctgcaagtc 180 ctggatgaccactaccgggacgtgctcaaggagatgaaggcgaaggtgtccacagtcaag 240 gctaaacttctatccgtggaagaagcctgtaagctgacgcccccacattcagccagatcc 300 aaatttggctatggggcgaaggacgtccggaacctatccagcaaggccgttaaccacatc 360 cactccgtgtggaaggacttgctggaagacactgagacaccaattgacaccaccatcatg 420 gcaaaaaatgaggttttctgcgttcaaccagagaaaggaggccgcaagccagctcgccta 480 atcgtgtacccagacttgggggttcgcgtgtgcgagaaaatggccctctacgacgtggtc 540 tccacccttcctcaggctgtgatgggctcctcatacggattccagtactctcctggacag 600 cgggtcgagttcctggtgaatgcctggaagtcaaagaaatgccctatgggcttcgcatat 660 gacacccgctgtttcgactcaacggtcaccgagaatgacatccgtgttgaggagtcaatt 720 taccaatgttgtgacttggcccccgaagccagacaggccataaggtcgcttacagagcgg 780 ctttatatcgggggtcccctgactaactcaaaagggcagagctgcggttatcgccggtgc 840 cgtgcgagcggcgtactgacgactagctgcggtaataccctcacatgttacttgaaggcc 900 tctgcagcctgtcgagctgcaaagctccaggactgcacgatgcttgtgtgcggagacgac 960 ctcgtcgttatctgtgaaagcgcgggaacccaagaggacgcggcgagcctacgagtcttc 1020 acggaggctatgactaggtactctgccccccctggggacccgccccaaccagaatacgac 1080 ttggagctaataacatcatgctcctccaacgtgtcggtcgcgcacgatgcatctggcaaa 1140 agggtatactacctcacccgtgaccccaccacccctcttgcgcgggctgcgtgggagaca 1200 gctagacacactccagttaactcctggctaggcaacatcatcatgtatgcgcccactctg 1260 tgggcaaggatgattctgatgactcacttcttctccatccttctagctcaggagcaactt 1320 gaaaaagccctagattgtgagatctacggggcccactactccattgagccacttgaccta 1380 cctcagatcattcaacgactccatggtcttagcgcgttttcactccacagttactctcca 1440 ggtgaaatcaatagggtggcttcatgcctcaggaagcttggggtaccacccttgcgagtc 1500 tggagacatcgggccagaagcgtccgcgctaagttactgtcccagggggggagggctgcc 1560 acttgtggcaagtacctcttcaactgggcagtaaggaccaagcttaaactcactccaatt 1620 ccggctgcgtcccagttggacttatccggctggttcgttgctggttacagcgggggagac 1680 atatatcacagcctgtctcgtgcccgaccccgctggttcatgtggtgcctactcctactt 1740 tctgtaggggtaggcatctacctgctccccaaccgatga 1778 <210> 4 <211> 1779 <212> DNA
<213> Hepatitis C Virus <400> 4 atgtcaatgt cctacacatg gacaggcgct ctgattacac catgcgctgc ggaggagagc 60 aagctgcccatcaatgcgctgagcaactctttgctgcgccaccataacatggtctatgcc120 acaacatcccgcagcgcaagccagcggcagaagaaggtaacttttgacaggctgcaagtc180 ctggatgaccactaccgggacgtgctcaaggagatgaaggcgaaggcgtccacagtcaag240 gctaaacttctatccgtggaagaagcctgtaagctgacgcccccacattcagccagatcc300 aaatttggctatggggcgaaggacgtccggaacctatccagcaaggccgttaaccacatc360 cactccgtgtggaaggacttgctggaagacactgagacaccaattgacaccaccatcatg420 gcaaaaaatgaggttttctgcgttcaaccagagaaaggaggccgcaagccagctcgccta480 atcgtgtacccagacttgggggttcgcgtgtgcgagaaaatggccctctacgacgtgatc540 tccacccttcctcaggctgtgatgggctcctcatacggattccagtactctcctggacag600 cgggtcgagttcctggtgaatgcctggaagtcaaagaaatgccctatgggcttcgcatat660 gacacccgctgtttcgactcgacggtcaccgagaatgacatccgtgttgaggagtcaatt720 taccaatgttgtgacttggcccccgaagccagacaggccataaggtcgcttacagagcgg780 ctttatatcgggggtcccctgactaactcaaaagggcagagctgcggtcatcgccggtgc840 cgtgcgagcggcgtactgacgactagctgcggtaataccctcacatgttacttgaaggcc900 tctgcagcctgtcgagctgcaaagctccaggactgcacgatgcttgtgtgcggagacgac960 ctcatcgttatctgtgaaagcgcgggaacccaagaggacgcggcgagcctacgagtcttc1020 acggaggctatgactaggtactctgccccccctggggacccgccccaaccagaatacgac1080 ttggagctaataacatcatgctcctccaacgtgtcggtcgcgcacgatgcatctggcaaa1140 agggtatactacctcacccgtgaccccaccacccctcttgcgcgggctgcgtgggagaca1200 gctagacacactccagttaactcctggctaggcaacatcatcatgtatgcgcccactctg1260 tgggcaaggatgattctgatgactcacttcttctccatccttctagctcaggagcaactt1320 gaaaaagccctagattgtgagatctacggggcccactactccattgagccacttgaccta1380 cctcagatcattcaacgactccatggtcttagcgcgttttcactccacagttactctcca1440 ggtgaaatcaatagggtggcttcatgcctcaggaagcttggggtaccacccttgcgagtc1500 tggagacatcgggccagaagcgtccgcgctaagttactgtcccagggggggagggctgcc1560 acttgtggcaagtacctcttcaactgggcagtaaggaccaagcttaaactcactccaatt1620 ccggctgcgtcccagttggacttatccggctggttcgttgctggttacagcgggggagac1680 atataccacagcctgtctcgtgcccgaccctgctggttcatgtggtgcctactcctactt1740 tctgtaggggtaggcatctacctgctccccaaccgatga 1779 <210> 5 <211> 1779 <212> DNA
<213> Hepatitis C Virus <400>
atgtcaatgtcctacacatggacaggcgctctgattacaccatgcgctgcggaggagagc60 aagctgcccatcaatgcgctgagcaactctttgctgcgccaccataacatggtctatgcc120 acaacatcccgcagcgcaagccagcggcagaagaaggtaacttttgacaggctgcaagtc180 ctggatgaccactaccgggacgtgctcaaggagatgaaggcgaaggcgtccacagtcaag240 gctaaacttctatccgtggaagaagcctgtaagctgacgcccccacattcagccagatcc300 aaatttggctatggggcgaaggacgtccggaacctatccagcaaggccgttaaccacatc360 cactccgtgtggaaggacttgctggaagacactgagacaccaattgacaccaccatcatg420 gcaaaaaatgaggttttctgcgttcaaccagagaaaggaggccgcaagccagctcgccta480 atcgtgtacccagacttgggggttcgcgtgtgcgagaaaatggccctctacgacgtggtc540 tccacccttcctcaggctgtgatgggctcctcatacggattccagtactcccctggacag600 cgggtcgagttcctggtgaatgcctggaagccaaagaaatgccctatgggcttcgcatat660 gacacccgctgtttcgactcaacggtcaccgagaatgacatccgtgttgaggagtcaatt720 taccaatgttgtgacttggcccccgaagccagacaggccataaggtcgcttacagagcgg780 ctttatatcgggggtcccctgactaactcaaaagggcagagctgcggttatcgccggtgc840 cgtgcgagcggcgtactgacgactagctgcggtaataccctcacatgttacttgaaggcc900 tctgcagcctgtcgagctgcaaagctccaggactgcacgatgcttgtgtgcggagacgac960 ctcgtcgttatctgtgaaagcgcgggaacccaagaggacgcggcgagcctacgagtcttc1020 acggaggctatgactaggtactctgccccccctggggacccgccccaaccagaatacgac1080 ttggagctaataacatcatgctcctccaacgtgtcggtcgcgcacgatgcatctggcaaa1140 agggtatactacctcacccgtgaccccaccacccctcttgcgcgggctgcgtgggagaca1200 gctagacacactccagttaactcctggctaggcaacaccatcatgtatgcgcccactctg1260 tgggcaaggatgattctgatgactcacttcttctccatccttctagctcaggagcaactt1320 gaaaaagccctagattgtgagatctacggggcccactactccattgagccacttgaccta1380 cctcagatcattcaacgactccatggtcttagcgcgttttcactccacagttactctcca1440 ggtgaaatcaatagggtggcttcatgcctcaggaagcttggggtaccacccttgcgagtc1500 tggagacatcgggccagaagcgtccgcgctaagttactgtcccagggggggagggctgcc 1560 acttgtggcaagtacctcttcaactgggcagtaaggaccaagcttaaactcactccaatt 1620 ccggctgcgtcccagttggacttatccggctggttcgttgctggttacagcgggggagac 1680 atatatcacagcctgtctcgtgcccgaccccgctggttcatgtggtgcctactcctactt 1740 tctgtaggggtaggcatctacctgctccccaaccgatga 1779 <210> 6 <211> 1779 <212> DNA
<2I3> Hepatitis C Virus <400> 6 atgtcaatgtcctacacatggagaggcgctctgattacaccatgcgctgcggaggagagc 60 aagctgcccatcaatgcgctgagcaactctttgctgcgccaccataacatggtctatgcc 120 acaacatcccgcagcgcaagccagcggcagaagaaggtaacttttgacaggctgcaagtc 180 ctggatgaccactaccgggacgtgctcaaggagatgaaggcgaaggcgtccacagtcaag 240 gccaaacttctatccgtggaagaagcctgtaagctgacgcccccacattcagccagatcc 300 aaatttggctatggggcgaaggacgtccggaacctatccagcaaggccgttaaccacatc 360 cactccgtgtggaaggacttgctggaagacactgagacaccaattgacaccaccatcatg 420 gcaaaaaatgaggtcttctgcgttcaaccagagaaaggaggccgcaagccagctcgccta 480 atcgtgtacccagacttgggggttcgcgtgtgcgagaaaatggccctctacgacgtggtc 540 tccacccttcctcaggctgtgatgggctcctcatacggattccagcactctcctggacag 600 cgggtcgagttcctggtgaatgcctggaagtcaaagaaatgccctatgggcttcgcatat 660 gacacccgctgtttcgactcaacggtcaccgagaatgacatccgtgttgaggagtcaatt 720 taccaatgttgtgacttggcccccgaagccagacaggccataaggtcgcttacagagcgg 780 ctttatatcgggggtcccctgactaactcaaaagggcagagctgcggttatcgccggtgc 840 cgtgcgagcggcgtactgacgactagctgcggtaataccctcacatgttacttgaaggcc 900 tctgcagcctgtcgagctgcaaagctccaggactgcacgatgcttgtgtgcggagacgac 960 ttcgtcgttatctgtgaaagcgcgggaacccaagaggacgcggcgagcctacgagtcttc 1020 acggaggctatgactaggtactctgccccccctggggacccgccccaaccagaatacgac 1080 ttggagctaataacatcatgctcctccaacgtgtcggtcgcgcacgatgcatctggcaaa 1140 agggtatactacctcacccgtgaccccaccacccctcttgcgcgggctgcgtgggagaca 1200 gctagacacactccagttaactcctggctaggcaacatcatcatgtatgcgcccactctg 1260 tgggcaaggatgattctgatgactcacttcttctccatccttctagctcaggagcaactt 1320 gaaaaagccctagattgtgagatctacggggcccactactccattgagccacttgaccta 1380 cctcagatcattcaacgactccatggtcttagcgcgttttcactccacagttactctcca 1440 ggtgaaatcaatagggtggcttcatgcctcaggaagcttggggtaccacccttgcgagtc 1500 tggagacatcgggccagaagcgtccgcgctaagttactgtcccagggggggagggctgcc 1560 acttgtggcaagtacctcttcaactgggcagtaaggaccaagcttaaactcactccaatt 1620 ccggctgcgtcccagttggacttatccggctggttcgttgctggttacagcgggggagac 1680 atatatcacagcctgtctcgtgcccgaccccgctggttcatgtggtgcctactcctactt 1740 tctgtaggggtaggcatctacctgctccccaaccgatga 1779 <210> 7 <211> 1779 <212> DNA
