AU5070699A - Process to collect metabolites from modified nectar by insects - Google Patents

Process to collect metabolites from modified nectar by insects Download PDF

Info

Publication number
AU5070699A
AU5070699A AU50706/99A AU5070699A AU5070699A AU 5070699 A AU5070699 A AU 5070699A AU 50706/99 A AU50706/99 A AU 50706/99A AU 5070699 A AU5070699 A AU 5070699A AU 5070699 A AU5070699 A AU 5070699A
Authority
AU
Australia
Prior art keywords
sequence
nectar
protein
plants
plant
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Granted
Application number
AU50706/99A
Other versions
AU772119B2 (en
Inventor
Gerrit Cornelis Angenent
Jantina Creemers
Martin Maria Kater
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Plant Research International BV
Original Assignee
Plant Research International BV
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from EP98202375A external-priority patent/EP0974667A1/en
Application filed by Plant Research International BV filed Critical Plant Research International BV
Publication of AU5070699A publication Critical patent/AU5070699A/en
Assigned to PLANT RESEARCH INTERNATIONAL B.V. reassignment PLANT RESEARCH INTERNATIONAL B.V. Alteration of Name(s) of Applicant(s) under S113 Assignors: STICHTING CENTRUM VOOR PLANTENVEREDELINGS-EN REPRODUKTIEONDERZOEK (CPRO-DLO)
Application granted granted Critical
Publication of AU772119B2 publication Critical patent/AU772119B2/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8242Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
    • C12N15/8257Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits for the production of primary gene products, e.g. pharmaceutical products, interferon
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/415Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8216Methods for controlling, regulating or enhancing expression of transgenes in plant cells
    • C12N15/8222Developmentally regulated expression systems, tissue, organ specific, temporal or spatial regulation
    • C12N15/823Reproductive tissue-specific promoters
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8216Methods for controlling, regulating or enhancing expression of transgenes in plant cells
    • C12N15/8222Developmentally regulated expression systems, tissue, organ specific, temporal or spatial regulation
    • C12N15/823Reproductive tissue-specific promoters
    • C12N15/8231Male-specific, e.g. anther, tapetum, pollen
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8242Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits

Description

WO 00/04176 PCT/NL99/00453 Process to collect metabolites from modified nectar by insects. Field of the invention The present invention relates to isolated, purified DNA 5 sequences which can act as promoters in eukaryotic cells. More specifically, the present invention is related to such DNA sequences which act as promoters to express genes in nectaries of plants. The present invention also relates to chimerical gene constructs comprising a structural or a 10 synthetic gene under the control of a promoter that effects expression of said genes in nectaries. This invention also relates to a process for producing metabolites in honey by allowing insects, preferably bees, to collect and process nectar from plants that excrete said metabolites in nectar 15 or other exudates. Further, this invention relates to plant cells, plants or derivatives therefrom, that express the said chimerical gene. Background of the invention 20 Nectaries are nectar secreting organs or tissues that can be located inside (floral) or outside (extrafloral) the flower. The main component of nectar is sugar, the variati on between nectars of flowers from different species mainly 25 being the concentration and ratio of glucose, fructose and sucrose (Baker and Baker, 1982). In addition, depending on the plant species, varying amounts of polysaccharides, lipids, organic acids, volatiles, minerals, phosphates, alkaloids, amino acids and proteins have been detected SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 -2 (Baker and Baker, 1982). Being a specialised sink organ, the nectaries are supplied with sucrose by phloem unloading (Davis et al., 1985, Hagitzer and Fahn, 1992). 5 The mechanisms of sugar accumulation and nectar secretion have been described for several plant species (Fahn et al., 1979) . Sugar transport to the nectaries is achieved by active transport mechanisms and/or osmotic and chemical gradients. In the nectaries of many plants sucrose is 10 converted to glucose and fructose, resulting in a hexose dominant nectar. Part of the hexoses are converted to starch, which is hydrolysed prior to anthesis and nectar secretion. Cell to cell transport of nectar in the nectary parenchyma tissue is mainly symplastic, as demonstrated by 15 the presence of many plasmodesmata between these cells (Fahn et al., 1979). Nectar is secreted from secretory cells via the cell membrane (eccrine secretion) or via the Golgi and endoplasmatic reticulum vesicles (granulocrine secretion). Research on the molecular regulation of nectary 20 development and nectary biochemistry has not been reported. The main function of floral nectar is to reward pollinating insects. Insects collect nectar to meet their short-term energy requirements. Colony-living honeybees process large 25 quantities of nectar into honey, which is stored in honey combs of the beehive and is used as food supply during the winter period. Within the bee colony different classes of worker bees cooperate in the honey production process. Foraging bees collect pollen and nectar from the flowers 30 and bring it to the hive. On returning to the hive they give most of it up to household bees. Pollen is used as a protein source, especially to feed the brood. Adult nurse and worker bees use little protein, their capacity to digest proteins being very low (Crailsheim et al., 1993). 