CA2153162A1 - New polypeptides having serotoninergic receptor activity, nucleic acids coding therefor and uses thereof - Google Patents
New polypeptides having serotoninergic receptor activity, nucleic acids coding therefor and uses thereofInfo
- Publication number
- CA2153162A1 CA2153162A1 CA002153162A CA2153162A CA2153162A1 CA 2153162 A1 CA2153162 A1 CA 2153162A1 CA 002153162 A CA002153162 A CA 002153162A CA 2153162 A CA2153162 A CA 2153162A CA 2153162 A1 CA2153162 A1 CA 2153162A1
- Authority
- CA
- Canada
- Prior art keywords
- polypeptide
- sequence
- leu
- polypeptides
- ala
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70571—Receptors; Cell surface antigens; Cell surface determinants for neuromediators, e.g. serotonin receptor, dopamine receptor
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/94—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving narcotics or drugs or pharmaceuticals, neurotransmitters or associated receptors
- G01N33/9406—Neurotransmitters
- G01N33/942—Serotonin, i.e. 5-hydroxy-tryptamine
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Hematology (AREA)
- Cell Biology (AREA)
- Urology & Nephrology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biotechnology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Zoology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- Microbiology (AREA)
- Neurology (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Description
Wo 94/18319 215 316 2 PCT/FR94/00136 NOUVEAUX POLYPEPTIDES AYANT UNE ACTIV~TE DE REC~;r~ JR
SEROTONINERGIQUE. ACIDES NUCLEIQUES CODANT POUR CES
POLYPEPTIDES ET UTILJSATIONS
La présente invention concerne de nouveaux polypeptides et le matériel 5 génétique permettant leur expression. Plus particulièrement, elle concerne de nouveaux polypeptides ayant une activité de récepteur sérotoninergique.
La sérotonine est un neuromodulateur capable d'induire et de moduler une grande variété de comportements tels que le sommeil, I'appétit, la locomotion, l'activité sexuelle ou encore la contraction vasculaire. Il est admis que l'activité de la 0 sérotonine est médiée par son interaction avec des récepteurs, désignés récepteurs sérotoninergiques ou récepteurs 5-HT (pour 5-hydroxyllyptamine). Des études de biologie moléculaire ainsi que des études pharmacologiques ont révélé qu'il existait un grand nombre de sous-types de récepteurs 5-HT. Les récepteurs 5-HT qui ont été
décrits jusqu'à aujourd'hui appartiennent soit à la famille des récepteurs liés à des 15 canaux ioniques (récepteurs 5-HT3), soit à la famille des récepteurs qui interagissent avec des protéines G et qui pos~èclçnt sept domaines tMnsmembranaires. Par ailleurs, l'analyse des séquences d'acides aminés a montré que les récepteurs 5-HT
interagissant avec des protéines G peuvenl être sous-divisés en deux groupes distincts: Les récepteurs 5HT1, comprenant les sous-types m~mmifères 5HTlA, 20 5HTlB et 5HTlD ainsi que trois récepteurs 5HT de drosophile; et les récepteurs 5HT2 comprenant les sous-types 5HT2 et 5HTlC.
Ces récepteurs ne sont sans doute pas les seuls récepteurs 5HT existant, dans la mesure où des études pharmacologiques ont révélé d'autres sous-types tels que les récepteurs 5HT4 ainsi que certains récepteurs apparentés au sous-type 5HTI
25 (récepteurs "5HTI like"). De plus, des études supplémentaires de biologie moléculaire ont également révélé des hétérogénéités au sein des sous-types 5HT1 B/lD.
La présente invention résulte de la mise en évidence de nouveaux polypeptides ayant une activité de récepteur sérotoninergique. Bien qu'appartenant à
30 la famille des récepteurs qui interagissent avec des protéines G, ces nouveaux polypeptides diffèrent des récepteurs sérotoninergiques déjà décrits (5HT1, 5HT2, 5HT3 et 5HT4) du point de vue structural comme du point de vue pharmacologique.
Plus particulièrement, I'invention résulte de l'isolement et de la caractérisation de ces .
2l53l6~ 2 nouveaux polypeptides, désignés 5HTSb, ainsi que du matériel génétique permettant leur expression ou leur identification.
Un premier objet de l'invention réside donc dans des polypeptides comprenant tout ou partie de la séquence peptidique SEQ ID n 2 ou d'un dérivé de 5 celle-ci.
Au sens de la présente invention, le terme dérivé désigne toute molécule obtenue par modification de nature génétique et/ou chimique de la séquence peptidique SEQ ID n 2. Par modification de nature génétique et/ou chimique, on peut entendre toute mutation, substitution, délétion, addition et/ou modification d'un 10 ou plusieurs résidus. De tels dérivés peuvent être générés dans des buts différents, tels que notamment celui d'augmenter l'affinité du peptide pour son(ses) ligand(s), celui d'améliorer ses niveaux de production, celui d'~ugmenter sa résistance à des protéases, celui d'augmenter et/ou de modifier son activité, ou celui de lui conférer de nouvelles propriétés pharmacocinétiques et/ou biologiques. Parmi les dérivés 15 résultant d'une addition, on peut citer par exemple les polypeptides chimèrescomportant une partie hétérologue supplémentaire liée à une extrêmité. Le terme dérivé col,lprelld également les polypeptides homologues au polypeptide SEQ ID
n 2, issus d'autres sources cellulaires et not~mment de cellules d'origine humaine, ou d'autres organismes, et possédant une activité de même type. De tels polypeptides 20 homologues peuvent être obtenus par des expériences d'hybridation comme décrit dans les exemples.
Préférentiellement, les polypeptides de l'invention sont des polypeptides possédant la capacité de lier la sérotonine. Encore plus préférentiellement, il s'agit de polypeptides ayant une activité de récepteur sérotoninergique. Toujours selon un25 mode préféré, les polypeptides de l'invention sont susceptibles d'être reconnus par des anticorps reconnaissant la séquence peptidique SEQ ID n 2 complète.
Un mode de réalisation particulier de l'invention est représenté par le polypeptide 5HT5b comprenant toute la séquence peptidique SEQ ID n 2. Comme indiqué dans les exemples, ce polypeptide peut être exprimé dans différents types 30 cellulaires pour forrner un récepteur sérotoninergique fonctionnel.
Les polypeptides de l'invention peuvent être obtenus par expression dans un hôte cellulaire d'une séquence nucléotidique telle que décrite ci-dessous, par synthèse ` 2153162 ,.
chimique, sur la base de la séquence SEQ ID n 2 en utili.c~nt les techniques connues de l'homme du métier, ou par une combinaison de ces techniques.
Dans ce qui suit, les polypeptides de l'invention tels que définis ci-dessus sont désignés par polypeptides 5HTSb.
La présente invention a également pour objet toute séquence nucléotidique codant pour un polypeptide SHTSb. Plus prérelt:nliellement, il s'agit d'une séquence choisie parmi:
(a) tout ou partie de la séquence nucléotidique SEQ ID n 1 ou de son brin complémentaire, ]0 (b) toute séquence hybridant avec une séquence (a) et codant pour un polypeptide tel que défini précédemment, et, (c) les séquences dérivées des séquences (a) et (b) en raison de la dégénérescence du code génétique.
Les différentes séquences nucléotidiques de l'invention peuvent être S d'origine artificielle ou non. Il peut s'agir de séquences génomiques, d'ADNc, d'ARN, de séquences hybrides ou de séquences synthétiques ou semi-synthétiques. Ces séquences peuvent être obtenues par exemple par criblage de banques d'ADN (banque d'ADNc, banque d'ADN génomique) au moyen de sondes élaborées sur la base de la séquence SEQ ID n 1. De telles banques peuvelll être préparées à partir de cellules de différentes origines par des techniques classiques de biologie moléculaire connues de l'homme du métier. Les séquences nucléotidiques de l'invention peuvent également être préparées par synthèse chimique, notamment selon la méthode des phosphoramidites, ou encore par des méthodes mixtes incluant la modification chimique ou enzymatiqe de séquences obtenues par criblage de banques. Wo 94/18319 215 316 2 PCT / FR94 / 00136 NOVEL POLYPEPTIDES HAVING REC ACTIVITY; JR
SEROTONINERGIC. NUCLEIC ACIDS ENCODING THESE
POLYPEPTIDES AND UTILJSATIONS
The present invention relates to novel polypeptides and to the material 5 genetics allowing their expression. More particularly, it relates to new polypeptides having serotonergic receptor activity.
Serotonin is a neuromodulator capable of inducing and modulating a wide variety of behaviors such as sleep, appetite, locomotion, sexual activity or even vascular contraction. It is recognized that the activity of the 0 serotonin is mediated by its interaction with receptors, designated receptors serotonergic or 5-HT receptors (for 5-hydroxyllyptamine). Studies of molecular biology as well as pharmacological studies revealed that it existed a large number of 5-HT receptor subtypes. 5-HT receptors that have been described until today belong either to the family of receptors linked to 15 ion channels (5-HT3 receptors), i.e. to the family of interacting receptors with proteins G and which pos ~ èclçnt seven domains tMnsmembranaires. Otherwise, amino acid sequence analysis has shown that 5-HT receptors interacting with G proteins can be subdivided into two groups distinct: 5HT1 receptors, comprising the m ~ mmiferous 5HTlA subtypes, 5HTlB and 5HTlD as well as three 5HT Drosophila receptors; and the receptors 5HT2 including the 5HT2 and 5HTlC subtypes.
These receptors are probably not the only 5HT receptors existing in the extent to which pharmacological studies have revealed other subtypes such as 5HT4 receptors as well as certain receptors related to the 5HTI subtype 25 ("5HTI like" receptors). In addition, additional biology studies also revealed heterogeneities within subtypes 5HT1 B / lD.
The present invention results from the discovery of new polypeptides having serotonergic receptor activity. Although belonging to 30 family of receptors that interact with G proteins, these new polypeptides differ from the serotonergic receptors already described (5HT1, 5HT2, 5HT3 and 5HT4) from the structural point of view as from the pharmacological point of view.
More particularly, the invention results from the isolation and characterization of these .
2l53l6 ~ 2 new polypeptides, designated 5HTSb, as well as genetic material allowing their expression or their identification.
A first object of the invention therefore resides in polypeptides comprising all or part of the peptide sequence SEQ ID No. 2 or of a derivative of 5 this one.