<213> Hepatitis C Virus <400> 7 gtgtcaatgtcctacacatggacaggcgctctgattacaccatgcgctgcggaggagagc 60 aagctgcccatcaatgcgctgagcaactctttgctgcgccaccataacatggtctatgcc 120 acaacatcccgcagcgcaagccagcggcagaagaaggtaacttttgacaggctgcaagtc 180 ctggatgaccactaccgggacgtgctcaaggagatgaaggcgaaggcgtccacagtcaag 240 gctaaacttctatccgtggaagaagcctgtaagctgacgcccccacattcagccagatcc 300 aaatttggctatggggcgaaggacgtccggaacctatccagcaaggccgttaaccacatc 360 cactccgtgtggaaggacttgctggaagacactgagacaccaattgacaccaccatcatg 420 gcaaaaaatgaggttttctgcgttcaaccagagaaaggaggccgcaagccagctcgccta 480 atcgtgtacccagacttgggggttcgcgtgtgcgagaaaatggccctctacgacgtggtc 540 tccacccttcctcaggctgtgatgggctcctcatacggattccagtactctcctggacag 600 cgggtcgagttcctggtgaatgcctggaagtcaaagaaatgccctatgggcttcgcatat 660 gacactcgctgtttcgactcaacggtcaccgagaat~acatccgtgttgaggagtcaatt 720 taccaatgttgtgacttggcccccgaagccagacaggccataaggtcgcttacagagcgg 780 ctttatatcgggggtcccctgactaactcaaaagggcagagctgcggttatcgccggtgc 840 cgtgcgagcggcgtactgacgactagctgcggtaataccctcacatgttacttgaaggcc 900 tctgcagcctgtcgagctgcaaagctccaggactgcacgatgcttgtgtgcggagacgac 960 ctcgtcgttatctgtgaaagcgcgggaacccaagaggacgcggcgagcctacgagtcttc 1020 acggaggctatgactaggtactctgccccccctggggacccgccccaaccagaatacgac 1080 ttggagctaataacatcatgctcctccaacgtgtcggtcgcgcacgatgcatctggcaaa 1140 agggtatactacctcacccgtgaccccaccacccctcttgcgcgggctgcgtgggagaca 1200 gctagacacactccagttaactcctggctaggcaacatcatcatgtatgcgcccactctg 1260 tgggcaaggatgattctgatgactcacttcttctccatccttctagctcaggagcaactt 1320 gaaaaagccctagattgtgagatctacggggcccactactccattgagccacttgaccta 1380 cctcagatcattcaacgactccatggtcttagcgcgttttcactccacagttactctcca 1440 ggtgaaatcaatagggtggcttcatgcctcaggaagcttggggtaccacccttgcgagtc 1500 tggagacatcgggccagaagcgtccgcgctaagttactgtcccagggggggagggctgcc 1560 acttgtggcaagtacctcttcaactgggcagtaaggaccaagcttaaactcactccaatt 1620 ccggctgcgccccagttggacttatccggctggttcgttgctggttacagcgggggagac 1680 atatatcacagcctgtctcgtgcccgaccccgctggttcatgtggtgcctactcctactt 1740 tctgtaggggtaggcatctacctgctccccaaccgatga 1778 <210> 8 <211> 592 <212> PRT
<213> Hepatitis C Virus <400> 8 Met Ser Met Ser Tyr Thr Trp Thr Gly Ala Leu Ile Thr Pro Cys Ala Ala Glu Glu Ser Lys Leu Pro Ile Asn Ala Leu Ser Asn Ser Leu Leu Arg His His Asn Met Val Tyr Ala Thr Thr Ser Arg Ser Ala Ser Gln Arg Gln Lys Lys Val Thr Phe Asp Arg Leu Gln Val Leu Asp Asp His Tyr Arg Asp Val Leu Lys Glu Met Lys Ala Lys Val Ser Thr Val Lys Ala Lys Leu Leu Ser Val Glu Glu Ala Cys Lys Leu Thr Pro Pro His Ser Ala Arg Ser Lys Phe Gly Tyr Gly A1a Lys Asp Val Arg Asn Leu Ser Ser Lys Ala Val Asn His Ile His Ser Val Trp Lys Asp Leu Leu Glu Asp Thr Glu Thr Pro Ile Asp Thr Thr Ile Met Ala Lys Asn Glu Val Phe Cys Val Gln Pro Glu Lys Gly Gly Arg Lys Pro Ala Arg Leu Ile Val Tyr Pro Asp Leu Gly Val Arg Val Cys Glu Lys Met Ala Leu Tyr Asp Val Val Ser Thr Leu Pro Gln Ala Val Met Gly Ser Ser Tyr Gly Phe Gln Tyr Ser Pro Gly Gln Arg Val Glu Phe Leu Val Asn Ala Trp Lys Ser Lys Lys Cys Pro Met Gly Phe Ala Tyr Asp Thr Arg Cys Phe Asp Ser Thr Val Thr Glu Asn Asp Ile Arg Val Glu Glu Ser Ile Tyr Gln Cys Cys Asp Leu Ala Pro Glu Ala Arg Gln Ala Ile Arg Ser Leu Thr Glu Arg Leu Tyr Ile Gly Gly Pro Leu Thr Asn Ser Lys Gly Gln Ser Cys Gly Tyr Arg Arg Cys Arg Ala Ser Gly Val Leu Thr Thr Ser Cys Gly Asn Thr Leu Thr Cys Tyr Leu Lys Ala Ser Ala Ala Cys Arg Ala Ala Lys Leu Gln Asp Cys Thr Met Leu Val Cys Gly Asp Asp Leu Val Val Ile Cys Glu Ser Ala Gly Thr Gln Glu Asp Ala Ala Ser Leu Arg Val Phe Thr Glu Ala Met Thr Arg Tyr Ser Ala Pro Pro Gly Asp Pro Pro Gln Pro Glu Tyr Asp Leu Glu Leu Ile Thr Ser Cys Ser Ser Asn Val Ser Val Ala His Asp Ala Ser Gly Lys Arg Val Tyr Tyr Leu Thr Arg Asp Pro Thr Thr Pro Leu Ala Arg Ala Ala Trp Glu Thr Ala Arg His Thr Pro Val Asn Ser Trp Leu Gly Asn Ile Ile Met Tyr Ala Pro Thr Leu Trp Ala Arg Met Ile Leu Met Thr His Phe Phe Ser Ile Leu Leu Ala Gln Glu Gln Leu Glu Lys Ala Leu Asp Cys Glu Ile Tyr Gly Ala His Tyr Ser Ile Glu Pro Leu Asp Leu Pro Gln Ile Ile Gln Arg Leu His Gly Leu Ser Ala Phe Ser Leu His Ser Tyr Ser Pro Gly Glu Ile Asn Arg Val Ala Ser Cys Leu Arg Lys Leu Gly Val Pro Pro Leu Arg Val Trp Arg His Arg Ala Arg Ser Val Arg Ala Lys Leu Leu Ser Gln Gly Gly Arg Ala Ala Thr Cys Gly Lys Tyr Leu Phe Asn Trp Ala Val Arg Thr Lys Leu Lys Leu Thr Pro Ile Pro Ala Ala Ser Gln Leu Asp Leu Ser Gly Trp Phe Val Ala Gly Tyr Ser Gly Gly Asp Ile Tyr His Ser Leu Ser Arg Ala Arg Pro Arg Trp Phe Met Trp Cys Leu Leu Leu Leu Ser Val Gly Val Gly Ile Tyr Leu Leu Pro Asn Arg <210> 9 <211> 592 <212> PRT
<213> Hepatitis C Virus <400> 9 Met Ser Met Ser Tyr Thr Trp Thr Gly Ala Leu Ile Thr Pro Cys Ala Ala Glu Glu Ser Lys Leu Pro Ile Asn Ala Leu Ser Asn Ser Leu Leu Arg His His Asn Met Val Tyr Ala Thr Thr Ser Arg Ser Ala Ser Gln Arg Gln Lys Lys Val Thr Phe Asp Arg Leu Gln Val Leu Asp Asp His Tyr Arg Asp Val Leu Lys Glu Met Lys Ala Lys Val Ser Thr Val Lys Ala Lys Leu Leu Ser Val Glu Glu Ala Cys Lys Leu Thr Pro Pro His Ser Ala Arg Ser Lys Phe Gly Tyr Gly Ala Lys Asp Val Arg Asn Leu Ser Ser Lys Ala Val Asn His Ile His Ser Val Trp Lys Asp Leu Leu Glu Asp Thr Glu Thr Pro Ile Asp Thr Thr Ile Met Ala Lys Asn Glu Val Phe Cys Val Gln Pro Glu Lys Gly Gly Arg Lys Pro Ala Arg Leu Ile Val Tyr Pro Asp Leu Gly Val Arg Val Cys Glu Lys Met Ala Leu Tyr Asp Val Ile Ser Thr Leu Pro Gln Ala Val Met Gly Ser Ser Tyr Gly Phe Gln Tyr Ser Pro Gly Gln Arg Val Glu Phe Leu Val Asn Ala Trp Lys Ser Lys Lys Cys Pro Met Gly Phe Ala Tyr Asp Thr Arg Cys Phe Asp Ser Thr Val Thr Glu Asn Asp Ile Arg Val Glu Glu Ser Ile Tyr Gln Cys Cys Asp Leu Ala Pro Glu Ala Arg Gln Ala Ile Arg Ser Leu Thr Glu Arg Leu Tyr Ile Gly Gly Pro Leu Thr Asn Ser Lys Gly Gln Ser Cys Gly His Arg Arg Cys Arg Ala Ser Gly Val Leu Thr Thr Ser Cys Gly Asn Thr Leu Thr Cys Tyr Leu Lys Ala Ser Ala Ala Cys Arg Ala Ala Lys Leu Gln Asp Cys Thr Met Leu Val Cys Gly Asp Asp Leu Ile Val Ile Cys Glu Ser Ala Gly Thr Gln Glu Asp Ala Ala Ser Leu Arg Val Phe Thr Glu Ala Met Thr Arg Tyr Ser Ala Pro Pro Gly Asp Pro Pro Gln Pro Glu Tyr Asp Leu Glu Leu Ile Thr Ser Cys Ser Ser Asn Val Ser Val Ala His Asp Ala Ser Gly Lys Arg Val Tyr Tyr Leu Thr Arg Asp Pro Thr Thr Pro Leu Ala Arg Ala Aia Trp Glu Thr Ala Arg His Thr Pro Val Asn Ser Trp Leu Gly Asn Ile Ile Met Tyr Ala Pro Thr Leu Trp Ala Arg Met Ile Leu Met Thr His Phe Phe Ser Ile Leu Leu Ala Gln Glu Gln Leu Glu Lys Ala Leu Asp Cys Glu Ile Tyr Gly Ala His Tyr Ser Ile Glu Pro Leu Asp Leu Pro Gln Ile Ile Gln Arg Leu His Gly Leu Ser Ala Phe Ser Leu His Ser Tyr Ser Pro Gly Glu Ile Asn Arg Val Ala Ser Cys Leu Arg Lys Leu Gly Val Pro Pro Leu Arg Val Trp Arg His Arg Ala Arg Ser Val Arg Ala Lys Leu Leu Ser Gln Gly Gly Arg Ala Ala Thr Cys Gly Lys Tyr Leu Phe Asn Trp Ala Val Arg Thr Lys Leu Lys Leu Thr Pro Ile Pro Ala Ala Ser Gln Leu Asp Leu Ser Gly Trp Phe Val Ala Gly Tyr Ser Gly Gly Asp Ile Tyr His Ser Leu Ser Arg Ala Arg Pro Cys Trp Phe Met Trp Cys Leu Leu Leu Leu Ser Val Gly Val Gly Ile Tyr Leu Leu Pro Asn Arg <210> 10 <211> 592 <212> PRT
<213> Hepatitis C Virus <400> 10 Met Ser Met Ser Tyr Thr Trp Thr Gly Ala Leu Ile Thr Pro Cys Ala Ala Glu Glu Ser Lys Leu Pro Ile Asn Ala Leu Ser Asn Ser Leu Leu Arg His His Asn Met Val Tyr Ala Thr Thr Ser Arg Ser Ala Ser Gln Arg Gln Lys Lys Val Thr Phe Asp Arg Leu Gln Val Leu Asp Asp His Tyr Arg Asp Val Leu Lys Glu Met Lys Ala Lys Val Ser Thr Val Lys Ala Lys Leu Leu Ser Val Glu Glu Ala Cys Lys Leu Thr Pro Pro His Ser Ala Arg Ser Lys Phe Gly Tyr Gly Ala Lys Asp Val Arg Asn Leu Ser Ser Lys Ala Val Asn His Ile His Ser Val Trp Lys Asp Leu Leu Glu Asp Thr Glu Thr Pro Ile Asp Thr Thr Ile Met Ala Lys Asn Glu Val Phe Cys Val Gln Pro Glu Lys Gly Gly Arg Lys Pro Ala Arg Leu Ile Val Tyr Pro Asp Leu Gly Val Arg Val Cys Glu Lys Met Ala Leu Tyr Asp Val Val Ser Thr Leu Pro Gln Ala Val Met Gly Ser Ser Tyr 180 185 19b Gly Phe Gln Tyr Ser Pro Gly Gln Arg Val Glu Phe Leu Val Asn Ala Trp Lys Pro Lys Lys Cys Pro Met Gly Phe Ala Tyr Asp Thr Arg Cys Phe Asp Ser Thr Val Thr Glu Asn Asp Ile Arg Val Glu Glu Ser Ile Tyr Gln Cys Cys Asp Leu Ala Pro Glu Ala Arg Gln Ala Ile Arg Ser Leu Thr Glu Arg Leu Tyr Ile Gly Gly Pro Leu Thr Asn Ser Lys Gly Gln Ser Cys Gly Tyr Arg Arg Cys Arg Ala Ser Gly Val Leu Thr Thr Ser Cys Giy Asn Thr Leu Thr Cys Tyr Leu Lys Ala Ser Ala Ala Cys Arg Ala Ala Lys Leu Gln Asp Cys Thr Met Leu Val Cys Gly Asp Asp Leu Val Val Ile Cys Glu Ser Ala Gly Thr Gln Glu Asp Ala Ala Ser Leu Arg Val Phe Thr Glu Ala Met Thr Arg Tyr Ser Ala Pro Pro Gly Asp Pro Pro Gln Pro Glu Tyr Asp Leu Glu Leu Ile Thr Ser Cys Ser Ser Asn Val Ser Val Ala His Asp Ala Ser Gly Lys Arg Val Tyr Tyr Leu Thr Arg Asp Pro Thr Thr Pro Leu Ala Arg Ala Ala Trp Glu Thr Ala Arg His Thr Pro Val Asn Ser Trp Leu Gly Asn Thr Ile Met Tyr Ala Pro Thr Leu Trp Ala Arg Met Ile Leu Met Thr His Phe Phe Ser Ile Leu Leu Ala Gln Glu Gln Leu Glu Lys Ala Leu Asp Cys Glu Ile Tyr Gly Ala His Tyr Sex Ile Glu Pro Leu Asp Leu Pro Gln Ile Ile WO 99/51781 PCTlUS99/07404 Gin Arg Leu His Gly Leu Ser Ala Phe Ser Leu His Ser Tyr Ser Pro Gly Glu Ile Asn Arg Val Ala Ser Cys Leu Arg Lys Leu Gly Val Pro Pro Leu Arg Val Trp Arg His Arg Ala Arg Ser Val Arg Ala Lys Leu Leu Ser Gln Gly Gly Arg Ala Ala Thr Cys Gly Lys Tyr Leu Phe Asn Trp Ala Val Arg Thr Lys Leu Lys Leu Thr Pro Ile Pro Ala Ala Ser Gln Leu Asp Leu Ser Gly Trp Phe Val Ala Gly Tyr Ser Gly Gly Asp Ile Tyr His Ser Leu Ser Arg Ala Arg Pro Arg Trp Phe Met Trp Cys Leu Leu Leu Leu Ser Val Gly Val Gly Ile Tyr Leu Leu Pro Asn Arg <210> 11 <211> 592 <212> PRT