35 Honey processing takes place by repeated swallowing and bringing up of the nectar from the honey stomach. In the first process 15% of the water content is lost. This semi SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 -3 processed nectar is temporarily stored in a honeycomb cell and taken out later for further processing. The final process includes filtering the honey to discard small particles like pollen grains. Sugar metabolising enzymes 5 (invertase, amylase) are added and the honey is concentra ted to an average water content of 20%. Most nectars and honeys only contain traces of protein (<0.2%) . However, Calluna vulgaris (heather) honey can contain up to 1.8% protein, giving it thixotropic properties (Butler, 1962). 10 It is known that bees add enzymes like invertase to nectar during the honey processing. Therefore, the probability that proteases are also added is very low. Protein digesti on does not take place in the honey stomach but in the intestine of the honeybee. However, the ability of adult 15 worker bees to digest proteins is very low, their main requirement being energy which they obtain from nectar. Until now, it was not established which proteins are present in heather honey and whether these originate from floral heather nectar or are added to honey by honeybees. 20 In the present invention it was established that heather honey contains two unique proteins that originate from floral nectar of heather. Based on these results a produc tion system for proteins in nectar and honey was estab 25 lished. It is an object of the present invention to show that recombinant proteins can be secreted in nectar of transge nic plants, that this nectar is collected by honeybees and 30 that the bees process this nectar into honey that contains the unaltered protein in a concentrated form. Definitions 35 Honey: A substance that contains approximately 80% sugar and varying amounts of other components and that is produ ced by insects, preferably bees, that collect and process SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 -4 nectar from floral or extrafloral nectaries, from honeydew, other plant exudates or artificial sugar solutions. MADS box gene: a gene coding for a transcription factor 5 having a region of 56 amino acids which is homologous to a similar region in the Arabidopsis AGAMOUS protein and Antirrhinum DEFICIENS protein. This region is called the 'MADS box' . At least 50% of the amino acids in this region should be identical to the amino acid composition in the 10 MADS boxes of AGAMOUS and/or DEFICIENS. Nectary: secretory organ or secretory tissue of plants, located in the flowers (floral nectaries) or outside the flower (extrafloral nectaries) that excrete nectar. 15 Nectar: sugar containing fluid that is secreted by necta ries. Nectar can also contain substances like minerals, amino acids, proteins, organic acids, volatiles, alkaloids etc. 20 Recombinant protein: the gene product of a recombinant DNA molecule. Recombinant DNA molecule: A DNA molecule in which sequences 25 which are not naturally contiguous have been placed next to each other by in vitro manipulations. Promoter: The DNA region, usually upstream to the coding sequence of a gene, which binds RNA polymerase and directs 30 the enzyme to the correct transcriptional start site. Summary of the invention The production of recombinant proteins for pharmaceutical 35 purposes is a growing market. Until now, mainly bacterial and yeast systems have been used for bulk production of proteins. Recently animal production systems have also been SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 -5 developed. With the availability of efficient transformati on techniques for plants, procedures to use plants for the production of proteins are now in progress. In plants, the recombinant proteins are targeted to sink organs like 5 tubers and seeds. A serious draw-back of these production methods is that the recombinant protein can only be obtai ned after extended, and therefore expensive, purification steps. 10 The present invention provides a method to produce metab olites, preferably recombinant proteins in honey, which is manufactured by insects, preferably honeybees, that collect floral nectar of transgenic plants. Harvesting of honey is very simple and purification of the protein is very 15 straight forward and requires no advanced purification steps. To give an estimation of the protein yield in a crop like rapeseed, we suggest an average protein production of 2% in honey, as has been found in honey of heather. If one hectare of rapeseed yields 100-500 kilo honey in one 20 season, a yield of 2 to 10 kilo protein can be obtained. In addition, the present invention provides a method to collect metabolites from honey that is derived from non transgenic plants that secrete these metabolites in nectar. An example are secondary metabolites like acetylandromedol, 25 a diterpine compound, that is excreted in nectar of Rhododendron arboreum and Rhododendron barbatum and of Piptanthus nepalensis (Martini et al., 1990). This invention provides a gene from petunia, NECl, that is 30 highly expressed in the nectaries