Within the meaning of the present invention, the term derivative designates any molecule obtained by modification of genetic and / or chemical nature of the sequence peptide SEQ ID n 2. By modification of a genetic and / or chemical nature, we may hear any mutation, substitution, deletion, addition and / or modification of a 10 or more residues. Such derivatives can be generated for different purposes, such as that in particular that of increasing the affinity of the peptide for its ligand (s), that to improve its production levels, that of increasing its resistance to proteases, that of increasing and / or modifying its activity, or that of giving it new pharmacokinetic and / or biological properties. Among the derivatives Resulting from an addition, mention may, for example, be made of chimeric polypeptides comprising an additional heterologous part linked at one end. The term derivative col, lprelld also polypeptides homologous to the polypeptide SEQ ID
n 2, from other cellular sources, including cells of human origin, or other organisms, and having an activity of the same type. Such polypeptides 20 homologs can be obtained by hybridization experiments as described in the examples.
Preferably, the polypeptides of the invention are polypeptides possessing the ability to bind serotonin. Even more preferably, it is about polypeptides having serotonergic receptor activity. Still according to a preferred mode, the polypeptides of the invention are capable of being recognized by antibody recognizing the complete SEQ ID n 2 peptide sequence.
A particular embodiment of the invention is represented by the 5HT5b polypeptide comprising the entire peptide sequence SEQ ID No. 2. As indicated in the examples, this polypeptide can be expressed in different types 30 cells to form a functional serotonergic receptor.
The polypeptides of the invention can be obtained by expression in a cellular host of a nucleotide sequence as described below, by synthesis `2153162 ,.
chemical, based on the sequence SEQ ID n 2 using utili.c ~ nt known techniques skilled in the art, or a combination of these techniques.
In the following, the polypeptides of the invention as defined above are designated by 5HTSb polypeptides.
The present invention also relates to any nucleotide sequence encoding a SHTSb polypeptide. More pre -elt: it is a sequence chosen from:
(a) all or part of the nucleotide sequence SEQ ID n 1 or its strand complementary, ] 0 (b) any sequence hybridizing with a sequence (a) and coding for a polypeptide as defined above, and, (c) the sequences derived from the sequences (a) and (b) due to the degeneration of the genetic code.
The different nucleotide sequences of the invention can be S of artificial origin or not. It can be genomic sequences, cDNA, RNA, hybrid sequences or synthetic or semi-synthetic sequences. These sequences can be obtained for example by screening of DNA libraries (library cDNA, genomic DNA bank) using probes developed on the basis of sequence SEQ ID No. 1. Such libraries can be prepared from cells from different origins by known classical molecular biology techniques of the skilled person. The nucleotide sequences of the invention can also be prepared by chemical synthesis, in particular according to the method of phosphoramidites, or by mixed methods including modification chemical or enzymatic sequence obtained by screening libraries.
2~ Les séquences nucléotidiques de l'invention peuvent être utilisées pour la production des polypeptides 5HT5b tels que définis précédemment. Dans ce cas, lapartie codant pour ledit polypeptide est généralement placée sous le contrôle designaux permettant son expression dans un hote cellulaire. Le choix de ces signaux (promoteurs, terminateurs, etc) peut varier en fonction de l'hôte cellulaire utilisé. A
cet effet, les séquences nucléotidiques de l'invention peuvent faire partie d'un vecteur, qui peut être à réplication autonome ou intégratif. Plus particulièrement, des vecteurs à réplication autonome peuvent etre préparés en utilisant des séquences à réplication autonome chez l'hôte choisi. S'agissant des vecteurs intégratifs, ceux-ci peuvent être Wo 94/18319 ; PCTIFR94/00136 21~3162 4 ~répalés par exemple en utili.c~nt des séquences homologues à certaines régions du génome de l'hôte, permettant, par recombinaison homologue, l'intégration du vecteur.
Les hôtes cellulaires utilisables pour la production des polypeptides 5HT5b de l'invention par voie recombinante sont aussi bien des hôtes eucaryotes que 5 procaryotes. Parmi les hôtes eucaryotes qui conviennent, on peut citer les cellules animales, les levures, ou les champignons. En particulier, s'~i.c.~nt de levures, on peut citer les levures du genre Saccharomyces, Kluyveromyces, Pichia, Schwanniomyces, ou l~ansenula. S'Agi.cs~nt de cellules animales, on peut citer les cellules COS, CHO, C127, NIH-3T3, etc. Parmi les champignons, on peut citer plus10 particulièrement Aspergill~ls ssp. ou Trichoderma ssp. Comme hôtes procaryotes, on préfère utiliser les bactéries suivantes E.coli, Bacillus, ou Streptomyces.
Les séquences nucléotidiques de la présente invention sont également utilisables dans le domaine pharmaceutique, soit pour la réalisation de séquences antisens utilisables dans le cadre d'une thérapie génique, soit encore pour la 15 réalisation de sondes permettant la détection, par des expériences d'hybridation, de l'expression de récepteurs sé~oloninergiques dans des éch~ntil1Ons biologiques et la mise en évidence d'anomalies génétiques (polymorphisme, mutations) ou d'expressions aberrantes.
L'inhibition de l'expression de certains gènes par des oligonucléotides 20 antisens s'est avérée être une stratégie prometteuse dans le contrôle de l'activité d'un gène. Les oligonucléotides ~nti~n.~ sont des oliogonucléotides de petite taille,complémentaires d'un ARNm, et de ce fait capables d'hybrider spécifiquement aveccelui-ci, inhibant sa traduction en protéine. L'invention a ainsi pour objet lesoligonucléotides antisens capables d'inhiber au moins partiellement la production de 2~ polypeptides SHT5b tels que définis précédemment. L'invention concerne également les séquences antisens capables d'inhiber au moins partiellement la production de polypeptides 5HT5b. Les séquences antisens produisent dans la cellule cible des transcrits qui sont complémentaires d'ARNm cellulaires. De tels oligonucléotides ou séquences peuvent être constitués par tout ou partie des séquences nucléotidiques 30 définies ci-avant. Il s'agit généralement de séquences ou de fragments de séquences complémentaires de séquences codant pour des peptides de l'invention. De tels oligonucléotides peuvent être obtenus à partir de la séquence SEQ ID n 1, par fragmentation ou par svnthèse chimique, etc.
WO 94/18319 215 316 2 PCT/F~94/00136 Comme indiqué ci-dessus, l'invention perrnet également la réalisation de sondes nucléotidiques, synthétiques ou non, capables de s'hydrider avec les séquences nucléotidiques définies ci-avant qui codent pour des polypeptides 5HT5b de l'invention, ou avec les ARNm correspondant. De telles sondes peuvent être ~Itiliseçs 5 in vitro comme outil de diagnostic, pour la détection de l'expression d'un récepteur sérotoninergique 5HT5b, ou encore pour la mise en évidence d'anomalies génétiques (mauvais épissage, polymorphisme, mutations pon~-t~l~lles, etc). ~ompte tenu desactivités multiples de la sérotonine, les sondes de l'invention peuvent ainsi permettre d'identifier des affections neurologique, cardiovasculaire ou psychiatrique comme 0 étant liées aux récepteurs 5HT5b. Ces sondes peuvent également être utili!;;ee.s pour la mise en évidence et l'isolement de séquences d'acides nucléiques homologues codant pour des polypeptides 5HT5b tels que définis précédemment, à partir d'autres sources cellulaires et préférentiellement de cellules d'origines hl-m~in~c~ Les sondes de l'invention comportent généralement au moins 10 bases, et elles peuvent comporter jusqu'à l'intégralité de la séquence SEQ ID n 1 ou de son brin complement~ire.
Préférentiellement, ces sondes sont, préalablement à leur utilisation, marquées. Pour cela, différentes techniques connues de l'homme du métier peuvent être employées(marquage radioactif, enzymatique, etc). Les conditions d'hybridation dans lesquelles ces sondes peuvent être utilisées sont indiquées dans les techniques générales de clonage ci-après ainsi que dans les exemples.
Un autre objet de l'invention concerne les cellules recomhin~es capables d'exprimer à leur surface un polypeptide 5HT5b tel que défini ci-avant. Ces cellules peuvent être obtenues par introduction d'une séquence nucléotidique telle que définie ci-dessus codant pour un polypeptide de l'invention, puis culture desdites cellules dans des conditions d'expression de ladite séquence.
Les cellules recombinées selon l'invention peuvent être aussi bien des cellules eucaryotes que procaryotes. Parmi les cellules eucaryotes qui conviennent, on peut citer les cellules animales, les levures, ou les champignons. En particulier, s'agissant de levures, on peut citer les levures du genre Saccharomyces, Kluyl~el-ol1lyces, Pichia, Sch~anniom~ces, ou Hansenula. S'agissant de cellules animales, on peut citer les cellules COS, CHO, C127, NIH-3T3, etc. Parmi les champignons, on peut citer plus particulièrement Aspergillus ssp. ou Trichodermassp. Comme cellules procaryotes, on préfère utiliser les bactéries suivantes E.coli, Bacillus, ou Streptomvces. Les cellules ainsi obtenues peuvent être utili~ées pour mesurer la capacité de différentes molécules à se comporter comme ligand ou comme WO 94/18319 PCTIF~94/00136 ~ls3l62 modulateur de l'activité des polypeptides de l'invention. Plus particulièrement, elles peuvent ainsi être utilisées dans un procédé de mise en évidence et d'isolement de ligands ou de modulateur de l'activité des polypeptides de l'invention, et, pluspréférentiellement, d'agonistes et d'antagonistes de la sélotc,nine.
S Un autre objet de l'invention concerne donc un procédé de mise en évidence et/ou d'isolement de ligands des polypeptides 5HT5b de l'invention, selon lequel on réalise les étapes suivantes:
- on met en contact une molécule ou un mélange cont~n~nt différentes molécules, éventuellement non-identifiées, avec une cellule recombinée telle quedécrite ci-dessus exprimant à sa surface un polypeptide de l'invention dans des conditions permettant l'interaction entre ledit polypeptide de l'invention et ladite molécule dans le cas où celle-ci possèderait une affinité pour ledit polypeptide, et, - on détecte et/ou isole les molécules liées au dit polypeptide de l'invention.
Dans un mode particulier, ce procédé de l'invention est adapté à la mise en évidence et/ou l'isolement d'agonistes et d'antagonistes de la sérotonine pour les polypeptides 5HT5b.
Un autre objet de l'invention concerne un procédé de mise en évidence et/ou d'isolement de modulateurs des polypeptides 5HT5b de l'invention, selon lequel on réalise les étapes suivantes:
- on met en contact une molécule ou un mélange contenant différentes molécules, éventuellement non-identifiées, avec une cellule recombinée telle quedécrite ci-dessus exprimant à sa surface un polypeptide de l'invention, en présence de 5HT, dans des conditions permettant l'interaction entre ledit polypeptide de l'invention et le SHT, et, - on détecte et/ou isole les molécules capables de moduler l'activité du 5HT
sur ledit polypeptide de l'invention.