<213> Hepatitis C Virus <400> 11 Met Ser Met Ser Tyr Thr Arg Thr Gly Ala Leu Ile Thr Pro Cys Ala Ala Glu Glu Ser Lys Leu Pro Ile Asn Ala Leu Ser Asn Ser Leu Leu Arg His His Asn Met Val Tyr Ala Thr Thr Ser Arg Ser Ala Ser Gln Arg Gln Lys Lys Val Thr Phe Asp Arg Leu Gln Val Leu Asp Asp His Tyr Arg Asp Val Leu Lye Glu Met Lys Ala Lye Val Ser Thr Val Lys 65 70 75 g0 Ala Lys Leu Leu Ser Val Glu Glu Ala Cys Lys Leu Thr Pro Pro His Ser Ala Arg Ser Lys Phe Gly Tyr Gly Ala Lys Asp Val Arg Asn Leu Ser Ser Lys Ala Val Asn His Ile His Ser Val Trp Lys Asp Leu Leu Glu Asp Thr Glu Thr Pro Ile Asp Thr Thr Ile Met Ala Lys Asn Glu Val Phe Cys Val Gln Pro Glu Lys Gly Gly Arg Lys Pro Ala Arg Leu Ile Val Tyr Pro Asp Leu Gly Val Arg Val Cys Glu Lys Met Ala Leu Tyr Asp Val Val Ser Thr Leu Pro Gln Ala Val Met Gly Ser Ser Tyr Gly Phe Gln His Ser Pro Gly Gln Arg Val Glu Phe Leu Val Asn Ala Trp Lys Ser Lys Lys Cys Pro Met Gly Phe Ala Tyr Asp Thr Arg Cys Phe Asp Ser Thr Val Thr Glu Asn Asp Ile Arg Val Glu Glu Ser Ile Tyr Gln Cys Cys Asp Leu Ala Pro Glu Ala Arg Gln Ala Ile Arg Ser Leu Thr Glu Arg Leu Tyr Ile Gly Gly Pro Leu Thr Asn Ser Lys Gly Gln Ser Cys Gly Tyr Arg Arg Cys Arg Ala Ser Gly Val Leu Thr Thr Ser Cys Gly Asn Thr Leu Thr Cys Tyr Leu Lys Ala Ser Ala Ala Cys Arg Ala Ala Lys Leu Gln Asp Cys Thr Met Leu Val Cys Gly Asp Asp Phe Val Val Ile Cys Glu Ser Ala Gly Thr Gln Glu Asp Ala Ala Ser Leu Arg Val Phe Thr Glu Ala Met Thr Arg Tyr Ser Ala Pro Pro Gly Asp Pro Pro Gln Pro Glu Tyr Asp Leu Glu Leu Ile Thr Ser Cys Ser Ser Asn Val Ser Val Ala His Asp Ala Ser Gly Lys Arg Val Tyr Tyr Leu Thr Arg Asp Pro Thr Thr Pro Leu Ala Arg Ala Ala Trp Glu Thr Ala Arg His Thr Pro Val Asn Ser Trp Leu Gly Asn Ile Ile Met Tyr Ala Pro Thr Leu Trp Ala Arg Met Ile Leu Met Thr His Phe Phe Ser Ile Leu Leu Ala Gln Glu Gln Leu Glu Lys Ala Leu Asp Cys Glu Ile Tyr Gly Ala His Tyr Ser Ile Glu Pro Leu Asp Leu Pro Gln Ile Ile Gln Arg Leu His Gly Leu Ser Ala Phe Ser Leu His Ser Tyr Ser Pro Gly Glu Ile Asn Arg Val Ala Ser Cys Leu Arg Lys Leu Gly Val Pro Pro Leu Arg Val Trp Arg His Arg Ala Arg Ser Val Arg Ala Lys Leu Leu Ser Gln Gly Gly Arg Ala Ala Thr Cys Gly Lys Tyr Leu Phe Asn Trp Ala Val Arg Thr Lys Leu Lys Leu Thr Pro Ile Pro Ala Ala Ser Gln Leu Asp Leu Ser Gly Trp Phe Val Ala Gly Tyr Ser Gly Gly Asp Ile Tyr His Ser Leu Ser Arg Ala Arg Pro Arg Trp Phe Met Trp Cys Leu Leu Leu Leu Ser Val Gly Val Gly Ile Tyr Leu Leu Pro Asn Arg <210> 12 <211> 592 <212> PRT
<213> Hepatitis C Virus <400> 12 Val Ser Met Ser Tyr Thr Trp Thr Gly A1a Leu Ile Thr Pro Cys Ala Ala Glu Glu Ser Lys Leu Pro Ile Asn Ala Leu Ser Asn Ser Leu Leu Arg His His Asn Met Val Tyr Ala Thr Thr Ser Arg Ser Ala Ser Gln Arg Gln Lys Lys Val Thr Phe Asp Arg Leu Gln Val Leu Asp Asp His Tyr Arg Asp Val Leu Lys Glu Met Lys Ala Lys Val Ser Thr Val Lys Ala Lys Leu Leu Ser Val Glu Glu Ala Cys Lys Leu Thr Pro Pro His Ser Ala Arg Ser Lys Phe Gly Tyr Gly Ala Lys Asp Val Arg Asn Leu Ser Ser Lys Ala Val Asn His Ile His Ser Val Trp Lys Asp Leu Leu Glu Asp Thr Glu Thr Pro Ile Asp Thr Thr Ile Met Ala Lys Asn Glu Val Phe Cys Val Gln Pro Glu Lys Gly Gly Arg Lys Pro Ala Arg Leu Ile Val Tyr Pro Asp Leu Gly Val Arg Val Cys Glu Lys Met Ala Leu Tyr Asp Val Val Ser Thr Leu Pro Gln Ala Val Met Gly Ser Ser Tyr Gly Phe Gln Tyr Ser Pro Gly Gln Arg Val Glu Phe Leu Val Asn Ala Trp Lys Ser Lys Lys Cys Pro Met Gly Phe Ala Tyr Asp Thr Arg Cys Phe Asp Ser Thr Val Thr Glu Asn Asp Ile Arg Val Glu Glu Ser Ile Tyr Gln Cys Cys Asp Leu Ala Pro Glu Ala Arg Gln Ala Tle Arg Ser Leu Thr Glu Arg Leu Tyr Ile Gly Gly Pro Leu Thr Asn Ser Lys Gly Gln Ser Cys Gly Tyr Arg Arg Cys Arg Ala Ser Gly Val Leu Thr Thr Ser Cys Gly Asn Thr Leu Thr Cys Tyr Leu Lys Ala Ser Ala Ala Cys Arg Ala Ala Lys Leu Gln Asp Cys Thr Met Leu Val Cys Gly Asp Asp Leu Val Val Ile Cys Glu Ser Ala Gly Thr Gln Glu Asp Ala Ala Ser Leu Arg Val Phe Thr Glu Ala Met Thr Arg Tyr Ser Ala Pro Pro Gly Asp Pro Pro Gln Pro Glu Tyr Asp Leu Glu Leu Ile Thr Ser Cys Ser Ser Asn Val Ser Val Ala His Asp Ala Ser Gly Lys Arg Val Tyr Tyr Leu Thr Arg Asp Pro Thr Thr Pro Leu Ala Arg Ala Ala Trp Glu Thr Ala Arg His Thr Pro Val Asn Ser Trp Leu Gly Asn Ile Ile Met Tyr Ala Pro Thr Leu Trp Ala Arg Met Ile Leu Met Thr His Phe Phe Ser Ile Leu Leu Ala Gln G1u Gln Leu Glu Lys Ala Leu Asp Cys Glu Ile Tyr Gly Ala His Tyr Ser Ile Glu Pro Leu Asp Leu Pro Gln Ile Ile Gln Arg Leu His Gly Leu Ser Ala Phe Ser Leu His Ser Tyr Ser Pro Gly Glu Ile Asn Arg Val Ala Ser Cys Leu Arg Lys Leu Gly Val Pro Pro Leu Arg Val Trp Arg His Arg Ala Arg Ser Val Arg Ala Lys Leu Leu Ser Gln Gly Gly Arg Ala Ala Thr Cys Gly Lys Tyr Leu Phe Asn Trp Ala Val Arg Thr Lys Leu Lys Leu Thr Pro Ile Pro Ala Ala Pro Gln Leu Asp Leu Ser Gly Trp Phe Val Ala Gly Tyr Ser Gly Gly Asp Ile Tyr His Ser Leu Ser Arg Ala Arg Pro Arg Trp Phe Met Trp Cys Leu Leu Leu Leu Ser Val Gly Val Gly Ile Tyr Leu Leu Pro Asn Arg <210> 13 <211> 592 <212> PRT
<213> Hepatitis C Virus <400> 13 Met Ser Met Ser Tyr Thr Trp Thr Gly Ala Leu Ile Thr Pro Cys Ala Ala Glu Glu Ser Lys Leu Pro Ile Asn Ala Leu Ser Asn Ser Leu Leu Arg His His Asn Met Val Tyr Ala Thr Thr Ser Arg Ser Ala Ser Gln Arg Gln Lys Lys Val Thr Phe Asp Arg Leu Gln Val Leu Asp Asp His Tyr Arg Asp Val Leu Lys Glu Met Lys Ala Lys Val Ser Thr Val Lys 65 70 75 g0 Ala Lys Leu Leu Ser Val Glu Glu Ala Cys Lys Leu Thr Pro Pro His Ser Ala Arg Ser Lys Phe Gly Tyr Gly Ala Lys Asp Val Arg Asn Leu Ser Ser Lys Ala Val Asn His Ile His Ser Val Trp Lys Asp Leu Leu Glu Asp Thr Glu Thr Pro Ile Asp Thr Thr Ile Met Ala Lys Asn Glu Val Phe Cys Val Gln Pro Glu Lys Gly Gly Arg Lys Pro Ala Arg Leu Ile Val Tyr Pro Asp Leu Gly Val Arg Val Cys Glu Lys Met Ala Leu Tyr Asp Val Val Ser Thr Leu Pro Gln Ala Val Met Gly Ser Ser Tyr Gly Phe Gln Tyr Ser Pro Gly Gln Arg Val Glu Phe Leu Val Asn Ala Trp Lys Ser Lys Lys Cys Pro Met Gly Phe Ala Tyr Asp Thr Arg Cys Phe Asp Ser Thr Val Thr Glu Asn Asp Ile Arg Val Glu Glu Ser Ile Tyr Gln Cys Cys Asp Leu Ala Pro Glu Ala Arg Gln Ala Ile Arg Ser Leu Thr Glu Arg Leu Tyr Ile Gly Gly Pro Leu Thr Asn Ser Lys Gly Gln Ser Cys Gly Tyr Arg Arg Cys Arg Ala Ser Gly Val Leu Thr Thr Ser Cys Gly Asn Thr Leu Thr Cys Tyr Leu Lys Ala Ser Ala Ala Cys Arg Ala Ala Lys Leu Gln Asp Cys Thr Met Leu Val Cys Gly Asp Asp Leu Val Val Ile Cys Glu Ser Ala Gly Thr Gln Glu Asp Ala Ala Ser Leu Arg Val Phe Thr Glu Ala Met Thr Arg Tyr Ser Ala Pro Pro Gly Asp Pro Pro Gln Pro Giu Tyr Asp Leu Glu Leu Tle Thr Ser Cys Ser Ser Asn Val Ser Val Ala His Asp Ala Ser Gly Lys Arg Val Tyr Tyr Leu Thr Arg Asp Pro Thr Thr Pro Leu Ala Arg Ala Ala Trp Glu Thr Ala Arg His Thr Pro Val Asn Ser Trp Leu Gly Asn Ile Ile Met Tyr Ala Pro Thr Leu Trp Ala Arg Met Ile Leu Met Thr His Phe Phe Ser Ile Leu Leu Ala Gln Glu Gln Leu Glu Lys Ala Leu Asp Cys Glu Ile Tyr Gly Ala His Tyr Ser Ile Glu Pro Leu Asp Leu Pro Gln Ile Ile Gln Arg Leu His Gly Leu Ser Ala Phe Ser Leu His Ser Tyr Ser Pro Gly Glu Ile Asn Arg Val Ala Ser Cys Leu Arg Lys Leu Gly Val Pro Pro Leu Arg Val Trp Arg His Arg Ala Arg Ser Val Arg Ala Lys Leu Leu Ser Gln Gly Gly Arg Ala Ala Thr Cys Gly Lys Tyr Leu Phe Asn Trp Ala Val Arg Thr Lys Leu Lys Leu Thr Pro Ile Pro Ala Ala Pro Gln Leu Asp Leu Ser Gly Trp Phe Val Ala Gly Tyr Ser Gly Gly Asp Ile Tyr His Ser Leu Ser Arg Ala Arg Pro Arg Trp Phe Met Trp Cys Leu Leu Leu Leu Ser Val Gly Val Gly Ile Tyr Leu Leu Pro Asn Arg <210> 14 <211> 20 <212> DNA