of petunia and weakly expressed in the stamens. It also provides another gene from petunia, FBP15, that encodes a MADS box protein and which is specifically expressed in the nectaries of petu nia. Further, it provides the isolated DNA sequences of the 35 promoters of the NECI and the FBP15 genes. Furthermore, this invention provides an isolated DNA sequence expressed in nectaries encoding a signal peptide that is translation SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 -6 ally fused to a germin-like protein (Lane et al., 1993, Dumas et al., 1995), having the function to target the mature germin-like protein to nectar of heather (Calluna vulgaris) . This invention gives proof that protein-contai 5 ning sugar solution is collected by honeybees to produce honey that has a higher protein content than the sugar solution itself, the protein having undergone no qualitati ve alterations. This invention also proofs that a recombi nant protein can be produced in nectar of transgenic plants 10 and that this protein is present in honey produced by honeybees that collected this nectar. Accordingly, this invention provides an isolated DNA sequence which encodes a protein indicated NEC1 and having 15 the amino acid sequence given in SEQ ID NO:1 of the sequen ce listing hereafter or homologs of NEC1. A homolog of NEC1 is predominantly expressed in nectaries and/or has at least 60% homology with the amino acid sequence given in SEQ ID NO:1. Further this invention provides an isolated DNA 20 sequence which encodes a protein indicated FBP15 and having the amino acid sequence given in SEQ ID NO:2 of the sequen ce listing hereafter or a homolog of FBP15. A homolog of FBP15 is specifically expressed in nectaries and belonging to the MADS box family. Furthermore, a homolog is also a 25 gene sequence that has at least 80% homology within the MADS box region and a 60% overall homology with the amino acid sequence given in SEQ ID NO:2. Further this invention provides the characterisation and the isolation of a DNA sequence which encodes a signal peptide indicated "CVSP" 30 (Calluna vulgaris signal peptide), wherein the information contained in the DNA sequence permits, upon translational fusion with a DNA sequence encoding a protein that is expressed in nectaries, targeting of the protein to nectar. 35 The DNA sequences of the invention can also be characteri sed in that they comprise the NECI gene and the FBP15 gene having the nucleotide sequences given in SEQ ID NO:4 and SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 -7 SEQ ID NO:5 respectively, or a functionally homologous gene or an essentially identical nucleotide sequence or part thereof or derivatives thereof which are derived from said sequences by insertion, deletion or substitution of one or 5 more nucleotides, said derived nucleotide sequences being obtainable by hybridisation with the nucleotide sequences given in SEQ ID NO:4 and 5 respectively. Furthermore, the DNA sequences of the invention can also be 10 characterised in that they comprise signal sequence CVSP having the nucleotide sequence given in SEQ ID NO:6, or an essentially identical nucleotide sequence or part thereof or derivatives thereof which are derived from said sequen ces by insertion, deletion or substitution of one or more 15 nucleotides. Further, this invention provides an isolated DNA sequence from the promoter region upstream of a nectary-specific expressed sequence, which nectary-specific expressed 20 sequence encodes a protein comprising the amino acid sequence given in SEQ ID NO:1, or a homologous protein. Furthermore, this invention provides an isolated DNA sequence from the promoter region upstream of a nectary specific expressed sequence, which nectary-specific expres 25 sed sequence encodes a protein comprising the amino acid sequence given in SEQ ID NO:2, or a homologous protein. In a further aspect, the invention provides a protein encoded by any of the above defined DNA sequences. Further, 30 the invention provides processes of producing transgenic plants exhibiting excretion of recombinant proteins in nectar, the expression of the chimerical genes and the targeting of the recombinant proteins being under the control of promoter sequences and a signal sequence as 35 described in this invention. Still further, the invention provides processes of producing transgenic plants that produce recombinant proteins in nectar, the expression of SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 -8 the chimerical genes being under the control of promoter regions upstream of other genes that are expressed in nectaries. Still further, the invention provides processes of producing transgenic plants that produce recombinant 5 proteins in nectar, the expression of these proteins being under the control of any signal peptide that affects targeting of a protein in nectar. Also, the invention provides recombinant double stranded 10 DNA molecules comprising expression cassettes to be used in the above process. Further, the invention provides transge nic bacteria, transgenic plants producing recombinant proteins in nectar, and also plant cells, tissue culture, plant parts or progeny plants derived from said transgenic 15 plants. Finally, the invention provides a process to produce recombinant gene products in honey, produced by bees that collect nectar from transgenic plants and process this nectar into honey. 