Un autre objet de l'invention concerne l'utilisation d'un ligand ou d'un modulateur identifié et/ou obtenu selon le procédé décrit ci-avant comme médicament. De tels ligands ou modulateurs peuvent en effet permettre de traitercertaines affections neurologique, cardiovasculaire ou psychiatrique liées aw;
récepteurs 5HT5b.
L'invention concerne également tout médicament comprenant comme principe actif au moins une molécule agissant sur un polypeptide 5HT5b de WO 94/18319 PCT/FRs4100136 ` 2153162 7 ~ ~
l'invention. Préférentiellement la molécule est un ligand ou un m~ll~late~r identifié
et/ou isolé selon le procédé décrit précédernment.
D'autres avantages de la présente invention app~î1roll~ à la lecture des exemples qui suivent, qui doivent être considérés comme illustratifs et non limitatifs.
5 Légende des fi~ures Table l: Profil pharmacologique du récepteur SHT5b. Les résultats correspondent à
des expériences de compétition pour la liaison du [125I]-LSD aux membranes des cellules Cos-7 exprimant le récepteur 5HT5b. Les valeurs d'ICS0 (correspondant à la concentration en ligand nécessaire pour déplacer S0 5~o du [125I]-LSD lié) ont été
o calculées expérimentalement et converties en Ki selon l'équation suivante: Ki =
IC50/(1 + C/Kd) dans laquelle C est la concentration en [125I]-LSD (150 pM) et Kd est la constante de dissociation du [125I]-LSD. Les nombres entre parenthèses correspondent au nombre d'expériences indép~nli~ntes ré~ é~s, chaque point éta~nt réalisé en triple.
15 Table 2: Pourcentages d'homologie de séquence peptidique entre le récepteur SHT5b (SEQ ID n 2) et d'autres récepteurs de la famille des récep1eul~ couplés à des protéines G. Les homologies ont été calculées sur les séquences conse1vées: le domaine transmembranaire et ses boucles de connection.
Fi~ure ]: Courbe de saturation du [125I]-LSD aux membranes des cellules Cos-7 20 exprimant le récepteur 5HT5b. Les membranes ont été incubées avec des concentrations de ligand allant de 50 pM à 1,25 nM, avec ou sans 10 ~I de 5HT. La liaison spécifique est représentée. L'encart représente l'analyse en Scatchard des résultats.
Techniques ~énérale.s de clona~e Les méthodes classiquement utilisées en biologie moléculaire telles que les extractions préparatives d'ADN plasmidique, la centrifugation d'ADN plasmidique en gradient de chlorure de césium, I'électrophorèse sur gels d'agarose ou d'acrylamide, la purification de fragments d'ADN par électroélution, les extractions de protéines au phénol ou au phénol-chloroforme, la précipitation d'ADN en milieu salin par de l'éthanol ou de l'isopropanol, la transformation dans Escherichia coli, etc, sont bien connues de l'homme de métier et sont abondament décrites dans la littérature wo 94/l83l9 PCT/FR94/00l36 21531''62'' 8 [Maniatis T. et al., "Molecular Cloning, a Labo.~toly Manual", Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y., 1982; Ausubel F.M. et al. (eds), "Current Protocols in Molecular Biology", John Wiley & Sons, New York, 1987].
Les enzymes de restriction ont été fournies par New England Biolabs (Biolabs), Bethesda Research Laboratories (BRL) ou Amersham et sont utili.~ees selon les recommandations des fournisseurs.
Pour les ligatures, les fragments d'ADN sont séparés selon leur taille par électrophorèse en gels d'agarose ou d'acrylamide, extraits au phénol ou par un mélange phénol/chloroforme, pleci~ilés à l'éthanol puis incubés en présence de o l'ADN ligase du phage T4 (Biolabs) selon les recommandations du fournisseur.
Le remplissage des extrémités 5' proéminentes est effectué par le fragment de Klenow de l'ADN Polymérase I d'E. coli (Biolabs) selon les spécifications du fournisseur. La destruction des e~lre.l,ilés 3' pr~éminentes est effectuée en présence de l'ADN Polymérase du phage T4 (Biolabs) utilisée selon les recomm~ndations du fabricant. La destruction des e~lllilés 5' proéminentes est effectuée par un traitement ménagé par la nucléase S1.
La mutagénèse dirigée in vitro par oligodéoxynucléotides synthétiques est effectuée selon la méthode développée par Taylor et al. [Nucleic Acids Res. 13 (1985) 8749-8764] en utilisant le kit distribué par Amersham.
L'amplification enzymatique de fragments d'ADN par la technique dite de PCR [~olymérase-catalyzed _hain Beaction, Saiki R.K. et al., Science ~ (1985) 1350-1354; Mullis K.B. et Faloona F.A., Meth. Enzym. 155 (1987) 335-350] est effectuée en utili~s~nt un "DNA thermal cycler" (Perkin Elmer Cetus) selon les spécifications du fabricant.
La vérification des séquences nucléotidiques est effectuée par la méthode développée par Sanger et al. [Proc. Natl. Acad. Sci. USA, 74 (1977) 5463-5467] en utilisant le l~it distribué par Amersham.
Pour les expériences d'hybridation, les conditions de stringence normales sont généralement les suivantes: hybridation: 3 x SCC en présence de 5 x Denhart's à
65C; lavage: 0,5 x SSC à 65C.
1. Isolement du récepteur 5HT5b Les comparaisons de séquences entre les différents récepteurs sérotoni-nergiques connus font apparaître une certaine conservation, particulièrement dans certaines régions transmembranaires potentielles telles que les domaines III et VI.
WO 94/18319 PCT/Fl~g4/00l36 - 21~3162 :
q Dans le but de mettre en évidence et d'isoler un nouveau récepteur, trois oligonucléotides dégénérés correspondant à ces deux régions ont été préparés, puis utilisés dans une série de réactions de PCR sur une préparation d'ARN de cerveau de souris. La séquence des oligonucléotides dégénérés est la suivante:
5 Oligonucléotide (i) AGAACTAGTGGATCCAA(A/G)AA(A/G/C/T)GG(A/G/C~r)A(A/G)CCA(A/G)CA
Oligonucléotide (ii) Cl~GATATCGAAl-rCGA(T/C) (A/G)T(A/G/C~r)CT(A/G/C/T)TG (C/T)TG (C/T)A
C
0 Oligonucléotide (iii) GGTATCGATAAGCl-rAT(C/T/A)GC(C~r)CT(A/G/C/T)GA(C/T) (C/A)G(A/G/C/
T)TA
Les réactions de PCR ont été réalisées de la manière suivante: 5 ~g d'ARN
de cerveau de souris adulte ont été soumis à une réaction de transcription inverse en présence de 500 ng d'oligonucléotide (i) et de 200 unités de transcriptase inverse MMLV (BRL). La moitié du produit de cette réaction a ensuite été soumise à 30 cycles d'amplification en présence de 5 unités de polymérase Taq (Cetus) et de 1 llg d'oligonucléotide (i) et d'oligonucléotide (ii). 1/20e du produit de cette réaction a ensuite été soumis à 30 cycles d'amplification supplémentaires en présence des oligonucléotides (i) et (iii). Les produits ainsi obtenus ont été digérés avec les enzymes BamHI et HindIII, insérés aux sites correspondant du pl~mide Bluescript (Stratagène), et séquencés. L'un des fragments ainsi obtenus, présentant une certaine homologie avec les récepteurs sérotoninergiques, a été marqué par "random priming"
(Feinberg et Vogelstein, Analytical Biochemistry 132 (1984) 6) et utilisé comme sonde pour cribler une banque de cDNA de cerveau de souris construite dans le phage UniZap (Stratagène). Parmi les phages positifs obtenus, l'un d'entre-eux, dénommé
~NS et porté par le plasmide pNS, contenait un insert de 2,1 kb. Ce phage a été isolé, et son insert a ensuite été introduit dans le plasmide Bluescript. La séquence de ce fra~gment a été déterminée sur les 2 brins en utilisant la technique des dideoxynucléotides au moyen d'oligonucléotides synthétiques.
Wo 94/l83l9 ~ PCT/~94/00136 215316~ ~o La séquence ainsi obtenue correspond à la séquence SEQ ID n 1. Elle montre que l'ADNc isolé porte une phase de lecture ouverte de 370 acides aminés.Par ailleurs, l'analyse d'hydrophobicité montre que cette protéine porte sept domaines hydrophobes, une particularité rencontrée chez les membres de la famille des 5 récepteurs couplés à des protéines G. L'e~l,emilé N-terminale contient par ailleurs 1 site de N-glycosylation, et le domaine cytoplasmique présumé contient les sites consensus de phosphorylation par les protéines kinases C et A.
Un clone génomique codant pour le récepteur 5HT5b a également été isolé, par criblage d'une banque génomique au moyen de la séquence SEQ ID n 1 comme n sonde. La banque avait été obtenue par digestion partielle par Sau3A de l'ADN
génomique de cellules souches d'embr,von de souris, puis insertion dans le phagelambda EMBL3.
Les fragments obtenus ont été sous clonés dans le pl~cmi~e Bluescript et partiellement séquencés. L'analyse de ces séquences révèle la présence d'un intron, 5 localisé au milieu de la 3ème boucle cytoplasmique.
2. Etude d'homologies de séquence La séquence du récepteur 5HT5b isolé ci-dessus a été comparée avec les séquences des récepteurs couplés à des protéines G suivants: 5HTlB, 5HTlD, 5HT5A, 5HTlA, 5HT-dro2A, 5HT-drol, a2, D2, 131, D1, H2, 5HT1C et 5HT2. Ces 20 expériences ont révélé une certaine homologie dans le domaine transmembranaire potentiel et dans certaines boucles, mais aucune homologie dans les régions terminales ni dans la troisième boucle cytoplasmique. La table 2 donne les %
d'homologie au niveau des régions conservées. 2 ~ The nucleotide sequences of the invention can be used for the production of the 5HT5b polypeptides as defined above. In this case, the part coding for said polypeptide is generally placed under design control allowing its expression in a cell host. The choice of these signals (promoters, terminators, etc.) may vary depending on the cell host used. AT
for this purpose, the nucleotide sequences of the invention can be part of a vector, which can be autonomous or integrative replication. More specifically, vectors Autonomically replicable can be prepared using replicating sequences autonomous at the chosen host. As regards integrative vectors, these can be Wo 94/18319; PCTIFR94 / 00136 21 ~ 3162 4 ~ repeated for example in utili.c ~ nt sequences homologous to certain regions of the host genome, allowing, by homologous recombination, integration of the vector.