<213> Hepatitis C Virus <400> 14 tcaatgtcct acacatggac 20 <210> 15 <211> 10 <212> DNA
<213> Hepatitis C Virus <400> 15 ctacacatgg 10 <210> 16 <211> 41 <212> DNA
<213> Hepatitis C Virus <400> 16 ctctgattac accatgcgct gcggaggaga gcaagctgcc c 41 <210> 17 <211> 28 <212> DNA
<213> Hepatitis C Virus <400> 17 aatgcgctga gcaactcttt gctgcgcc <210> 18 <211> 47 <212> DNA
<213> Hepatitis C Virus <400> 18 ccataacatg gtctatgcca caacatcccg cagcgcaagc cagcggc 47 <210> 19 <211> 22 <212> DNA
<213> Hepatitis C Virus <400> 19 gaagaaggta acttttgacagg 22 <210> 20 <211> 23 <212> DNA
<213> Hepatitis C Virus <400> 20 caagtcctgg atgaccactaccg 23 <210> 21 <211> 14 <212> DNA
<213> Hepatitis C Virus <400> 21 gacgtgctca agga 14 <210> 22 <211> 18 <212> DNA
<213> Hepatitis C Virus <400> 22 atgaaggcga aggcgtcc <210> 23 <211> 16 <212> DNA
<213> Hepatitis C Virus <400> 23 ggaagaagcc tgtaag 16 <210> 24 <211> 24 <212> DNA
<213> Hepatitis C Virus <400> 24 gaacctatcc agcaaggccgttaa 24 <210> 25 <211> 19 <212> DNA
<213> Hepatitis C Virus <400> 25 accagagaaa ggaggccgc 19 <210> 26 <211> 14 <212> DNA
<213> Hepatitis C Virus <400> 26 acccagactt gggg 14 <210> 27 <211> 20 <212> DNA
<213> Hepatitis C Virus <400> 27 tctccaccct tcctcaggct 20 <210> 28 <211> 19 <212> DNA
<213> Hepatitis C Virus <400> 28 cgagttcctg gtgaatgcc <210> 29 <211> 24 <212> DNA
<213> Hepatitis C Virus <400> 29 tgccctatgg gcttcgcatatgac 24 <210> 30 <211> 25 <212> DNA
<213> Hepatitis C Virus <400> 30 tttcgactca acggtcaccgagaat 25 <210> 31 <211> 15 <212> DNA
<213> Hepatitis C Virus <400> 31 gttgaggagt caatt <210> 32 <211> 20 <212> DNA
<213> Hepatitis C Virus <400> 32 ttggcccccg aagccagaca 20 <210> 33 <211> 17 <212> DNA
<213> Hepatitis C virus <400> 33 aaggtcgctt acagagc 17 <210> 34 <211> 17 <212> DNA
<213> Hepatitis C Virus <400> 34 atcgggggtc ccctgac WO 99/51781 ] ~ / 20 PCT/US99/07404 <210> 35 <211> 18 <212> DNA
<2I3> Hepatitis C Virus <400> 35 taactcaaaa gggcagag 18 <210> 36 <211> 19 <212> DNA
<213> Hepatitis C Virus <400> 36 atgttacttg aaggcctct 19 <210> 37 <211> 25 <212> DNA
<213> Hepatitis C Virus <400> 37 gatgcttgtg tgcggagacgacctc 25 <210> 38 <211> 31 <212> DNA
<213> Hepatitis C Virus <400> 38 ggtcgcgcac gatgcatctggcaaaagggt a 31 <210> 39 <211> 19 <212> DNA
<213> Hepatitis C Virus <400> 39 caccacccct cttgcgcgg 19 <210> 40 <211> 25 <212> DNA
<213> Hepatitis C Virus <400> 40 ctccatcctt ctagctcaggagcaa 25 <210> 41 <211> 20 <212> DNA
<213> Hepatitis C Virus <400> 41 agttactgtc ccaggggggg 20 <210> 42 <211> 17 <212> DNA
<213> Hepatitis C Virus W099/51781 1g / 20 PCT/US99/07404 <400> 42 tccggctgcg tcccagt 17 <210> 43 <211> 26 <212> DNA
<213> Hepatitis C Virus <400> 43 ccgaccccgc tggttcatgt ggtgcc 26 <210> 44 <211> 19 <212> DNA
<213> Hepatitis C Virus <400> 44 ctacctgctc ccgaaccga lg <210> 45 <211> 19 <212> DNA
<213> Hepatitis C Virus <400> 45 ctacctgctc cccaaccga 19 <210> 46 <211> 80 <212> PRT
<213> cHepatitis C Virus <400> 46 Ser Met Ser Tyr Thr Trp Thr Gly Ala Leu Ile Thr Pro Cys Ala Ala Glu Glu Ser Lys Leu Pro Ile Asn Ala Leu Ser Asn Ser Leu Leu Arg His His Asn Met Val Tyr Ala Thr Thr Ser Arg Ser Ala Ser Gln Arg Gln Lys Lys Val Thr Phe Asp Arg Leu Gln Val Leu Asp Asp His Tyr Arg Asp Val Leu Lys Glu Met Lys Ala Lys Ala Ser Thr Val Lys Ala <210> 47 <211> 47 <212> PRT
<213> cHepatitis C Virus <400> 47 Ser Val Glu Glu Ala Cys Lys Leu Thr Pro Pro His Ser Ala Arg Ser Lys Phe Gly Tyr Gly Ala Lys Asp Val Arg Asn Leu Ser Ser Lys Ala Val Asn His Ile His Ser Val Trp Lys Asp Leu Leu Glu Asp Thr <210> 48 <211> 40 <212> PRT
<213> cHepatitis C Virus <400> 48 Glu Thr Pro Ile Asp Thr Thr Ile Met AIa Lys Asn Glu Val Phe Cys Val Gln Pro Glu Lys GIy Gly Arg Lys Pro Ala Arg Leu Ile Val Tyr Pro Asp Leu Gly Val Arg Val Cys <210> 49 <2I1> 102 <212> PRT
<213> cHepatitis C Virus <400> 49 Ser Ser Tyr Gly Phe Gln Tyr Ser Pro Gly Gln Arg Val Glu Phe Leu Val Asn Ala Trp Lys Ser Lys Lys Cys Pro Met Gly Phe Ala Tyr Asp Thr Arg Cys Phe Asp Ser Thr Val Thr Glu Asn Asp Ile Arg Val Glu Glu Ser Ile Tyr Gln Cys Cys Asp Leu Ala Pro Glu Ala Arg Gln Ala Ile Arg Ser Leu Thr Glu Arg Leu Tyr Ile Gly Gly Pro Leu Thr Asn Ser Lys Gly Gln Ser Cys Gly Tyr Arg Arg Cys Arg Ala Ser Gly Val Leu Thr Thr Ser Cys Gly <210> 50 <211> 56 <212> PRT
<213> cHepatitis C Virus <400> 50 Cys Thr Met Leu Val Cys GIy Asp Asp Leu Val VaI Ile Cys Glu Ser Ala Gly Thr Gln Glu Asp Ala Ala Ser Leu Arg Val Phe Thr Glu Ala Met Thr Arg Tyr Ser Ala Pro Pro Gly Asp Pro Pro Gln Pro Glu Tyr Asp Leu Glu Leu IIe Thr Ser Cys <210> 51 <211> 37 <212> PRT
<213> cHepatitis C Virus <400> 51 Ser Val Ala His Asp Ala Ser Gly Lys Arg Val Tyr Tyr Leu Thr Arg Asp Pro Thr Thr Pro Leu Ala Arg Ala Ala Trp Glu Thr Ala Arg His Thr Pro Val Asn Ser <210> 52 <211> 29 <212> PRT
<213> cHepatitis C Virus <400> 52 Cys Leu Arg Lys Leu Gly Val Pro Pro Leu Arg Val Trp Arg His Arg Ala Arg Ser Val Arg Ala Lys Leu Leu Ser Gln Gly Gly <210> 53 <211> 25 <212> PRT
<213> Hepatitis C Virus <400> 53 Phe Val Ala Gly Tyr Ser Gly Gly Asp Ile Tyr His Ser Leu Ser Arg Ala Arg Pro Arg Trp Phe Met Trp Cys
Claims
What is claimed is:
1. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein comprising the sequence of SEQ ID NO:
1 and natural allelic variants, mutants and derivatives thereof.
2. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein having a sequence of SEQ ID NO. 2.
3. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein comprising the sequence of SEQ ID NO:
3 and natural allelic variants, mutants and derivatives thereof.
4. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein having a sequence of SEQ ID NO: 8 5. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein comprising the sequence of SEQ ID NO:
4 and natural allelic variants, mutants and derivatives thereof.
6. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein having the sequence of SEQ ID NO: 9.
7. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein comprising the sequence of SEQ ID NO:
5 and natural allelic variants, mutants and derivatives thereof.
8. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein having the sequence of SEQ ID NO: 10.
9. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein comprising the sequence of SEQ ID NO:
6 and natural allelic variants, mutants and derivatives thereof.
10. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein having the sequence of SEQ ID NO: 11.
11. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein comprising the sequence of SEQ ID NO:
7 and natural allelic variants, mutants and derivatives thereof.
12. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein having the sequence of SEQ ID NO: 12.
13. A nucleic acid molecule encoding a hepatitis C
virus protein, said molecule having a nucleic acid sequence selected from the group consisting of SEQ ID
NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ ID
NO:6, and SEQ ID NO: 7 and natural allelic variants, mutants and derivatives thereof.
24. A nucleic acid as claimed in claim 13, said nucleic acid molecule being modified as set forth in Table 6.
15. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein, said protein having an amino acid sequence selected from the group consisting of SEQ ID
NO: 2, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID
NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13.
16. A hepatitis C virus NS5B protein having a sequence selected from the group consisting of SEQ ID
NO: 2, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID
NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13.
17. An HCV NS5B protein as claimed in claim 16, said protein being modified as set forth in Tables 4 and 5.
18. A vector comprising a nucleic acid sequence encoding a hepatitis C virus NS5B protein, said protein consisting essentially of an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ
ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and SEQ ID NO: 13.
19. A vector as claimed in claim 18, said vector comprising a nucleic acid encoding a hepatitis C NS5B
protein, said amino acid sequence of said protein being altered as set forth in Tables 4 and 5.