20 Brief description of the figures: 25 Figure 1 shows a polyacrylamide gel with PCR products after Differential Display mRNA amplification. PCR reactions were performed with the oligo-dT primer T12MG in combination with 5 different random primers Ap1l-AP15 on cDNA samples 30 of pistils without nectaries (two independent samples), nectaries (two independent samples) , leaves and a mixture of sepals (s) , petals (p) and stamens (a) . Bold arrow depicts the cloned fragment DD18. 35 Figure 2 is the DNA sequence of the Differential Display RT-PCR clone DD18a. The primers prat 122 and prat 119 that were used for 5' RACE PCR reactions are underlined. SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 -9 Figure 3 is the DNA sequence of clone RC8, obtained by RACE PCR with gene specific primers prat 122 and prat 119 (Fig. 2) in combination with adapter primers. Primer prat 129 (underlined) is used in the next step together with primer 5 prat 122 to amplify the coding region of the NECl cDNA. Figure 4 is the full length sequence of NECl cDNA. The translation start (ATG) and translation stop (TAA) are depicted bold. 10 Figure 5 shows the expression of NECl (A) and FBPl5 (B) in wild type petunia plants (line W115) as determined by Northern blot analysis. Blot A contains total RNA, while blot B is enriched for mRNA. The tissues are indicated as: 15 1= leaf, 2= sepal, 3= petal, 4= stamen, 5= pistil, 6= nectary. For blot A the HindIII/EcoRI fragment of pDD18a was used as a probe. For blot B the full length cDNA of FBPl5 was used as a probe. 20 Figure 6 Expression of NECl by in situ localisation of NECI transcripts (A) and activity of the NECl promoter in the nectaries (B) and the stamen (C) as shown by GUS expression driven by the NECl promoter. The GUS assay used for the stamens was incubated overnight without modificati 25 ons to prevent diffusion (example 8). The GUS assay for the nectaries was incubated for 5 hrs, using an assay mixture to prevent diffusion (example 8) . For in situ localisation longitudinal sections of flowers of Petunia hybrida were hybridised with digoxigenin-labeled antisense NECI RNA 30 Figure 7 is the DNA sequence from the promoter region upstream of a sequence encoding the NEC1 protein. Underli ned is the translation start of NECI cDNA. 35 Figure 8 depicts a schematic presentation of the T-DNA region between the borders of the binary vector pBNEP1, containing the NECI promoter (Figure 7), the GUS reporter SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 10 gene and the nos terminator in pBINPLUS. This vector was used to generate transgenic plants to study the expression of the NECI promoter. 5 Figure 9 shows the SDS-PAGE separation of proteins that are present in commercial honey samples from different flowers. M= marker, lane 1: wattle bark, lane 2: flower mixture, lane 3: heather, lane 4: clover, lane 5: rapeseed. 10 Figure 10 shows the SDS-PAGE separation of proteins that are present in commercial honey samples of rapeseed (RH2x, RHlox) and heather (HH2x, HH10x) and of nectar samples of rapeseed (RN2x, RNlOx) and heather (HN2x, HN10x). M= molecular weight marker. Two (2x) or ten (lox) fold diluti 15 ons were used. Figure 11 shows the SDS-PAGE separation of proteins present in dilutions of the sugar/BSA feeding solution (A) and of honey from bees that had collected the sugar/BSA solution 20 (B) . The dilutions of the sugar/BSA and honey/BSA solution was the same for both gels: 1= 15x, 2= 30x, 3= 60x, 4= 75x, 5= 75x, 6= 90x, 7= 105x, 8= 120x, 9= 135x. M= marker Figure 12 shows the sequence homology of the N-terminal 25 protein sequence of CVH29, a unique protein present in heather honey and nectar, with a germin-like protein GER1 from a gene bank homology search (BLAST). Figure 13 shows the deduced DNA sequence of the N-terminal 30 protein sequence of CVH29. The degenerated primers prat 176 and prat 177 are underlined (A) . The DNA sequence of the PCR product obtained with prat 176 and prat 177 performed on genomic DNA of heather is shown in B. The gene-specific primers prat 207 and prat 206 used to perform 5'RACE PCR 35 reactions on cDNA from heather flowers are underlined. SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 11 Figure 14 shows the DNA sequence of four independent clones obtained by 5'RACE PCR with prat 207 and prat 206 on cDNA of heather flowers. The ATG translation start of the putative signal sequence is boxed. The end of the putative 5 signal sequence and the start of the mature protein are indicated by arrows. Figure 15 is the sequence of the synthetically produced DNA molecule encoding the signal sequence CVSP (boxed) with 10 linkers. Figure 16 is the schematic representation of the plasmid pCV1. Not all restriction sites are indicated. 15 Figure 17 is the schematic representation of the plasmid pCV2. Not all restriction sites are indicated. Figure 18 is the schematic representation of the plasmid pCV3. Not all restriction sites are indicated. 20 Figure 19 is the DNA sequence of the full length cDNA of FBPl5. The translation start (ATG) and translation stop (TAA) are boxed. The MAD-box and K-box region are underli ned. 25 Detailed description of the invention This invention provides processes of producing transgenic 30 plants that produce recombinant proteins in nectaries and nectar that is collected by foraging honeybees. This invention gives evidence that honeybees process protein containing nectar into honey that contains the unaltered protein in a concentrated form. Subsequently, the desired 35 protein can be purified from the honey. SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 12 To express recombinant proteins in nectaries of transgenic plants, a translational fusion of an isolated DNA sequence from a promoter region upstream of a sequence encoding a protein that is expressed in nectaries with a sequence 5 encoding the recombinant protein has to be carried out. Preferably, the isolated DNA sequence from a promoter region is upstream of a sequence that is specifically or highly expressed in nectaries. 