The cellular hosts which can be used for the production of the 5HT5b polypeptides the invention by recombinant means are both eukaryotic hosts and 5 prokaryotes. Examples of suitable eukaryotic hosts include cells animals, yeasts, or fungi. In particular, if yeast ~ ic ~ nt mention may be made of yeasts of the genus Saccharomyces, Kluyveromyces, Pichia, Schwanniomyces, or the ansenula. If animal cells are involved, we can cite the COS, CHO, C127, NIH-3T3 cells, etc. Among the mushrooms, there may be mentioned more particularly Aspergill ~ ls ssp. or Trichoderma ssp. As prokaryotic hosts, prefer to use the following bacteria E.coli, Bacillus, or Streptomyces.
The nucleotide sequences of the present invention are also usable in the pharmaceutical field, either for the production of sequences antisense usable in the context of gene therapy, or even for the 15 production of probes allowing the detection, by hybridization experiments, of the expression of se olonergic receptors in biological samples and the highlighting of genetic anomalies (polymorphism, mutations) or outliers.
Inhibition of expression of certain genes by oligonucleotides 20 antisense has proven to be a promising strategy in controlling the activity of a uncomfortable. The oligonucleotides ~ nti ~ n. ~ Are small oliogonucleotides, complementary to an mRNA, and therefore capable of hybridizing specifically with it, inhibiting its translation into protein. The subject of the invention is therefore the antisense oligonucleotides capable of at least partially inhibiting the production of 2 ~ SHT5b polypeptides as defined above. The invention also relates to antisense sequences capable of at least partially inhibiting the production of 5HT5b polypeptides. Antisense sequences produce in the target cell transcripts that are complementary to cellular mRNAs. Such oligonucleotides or sequences can consist of all or part of the nucleotide sequences 30 defined above. These are generally sequences or fragments of sequences complementary to sequences coding for peptides of the invention. Such oligonucleotides can be obtained from the sequence SEQ ID No. 1, by fragmentation or by chemical synthesis, etc.
WO 94/18319 215 316 2 PCT / F ~ 94/00136 As indicated above, the invention also allows the realization of nucleotide probes, synthetic or not, capable of hydriding with the sequences nucleotides defined above which code for 5HT5b polypeptides of the invention, or with the corresponding mRNAs. Such probes can be ~ Itiliseçs 5 in vitro as a diagnostic tool for detecting the expression of a receptor serotonergic 5HT5b, or for the detection of genetic anomalies (bad splicing, polymorphism, pon ~ -t ~ lles mutations, etc.). ~ Taking into account the multiple activities of serotonin, the probes of the invention can thus allow identify neurological, cardiovascular or psychiatric conditions such as 0 being linked to 5HT5b receptors. These probes can also be used for the detection and isolation of homologous nucleic acid sequences encoding for 5HT5b polypeptides as defined above, from other sources cells and preferably cells of hl-m origins ~ in ~ c ~ The probes the invention generally comprises at least 10 bases, and they can comprise up to the entire sequence SEQ ID No. 1 or its complementary strand ~ ire.
Preferably, these probes are, prior to their use, marked. For that, various techniques known to those skilled in the art can be used (radioactive, enzymatic labeling, etc.). The hybridization conditions under which these probes can be used are indicated in the general techniques of cloning below as well as in the examples.
Another object of the invention relates to recomhin ~ es capable cells to express on their surface a 5HT5b polypeptide as defined above. These cells can be obtained by introducing a nucleotide sequence as defined above coding for a polypeptide of the invention, then culturing said cells under conditions of expression of said sequence.
The recombinant cells according to the invention can be either eukaryotic cells than prokaryotic. Among suitable eukaryotic cells are may cite animal cells, yeasts, or fungi. In particular, in the case of yeasts, mention may be made of yeasts of the genus Saccharomyces, Kluyl ~ el-ol1lyces, Pichia, Sch ~ anniom ~ ces, or Hansenula. Regarding cells animal, one can quote the cells COS, CHO, C127, NIH-3T3, etc. From mushrooms, there may be mentioned more particularly Aspergillus ssp. or Trichodermassp. As prokaryotic cells, it is preferred to use the following bacteria E.coli, Bacillus, or Streptomvces. The cells thus obtained can be used for measure the ability of different molecules to behave as ligands or as WO 94/18319 PCTIF ~ 94/00136 ~ ls3l62 modulator of the activity of the polypeptides of the invention. More specifically, they can thus be used in a process for highlighting and isolating ligands or modulator of the activity of the polypeptides of the invention, and, more preferably, of agonists and antagonists of selotc, nine.
Another object of the invention therefore relates to a method of highlighting and / or isolation of ligands of the 5HT5b polypeptides of the invention, according to which performs the following steps:
- we put in contact a molecule or a mixture cont ~ n ~ nt different molecules, possibly unidentified, with a recombinant cell as described above expressing on its surface a polypeptide of the invention in conditions allowing the interaction between said polypeptide of the invention and said molecule in the event that it has an affinity for said polypeptide, and, - Molecules linked to said polypeptide of the invention are detected and / or isolated.
In one particular mode, this method of the invention is suitable for implementing evidence and / or isolation of serotonin agonists and antagonists for 5HT5b polypeptides.
Another subject of the invention relates to a method of highlighting and / or of isolation of modulators of the 5HT5b polypeptides of the invention, according to which performs the following steps:
- we put in contact a molecule or a mixture containing different molecules, possibly unidentified, with a recombinant cell as described above expressing on its surface a polypeptide of the invention, in the presence of 5HT, under conditions allowing the interaction between said polypeptide of the invention and the SHT, and, - molecules and molecules capable of modulating the activity of 5HT are detected and / or isolated on said polypeptide of the invention.
Another subject of the invention relates to the use of a ligand or of a modulator identified and / or obtained according to the process described above as drug. Such ligands or modulators can indeed allow the treatment of certain neurological, cardiovascular or psychiatric disorders linked to;
5HT5b receptors.
The invention also relates to any medicament comprising as active ingredient at least one molecule acting on a 5HT5b polypeptide WO 94/18319 PCT / FRs4100136 `2153162 7 ~ ~
the invention. Preferably the molecule is a ligand or a m ~ ll ~ late ~ r identified and / or isolated according to the method described above.
Other advantages of the present invention app ~ î1roll ~ when reading examples which follow, which should be considered as illustrative and not limiting.
5 Legend of fi ~ ures Table l: Pharmacological profile of the SHT5b receptor. The results correspond to competition experiments for the binding of [125I] -LSD to the membranes of Cos-7 cells expressing the 5HT5b receptor. The ICS0 values (corresponding to the ligand concentration required to displace S0 5 ~ o from [125I] -LSD bound) have been o calculated experimentally and converted into Ki according to the following equation: Ki =
IC50 / (1 + C / Kd) in which C is the concentration of [125I] -LSD (150 pM) and Kd is the dissociation constant of [125I] -LSD. The numbers in parentheses correspond to the number of independent experiences re ~ ed ~ s, each point was performed in triplicate.
15 Table 2: Percentages of peptide sequence homology between the SHT5b receptor (SEQ ID No. 2) and other receptors of the receptor family ~ coupled to G proteins. Homologies were calculated on the recommended sequences: the transmembrane domain and its connection loops.
Fi ~ ure]: Saturation curve of [125I] -LSD to the membranes of Cos-7 cells 20 expressing the 5HT5b receptor. The membranes were incubated with ligand concentrations ranging from 50 pM to 1.25 nM, with or without 10 ~ I of 5HT. The specific binding is shown. The insert represents the Scatchard analysis of results.
Techniques ~ enérale.s de clona ~ e The methods conventionally used in molecular biology such as preparative plasmid DNA extractions, centrifugation of plasmid DNA into cesium chloride gradient, electrophoresis on agarose or acrylamide gels, purification of DNA fragments by electroelution, protein extractions at phenol or phenol-chloroform, the precipitation of DNA in a saline medium by ethanol or isopropanol, processing in Escherichia coli, etc., are fine known to those skilled in the art and are abundantly described in the literature wo 94 / l83l9 PCT / FR94 / 00l36 21531''62 '' 8 [Maniatis T. et al., "Molecular Cloning, a Labo. ~ Toly Manual", Cold Spring Harbor Laboratory, Cold Spring Harbor, NY, 1982; Ausubel FM et al. (eds), "Current Protocols in Molecular Biology ", John Wiley & Sons, New York, 1987].
Restriction enzymes were supplied by New England Biolabs (Biolabs), Bethesda Research Laboratories (BRL) or Amersham and are used.
according to supplier recommendations.
For ligations, the DNA fragments are separated according to their size by electrophoresis in agarose or acrylamide gels, extracted with phenol or with a phenol / chloroform mixture, pleci ~ islanded with ethanol then incubated in the presence of o phage T4 DNA ligase (Biolabs) according to the supplier's recommendations.
The filling of the protruding 5 ′ ends is carried out by the fragment of Klenow of E. DNA Polymerase I. coli (Biolabs) according to the specifications of provider. The destruction of e ~ lre.l, ilés 3 'pre ~ prominent is carried out in the presence of DNA polymerase from phage T4 (Biolabs) used according to the recommendations of maker. The destruction of the prominent e ~ llliles 5 'is carried out by a gentle treatment with S1 nuclease.
Mutagenesis directed in vitro by synthetic oligodeoxynucleotides is performed according to the method developed by Taylor et al. [Nucleic Acids Res. 13 (1985) 8749-8764] using the kit distributed by Amersham.
The enzymatic amplification of DNA fragments by the technique known as PCR [~ olymerase-catalyzed _hain Beaction, Saiki RK et al., Science ~ (1985) 1350-1354; Mullis KB and Faloona FA, Meth. Enzym. 155 (1987) 335-350] is performed using a DNA thermal cycler (Perkin Elmer Cetus) according to the manufacturer's specifications.
Verification of nucleotide sequences is carried out by the method developed by Sanger et al. [Proc. Natl. Acad. Sci. USA, 74 (1977) 5463-5467] in using the l ~ it distributed by Amersham.
For hybridization experiments, the normal stringency conditions are generally the following: hybridization: 3 x SCC in the presence of 5 x Denhart's at 65C; washing: 0.5 x SSC at 65C.
1. Isolation of the 5HT5b receptor Sequence comparisons between different serotonin receptors known energetics show a certain conservation, particularly in certain potential transmembrane regions such as domains III and VI.