20. A hepatitis C virus NS5B protein comprising the sequence of SEQ ID NO: 2.
21. A hepatitis C virus NS5B protein comprising the sequence of SEQ ID NO: 8.
22. A hepatitis C virus NS5B protein comprising the sequence of SEQ ID NO: 9.
23. A hepatitis C virus NS5B protein comprising the sequence of SEQ ID NO: 10.
24. A hepatitis C virus NS5B protein comprising the sequence of SEQ ID NO: 11.
25. A hepatitis C virus NS5B protein comprising the sequence of SEQ ID NO: 12.
26. A hepatitis C virus NS5B protein comprising the sequence of SEQ ID NO: 13.
27. A hepatitis C virus NS5B protein having an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO:
10, SEQ ID NO: 11, SEQ ID NO: 12, and SEQ ID NO: 13, wherein the amino acid residues at positions +1 and +2 may be any amino acid.
28. A hepatitis C virus NS5B protein as claimed in claim 27, wherein said amino acid sequence is altered as set forth in Tables 4 and 5.
29. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein in which the amino acid at position 177 of the mature polypeptide is asparagine.
30. A hepatitis C virus NS5B protein in which the amino acid at position 177 of the mature polypeptide is asparagine.
31. A nucleic acid molecule as claimed in claim 1, wherein the codon encoding an amino acid at position 75 is changed from alanine to valine.
32. A hepatitis C virus NS5B protein as claimed in claim 20, wherein the amino acid at position 75 is changed from alanine to valine.
33. A nucleic acid molecule as claimed in claim 1, wherein the codon encoding an amino acid at position 177 is changed from asparagine to aspartic acid.
34. A hepatitis C virus NS5B protein as claimed in claim 20, wherein the amino acid at position 177 is changed from asparagine to aspartic acid.
35. A nucleic acid molecule as claimed in claim 1, wherein a codon encoding an amino acid at position 534 is changed from serine to proline.
36. A hepatitis C virus NS5B protein as claimed in claim 20, wherein the amino acid at position 534 is changed from serine to proline.
37. A nucleic acid molecule encoding a HCV NS5B
protein having a sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ
ID NO: 5, SEQ ID NO:6, and SEQ ID NO: 7, wherein the codons encoding amino acids at positions -1, -2, and -3 may encode any amino acid.
38. A nucleic acid molecule as claimed in claim 13, further comprising a tag sequence.
39. A nucleic acid molecule as claimed in claim 38, said tag sequence being selected from the group consisting of homopolymeric nucleic acid sequences, polyhistidine, flag epitope, c-myc epitope, transmembrane epitope of the influenza A virus hemaglutinin protein, protein A, cellulose binding domain, calmodulin binding protein, maltose binding protein, chitin binding domain, glutathione S-transferase, or biotin.
40. A nucleic acid molecule as claimed in claim 14, further comprising a tag sequence.
41. A nucleic acid molecule as claimed in claim 40, said tag sequence being selected from the group consisting of homopolymeric nucleic acid sequences, polyhistidine, flag epitope, c-myc epitope, transmembrane epitope of the influenza A virus hemaglutinin protein " protein A, cellulose binding domain, calmodulin binding protein, maltose binding protein, chitin binding domain, glutathione S-transferase, or biotin.
42. A hepatitis C virus NS5B protein selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 8, SEQ
ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13 and a modified NS5B protein as set forth in Tables 4 and 5, further comprising a protein tag sequence, said tag sequence being selected from the group consisting of homopolymeric nucleic acid sequences, polyhistidine, flag epitope, c-myc epitope, transmembrane epitope of the influenza A virus hemaglutinin protein, protein A, cellulose binding domain, calmodulin binding protein, maltose binding protein, chitin binding domain, glutathione S-transferase, or biotin.
43. A nucleic acid molecule encoding a hepatitis C
virus protein having a nucleic acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ ID NO:6, and SEQ ID NO:
7, natural allelic variants, mutants and derivatives of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ
ID NO:6, and SEQ ID NO: 7 and nucleic acids modified as set forth in Table 6, wherein an amino acid codon for alanine precedes the first amino acid codon of the mature NS5B protein.
44. A hepatitis C virus NS5B protein having a sequence selected from the group consisting of SEQ ID
NO: 2, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID
NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13 and a modified NS5B protein as set forth in Tables 4 and 5, wherein an alanine residue precedes the first amino acid of the mature NS5B protein.
45. A method for assaying a test compound, for a modulating activity against hepatitis C virus comprising:
i) providing an enzymatically active hepatitis C virus NS5B protein comprising a sequence selected from the group consisting of SEQ ID NO: 2, SEQ
ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 13;
ii) contacting said protein with a test compound suspected of modulating hepatitis C virus NS5B
activity; and iii) measuring modulation of said hepatitis C
virus NS5B activity by said test compound.
46. A method as claimed in claim 45, wherein said HCV NS5B protein sequence is modified as set forth in Tables 4 and 5.
47. A method as claimed in claim 45, wherein the amino acids at positions +1 and +2 in said HCV NS5B
protein may be any amino acid.
48. A method as claimed in claim 45, wherein amino acids at positions -1, -2 and -3 of said HCV NS5B
protein may be any amino acid.
50. A method as claimed in claim 45, wherein said HCV NS5B protein further comprises a tag sequence.
51. A method for assaying a compound, for antagonistic activity against hepatitis C virus comprising:
i) providing an enzymatically active hepatitis C virus NS5B protein comprising a sequence selected from the group consisting of SEQ ID NO: 2, SEQ
ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 13;
ii} contacting said protein with a test compound suspected of antagonizing hepatitis C virus NS5B activity; and iii) measuring antagonism of said hepatitis C
virus NS5B activity by said test compound.
52. A method as claimed in claim 51, wherein said HCV NS5B protein sequence is modified as set forth in Tables 4 and 5.
53. A method as claimed in claim 51, wherein the amino acids at positions +1 and +2 in said HCV NS5B
protein may be any amino acid.
54. A method as claimed in claim 51, wherein said HCV NS5B protein further comprises a tag sequence.
55. A method as claimed in claim 51, wherein amino acids at positions -1, -2 and -3 of said HCV NS5B
protein may be any amino acid.
56. A method for assaying a test compound, for agonistic activity against hepatitis C virus comprising:
i) providing an enzymatically active hepatitis C virus NS5B protein comprising a sequence selected from the group consisting of SEQ ID NO: 2, SEQ
ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 13;
ii) contacting said protein with a test compound suspected of agonizing hepatitis C virus NS5B
activity; and iii) measuring agonism of said hepatitis C
virus NS5B activity by said test compound.
57. A method as claimed in claim 56, wherein said HCV NS5B protein sequence is modified as set forth in Tables 4 and 5.
58. A method as claimed in claim 56, wherein the amino acids at positions +1 and +2 in said HCV NS5B
protein may be any amino acid.
59. A method as claimed in claim 56, wherein amino acids at positions -1, -2 and -3 of said HCV NS5B
protein may be any amino acid.
60. A method as claimed in claim 56, wherein said HCV NS5B protein further comprises a tag sequence.
61. A method for assaying a test compound for interaction with the hepatitis C virus NS5B protein sequence comprising:
i) providing a hepatitis C virus NS5B
polypeptide consisting essentially of a sequence selected from the group consisting of SEQ ID NO: 2, SEQ
ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and SEQ ID NO: 13;
ii) contacting said protein or peptide with a test compound suspected of interacting with the hepatitis C virus NS5B protein or peptide; and iii) measuring the interaction of said test compound or material with said hepatitis C virus NS5B
polypeptide.
62. A method as claimed in claim 61, wherein said HCV NS5B protein sequence is modified as set forth in Tables 4 and 5.
63. A method as claimed in claim 61, wherein the amino acids at positions +1 and +2 in said HCV NS5B
protein may be any amino acid.
64. A method as claimed in claim 61, wherein amino acids at positions -1, -2 and -3 of said HCV NS5B
protein may be any amino acid.
65. A method as claimed in claim 61, wherein said HCV NS5B protein further comprises a tag sequence.
66. A method for assaying a test compound, for interaction with a hepatitis C virus NS5B nucleic acid sequence comprising:
i) providing a hepatitis C virus NS5B nucleic acid consisting essentially of a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ
ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7;
ii) contacting said NS5B nucleic acid with a test compound suspected of interacting with the hepatitis C virus NS5B NS5B nucleic acid; and iii) measuring the interaction of said test compound with said hepatitis C virus NS5B NS5B nucleic acid.
67. A method as claimed in claim 66, wherein said HCV NS5B nucleic acid sequence is modified as set forth in Table 6.
68. A method for detecting the presence of HCV in a biological sample, comprising nucleic acid amplification that effectively amplifies a selected nucleotide sequence from said virus and detection of said selected sequence; said nucleic acid having a sequence selected from the group consisting of SEQ ID
NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID
NO: 6, and SEQ ID NO: 7.
69. A method as claimed in claim 68, said nucleic acid sequence being altered as set forth in Table 6.
70. A method as claimed in claim 68, wherein the nucleic acid amplification method is performed employing a series of nested primers.
71. A method as claimed in claim 68, wherein said sequence is detected using an oligonucleotide comprising a sequence set forth in Table 1.
72. A method for detecting immunological interactions between viral polypeptides and antibodies directed toward hepatitis C virus in a biological sample, said method comprising isolating said antibodies using an NS5B amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 8, SEQ ID
NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and SEQ ID NO: 13.
73. A method as claimed in claim 72, wherein said HCV NS5B amino acid sequence is modified as set forth in Tables 4 and 5.
74. A method as claimed in claim 72, wherein the amino acids at positions +1 and +2 in said HCV NS5B
protein may be any amino acid.
75. A method as claimed in claim 72, wherein amino acids at positions -1, -2 and -3 of said HCV NS5B
protein can be any amino acid.
76. An antibody having affinity for a hepatitis C
polypeptide having a sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and SEQ ID
NO: 13.
77. An antibody as claimed in claim 76, wherein said HCV NS5B protein sequence is modified as set forth in Tables 4 and 5.
78. An antibody as claimed in claim 76, wherein the amino acids at positions +1 and +2 in said HCV NS5B
protein may be any amino acid.
79. An antibody as claimed in claim 76, wherein amino acids at positions -1, -2 and -3 of said HCV NS5B
protein may be any amino acid.
80. An antibody having affinity for a polypeptide comprising a sequence set forth in Table 2.
81. A nucleic acid molecule encoding a hepatitis C
virus protein having a nucleic acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ ID NO:6, and SEQ ID NO:
7, natural allelic variants, mutants and derivatives of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ
ID NO:6, and SEQ ID NO: 7 and nucleic acids modified as set forth in Table 6, which encodes a viral antigen.
82. A method for introducing a nucleic acid as claimed in claim 81 into a host, wherein said nucleic acid is delivered to said host via a process selected from the group consisting of transformation, transfection, transduction, transgenetics, surgically and by physical bombardment with nucleic acid-coated particles.
83. A viral antigen comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ
ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13 and a modified NS5B
protein as set forth in Tables 4 and 5 84. A viral antigen as claimed in claim 83, wherein the amino acids at positions +1 and +2 in said HCV NS5B protein may be any amino acid.
85. A viral antigen as claimed in claim 83, wherein amino acids at positions -1, -2 and -3 of said HCV NS5B protein may be any amino acid.
86. A viral antigen as claimed in claim 83, further comprising a protein tag sequence.
87. A method of raising an immune response in a mammalian subject comprising administering to said subject a viral antigen encoded by the nucleic acid of claim 81.
88. A method of raising an immune response in a mammalian subject comprising administering to said subject a viral antigen according to claim 83.
89. A method of amplifying hepatitis C virus nucleic acids employing primers comprising sequences selected from the oligonucleotide sequences set forth in Table 1.
90. A host cell comprising a hepatitis C virus nucleic acid as claimed 13.
91. A host cell comprising a hepatitis C virus nucleic acid, said nucleic acid being altered as set forth in Table 6.
92. A host cell comprising a nucleic acid encoding a hepatitis C NS5B protein, said nucleic acid being selected from the group consisting of SEQ ID NO:1, SEQ
ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ ID NO:6, and SEQ
ID NO: 7, natural allelic variants, mutants and derivatives of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ ID NO:6, and SEQ ID NO: 7 and nucleic acids modified as set forth in Table 6, said host cell being selected from the group of cells consisting of bacterial cells, fungal cells, insect cells, mammalian cells, and plant cells.
93. A cell line comprising a nucleic acid encoding a hepatitis C NS5B protein, said nucleic acid being selected from the group consisting of SEQ ID NO:1, SEQ
ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ ID NO:6, and SEQ
ID NO: 7, natural allelic variants, mutants and derivatives of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ ID NO:6, and SEQ ID NO: 7 and nucleic acids modified as set forth in Table 6, said cell line being selected from the group consisting of a hepatocyte cell line, Chang liver cells, Hela cells, U937 cells, HepG2 cells, MT-4 cells and clonal cells generated from said cell lines.
94. A cell line according to claim 93, wherein said cell line expresses a functional NS5B protein.
95. A cell line according to claim 94 further comprising a reporter system wherein a reporting signal which from said reporter system is dependent on the polymerase activity of a functional HCV NS5B protein in said cells.