10 The invention relates to a DNA sequence isolated from Petunia hybrida that encodes a protein indicated NEC1 or a homologous protein or part thereof. A homologous protein has at least 65% homology with the amino acid sequence given in SEQ ID NO:1. The cDNA sequence of the NECI gene is 15 given in Fig. 4 and in SEQ ID NO:4. The deduced amino acid sequence of the NECl gene is given in SEQ ID NO:1. The NECl gene shows strong expression in the nectaries and in a very localised region of the anther filaments of Petunia hybri da. The deduced amino acid sequence of NECI predicts a 20 membrane bound protein. The precise function of the gene has not been elucidated yet, but considering the phenotype of transgenic plants that ectopically express NECl in the leaves, a role in sugar metabolism of NECl is apparent. 25 The present invention also relates to homologous DNA sequences that can be isolated from other organisms, preferably plants, using standard methods and the already known DNA sequence of the NECl gene. More precisely, it is also possible to use DNA sequences which have a high degree 30 of homology to the DNA sequence of the NECl gene, but which are not completely identical, in the process according to the invention. The use of sequences having homologies between 85 and 100 % is to be preferred. DNA sequences can also be used which result from the sequence shown in SEQ ID 35 NO:4 by insertion, deletion or substitution of one or more nucleotides. This includes naturally occurring variations or variations introduced through targeted mutagenesis or SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 13 recombination. The DNA sequence shown in SEQ ID NO:4 can also be produced by using DNA synthesis techniques. The invention also relates to a DNA sequence isolated from 5 Petunia hybrida that encodes a MADS box protein indicated FBP15 or a homologous protein or part thereof. The cDNA sequence of FBPl5 is given in SEQ ID NO:5. FBP15 shows exclusively expression in the nectaries of Petunia hybrida. The function of FBPl5 is unknown. 10 The present invention also relates to homologous DNA sequences that can be isolated from other organisms, preferably plants, using standard methods and the already known DNA sequence of FBP15. More precisely, it is also possible to use DNA sequences which have a high degree of 15 homology to the DNA sequence of FBP15, but which are not completely identical, in the process according to the invention. The use of sequences having homologies between 85 and 100 % is to be preferred. DNA sequences can also be used which result from the sequence shown in SEQ ID NO:5 by 20 insertion, deletion or substitution of one or more nucleo tides. This includes naturally occurring variations or variations introduced through targeted mutagenesis or recombination. The DNA sequence shown in SEQ ID NO:5 can also be produced by using current DNA synthesis techniques. 25 Further, this invention provides an isolated DNA sequence from the promoter region upstream of a nectary-specific expressed sequence, which nectary-specific expressed 30 sequence encodes a protein comprising the amino acid sequence given in SEQ ID NO:1, or a homologous protein that is expressed in nectaries. Furthermore, this invention provides an isolated DNA sequence from the promoter region upstream of an isolated DNA sequence from the promoter 35 region upstream of a nectary-specific expressed sequence, which nectary specific sequence encodes a protein compri SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 14 sing the amino acid sequence given in SEQ ID NO:2, or a homologous protein that is expressed in nectaries. More specifically this invention provides an isolated DNA 5 sequence from the promoter region upstream of a nectary specific expressed sequence, which nectary-specific expres sed sequence has: a) a nucleotide sequence given in SEQ ID NO:4, or b) a nucleotide sequence obtainable by hybridisation with 10 the nucleotide sequence of (a) or with a fragment of (a). In a more specific embodiment this invention provides an isolated DNA sequence from the promoter region upstream of a nectary-specific expressed sequence, obtained from a 15 plant of Petunia hybrida, the sequence consisting essenti ally of the sequence given in SEQ ID NO:7, or a functional fragment thereof having promoter activity. In a further aspect, the invention provides an isolated DNA 20 sequence from the promoter region upstream of a nectary specific expressed sequence, which nectary-specific expres sed sequence has: a) a nucleotide sequence given in SEQ ID NO:5, or b) a nucleotide sequence obtainable by hybridisation with 25 the nucleotide sequence of (a) or with a fragment of (a). In a more specific embodiment this invention provides an isolated DNA sequence from the promoter region upstream of a nectary-specific expressed sequence, obtained from a 30 plant of Petunia hybrida, the sequence consisting essenti ally of the sequence given in SEQ ID NO:8 , or a functional fragment thereof having promoter activity. Further, this invention provides an isolated DNA sequence 35 comprising the coding region for a signal