WO 94/18319 PCT / Fl ~ g4 / 00l36 - 21 ~ 3162:
q In order to identify and isolate a new receptor, three degenerate oligonucleotides corresponding to these two regions were prepared, then used in a series of PCR reactions on a brain RNA preparation from mouse. The sequence of degenerate oligonucleotides is as follows:
5 Oligonucleotide (i) AGAACTAGTGGATCCAA (A / G) AA (A / G / C / T) GG (A / G / C ~ r) A (A / G) CCA (A / G) CA
Oligonucleotide (ii) Cl ~ GATATCGAAl-rCGA (T / C) (A / G) T (A / G / C ~ r) CT (A / G / C / T) TG (C / T) TG (C / T) A
VS
0 Oligonucleotide (iii) GGTATCGATAAGCl-rAT (C / T / A) GC (C ~ r) CT (A / G / C / T) GA (C / T) (C / A) G (A / G / C /
T) TA
The PCR reactions were carried out as follows: 5 ~ g of RNA
of adult mouse brains were subjected to a reverse transcription reaction in presence of 500 ng of oligonucleotide (i) and 200 units of reverse transcriptase MMLV (BRL). Half of the product of this reaction was then subjected to 30 amplification cycles in the presence of 5 Taq polymerase units (Cetus) and 1 llg oligonucleotide (i) and oligonucleotide (ii). 1 / 20th of the product of this reaction a then subjected to 30 additional amplification cycles in the presence of oligonucleotides (i) and (iii). The products thus obtained were digested with the BamHI and HindIII enzymes, inserted at the corresponding sites of the Bluescript plasmid (Stratagene), and sequenced. One of the fragments thus obtained, presenting a certain homology with serotonergic receptors, was marked by "random priming"
(Feinberg and Vogelstein, Analytical Biochemistry 132 (1984) 6) and used as probe to screen a phage library of mouse brain cDNA
UniZap (Stratagene). Among the positive phages obtained, one of them, called ~ NS and carried by the plasmid pNS, contained an insert of 2.1 kb. This phage has been isolated, and its insert was then introduced into the Bluescript plasmid. The sequence of this fra ~ gment was determined on the 2 strands using the technique of dideoxynucleotides using synthetic oligonucleotides.
Wo 94 / l83l9 ~ PCT / ~ 94/00136 215316 ~ ~ o The sequence thus obtained corresponds to the sequence SEQ ID n 1. It shows that the isolated cDNA carries an open reading phase of 370 amino acids, and the hydrophobicity analysis shows that this protein carries seven domains hydrophobic, a peculiarity encountered in members of the family of 5 receptors coupled to proteins G. The e ~ l, N-terminal emile also contains 1 N-glycosylation site, and the suspected cytoplasmic domain contains the sites phosphorylation consensus by protein kinases C and A.
A genomic clone coding for the 5HT5b receptor was also isolated, by screening a genomic library using the sequence SEQ ID No. 1 as n probe. The bank was obtained by partial digestion with DNA Sau3A
genomics of embry, von stem cells from mouse, then insertion into the phagelambda EMBL3.
The fragments obtained were subcloned into the pl ~ cmi ~ e Bluescript and partially sequenced. Analysis of these sequences reveals the presence of an intron, 5 located in the middle of the 3rd cytoplasmic loop.
2. Study of sequence homologies The sequence of the 5HT5b receptor isolated above was compared with the sequences of receptors coupled to the following G proteins: 5HTlB, 5HTlD, 5HT5A, 5HTlA, 5HT-dro2A, 5HT-drol, a2, D2, 131, D1, H2, 5HT1C and 5HT2. These 20 experiments revealed a certain homology in the transmembrane domain potential and in some loops but no homology in the regions nor in the third cytoplasmic loop. Table 2 gives the%
of homology at the level of the conserved regions.
3. Expression du récepteur 5HT5b dans les cellules Cos-7 et caractérisation 2:- pharm~colo~ique Le fragment d'ADNc isolé dans l'exemple 1 a été inséré dans un vecteur d'expression eucaryote, qui a été utilisé pour transfecter des cellules Cos-7. Les membranes des cellules transfectées obtenues ont ensuite été préparées et testées pour leur capacité à lier certains ligands sérotoninergiques marqués.
L'ADNc de 2,1 kb codant pour le récepteur 5HT5b a été isolé à partir du plasmide pNS sous forme d'un fragment EcoRI-XhoI, puis inséré aux sites WO 94/183l9 215~1 6 2 PCTIFR94/00136 I l ~ , correspondants du vecteur p513. Le vecteur p513 dérive du vecteur pSG5 [Green etal., Nucl. Acids Res. 16 (1988) 369] par addition d'un multisite de clonage. Le vecteur recombinant ainsi obtenu désigné p513NS a ensuite été utilisé (20 ,ug par plaque de 10 cm) pour transfecter les cellules Cos-7 en présence de phosphate de5 calcium.
48 heures après la transfection, les cellules recombinantes sont récoltées et les membranes sont préparées selon la technique décrite par Amlaiky et Caron [J. Biol. Chem. 260 (1985) 1983]. Des expériences de liaison à saturation et de compétition ont ensuite été réalisées sur ces membranes en présence de différents o ligands radiomarqués (cf. Table 1). Pour cela, les é~h~ntilions de membrane (10-20 ~g de protéines) ont été incubés 10 minutes à 37C en présence du ligand dans un volume final de 250 Ill de tampon Tris-HCl 50 mM (pH 7,4). La réaction est ensuite stopée par filtration sous vide sur filtres en fibre de verre Whatman GF/C, et rin~cage 3. Expression of the 5HT5b receptor in Cos-7 cells and characterization 2: - pharm ~ colo ~ ique The cDNA fragment isolated in Example 1 was inserted into a vector eukaryotic expression, which was used to transfect Cos-7 cells. The membranes of the transfected cells obtained were then prepared and tested for their ability to bind certain labeled serotonergic ligands.
The 2.1 kb cDNA encoding the 5HT5b receptor was isolated from the plasmid pNS in the form of an EcoRI-XhoI fragment, then inserted at the sites WO 94 / 183l9 215 ~ 1 6 2 PCTIFR94 / 00136 I l ~, correspondents of vector p513. The vector p513 is derived from the vector pSG5 [Green et al., Nucl. Acids Res. 16 (1988) 369] by adding a multisite of cloning. The recombinant vector thus obtained designated p513NS was then used (20 μg per 10 cm plate) to transfect Cos-7 cells in the presence of calcium phosphate.
48 hours after transfection, the recombinant cells are harvested and the membranes are prepared according to the technique described by Amlaiky and Caron [J. Biol. Chem. 260 (1985) 1983]. Saturation binding experiments and competition were then carried out on these membranes in the presence of different o radiolabelled ligands (see Table 1). For this, the é ~ h ~ ntilions of membrane (10-20 ~ g of proteins) were incubated for 10 minutes at 37C in the presence of the ligand in a final volume of 250 μl of 50 mM Tris-HCl buffer (pH 7.4). The reaction is then stopped by vacuum filtration on Whatman GF / C fiberglass filters, and rin ~ cage
4 fois avec 4 ml de tampon Tris-HCl 50 mM (pH 7,4). La liaison non-spécifique a été
15 déterminée en présence de 10 ~lM de 5HT. La radioactivité a été mesurée avec un compteur y.
Les résultats obtenus montrent que le [125I]-LSD présente un site de liaison saturab]e avec un Kd = 470 pM et un Bmax = 170 fmol/mg de protéines membranaires (figure 1). Dans une exprérience contrôle, il a par ailleurs été montré
20 que le [125I]-LSD ne liait pas les cellules Cos-7 transfectées par le pl~cmide p513.
Pour déterminer le profil pharmacolo~ique de ce récepteur, le [125I]-LSD lié
aux membranes a été déplacé en présence de différentes drogues sérotoninergiques(table 1) . Ces différentes drogues montrent l'ordre d'efficacité de déplacementsuivant: ergotamine > 5-CT > methysergide > 5HT > RU24969 > 8-OH-DPAT >
25 yohimbine > bufotenine (table 1). La kétansérine, le propanolol (-), le sumatriptan, la dopamine et la norépinéphrine sont inactifs.
4. Recherche de séquences homologues dans d'autres tissus La séquence nucléotidique SEQ ID n 1 a ensuite été utilisée pour la mise en évidence de séquences homolo~ues à partir d'autres tissus par hybridation in situ.
Les expériences d'hybridation in situ ont été réalisées sur des sections cryostatées de cerveau de souris adulte (8 semaines environ) selon la technique décrite par Hafen et al. [EMBO J. 2 (1983) 617]. La sonde utilisée pour ces 21~3162 12 expériences est un ARN simple brin obtenu par transcription en présence de polymérase T3, de [35S]-CTP en utilisant comme matrice le plasmide pNS linéarisépar XhoE
Cette étude a permis de mettre en évidence des séquences homologues selon 4 times with 4 ml of 50 mM Tris-HCl buffer (pH 7.4). Non-specific binding was 15 determined in the presence of 10 ~ 1M of 5HT. Radioactivity was measured with a counter y.
The results obtained show that the [125I] -LSD has a binding site saturab] e with a Kd = 470 pM and a Bmax = 170 fmol / mg of proteins membranes (Figure 1). In a control experiment, it was also shown 20 that [125I] -LSD did not bind Cos-7 cells transfected with pl ~ cmide p513.
To determine the pharmacological profile of this receptor, the [125I] -LSD linked membranes was moved in the presence of different serotonergic drugs (Table 1). These different drugs show the following order of movement efficiency: ergotamine>5-CT>methysergide>5HT>RU24969>8-OH-DPAT>
25 yohimbine> bufotenine (table 1). Ketanserin, propanolol (-), sumatriptan, dopamine and norepinephrine are inactive.
4. Search for homologous sequences in other tissues The nucleotide sequence SEQ ID No. 1 was then used for the implementation evidence of homologous sequences from other tissues by in situ hybridization.
In situ hybridization experiments were carried out on sections adult mouse cryostatics (approximately 8 weeks) according to the technique described by Hafen et al. [EMBO J. 2 (1983) 617]. The probe used for these 21 ~ 3162 12 experiments is a single stranded RNA obtained by transcription in the presence of T3 polymerase of [35S] -CTP using as matrix the plasmid pNS linearized by XhoE
This study made it possible to highlight homologous sequences according to
5 l'invention dans l'hippocampe (région CA1), le corps d'habenula et le raphé dorsal.