96. A cell line according to claim 95, wherein said reporter system includes a nucleic acid comprising the antisense strand of an RNA molecule encoding a functional reporter molecule, said NS5B polymerase acting on said antisense molecule to generate a translatable mRNA sequence in said host cell, said translated reporter molecule sequence being capable of producing an increase in signal which is indicative of the presence of a functional NS5B polymerase.
97. A cell line according to claim 96 wherein said functional mRNA molecule encodes a reporter molecule selected from a group consisting of luciferase, .beta.-galactosidase, alkaline phosphatase or fluorescent green protein host cell is a hepatocyte.
98. A method for assessing the functionality of a hepatitis C NS5B protein, comprising:
i) providing a cell line as claimed in claim 93;
ii) transforming said cell line with a nucleic acid encoding an antisense molecule, the complement of which encodes a functional reporter molecule, said NS5B polymerase acting on said antisense molecule to generate a translatable mRNA sequence in said host cell; and iii) assessing said cells for an increase in signal produced by said translated reporter molecule sequence, said increase indicating the presence of a functional NS5B protein.
99. A method as claimed in claim 98, wherein said functional reporter molecule is selected from a group consisting of luciferase, .beta.-galactosidase, alkaline phosphatase or fluorescent green protein.
100. A host cell as claimed in claim 90, wherein said host cell is a hepatocyte.
101. A method for assaying a test compound for antagonist activity against hepatitis C virus comprising:
i) providing a cell line according to claim 94;
ii) contacting said cell line with a test compound suspected of having antagonistic hepatitis C
virus NS5B activity; and iii) measuring the antagonistic effect, if any, of said test compound on hepatitis C virus NS5B
activity.
102. A method for assaying a test compound for agonist activity against hepatitis C virus comprising:
i) providing a cell line according to claim 94;
ii) contacting said cell line with a test compound suspected of having agonistic hepatitis C virus NS5B activity; and iii) measuring the agonistic effect, if any, of said test compound on hepatitis C virus NS5B
activity.
103. A method of preparing a hepatitis C virus NS5B protein comprising a sequence selected from a group consisting of SEQ ID NO: 2, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and SEQ ID
NO: 13 comprising:
i) expressing said protein in a biological system;
ii) solubilizing said protein;
iii) extracting said protein and iii) enriching for said NS5B protein.
104. A method as claimed in claim 103, wherein said hepatitis C virus protein has been altered as set forth in Tables 4 and 5.
105. A method as claimed in claim 103, wherein the amino acids at positions +1 and +2 in said HCV NS5B
protein can be any amino acid.
106. A method as claimed in claim 103, wherein amino acids at positions -1, -2 and -3 of'said HCV NS5B
protein may be any amino acid.
107. A method as claimed in claims 103, wherein said HCV NS5B further comprising a protein tag sequence according to claim 40.
108. A method as claimed in claim 103, wherein said NS5B protein is enriched by a process selected from the group consisting of cell disruption, cell fractionation, partitioning, reverse micelle partitioning, aqueous two-phase extraction, precipitation, chromatography, ion exchange chromatography, chelation chromatography, affinity chromatography, immunoaffinity chromatography, high pressure liquid chromatography, hydrophobic interaction chromatography, centrifugation, membrane filtration, gel filtration, immunoprecipitation, electrophoresis, isoelectric focusing, and isotachophoresis.
109. A method as claimed in claim 103, wherein said biological system is selected from the group consisting of bacterial cells, fungal cells, insect cells, mammalian cells, and plant cells.
110. A method as claimed in claim 103, wherein said biological system is cell free.
111. A method for isolating an HCV NS5B protein, comprising:
i) contacting an extract of a biological system containing the NS5B protein with a solid matrix possessing a diethylaminoethyl (DEAE) moiety as a functional group in a salt-containing buffer solution;
ii) removing said NS5B protein from said solid matrix and further contacting said protein with a solid matrix comprising heparin as a functional group;
iii) exposing said heparin matrix containing bound NS5B protein to a buffer solution of continuously increasing levels of salt;
iv) collecting NS5B protein-containing fractions and contacting said collected fractions with a solid matrix containing Cibacron Blue as a functional group;
v) exposing said Cibacron Blue matrix containing bound NS5B protein to a buffered solution containing increasing levels of salt; and vi) collecting said enriched NS5B-containing fractions.
112. A method of generating an infectious viral vector, comprising incorporating a hepatitis C virus NS5B nucleic acid selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7 into said viral vector.
113. A method as claimed in claim 112, wherein said nucleic acid sequence is altered as set forth in Table 6.
114. A method of generating an infectious viral vector comprising substituting an HCV NS5B homologous gene sequence derived from any HCV sequence with a hepatitis C virus NS5B nucleic acid selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID
NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7 in said viral vector.
115. A method as claimed in claim 114, wherein said nucleic acid sequence is altered as set forth in Table 6.
116. A host animal comprising a nucleic acid sequence selected from the group consisting of SEQ ID
NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ ID
NO:6, and SEQ ID NO: 7, natural allelic variants, mutants and derivatives of SEQ ID NO:1, SEQ ID NO:3, SEQ
ID NO:4, SEQ ID NO: 5, SEQ ID NO:6, and SEQ ID NO: 7 and nucleic acids modified as set forth in Table 6.
117. A method of isolating antibodies to HCV NS5B
protein comprising screening a human or murine antibody library for reactivity to NS5B proteins having a sequence selected from the group consisting of SEQ ID
NO: 2, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID
NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13 and a modified NS5B protein as set forth in Tables 4 and 5, and selecting a clone from said library which expresses the reactive antibody and isolating said clone.
118. A method for propagating HCV in an in vitro system comprising culturing a cell line in which functional HCV NS5B sequences are provided, said sequences being selected from the group consisting of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ
ID NO:6, and SEQ ID NO: 7, natural allelic variants, mutants and derivatives of SEQ ID NO:1, SEQ ID NO:3, SEQ
ID NO:4, SEQ ID NO: 5, SEQ ID NO:6, and SEQ ID NO: 7 and nucleic acids modified as set forth in Table 6, under conditions that facilitate the replication of HCV.
119. A method for infecting a cell culture with hepatitis C virus comprising administering a viral vector which is generated as claimed in claim 112.
120. A method for infecting an animal with hepatitis C virus comprising administering a viral vector which is generated as claimed in claim 112.
121. A method of propagating hepatitis C virus in vitro comprising:
i) contacting a cell line with a functional HCV NS5B protein consisting essentially of a sequence selected from the group consisting of SEQ ID NO: 2, SEQ
ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and SEQ ID NO: 13; and ii) said cell line being further contacted with an HCV nucleic acid.
122. A method as claimed in claim 121, wherein said NS5B protein has been modified as set forth in Tables 4 and 5 123. A method as claimed in claim 121, wherein the amino acid residues at positions +1 and +2 in said NS5B protein may be any amino acid.
124. A method according to claim 121 wherein said NS5B nucleic acid is provided within a hepatitis C virus replicon.
125. A method of propagating hepatitis C virus in a living host, comprising:
i) delivering a nucleic acid encoding a hepatitis C virus NS5B protein having a sequence selected from the group consisting SEQ ID NO: 2, SEQ ID
NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ
ID NO: 12, and SEQ ID NO: 13 to a living host, said nucleic acid encoding a functional NS5B protein and being operably linked to an expression operon; and ii) contacting said living host with an HCV
molecule selected from the group consisting of HCV
particles, HCV nucleic acids, and HCV replicons.
126. A method as claimed in claim 125, wherein said NS5B encoding nucleic acid is altered as set forth in Table 6.
127. A method as claimed in claim 125, wherein said nucleic acid is delivered to said host via a process selected from the group consisting of transformation, transfection, transduction, transgenetics, surgically or by physical bombardment with nucleic acid-coated particles.
128. A method according to claim 125 wherein said NS5B encoding nucleic acid of step i) is provided within a replicon.
129. A kit for detecting the presence of HCV
nucleic acids in a biological sample, comprising:
i) oligonucleotides comprising a sequence set forth in Table I, said oligonucleotides being hybridizable to said HCV encoding nucleic acid;
ii) reaction buffer; and iii) an instruction sheet.
130. A kit as claimed in claim 129, wherein said oligonucleotide contains a tag.
131. A kit for detecting the presence of HCV in a biological sample, comprising:
i) antibodies immunologically specific for HCV proteins;
ii) a solid support with immobilized HCV
antigens as a positive control; and iii) an instruction sheet.
132. A kit as claimed in claim 131, wherein said antibody contains a tag.
1. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein comprising the sequence of SEQ ID NO:
1 and natural allelic variants, mutants and derivatives thereof.
2. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein having a sequence of SEQ ID NO. 2.
3. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein comprising the sequence of SEQ ID NO:
3 and natural allelic variants, mutants and derivatives thereof.
4. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein having a sequence of SEQ ID NO: 8 5. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein comprising the sequence of SEQ ID NO:
4 and natural allelic variants, mutants and derivatives thereof.
6. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein having the sequence of SEQ ID NO: 9.
7. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein comprising the sequence of SEQ ID NO:
5 and natural allelic variants, mutants and derivatives thereof.
8. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein having the sequence of SEQ ID NO: 10.
9. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein comprising the sequence of SEQ ID NO:
6 and natural allelic variants, mutants and derivatives thereof.
10. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein having the sequence of SEQ ID NO: 11.
11. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein comprising the sequence of SEQ ID NO:
7 and natural allelic variants, mutants and derivatives thereof.
12. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein having the sequence of SEQ ID NO: 12.
13. A nucleic acid molecule encoding a hepatitis C
virus protein, said molecule having a nucleic acid sequence selected from the group consisting of SEQ ID
NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ ID
NO:6, and SEQ ID NO: 7 and natural allelic variants, mutants and derivatives thereof.
24. A nucleic acid as claimed in claim 13, said nucleic acid molecule being modified as set forth in Table 6.
15. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein, said protein having an amino acid sequence selected from the group consisting of SEQ ID
NO: 2, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID
NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13.
16. A hepatitis C virus NS5B protein having a sequence selected from the group consisting of SEQ ID
NO: 2, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID
NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13.
17. An HCV NS5B protein as claimed in claim 16, said protein being modified as set forth in Tables 4 and 5.
18. A vector comprising a nucleic acid sequence encoding a hepatitis C virus NS5B protein, said protein consisting essentially of an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ
ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and SEQ ID NO: 13.
19. A vector as claimed in claim 18, said vector comprising a nucleic acid encoding a hepatitis C NS5B
protein, said amino acid sequence of said protein being altered as set forth in Tables 4 and 5.
20. A hepatitis C virus NS5B protein comprising the sequence of SEQ ID NO: 2.
21. A hepatitis C virus NS5B protein comprising the sequence of SEQ ID NO: 8.
22. A hepatitis C virus NS5B protein comprising the sequence of SEQ ID NO: 9.
23. A hepatitis C virus NS5B protein comprising the sequence of SEQ ID NO: 10.
24. A hepatitis C virus NS5B protein comprising the sequence of SEQ ID NO: 11.
25. A hepatitis C virus NS5B protein comprising the sequence of SEQ ID NO: 12.
26. A hepatitis C virus NS5B protein comprising the sequence of SEQ ID NO: 13.
27. A hepatitis C virus NS5B protein having an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO:
10, SEQ ID NO: 11, SEQ ID NO: 12, and SEQ ID NO: 13, wherein the amino acid residues at positions +1 and +2 may be any amino acid.
28. A hepatitis C virus NS5B protein as claimed in claim 27, wherein said amino acid sequence is altered as set forth in Tables 4 and 5.
29. A nucleic acid molecule encoding a hepatitis C
virus NS5B protein in which the amino acid at position 177 of the mature polypeptide is asparagine.
30. A hepatitis C virus NS5B protein in which the amino acid at position 177 of the mature polypeptide is asparagine.
31. A nucleic acid molecule as claimed in claim 1, wherein the codon encoding an amino acid at position 75 is changed from alanine to valine.
32. A hepatitis C virus NS5B protein as claimed in claim 20, wherein the amino acid at position 75 is changed from alanine to valine.
33. A nucleic acid molecule as claimed in claim 1, wherein the codon encoding an amino acid at position 177 is changed from asparagine to aspartic acid.
34. A hepatitis C virus NS5B protein as claimed in claim 20, wherein the amino acid at position 177 is changed from asparagine to aspartic acid.
35. A nucleic acid molecule as claimed in claim 1, wherein a codon encoding an amino acid at position 534 is changed from serine to proline.
36. A hepatitis C virus NS5B protein as claimed in claim 20, wherein the amino acid at position 534 is changed from serine to proline.
37. A nucleic acid molecule encoding a HCV NS5B
protein having a sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ
ID NO: 5, SEQ ID NO:6, and SEQ ID NO: 7, wherein the codons encoding amino acids at positions -1, -2, and -3 may encode any amino acid.
38. A nucleic acid molecule as claimed in claim 13, further comprising a tag sequence.
39. A nucleic acid molecule as claimed in claim 38, said tag sequence being selected from the group consisting of homopolymeric nucleic acid sequences, polyhistidine, flag epitope, c-myc epitope, transmembrane epitope of the influenza A virus hemaglutinin protein, protein A, cellulose binding domain, calmodulin binding protein, maltose binding protein, chitin binding domain, glutathione S-transferase, or biotin.