peptide, wherein the information contained in the DNA sequence permits, upon translational fusion with a DNA sequence encoding a protein SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 15 that is expressed in nectaries, targeting of the protein to nectar. More specifically, the DNA sequence comprises the nucleotide sequence given in SEQ ID NO:6 obtained from a plant of Calluna vulgaris, or a nucleotide sequence obtai 5 nable by hybridisation with the nucleotide sequence given in SEQ ID NO:6. The use of sequences having homologies between 95 and 100 % is to be preferred. DNA sequences can also be used which result from the sequence shown in SEQ ID NO:6 by insertion, deletion or substitution of one or more 10 nucleotides. This includes naturally occurring variations or variations introduced through targeted mutagenesis or recombination. The DNA sequence shown in SEQ ID NO:6 can also be produced by using DNA synthesis techniques. The signal peptide CVSP was isolated from nectar of Calluna 15 vulgaris flowers and from honey processed by honeybees that collected the nectar. The function of CVSP in heather nectaries is to target the germin-like protein to nectar. The DNA sequence CVSP can also be used to target other proteins to nectar in plant species. 20 A subject of the present invention is the use of DNA sequences for producing recombinant proteins in nectar of plants, wherein the protein is produced in nectaries and targeted to nectar, and wherein expression in nectaries is 25 achieved by using a DNA sequence consisting of the promoter region upstream of a DNA sequence that is expressed in nectaries, and wherein secretion in nectar is achieved by using a DNA sequence that encodes a signal sequence that targets the recombinant protein to nectar. In a further 30 aspect the present invention relates to processes wherein a recombinant protein is expressed in other plant tissues than the nectaries and wherein the biochemical composition of nectar is changed as a consequence of the recombinant gene expression. The present invention also relates to 35 processes wherein a recombinant protein is expressed in nectaries of a transgenic plant, wherein the biochemical composition of nectar or the nectar secretion is changed as SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 16 a consequence of this protein expression. In particular, it relates to processes where the recombinant protein is an enzyme that interferes with the sugar metabolism in necta ries. 5 The production of a recombinant protein in nectaries and nectar is achieved by integrating into the genome of the plants a recombinant double-stranded DNA molecule compri sing an expression cassette having the following constitu 10 ents and expressing it: i) a promoter functional in nectaries of plants, ii) a DNA sequence encoding a protein which is fused to the promoter, iii) a DNA sequence encoding a signal peptide that 15 targets the recombinant protein to nectar, which is translationally fused to the DNA sequence enco ding the recombinant protein, and optionally iv) a signal sequence functional in plants for the transcription termination and polyadenylation of 20 an RNA molecule. Such DNA molecules are also subject of the invention. The present invention provides an example of such a DNA molecu le that contains the described expression cassettes in the 25 form of plasmid pCV3 (Fig. 18), which comprises the promo ter region of the NECl gene from petunia, the signal sequence CVSP from heather, the coding region of the reporter gene GUS and the NOS terminator. In principle, any promoter that is active in the nectaries of plants can be 30 used as promoter. The promoter is to ensure that the chosen gene is expressed in nectaries. Also, in principle, any signal sequence that targets the expressed protein to nectar can be used as a signal sequence. The signal sequen ce is to ensure that the protein is excreted in nectar. 35 Furthermore, any sequence that encodes a recombinant protein in nectaries can be used in the present invention. Preferably, the subject of this invention relates to DNA SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 17 sequences that encode proteins to be used for pharmaceuti cal purposes. It is also possible to use the invention to produce proteins for other purposes, e.g. enzymes for biotests or antioxidants for food additives. Furthermore, 5 it is possible to use the invention to produce metabolites in nectar that attract predators of pest insects or that kill or repel pest insects. In another aspect it is possi ble to use the invention to produce metabolites in nectar that modify the attractiveness of the plant for pollinating 10 insects or improve the health of pollinating insects. It is also possible to use DNA sequences that encode proteins that modify the nectar composition or the sink strength of nectaries. This means that the recombinant protein interferes with metabolic pathways in the necta 15 ries, resulting in changed levels of compounds that are already present in nectar, or the formation of new com pounds in nectar. In addition, the present invention also relates to expres sion cassettes that contain the above mentioned DNA sequen 20 ces, except for a signal sequence. The recombinant protein is then only expressed in the nectaries, but not targeted to the nectar. Consequently, the expression of the recombi nant protein in the nectaries can still affect nectar composition. 