5. T.solement du récepteur humain Selon la méthodologie décrite en 4. ci-dessus, le récepteur 5HT5b humain a été cloné.
Pour cela, une banque d'ADN génomique humain a été préparée à partir de o placenta, par digestion partielle par l'enzyme Mbol, séparation sur gradients de sels, et sous clonage dans le vecteur Lamda GEM 12 linéarisé par BamHI (bacterie hôte:TAP 90).
La banque ainsi obtenue a ensuite été criblée au moyen de la séquence SEQ
ID n 1. Les fragments de DNA qui hybrident avec cette sonde ont été isolés, sous 15 clonés dans un plasmide Bluescript, amplifiés, puis séquencés dans les deux sens selon la technique dideoxynucleotide.
La séquence obtenue est présentée sur la séquence SEQ ID n 3.
Il est entendu que les même expériences peuvent être répétées en lltili.c~nt d'autres tissus, et notamment des tissus d'origine humaine, d'autres sondes et d'autres 20 techniques (PCR, hybridation en Northern blot. Par ailleurs, les séquences homologues mises en évidence lors de ces expériences peuvent évidemment être ensuite isolées et/ou amplifiées par les techniques classiques de biologie moléculaire.
WO 94tl831g 2 1 S 3 1 6 2 PCT1~94/00136 l3 LIGAND 5HT5b Cellules Cos-7 5-HT 6.6 (3) 5-CT 7 4 (3) RU 24969 6.4 (2) TFMPP 5.4 (2) 8-OHDPAT 6.4 (2) Sumatriptan 5.1 (3) Bufotenine 5.8 (2) Methysergide 6.9 (2) Ergotamine 8.5 (2) 2-Bromo LSD
Methiothepin 7.8 (3) Yohimbine 6.0 (2) (+)Pindolol (-)Propanolol 5.2 (2) Ketanserin 5.8 (2) Spiperone Dopamine <5 (2) (-)Norepin <5 (2) 5HT5B souris 100 5HT5A souris 77 5HTlB~3 souris 37 5HTlDa humain 37 5HTlEa souris 37 5HTlE~ souris 36 5HTl A humain 36 5HT-dro2A 4]
5HT-drol 38 a2 humain 34 D2 souris 36 H2 chien 26 ~1 humain 30 ~2 souris 29 D] humain 31 5HTlC souris 30 5HT2 souris !26 WO 94/18319 ~.~ PCTIFR94100136 2i~3162 LISTE DE SEQUENCES
(]) INFORMATION GENERALE:
(i) DEPOSANT:
~A~ NOM: INSERM
(B) RUE: 101, rue dc Tolbiac -(C) VILLE: PARIS
(E) PAYS: FRANCE
(F) CODE POSTAL: 75654 (ii) TITRE DE L' INVENTION: NOUVEAUX POLYPEPTIDES AYANT UNE ACTIVITE DE
RECEPTEURS SEROTONINERGIQUES, ACIDES NUCLEIQUES CODANT POUR CES
15 POLYPEPTIDES ET UTILISATIONS.
(iii) NOMBRE DE SEQUENCES: 3 (iv~ FORME 1 ISTR! F. PAR ORDINATEUR:
(A) TYPE DE SUPPORT: Tapc (B) ORDINATEUR: IBM PC comp~ihl~
(C) SYSTEME D' EXPLOITATION: PC-DOS/MS-DOS
(D) LOGICIEL: PalentIn Rclcasc #1.0, Version #1.25 (OEB) (2) INFORMATION POUR LA SEQ ID NO: 1:
(i) CARACTERISTIQUES DE LA SEQUENCE:
(A) LONGUEUR: 2036 paircs dc bascs (B) TYPE: acidc ~vcl;;g.,c (C) NOMBRE DE BRINS: doublc (D) CONFIGURATION: linéairc (ii) TYPE DE MOLECULE: ADNc (iii) HYPOTHETIQUE: NON
(iii) ANTI-SENS: NON
40 (vi) ORIGINE:
(A) ORGANISME: SOURIS
(i~;) CARACTERISTIQUE ADDITIONELLE:
(A) NOM/CLE: CDS
(B) EMPLACEMENT: 312.. 1424 ~;i) DESCRIPTION DE LA SEQUENCE: SEQ ID NO: 1:
CAAAGGGACT GAGAGATTGA TGCGCTGGGC ~AGCTGGAC TAAGGAGTCT CATCTGGAAA 120 wo g4/~ 9 - 2 1 5 3 1 6 2 PCT/FR94100136 I . ~.~ .
ACAAGGGTGG CGCGGTTTGG ACATCTTTTT GCGTAGCTGG GCGCGCGGAG TGC~-C~ 240 Met Glu Val Ser Asn Leu Ser Gly Ala Thr Pro Gly Leu Ala Phe Pro Pro Gly Pro Glu Ser Cys Ser Asp Ser Pro Ser Ser Gly Arg Ser Met Gly Ser Thr Pro Gly Gly Leu Ile Leu Pro Gly Arg Glu Pro Pro Phe Ser Ala Phe Thr Val Leu Val Val Thr Leu Leu Val Leu CTG ATC GCT GCC ACT TTC TTA TGG ~AT CTG CTA GTT CTG GTG ACT ATC 542 Leu Ile Ala Ala Thr Phe Leu Trp Asn Leu Leu Val Leu Val Thr Ile Leu Arg Val Arg Ala Phe His Arg Val Pro His Asn Leu Val Ala Ser Thr Ala Val Ser Asp Val Leu Val Ala Val Leu Val Met Pro Leu Ser Leu Val Ser Glu Leu Ser Ala Gly Arg Arg Trp Gln Leu Gly Arg Ser Leu Cys His Val Trp Ile Ser Phe Asp Val Leu Cys Cys Thr Ala Ser Ile Trp Asn Val Ala Ala Ile Ala Leu Asp Arg Tyr Trp Thr Ile Thr Arg His Leu Gln Tyr Thr Leu Arg Thr Arg Ser Arg Ala Ser Ala Leu Met Ile Ala Ile Thr Trp Ala Leu Ser Ala Leu Ile Ala Leu Ala Pro Leu Leu Phe Gly Trp Gly Glu Ala Tyr Asp Ala Arg Leu Gln Arg Cys Gln Val Ser Gln Glu Pro Ser Tyr ~la Val Phe Ser Thr Cys Gly Ala TTC TAC CTG CCT CTA GCG GTG GTG CTC TTC GTC TAC TGG AAA ATA TAC l022 Phe Tyr Leu Pro Leu Ala Val Val Leu Phe Val Tyr Trp Lys Ile Tyr WO 94/lUl9 PCT1F~941W136 ~ /
21~3162 16 Lys Ala Ala Lys Phe Arg Phe Gly Arg Arg Arg Arg Ala Val Val Pro Leu Pro Ala Thr Thr Gln Ala Lys Glu Ala Pro Pro Glu Ser Glu Met Val Phe Thr Ala Arg Arg Arg Ala Thr Val Thr Phe Gln Thr Ser Gly Asp Ser Trp Arg Glu Gln Lys Glu Lys Arg Ala Ala Met Met Val Gly Ile Leu Ile Gly Val Phe Val Leu Cys Trp Ile Pro Phe Phe Leu Thr Glu Leu Ile Ser Pro Leu Cys Ala Cys Ser Leu Pro Pro Ile Trp Lys 2~ 320 325 330 Ser Ile Phe Leu Trp Leu Gly Tyr Ser Asn Ser Phe Phe Asn Pro Leu Ile Tyr Thr Ala Phe Asn Lys Asn Tyr Asn Asn Ala Phe Lys Ser Leu Phe Thr Lys Gln Arg CCTCTATCCC TTATCCATCA GAGGAGTTTC C~~ AG CCTCCTATAC AACCTCCACA 1881 (2) INFORMATION POUR LA SEQ ID NO: 2:
(i) CARACTERISTIQUES DE LA SEQUENCE:
WO 94/1831g ~ 2 1 5 3 1 6 2 PCT1~94/00136 ~ r ~A) LONGUEUR: 370 acides amin,s (B) TYPE: acide amin, ~D) CONFlGURATlON: lin,aire 5 (ii) TYPE DE MOLECULE: prot,ine ~xi) DESCRIPTION DE LA SEQUENCE: SEQ ID NO: 2:
Met Glu Val Ser Asn Leu Ser Gly Ala Thr Pro Gly Leu Ala Phe Pro Pro Gly Pro Glu Ser Cys Ser Asp Ser Pro Ser Ser Gly Arg Ser Met Gly Ser Thr Pro Gly Gly Leu Ile Leu Pro Gly Arg Glu Pro Pro Phe Ser Ala Phe Thr Val Leu Val Val Thr Leu Leu Val Leu Leu Ile Ala Ala Thr Phe Leu Trp Asn Leu Leu Val Leu Val Thr Ile Leu Arg Val Arg Ala Phe His Arg Val Pro His Asn Leu Val Ala Ser Thr Ala Val Ser Asp Val Leu Val Ala Val Leu Val Met Pro Leu Ser Leu Val Ser Glu Leu Ser Ala Gly Arg Arg Trp Gln Leu Gly Arg Ser Leu Cys His Val Trp Ile Ser Phe Asp Val Leu Cys Cys Thr Ala Ser Ile Trp Asn Val Ala Ala Ile Ala Leu Asp Arg Tyr Trp Thr Ile Thr Arg His Leu 145 150 155 ' 160 Gln Tyr Thr Leu Arg Thr Arg Ser Arg Ala Ser Ala Leu Met Ile Ala Ile Thr Trp Ala Leu Ser Ala Leu Ile Ala Leu Ala Pro Leu Leu Phe 45 Gly Trp Gly Glu Ala Tyr Asp Ala Arg Leu Gln Arg Cys Gln Val Ser Gln Glu Pro Ser Tyr Ala Val Phe Ser Thr Cys Gly Ala Phe Tyr Leu Pro Leu Ala Val Val Leu Phe Val Tyr Trp Lys Ile Tyr Lys Ala Ala Lys Phe Arg Phe Gly Arg Arg Arg Arg Ala Val Val Pro Leu Pro Ala Thr Thr Gln Ala Lys Glu Ala Pro Pro Glu Ser Glu Met Val Phe Thr 60 Ala Arg Arg Arg ~la Thr Val Thr Phe Gln Thr Ser Gly Asp Ser Trp WO 94/1831g PCT/~94/00136 2153162 18 `J
Arg Glu Gln Lys Glu Lys Arg Ala Ala Met Met Val Gly Ile Leu Ile Gly Val Phe Val Leu Cys Trp Ile Pro Phe Phe Leu Thr Glu Leu Ile Ser Pro Leu Cys Ala Cys Ser Leu Pro Pro Ile Trp Lys Ser Ile Phe 10 Leu Trp Leu Gly Tyr Ser Asn Ser Phe Phe Asn Pro Leu Ile Tyr Thr Ala Phe Asn Lys Asn Tyr Asn Asn Ala Phe Lys Ser Leu Phe Thr Lys Gln Arg 20 (2) INFORMATION POUR LA SEQ ID NO: 3:
(i) CARACTERISTIQUES DE LA SEQUENCE:
(B) TYPE: acide ~': 3 n (C) NOMBRE DE BRINS: doublc (D) CONFlGURATlON: iinéaire (ii) TYPE DE MOLECULE: ADNg (iii) HYPOTHETIQUE: NON
(iii) ANTI-SENS: NON
30 (vi) ORIGINE:
(A) ORGANISME: Homo Sapiens (xi) DESCRIPTION DE LA SEQUENCE: SEQ ID NO: 3:
FFLTELISPLCACSLPPIWKSIFLWLGYSNSFFNPLIYTAFNKNYNNAFKSLFTKQ
R*
GTAAAGGAAGCACCTGATGAGGCTGAAGTG~lGll'CACGGCACATTGCAAAGCAACGGTG
TCCTTCCAGGTGAGCGGGGACTCCTGGCGGGAGCAGAAGGAGAGGCGAGCAGCCATGATG
GTGGGGATTCTGATTGGCGlGlll~lGCTGTGCTGGATCCCCll~llCCTGACGGAACTC
ATCAGCCCACTCTGTGCCTGCAGCCTGCCCCCCATCTGGAAAAGCATATTTCTGTGGCTT
GGCTACTCCAATTClll~llCAACCCCCTGATTTACACAGCTTTTAACAAGAACTACAAC
AATGCCTTCAAGAGC~l~lllACTAAGCAGAGATGA 5 the invention in the hippocampus (region CA1), the habenula body and the dorsal raphe.