40. A nucleic acid molecule as claimed in claim 14, further comprising a tag sequence.
41. A nucleic acid molecule as claimed in claim 40, said tag sequence being selected from the group consisting of homopolymeric nucleic acid sequences, polyhistidine, flag epitope, c-myc epitope, transmembrane epitope of the influenza A virus hemaglutinin protein " protein A, cellulose binding domain, calmodulin binding protein, maltose binding protein, chitin binding domain, glutathione S-transferase, or biotin.
42. A hepatitis C virus NS5B protein selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 8, SEQ
ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13 and a modified NS5B protein as set forth in Tables 4 and 5, further comprising a protein tag sequence, said tag sequence being selected from the group consisting of homopolymeric nucleic acid sequences, polyhistidine, flag epitope, c-myc epitope, transmembrane epitope of the influenza A virus hemaglutinin protein, protein A, cellulose binding domain, calmodulin binding protein, maltose binding protein, chitin binding domain, glutathione S-transferase, or biotin.
43. A nucleic acid molecule encoding a hepatitis C
virus protein having a nucleic acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ ID NO:6, and SEQ ID NO:
7, natural allelic variants, mutants and derivatives of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ
ID NO:6, and SEQ ID NO: 7 and nucleic acids modified as set forth in Table 6, wherein an amino acid codon for alanine precedes the first amino acid codon of the mature NS5B protein.
44. A hepatitis C virus NS5B protein having a sequence selected from the group consisting of SEQ ID
NO: 2, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID
NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13 and a modified NS5B protein as set forth in Tables 4 and 5, wherein an alanine residue precedes the first amino acid of the mature NS5B protein.
45. A method for assaying a test compound, for a modulating activity against hepatitis C virus comprising:
i) providing an enzymatically active hepatitis C virus NS5B protein comprising a sequence selected from the group consisting of SEQ ID NO: 2, SEQ
ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 13;
ii) contacting said protein with a test compound suspected of modulating hepatitis C virus NS5B
activity; and iii) measuring modulation of said hepatitis C
virus NS5B activity by said test compound.
46. A method as claimed in claim 45, wherein said HCV NS5B protein sequence is modified as set forth in Tables 4 and 5.
47. A method as claimed in claim 45, wherein the amino acids at positions +1 and +2 in said HCV NS5B
protein may be any amino acid.
48. A method as claimed in claim 45, wherein amino acids at positions -1, -2 and -3 of said HCV NS5B
protein may be any amino acid.
50. A method as claimed in claim 45, wherein said HCV NS5B protein further comprises a tag sequence.
51. A method for assaying a compound, for antagonistic activity against hepatitis C virus comprising:
i) providing an enzymatically active hepatitis C virus NS5B protein comprising a sequence selected from the group consisting of SEQ ID NO: 2, SEQ
ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 13;
ii} contacting said protein with a test compound suspected of antagonizing hepatitis C virus NS5B activity; and iii) measuring antagonism of said hepatitis C
virus NS5B activity by said test compound.
52. A method as claimed in claim 51, wherein said HCV NS5B protein sequence is modified as set forth in Tables 4 and 5.
53. A method as claimed in claim 51, wherein the amino acids at positions +1 and +2 in said HCV NS5B
protein may be any amino acid.
54. A method as claimed in claim 51, wherein said HCV NS5B protein further comprises a tag sequence.
55. A method as claimed in claim 51, wherein amino acids at positions -1, -2 and -3 of said HCV NS5B
protein may be any amino acid.
56. A method for assaying a test compound, for agonistic activity against hepatitis C virus comprising:
i) providing an enzymatically active hepatitis C virus NS5B protein comprising a sequence selected from the group consisting of SEQ ID NO: 2, SEQ
ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 13;
ii) contacting said protein with a test compound suspected of agonizing hepatitis C virus NS5B
activity; and iii) measuring agonism of said hepatitis C
virus NS5B activity by said test compound.
57. A method as claimed in claim 56, wherein said HCV NS5B protein sequence is modified as set forth in Tables 4 and 5.
58. A method as claimed in claim 56, wherein the amino acids at positions +1 and +2 in said HCV NS5B
protein may be any amino acid.
59. A method as claimed in claim 56, wherein amino acids at positions -1, -2 and -3 of said HCV NS5B
protein may be any amino acid.
60. A method as claimed in claim 56, wherein said HCV NS5B protein further comprises a tag sequence.
61. A method for assaying a test compound for interaction with the hepatitis C virus NS5B protein sequence comprising:
i) providing a hepatitis C virus NS5B
polypeptide consisting essentially of a sequence selected from the group consisting of SEQ ID NO: 2, SEQ
ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and SEQ ID NO: 13;
ii) contacting said protein or peptide with a test compound suspected of interacting with the hepatitis C virus NS5B protein or peptide; and iii) measuring the interaction of said test compound or material with said hepatitis C virus NS5B
polypeptide.
62. A method as claimed in claim 61, wherein said HCV NS5B protein sequence is modified as set forth in Tables 4 and 5.
63. A method as claimed in claim 61, wherein the amino acids at positions +1 and +2 in said HCV NS5B
protein may be any amino acid.
64. A method as claimed in claim 61, wherein amino acids at positions -1, -2 and -3 of said HCV NS5B
protein may be any amino acid.
65. A method as claimed in claim 61, wherein said HCV NS5B protein further comprises a tag sequence.
66. A method for assaying a test compound, for interaction with a hepatitis C virus NS5B nucleic acid sequence comprising:
i) providing a hepatitis C virus NS5B nucleic acid consisting essentially of a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ
ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7;
ii) contacting said NS5B nucleic acid with a test compound suspected of interacting with the hepatitis C virus NS5B NS5B nucleic acid; and iii) measuring the interaction of said test compound with said hepatitis C virus NS5B NS5B nucleic acid.
67. A method as claimed in claim 66, wherein said HCV NS5B nucleic acid sequence is modified as set forth in Table 6.
68. A method for detecting the presence of HCV in a biological sample, comprising nucleic acid amplification that effectively amplifies a selected nucleotide sequence from said virus and detection of said selected sequence; said nucleic acid having a sequence selected from the group consisting of SEQ ID
NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID
NO: 6, and SEQ ID NO: 7.
69. A method as claimed in claim 68, said nucleic acid sequence being altered as set forth in Table 6.
70. A method as claimed in claim 68, wherein the nucleic acid amplification method is performed employing a series of nested primers.
71. A method as claimed in claim 68, wherein said sequence is detected using an oligonucleotide comprising a sequence set forth in Table 1.
72. A method for detecting immunological interactions between viral polypeptides and antibodies directed toward hepatitis C virus in a biological sample, said method comprising isolating said antibodies using an NS5B amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 8, SEQ ID
NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and SEQ ID NO: 13.
73. A method as claimed in claim 72, wherein said HCV NS5B amino acid sequence is modified as set forth in Tables 4 and 5.
74. A method as claimed in claim 72, wherein the amino acids at positions +1 and +2 in said HCV NS5B
protein may be any amino acid.
75. A method as claimed in claim 72, wherein amino acids at positions -1, -2 and -3 of said HCV NS5B
protein can be any amino acid.
76. An antibody having affinity for a hepatitis C
polypeptide having a sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and SEQ ID
NO: 13.
77. An antibody as claimed in claim 76, wherein said HCV NS5B protein sequence is modified as set forth in Tables 4 and 5.
78. An antibody as claimed in claim 76, wherein the amino acids at positions +1 and +2 in said HCV NS5B
protein may be any amino acid.
79. An antibody as claimed in claim 76, wherein amino acids at positions -1, -2 and -3 of said HCV NS5B
protein may be any amino acid.
80. An antibody having affinity for a polypeptide comprising a sequence set forth in Table 2.
81. A nucleic acid molecule encoding a hepatitis C
virus protein having a nucleic acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ ID NO:6, and SEQ ID NO:
7, natural allelic variants, mutants and derivatives of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ
ID NO:6, and SEQ ID NO: 7 and nucleic acids modified as set forth in Table 6, which encodes a viral antigen.
82. A method for introducing a nucleic acid as claimed in claim 81 into a host, wherein said nucleic acid is delivered to said host via a process selected from the group consisting of transformation, transfection, transduction, transgenetics, surgically and by physical bombardment with nucleic acid-coated particles.
83. A viral antigen comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ
ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13 and a modified NS5B
protein as set forth in Tables 4 and 5 84. A viral antigen as claimed in claim 83, wherein the amino acids at positions +1 and +2 in said HCV NS5B protein may be any amino acid.
85. A viral antigen as claimed in claim 83, wherein amino acids at positions -1, -2 and -3 of said HCV NS5B protein may be any amino acid.
86. A viral antigen as claimed in claim 83, further comprising a protein tag sequence.
87. A method of raising an immune response in a mammalian subject comprising administering to said subject a viral antigen encoded by the nucleic acid of claim 81.
88. A method of raising an immune response in a mammalian subject comprising administering to said subject a viral antigen according to claim 83.
89. A method of amplifying hepatitis C virus nucleic acids employing primers comprising sequences selected from the oligonucleotide sequences set forth in Table 1.
90. A host cell comprising a hepatitis C virus nucleic acid as claimed 13.
91. A host cell comprising a hepatitis C virus nucleic acid, said nucleic acid being altered as set forth in Table 6.
92. A host cell comprising a nucleic acid encoding a hepatitis C NS5B protein, said nucleic acid being selected from the group consisting of SEQ ID NO:1, SEQ
ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ ID NO:6, and SEQ
ID NO: 7, natural allelic variants, mutants and derivatives of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ ID NO:6, and SEQ ID NO: 7 and nucleic acids modified as set forth in Table 6, said host cell being selected from the group of cells consisting of bacterial cells, fungal cells, insect cells, mammalian cells, and plant cells.
93. A cell line comprising a nucleic acid encoding a hepatitis C NS5B protein, said nucleic acid being selected from the group consisting of SEQ ID NO:1, SEQ
ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ ID NO:6, and SEQ
ID NO: 7, natural allelic variants, mutants and derivatives of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ ID NO:6, and SEQ ID NO: 7 and nucleic acids modified as set forth in Table 6, said cell line being selected from the group consisting of a hepatocyte cell line, Chang liver cells, Hela cells, U937 cells, HepG2 cells, MT-4 cells and clonal cells generated from said cell lines.
94. A cell line according to claim 93, wherein said cell line expresses a functional NS5B protein.
95. A cell line according to claim 94 further comprising a reporter system wherein a reporting signal which from said reporter system is dependent on the polymerase activity of a functional HCV NS5B protein in said cells.
96. A cell line according to claim 95, wherein said reporter system includes a nucleic acid comprising the antisense strand of an RNA molecule encoding a functional reporter molecule, said NS5B polymerase acting on said antisense molecule to generate a translatable mRNA sequence in said host cell, said translated reporter molecule sequence being capable of producing an increase in signal which is indicative of the presence of a functional NS5B polymerase.
97. A cell line according to claim 96 wherein said functional mRNA molecule encodes a reporter molecule selected from a group consisting of luciferase, .beta.-galactosidase, alkaline phosphatase or fluorescent green protein host cell is a hepatocyte.
98. A method for assessing the functionality of a hepatitis C NS5B protein, comprising:
i) providing a cell line as claimed in claim 93;
ii) transforming said cell line with a nucleic acid encoding an antisense molecule, the complement of which encodes a functional reporter molecule, said NS5B polymerase acting on said antisense molecule to generate a translatable mRNA sequence in said host cell; and iii) assessing said cells for an increase in signal produced by said translated reporter molecule sequence, said increase indicating the presence of a functional NS5B protein.
99. A method as claimed in claim 98, wherein said functional reporter molecule is selected from a group consisting of luciferase, .beta.-galactosidase, alkaline phosphatase or fluorescent green protein.
100. A host cell as claimed in claim 90, wherein said host cell is a hepatocyte.
101. A method for assaying a test compound for antagonist activity against hepatitis C virus comprising:
i) providing a cell line according to claim 94;
ii) contacting said cell line with a test compound suspected of having antagonistic hepatitis C
virus NS5B activity; and iii) measuring the antagonistic effect, if any, of said test compound on hepatitis C virus NS5B
activity.
102. A method for assaying a test compound for agonist activity against hepatitis C virus comprising:
i) providing a cell line according to claim 94;
ii) contacting said cell line with a test compound suspected of having agonistic hepatitis C virus NS5B activity; and iii) measuring the agonistic effect, if any, of said test compound on hepatitis C virus NS5B
activity.
103. A method of preparing a hepatitis C virus NS5B protein comprising a sequence selected from a group consisting of SEQ ID NO: 2, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and SEQ ID
NO: 13 comprising:
i) expressing said protein in a biological system;
ii) solubilizing said protein;
iii) extracting said protein and iii) enriching for said NS5B protein.
104. A method as claimed in claim 103, wherein said hepatitis C virus protein has been altered as set forth in Tables 4 and 5.