25 In a further aspect, the present invention also relates to expression cassettes that contain DNA sequences coding for a protein that is expressed in other tissues than the nectaries. The expression of the recombinant protein affects changes in the biochemical composition of nectar or 30 in nectar secretion. Finally, the present invention also relates to non-transge nic plants that produce metabolites in nectar that can be harvested and purified from honey that is produced by honeybees that collect this nectar. Examples for these 35 metabolites are alkaloids, terpines, amino acids, proteins, pigments and volatiles. SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 18 A preferred embodiment of the process discussed above provides that the expression cassette is transformed to a plant species that produces nectar. Preferably, the recom binant protein is produced in nectar of plants that are 5 visited by honeybees that collect the nectar. Honeybees collect floral as well as extrafloral nectar. The present invention relates to plants that produce recombinant proteins in floral or extrafloral nectar. In addition, the present invention also relates to plants that produce 10 recombinant proteins in other plant organs, said plant organs producing an exudate that is collected by insects, preferably bees, and processed into honey. A particularly preferred embodiment of the present invention are plants that can be grown under controlled conditions. Controlled 15 conditions are greenhouses or field facilities where transgenic plants can be grown according to the safety rules that are required. Preferably, the controlled condi tions are such that bee colonies that perform normal foraging behaviour can be maintained in the same compart 20 ment during the flowering period. Preferred plants origina te from the Brassicaceae family, in particular Brassica napus. Examples 25 Example 1: Cloning of NEC1 The NECI cDNA was isolated using the mRNA Differential 30 Display system (Genhunter Corporation, Brookline USA). The isolation of total RNA from nectaries, sepals, petals, stamens and pistils from open flowers and from young leaves of Petunia hybrida was done according to Verwoerd et al. (1989) . Two independent RNA isolations were performed on 35 nectaries as well as on pistils. A DNase treatment was carried out on each RNA sample, using the RNA MessageCleanTM Kit (Genhunter Corporation Brookline USA, cat. No. M601). A SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 19 reverse transcription reaction was carried out on 0.1 jg RNA of each sample, using the oligo-dT primer T12MG from the Genhunter Kit. Following the protocol, PCR reactions were carried out using the arbritary primers AP11-AP15 in 5 combination with primer T12MG from the Kit. The PCR pro ducts were loaded on a sequencing gel and after electropho resis the gel was blotted on 3M paper, dried and exposed to X-ray film (Figure 1). Two adjacent nectary-specific bands were cut out from the blot and the DNA was purified accor 10 ding to the manual. Reamplification of the fragment was carried out using the oligo-dT primer T12MG and the arbri tary primer AP15. After electrophoresis, the PCR product was extracted from the agarose gel by freezing the isolated fragment in liquid nitrogen, followed by centrifugation. 15 DNA was precipitated by adding 1/10 volume 1% HAc, 0.1M MgCl 2 and 2.5 volume of 96% ethanol to the supernatant. The pellet was dissolved in 10 pl TE buffer. The fragment, now called DD18a, was cloned into a PMOSBlue T-vector (RPN 1719, Amersham Little Chalfont UK) giving the vector 20 pDD18a. The nucleotide sequence of this 3' cDNA clone was determi ned by the dideoxynucleotide chain termination method (ABI
PRISM
T M Ready Reaction DyeDeoxy T m Terminator Cycle Sequen cing Kit, P/N 402078, Perkin Elmer) and is shown in Figure 25 2. The DNA fragment has a length of 460 nucleotides. The missing 5' part of the cDNA was isolated using the Marathon TM cDNA Amplification Kit of Clontech (catalog K1802-1) and following the procedure as described in the manual. Brief ly, Poly A+ RNA was isolated from nectaries of Petunia 30 hybrida flowers. After double stranded cDNA synthesis, adapters were ligated and a 5'RACE reaction was carried out using the adapter primer AP1 supplied in the kit and a gene-specific primer prat 122. The nucleotide sequence of prat 122 is: 5'-gtgggaaggctatgctacaagc-3' (Figure 2). The 35 PCR product was diluted 10x and 1 pl was used in a second 5' RACE reaction with the nested adapter primer supplied by the kit (AP2) and the nested gene-specific primer prat 119 SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 20 (Figure 2). The nucleotide sequence of prat 119 is: 5' ccttctccatggactgcaatgcg-'3 . After gel electrophoreses a fragment of +850 bp was obtained that hybridised with clone DD18a. The fragment, now called RC8, was extracted 5 from the gel, purified and cloned into a PMOSBlue T-vector as described above. The sequence is shown in Figure 3. The combined (overlapping) sequences of clones DD18a and RC8 are shown in Figure 4, comprising the full length cDNA of a gene called NECl hereafter. The NECl clone has a length of 10 1205 nucleotides and encodes for a polypeptide of 265 amino acid residues. Based on the deduced amino acid sequence, high homology was found with a cDNA that is associated with Rhizobium-induced nodule development in the legume Medicago trunculata (MtN3, gene bank number: gn1/PID/e274341) . The 15 percentages of identity and similarity are 47% and 72% respectively. Analysis of the predicted protein, using the CAOS/CAMM programme (Protein analysis 1991, Genetics Computer Group inc., Wisconsin USA), shows that the putati ve protein structure resembles membrane proteins, having 20 six evenly spaced hydrophobic loops that traverse the cell membrane. In addition, a signal sequence is predicted at the N-terminus, while the C-terminus is highly hydrophilic. Highest homology with MtN3 is found in the N-terminal signal sequence, the first two membrane-spanning loops and 25 the last two membrane-spanning loops. The C-terminal hydrophilic part shows the lowest homology (28% identity, 30% similarity) . The function of NECl has not yet been determined. 