5. Isolated human receptor According to the methodology described in 4. above, the human 5HT5b receptor has been cloned.
For this, a human genomic DNA bank was prepared from o placenta, by partial digestion with the enzyme Mbol, separation on salt gradients, and under cloning in the vector Lamda GEM 12 linearized by BamHI (bacteria host: TAP 90).
The library thus obtained was then screened using the sequence SEQ
ID n 1. The DNA fragments which hybridize with this probe have been isolated, under 15 cloned into a Bluescript plasmid, amplified, then sequenced back and forth according to the dideoxynucleotide technique.
The sequence obtained is presented on the sequence SEQ ID No. 3.
It is understood that the same experiences can be repeated in lltili.c ~ nt other tissues, including tissues of human origin, other probes and other 20 techniques (PCR, Northern blot hybridization. Furthermore, the sequences counterparts highlighted during these experiments can obviously be then isolated and / or amplified by conventional molecular biology techniques.
WO 94tl831g 2 1 S 3 1 6 2 PCT1 ~ 94/00136 l3 LIGAND 5HT5b Cos-7 cells 5-HT 6.6 (3) 5-CT 7 4 (3) RU 24969 6.4 (2) TFMPP 5.4 (2) 8-OHDPAT 6.4 (2) Sumatriptan 5.1 (3) Bufotenine 5.8 (2) Methysergide 6.9 (2) Ergotamine 8.5 (2) 2-Bromo LSD
Methiothepin 7.8 (3) Yohimbine 6.0 (2) (+) Pindolol (-) Propanolol 5.2 (2) Ketanserin 5.8 (2) Spiperone Dopamine <5 (2) (-) Norepin <5 (2) 5HT5B mouse 100 5HT5A mouse 77 5HTlB ~ 3 mice 37 5HTlDa human 37 5HTlEa mouse 37 5HTlE ~ mouse 36 5HTl A human 36 5HT-dro2A 4]
5HT-drol 38 human a2 34 D2 mouse 36 H2 dog 26 ~ 1 human 30 ~ 2 mice 29 D] human 31 5HTlC mouse 30 5HT2 mouse! 26 WO 94/18319 ~. ~ PCTIFR94100136 2i ~ 3162 LIST OF SEQUENCES
(]) GENERAL INFORMATION:
(i) DEPOSITOR:
~ A ~ NAME: INSERM
(B) STREET: 101, rue dc Tolbiac -(C) CITY: PARIS
(E) COUNTRY: FRANCE
(F) POSTAL CODE: 75654 (ii) TITLE OF THE INVENTION: NEW POLYPEPTIDES HAVING AN ACTIVITY OF
SEROTONINERGIC RECEPTORS, NUCLEIC ACIDS ENCODING SAME
15 POLYPEPTIDES AND USES.
(iii) NUMBER OF SEQUENCES: 3 (iv ~ FORM 1 ISTR! F. BY COMPUTER:
(A) TYPE OF SUPPORT: Tapc (B) COMPUTER: IBM PC comp ~ ihl ~
(C) OPERATING SYSTEM: PC-DOS / MS-DOS
(D) SOFTWARE: PalentIn Rclcasc # 1.0, Version # 1.25 (EPO) (2) INFORMATION FOR SEQ ID NO: 1:
(i) CHARACTERISTICS OF THE SEQUENCE:
(A) LENGTH: 2036 pairs of bascs (B) TYPE: acidc ~ vcl ;; g., C
(C) NUMBER OF STRANDS: doublc (D) CONFIGURATION: linear (ii) TYPE OF MOLECULE: cDNA
(iii) HYPOTHETIC: NO
(iii) ANTI-SENSE: NO
40 (vi) ORIGIN:
(A) ORGANIZATION: MOUSE
(i ~;) ADDITIONAL FEATURE:
(A) NAME / KEY: CDS
(B) LOCATION: 312 .. 1424 ~; i) DESCRIPTION OF THE SEQUENCE: SEQ ID NO: 1:
CAAAGGGACT GAGAGATTGA TGCGCTGGGC ~ AGCTGGAC TAAGGAGTCT CATCTGGAAA 120 wo g4 / ~ 9 - 2 1 5 3 1 6 2 PCT / FR94100136 I. ~. ~.
ACAAGGGTGG CGCGGTTTGG ACATCTTTTT GCGTAGCTGG GCGCGCGGAG TGC ~ -C ~ 240 Met Glu Val Ser Asn Leu Ser Gly Ala Thr Pro Gly Leu Ala Phe Pro Pro Gly Pro Glu Ser Cys Ser Asp Ser Pro Ser Ser Gly Arg Ser Met Gly Ser Thr Pro Gly Gly Leu Ile Leu Pro Gly Arg Glu Pro Pro Phe Ser Ala Phe Thr Val Leu Val Val Thr Leu Leu Val Leu CTG ATC GCT GCC ACT TTC TTA TGG ~ AT CTG CTA GTT CTG GTG ACT ATC 542 Leu Ile Ala Ala Thr Phe Leu Trp Asn Leu Leu Val Leu Val Thr Ile Leu Arg Val Arg Ala Phe His Arg Val Pro His Asn Leu Val Ala Ser Thr Ala Val Ser Asp Val Leu Val Ala Val Leu Val Met Pro Leu Ser Leu Val Ser Glu Leu Ser Ala Gly Arg Arg Trp Gln Leu Gly Arg Ser Leu Cys His Val Trp Ile Ser Phe Asp Val Leu Cys Cys Thr Ala Ser Ile Trp Asn Val Ala Ala Ile Ala Leu Asp Arg Tyr Trp Thr Ile Thr Arg His Leu Gln Tyr Thr Leu Arg Thr Arg Ser Arg Ala Ser Ala Leu Met Ile Ala Ile Thr Trp Ala Leu Ser Ala Leu Ile Ala Leu Ala Pro Leu Leu Phe Gly Trp Gly Glu Ala Tyr Asp Ala Arg Leu Gln Arg Cys Gln Val Ser Gln Glu Pro Ser Tyr ~ la Val Phe Ser Thr Cys Gly Ala TTC TAC CTG CCT CTA GCG GTG GTG CTC TTC GTC TAC TGG AAA ATA TAC l022 Phe Tyr Leu Pro Leu Ala Val Val Leu Phe Val Tyr Trp Lys Ile Tyr WO 94 / lUl9 PCT1F ~ 941W136 ~ /
21 ~ 3162 16 Lys Ala Ala Lys Phe Arg Phe Gly Arg Arg Arg Arg Ala Val Val Pro Leu Pro Ala Thr Thr Gln Ala Lys Glu Ala Pro Pro Glu Ser Glu Met Val Phe Thr Ala Arg Arg Arg Ala Thr Val Thr Phe Gln Thr Ser Gly 270,275 280,285 Asp Ser Trp Arg Glu Gln Lys Glu Lys Arg Ala Ala Met Met Val Gly Ile Leu Ile Gly Val Phe Val Leu Cys Trp Ile Pro Phe Phe Leu Thr Glu Leu Ile Ser Pro Leu Cys Ala Cys Ser Leu Pro Pro Ile Trp Lys 2 ~ 320 325 330 Ser Ile Phe Leu Trp Leu Gly Tyr Ser Asn Ser Phe Phe Asn Pro Leu Ile Tyr Thr Ala Phe Asn Lys Asn Tyr Asn Asn Ala Phe Lys Ser Leu Phe Thr Lys Gln Arg CCTCTATCCC TTATCCATCA GAGGAGTTTC C ~~ AG CCTCCTATAC AACCTCCACA 1881 (2) INFORMATION FOR SEQ ID NO: 2:
(i) CHARACTERISTICS OF THE SEQUENCE:
WO 94 / 1831g ~ 2 1 5 3 1 6 2 PCT1 ~ 94/00136 ~ r ~ A) LENGTH: 370 amino acids, s (B) TYPE: amino acid, ~ D) CONFlGURATlON: linen, area 5 (ii) TYPE OF MOLECULE: prot, ine ~ xi) DESCRIPTION OF THE SEQUENCE: SEQ ID NO: 2:
Met Glu Val Ser Asn Leu Ser Gly Ala Thr Pro Gly Leu Ala Phe Pro Pro Gly Pro Glu Ser Cys Ser Asp Ser Pro Ser Ser Gly Arg Ser Met Gly Ser Thr Pro Gly Gly Leu Ile Leu Pro Gly Arg Glu Pro Pro Phe Ser Ala Phe Thr Val Leu Val Val Thr Leu Leu Val Leu Leu Ile Ala Ala Thr Phe Leu Trp Asn Leu Leu Val Leu Val Thr Ile Leu Arg Val Arg Ala Phe His Arg Val Pro His Asn Leu Val Ala Ser Thr Ala Val Ser Asp Val Leu Val Ala Val Leu Val Met Pro Leu Ser Leu Val Ser Glu Leu Ser Ala Gly Arg Arg Trp Gln Leu Gly Arg Ser Leu Cys His Val Trp Ile Ser Phe Asp Val Leu Cys Cys Thr Ala Ser Ile Trp Asn Val Ala Ala Ile Ala Leu Asp Arg Tyr Trp Thr Ile Thr Arg His Leu 145 150 155 '160 Gln Tyr Thr Leu Arg Thr Arg Ser Arg Ala Ser Ala Leu Met Ile Ala Ile Thr Trp Ala Leu Ser Ala Leu Ile Ala Leu Ala Pro Leu Leu Phe 45 Gly Trp Gly Glu Ala Tyr Asp Ala Arg Leu Gln Arg Cys Gln Val Ser Gln Glu Pro Ser Tyr Ala Val Phe Ser Thr Cys Gly Ala Phe Tyr Leu Pro Leu Ala Val Val Leu Phe Val Tyr Trp Lys Ile Tyr Lys Ala Ala Lys Phe Arg Phe Gly Arg Arg Arg Arg Ala Val Val Pro Leu Pro Ala Thr Thr Gln Ala Lys Glu Ala Pro Pro Glu Ser Glu Met Val Phe Thr 60 Ala Arg Arg Arg ~ la Thr Val Thr Phe Gln Thr Ser Gly Asp Ser Trp WO 94 / 1831g PCT / ~ 94/00136 2153162 18 `J
Arg Glu Gln Lys Glu Lys Arg Ala Ala Met Met Val Gly Ile Leu Ile Gly Val Phe Val Leu Cys Trp Ile Pro Phe Phe Leu Thr Glu Leu Ile Ser Pro Leu Cys Ala Cys Ser Leu Pro Pro Ile Trp Lys Ser Ile Phe 10 Leu Trp Leu Gly Tyr Ser Asn Ser Phe Phe Asn Pro Leu Ile Tyr Thr Ala Phe Asn Lys Asn Tyr Asn Asn Ala Phe Lys Ser Leu Phe Thr Lys Gln Arg 20 (2) INFORMATION FOR SEQ ID NO: 3:
(i) CHARACTERISTICS OF THE SEQUENCE:
(B) TYPE: acid ~ ': 3 n (C) NUMBER OF STRANDS: doublc (D) CONFlGURATlON: linear (ii) TYPE OF MOLECULE: gDNA
(iii) HYPOTHETIC: NO
(iii) ANTI-SENSE: NO
30 (vi) ORIGIN:
(A) ORGANIZATION: Homo Sapiens (xi) DESCRIPTION OF THE SEQUENCE: SEQ ID NO: 3:
FFLTELISPLCACSLPPIWKSIFLWLGYSNSFFNPLIYTAFNKNYNNAFKSLFTKQ
R *
GTAAAGGAAGCACCTGATGAGGCTGAAGTG ~ lGll'CACGGCACATTGCAAAGCAACGGTG