105. A method as claimed in claim 103, wherein the amino acids at positions +1 and +2 in said HCV NS5B
protein can be any amino acid.
106. A method as claimed in claim 103, wherein amino acids at positions -1, -2 and -3 of'said HCV NS5B
protein may be any amino acid.
107. A method as claimed in claims 103, wherein said HCV NS5B further comprising a protein tag sequence according to claim 40.
108. A method as claimed in claim 103, wherein said NS5B protein is enriched by a process selected from the group consisting of cell disruption, cell fractionation, partitioning, reverse micelle partitioning, aqueous two-phase extraction, precipitation, chromatography, ion exchange chromatography, chelation chromatography, affinity chromatography, immunoaffinity chromatography, high pressure liquid chromatography, hydrophobic interaction chromatography, centrifugation, membrane filtration, gel filtration, immunoprecipitation, electrophoresis, isoelectric focusing, and isotachophoresis.
109. A method as claimed in claim 103, wherein said biological system is selected from the group consisting of bacterial cells, fungal cells, insect cells, mammalian cells, and plant cells.
110. A method as claimed in claim 103, wherein said biological system is cell free.
111. A method for isolating an HCV NS5B protein, comprising:
i) contacting an extract of a biological system containing the NS5B protein with a solid matrix possessing a diethylaminoethyl (DEAE) moiety as a functional group in a salt-containing buffer solution;
ii) removing said NS5B protein from said solid matrix and further contacting said protein with a solid matrix comprising heparin as a functional group;
iii) exposing said heparin matrix containing bound NS5B protein to a buffer solution of continuously increasing levels of salt;
iv) collecting NS5B protein-containing fractions and contacting said collected fractions with a solid matrix containing Cibacron Blue as a functional group;
v) exposing said Cibacron Blue matrix containing bound NS5B protein to a buffered solution containing increasing levels of salt; and vi) collecting said enriched NS5B-containing fractions.
112. A method of generating an infectious viral vector, comprising incorporating a hepatitis C virus NS5B nucleic acid selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7 into said viral vector.
113. A method as claimed in claim 112, wherein said nucleic acid sequence is altered as set forth in Table 6.
114. A method of generating an infectious viral vector comprising substituting an HCV NS5B homologous gene sequence derived from any HCV sequence with a hepatitis C virus NS5B nucleic acid selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID
NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7 in said viral vector.
115. A method as claimed in claim 114, wherein said nucleic acid sequence is altered as set forth in Table 6.
116. A host animal comprising a nucleic acid sequence selected from the group consisting of SEQ ID
NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ ID
NO:6, and SEQ ID NO: 7, natural allelic variants, mutants and derivatives of SEQ ID NO:1, SEQ ID NO:3, SEQ
ID NO:4, SEQ ID NO: 5, SEQ ID NO:6, and SEQ ID NO: 7 and nucleic acids modified as set forth in Table 6.
117. A method of isolating antibodies to HCV NS5B
protein comprising screening a human or murine antibody library for reactivity to NS5B proteins having a sequence selected from the group consisting of SEQ ID
NO: 2, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID
NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13 and a modified NS5B protein as set forth in Tables 4 and 5, and selecting a clone from said library which expresses the reactive antibody and isolating said clone.
118. A method for propagating HCV in an in vitro system comprising culturing a cell line in which functional HCV NS5B sequences are provided, said sequences being selected from the group consisting of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5, SEQ
ID NO:6, and SEQ ID NO: 7, natural allelic variants, mutants and derivatives of SEQ ID NO:1, SEQ ID NO:3, SEQ
ID NO:4, SEQ ID NO: 5, SEQ ID NO:6, and SEQ ID NO: 7 and nucleic acids modified as set forth in Table 6, under conditions that facilitate the replication of HCV.
119. A method for infecting a cell culture with hepatitis C virus comprising administering a viral vector which is generated as claimed in claim 112.
120. A method for infecting an animal with hepatitis C virus comprising administering a viral vector which is generated as claimed in claim 112.
121. A method of propagating hepatitis C virus in vitro comprising:
i) contacting a cell line with a functional HCV NS5B protein consisting essentially of a sequence selected from the group consisting of SEQ ID NO: 2, SEQ
ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and SEQ ID NO: 13; and ii) said cell line being further contacted with an HCV nucleic acid.
122. A method as claimed in claim 121, wherein said NS5B protein has been modified as set forth in Tables 4 and 5 123. A method as claimed in claim 121, wherein the amino acid residues at positions +1 and +2 in said NS5B protein may be any amino acid.
124. A method according to claim 121 wherein said NS5B nucleic acid is provided within a hepatitis C virus replicon.
125. A method of propagating hepatitis C virus in a living host, comprising:
i) delivering a nucleic acid encoding a hepatitis C virus NS5B protein having a sequence selected from the group consisting SEQ ID NO: 2, SEQ ID
NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ
ID NO: 12, and SEQ ID NO: 13 to a living host, said nucleic acid encoding a functional NS5B protein and being operably linked to an expression operon; and ii) contacting said living host with an HCV
molecule selected from the group consisting of HCV
particles, HCV nucleic acids, and HCV replicons.
126. A method as claimed in claim 125, wherein said NS5B encoding nucleic acid is altered as set forth in Table 6.
127. A method as claimed in claim 125, wherein said nucleic acid is delivered to said host via a process selected from the group consisting of transformation, transfection, transduction, transgenetics, surgically or by physical bombardment with nucleic acid-coated particles.
128. A method according to claim 125 wherein said NS5B encoding nucleic acid of step i) is provided within a replicon.
129. A kit for detecting the presence of HCV
nucleic acids in a biological sample, comprising:
i) oligonucleotides comprising a sequence set forth in Table I, said oligonucleotides being hybridizable to said HCV encoding nucleic acid;
ii) reaction buffer; and iii) an instruction sheet.
130. A kit as claimed in claim 129, wherein said oligonucleotide contains a tag.
131. A kit for detecting the presence of HCV in a biological sample, comprising:
i) antibodies immunologically specific for HCV proteins;
ii) a solid support with immobilized HCV
antigens as a positive control; and iii) an instruction sheet.
132. A kit as claimed in claim 131, wherein said antibody contains a tag.
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US8050998P | 1998-04-02 | 1998-04-02 | |
US60/080,509 | 1998-04-02 | ||
US9035698P | 1998-06-23 | 1998-06-23 | |
US60/090,356 | 1998-06-23 | ||
PCT/US1999/007404 WO1999051781A1 (en) | 1998-04-02 | 1999-04-02 | Hepatitis c virus ns5b compositions and methods of use thereof |
Publications (1)
Publication Number | Publication Date |
---|---|
CA2325016A1 true CA2325016A1 (en) | 1999-10-14 |
Family
ID=26763614
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA002325016A Abandoned CA2325016A1 (en) | 1998-04-02 | 1999-04-02 | Hepatitis c virus ns5b compositions and methods of use thereof |
Country Status (6)
Country | Link |
---|---|
EP (1) | EP1068362A4 (en) |
JP (1) | JP2002510509A (en) |
AU (1) | AU768177B2 (en) |
CA (1) | CA2325016A1 (en) |
IL (1) | IL138804A0 (en) |
WO (1) | WO1999051781A1 (en) |
Families Citing this family (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6461845B1 (en) * | 1995-09-27 | 2002-10-08 | Emory University | Recombinant hepatitis C virus RNA replicase |
EP1257650A4 (en) * | 1999-11-23 | 2004-03-24 | Viropharma Inc | Polymerase compositions and methods of use thereof |
CA2389691A1 (en) | 2000-04-07 | 2001-10-18 | Shionogi & Co., Ltd. | A pre-incubation method for an assay of an inhibitor to an hcv rna-dependent rna polymerase |
EP1283267A4 (en) * | 2000-05-15 | 2004-05-12 | Tokyo Metropolitan Org Med Res | Vector for analysing replication mechanism of rna virus and use thereof |
WO2002070739A2 (en) * | 2001-03-08 | 2002-09-12 | Boehringer Ingelheim (Canada) Ltd | Assay for identifying inhibitors of the rna dependent rna polymerase (ns5b) of hcv |
EP1256628A3 (en) * | 2001-05-10 | 2003-03-19 | Agouron Pharmaceuticals, Inc. | Hepatitis c virus (hcv) ns5b rna polymerase and mutants thereof |
US7329732B2 (en) | 2004-01-09 | 2008-02-12 | Merck & Co., Inc. | HCV RNA-dependent RNA polymerase |
EP2236624B1 (en) * | 2007-08-09 | 2012-11-07 | Federalnoe Gosudarstvennoe Byudzhetnoe Uchrezhdenie Nauki Institut Molekulyarnoi Biologi Im. V.A. Engelgardta Rossiiskoi Akademii Nauk | Method for identifying the genotype and subtype of hepatitis c virus on a biological microchip |
Family Cites Families (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5372928A (en) * | 1989-09-15 | 1994-12-13 | Chiron Corporation | Hepatitis C virus isolates |
WO1991015575A1 (en) * | 1990-04-04 | 1991-10-17 | Chiron Corporation | Hepatitis c virus protease |
IT1278077B1 (en) * | 1995-05-25 | 1997-11-17 | Angeletti P Ist Richerche Bio | METHODOLOGY TO REPRODUCE IN VITRO THE ACTIVITIES OF RNA-DEPENDENT RNA POLYMERASE AND OF TERMINAL NUCLEOTIDYLTRANSPHERASE CODED BY THE |
US5981247A (en) * | 1995-09-27 | 1999-11-09 | Emory University | Recombinant hepatitis C virus RNA replicase |
-
1999
- 1999-04-02 WO PCT/US1999/007404 patent/WO1999051781A1/en not_active Application Discontinuation
- 1999-04-02 CA CA002325016A patent/CA2325016A1/en not_active Abandoned
- 1999-04-02 EP EP99921379A patent/EP1068362A4/en not_active Withdrawn
- 1999-04-02 AU AU38610/99A patent/AU768177B2/en not_active Ceased
- 1999-04-02 IL IL13880499A patent/IL138804A0/en unknown
- 1999-04-02 JP JP2000542492A patent/JP2002510509A/en active Pending
Also Published As
Publication number | Publication date |
---|---|
JP2002510509A (en) | 2002-04-09 |
EP1068362A1 (en) | 2001-01-17 |
IL138804A0 (en) | 2001-10-31 |
EP1068362A4 (en) | 2005-07-20 |
WO1999051781A9 (en) | 2000-05-04 |
WO1999051781A1 (en) | 1999-10-14 |
AU768177B2 (en) | 2003-12-04 |
AU3861099A (en) | 1999-10-25 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
You et al. | Hepatitis C virus core protein interacts with cellular putative RNA helicase | |
ES2298585T3 (en) | NS3 HCV PROTEASA INHIBITORS RESISTANT. | |
EP0998585B1 (en) | Screening methods using an atpase protein from a virus of the flaviviridae family | |
US20070184469A1 (en) | Attenuated flavivirus strains containing a mutated m-ectodomain and their applications | |
EP2029741A2 (en) | A rapid method to determine inhibitor sensitivity of ns3/4a protease sequences cloned from clinical samples | |
CN1125877C (en) | hepatitis G virus and molecular cloning thereof | |
US20040110126A1 (en) | Hcv polymerase inhibitor assay | |
AU768177B2 (en) | Hepatitis C virus NS5B compositions and methods of use thereof | |
US20020081574A1 (en) | Methods for identifying inhibitors of helicase C virus | |
US20070160629A1 (en) | Purified active HCV NS2/3 protease | |
Marín et al. | ATP binding and ATPase activities associated with recombinant rabbit hemorrhagic disease virus 2C-like polypeptide | |
JPH07503230A (en) | Drugs for the treatment of papillomavirus diseases | |
US20080187903A1 (en) | HCV RNA-dependent RNA polymerase | |
US20150072418A1 (en) | Hcv genotype 4d replicons | |
US7141405B2 (en) | Chimeric GB virus B (GBV-B) | |
CA2120499A1 (en) | Methods and compositions for identifying inhibitors of papilloma virus replication | |
WO2001038538A1 (en) | Polymerase compositions and methods of use thereof | |
JP2003526361A (en) | HCV NS2 / 3 fragment and use thereof | |
US20010034019A1 (en) | Chimeric HCV/GBV-B viruses | |
AU2002244566B2 (en) | Assay for identifying inhibitors of the RNA dependent RNA polymerase (NS5B) of HCV | |
JP5607528B2 (en) | Nucleic acids found in the blood of hepatitis patients, polypeptides encoded by them and their use | |
JPH05192160A (en) | C type hepatitis virus genome rna, cdna and polypeptide | |
JP4710001B2 (en) | Tick leucine aminopeptidase | |
KR100946170B1 (en) | Pharmaceutical composition for prevention and treatment of Hepatitis C Virus-mediated liver disease | |
WO1999043792A1 (en) | Recombinant protein having rna-dependent polymerase activity of human hepatitis c virus and process for producing the same |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
EEER | Examination request | ||
FZDE | Discontinued |