TCCTTCCAGGTGAGCGGGGACTCCTGGCGGGAGCAGAAGGAGAGGCGAGCAGCCATGATG
GTGGGGATTCTGATTGGCGlGlll ~ lGCTGTGCTGGATCCCCll ~ llCCTGACGGAACTC
ATCAGCCCACTCTGTGCCTGCAGCCTGCCCCCCATCTGGAAAAGCATATTTCTGTGGCTT
GGCTACTCCAATTClll ~ llCAACCCCCTGATTTACACAGCTTTTAACAAGAACTACAAC
AATGCCTTCAAGAGC ~ l ~ lllACTAAGCAGAGATGA
Claims (22)
n°2 ou SEQ ID n°3. 1. Polypeptide comprising all or part of the peptide sequence SEQ ID
#2 or SEQ ID #3.
(a) tout ou partie de la séquence nucléotidique SEQ ID n°1 ou de son brincomplémentaire, (b) toute séquence hybridant avec une séquence (a) et codant pour un polypeptide selon l'une des revendications 1 à 5, et, (c) les séquences dérivées des séquences (a) et (b) en raison de la dégénérescence du code génétique. 7. Sequence according to claim 6 characterized in that it is chosen among:
(a) all or part of the nucleotide sequence SEQ ID No. 1 or its complementary strand, (b) any sequence hybridizing with a sequence (a) and coding for a polypeptide according to one of claims 1 to 5, and, (c) sequences derived from sequences (a) and (b) due to the degeneration of the genetic code.
- on met en contact une molécule ou un mélange contenant différentes molécules, éventuellement non-identifiées, avec une cellule recombinée selon la revendication 16 exprimant à sa surface un polypeptide tel que défini dans les revendications 1 à 5 dans des conditions permettant l'interaction entre ledit polypeptide et ladite molécule dans le cas où celle-ci possèderait une affinité pour ledit polypeptide, et, - on détecte et/ou isole les molécules liées au dit polypeptide. 18. Process for detecting and/or isolating ligands of polypeptides as defined in claims 1 to 5, characterized in that one performs the following steps:
- a molecule or a mixture containing different molecules, possibly unidentified, with a recombinant cell according to the claim 16 expressing at its surface a polypeptide as defined in claims 1 to 5 under conditions permitting the interaction between said polypeptide and said molecule in the event that the latter possesses an affinity for said polypeptide, and, - the molecules bound to said polypeptide are detected and/or isolated.
- on met en contact une molécule ou un mélange contenant différentes molécules, éventuellement non-identifiées, avec une cellule recombinée selon la revendication 16 exprimant à sa surface un polypeptide tel que défini dans les revendications 1 à 5, en présence de 5HT, dans des conditions permettant l'interaction entre ledit polypeptide et le 5HT, et, - on détecte et/ou isole les molécules capables de moduler l'activité du 5HT
sur ledit polypeptide. 20. Method for highlighting and/or isolating modulators of polypeptides as defined in claims 1 to 5, characterized in that one performs the following steps:
- a molecule or a mixture containing different molecules, possibly unidentified, with a recombinant cell according to the claim 16 expressing at its surface a polypeptide as defined in claims 1 to 5, in the presence of 5HT, under conditions permitting the interaction between said polypeptide and 5HT, and, - the molecules capable of modulating the activity of 5HT are detected and/or isolated on said polypeptide.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| FR9301392A FR2701265B1 (en) | 1993-02-09 | 1993-02-09 | New polypeptides having serotoninergic receptor activity, nucleic acids encoding these polypeptides and uses. |
| FR9301392 | 1993-02-09 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CA2153162A1 true CA2153162A1 (en) | 1994-08-18 |
Family
ID=9443860
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CA002153162A Abandoned CA2153162A1 (en) | 1993-02-09 | 1994-02-07 | New polypeptides having serotoninergic receptor activity, nucleic acids coding therefor and uses thereof |
Country Status (5)
| Country | Link |
|---|---|
| EP (1) | EP0683817A1 (en) |
| JP (1) | JPH08506244A (en) |
| CA (1) | CA2153162A1 (en) |
| FR (1) | FR2701265B1 (en) |
| WO (1) | WO1994018319A1 (en) |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0791660A1 (en) * | 1996-02-22 | 1997-08-27 | Smithkline Beecham Corporation | A novel diagnostic marker for splicing variants of genes associated with neurological function |
| DE19900674A1 (en) * | 1999-01-11 | 2000-07-13 | Basf Ag | Binding partner for 5-HT5 receptors for migraine treatment |
| FR3022927B1 (en) | 2014-06-26 | 2016-06-10 | Onduline Sa | METHOD FOR DESIGNING AN ONDULATED PLATE AND AN INDEPENDENT PLATE OBTAINED |
-
1993
- 1993-02-09 FR FR9301392A patent/FR2701265B1/en not_active Expired - Fee Related
-
1994
- 1994-02-07 CA CA002153162A patent/CA2153162A1/en not_active Abandoned
- 1994-02-07 JP JP6517723A patent/JPH08506244A/en active Pending
- 1994-02-07 EP EP94906247A patent/EP0683817A1/en not_active Withdrawn
- 1994-02-07 WO PCT/FR1994/000136 patent/WO1994018319A1/en not_active Application Discontinuation
Also Published As
| Publication number | Publication date |
|---|---|
| JPH08506244A (en) | 1996-07-09 |
| FR2701265B1 (en) | 1995-04-07 |
| EP0683817A1 (en) | 1995-11-29 |
| WO1994018319A1 (en) | 1994-08-18 |
| FR2701265A1 (en) | 1994-08-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CA2262459C (en) | Gene involved in cadasil, method of diagnosis and therapeutic application | |
| FR2692268A1 (en) | New polypeptides having NMDA receptor activity, nucleic acids encoding these polypeptides and uses. | |
| FR2696749A1 (en) | Novel polypeptides having serotoninergic receptor activity, nucleic acids encoding these polypeptides and uses. | |
| CA2182621C (en) | Galanin receptor, nucleic acids, transformed cells and uses thereof | |
| EP0651801B1 (en) | Polypeptides having serotoninergique activity (5ht5a), nucleic acids coding for these polypeptides and uses thereof | |
| FR2759701A1 (en) | USE OF ULIP PROTEINS IN THE DIAGNOSIS AND THERAPY OF CANCER AND PARANEOPLASTIC NEUROLOGIC SYNDROMES | |
| WO1997028186A1 (en) | PURIFIED SR-p70 PROTEIN | |
| EP0672139B1 (en) | Novel polypeptides having opioid receptor activity, nucleic acids coding therefor and uses thereof | |
| BE1014938A4 (en) | Sequence dna encoding protein sodium channel, its production and use. | |
| CA2153162A1 (en) | New polypeptides having serotoninergic receptor activity, nucleic acids coding therefor and uses thereof | |
| EP0804574B1 (en) | Human kappa opioid receptor, nucleic acids and uses thereof | |
| CA2072874C (en) | Polypeptides having human dopaminergic receptor activity, nucleic acids coding for said polypeptides and uses thereof for screening active substances on said polypeptides | |
| CA2139431A1 (en) | Polypeptides having serotoninergie activity (5ht6), nucleic acids coding for said polypeptides, and uses thereof | |
| FR2723749A1 (en) | NEW VESICULAR ACETYLCHOLINE CONVEYOR | |
| WO2001047981A1 (en) | NUCLEOTIDE SEQUENCES CODING FOR A POLYPEPTIDE CAPABLE OF INTERACTING WITH PROTEINS OF THE p300/CBP AND Rb |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| FZDE | Dead |