30 Example 2: Cloning of FBP15 Petunia MADS box cDNA clones were isolated from a cDNA 35 library made from nectaries of Petunia hybrida flowers. The cDNA library was constructed using the lambda ZAP cloning vector (Stratagene, La Jolla USA, catalog nr. 200400 SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 21 200402). The library was screened under low stringency hybridisation conditions with a mixed probe comprising the MADS box regions of Floral binding protein gene FBP2, FBP6 and pMADS3 (Angenent et al., 1993, 1994, Tsuchimoto 1993). 5 The hybridizing phage plaques were purified using standard techniques. Using the in vivo excision method, E.coli clones which contain a double-stranded Bluescript SK plasmid with the cDNA insertion between the EcoRI and XhoI cleavage site of he polylinker were generated. Cross 10 hybridisation of the purified clones revealed 3 independent clones that did not cross hybridise with previously isola ted FBP cDNA's and which were designated FBP15, FBP16 and FBPl7. The nucleotide sequence of FBP15 was determined by the dideoxynucleotide-mediated chain termination method and 15 is depicted in SEQ ID NO:5. The FBP15 cDNA clone has a length of 1157 nucleotides and encodes a peptide of 222 amino acid residues. All characteristics of a MADS box protein are present in FBP15: a N-terminal located MADS box region which shows a high degree of similarity with other 20 MADS box proteins, and a K-box in the middle of the protein with an alpha helical structure. FBPl5 is most similar to the tobacco MADS box protein NAG1, which is an Agamous homolog and expressed in whorl 3 and 4 (Huang et al., 1996, Mizukami et al., 1996). 25 Example 3: Expression of FBP15 Expression of FBPl5 was determined by standard Northern 30 blot hybridisation experiments. A DNA fragment comprising the complete cDNA of FBPl5 was used as a probe. High stringency hybridisation and washing conditions were used. Using 10 p4g of total RNA from various petunia tissues, expression of FBP15 was only detectable in nectaries. Using 35 10 pg of mRNA from various tissues, prepared by using the kit and protocol of the Quickprep Micro mRNA Purification SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 22 Kit (Pharmacia Biotech), expression of FBPl5 was only detectable in nectaries as shown in Figure 5B. The expression in the ovary and nectaries was determined by in situ hybridisation using a DIG labelled antisense RNA 5 probe corresponding to the full length cDNA of FBPl5. In vitro antisense RNA transcripts were made using T7 RNA polymerase. A standard protocol for in situ hybridisation was used as described by Canis et al., 1994. A hybridizing signal was observed evenly strong in all cells of the 10 nectary tissue. Example 4: 15 Expression of NECl The RNA expression of NECl was determined by standard Northern blot hybridisation experiments. A DNA fragment comprising the complete sequence of the Differential 20 Display clone DD18 (Figure 2) was used as a probe. Using 10 jig of total RNA from various petunia tissues, strong expression of NECl was detectable in nectaries and weak expression in anthers. No expression was detectable in other floral organs, in leaves or in roots (Figure 5A). 25 The expression in the ovary and nectaries was determined by in situ hybridisation using a DIG labelled antisense RNA probe corresponding to the nucleotides 79 to 1036 of NECl cDNA, comprising the coding region and part of the 3' untranslated region. A clone containing this sequence was 30 obtained by PCR on adapter-ligated cDNA, using two gene specific primers prat 122 and prat 129 (Figure 4) . The nucleotide sequence of prat 122 is: 5'-gtgggaaggctatgctaca agc-3'", comprising the nucleotides 1015 to 1036 of the NECl cDNA. The nucleotide sequence of prat 129 is: 5' 35 gggatccatqqcgcaattacqtqctatq-3' , comprising the nucleoti des 79 to 100 of the NECl cDNA. The gene-specific region of the primers is underlined. The primer contains an extra SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 23 BamHI and NcoI site at the 5'end. A PCR fragment of 958 nucleotides was obtained and cloned into a PMOSBlue vector. The fragment was subcloned in a vector containing the T7 promoter and in vitro antisense RNA transcripts were made 5 using T7 RNA polymerase. A standard protocol for in situ hybridisation was used as described by Cands et al., 1994. Strong hybridizing signals were observed in the outer cell layers of the nectaries (Figure 6A) 10 Example 5: Isolation of NECl promoter fragment 15 The promoter fragment of NECl was cloned using the genome walker protocol (PT3042-1) and kit as provided by Clontech Laboraties. Briefly, genomic DNA from Petunia hybrida was digested with 5 different blunt cutting restriction enzy mes. GenomeWalker adapters were ligated and PCR reactions 20 were carried out on each GenomeWalker "library" with a gene specific, reversed primer prat 148 and the adapter primer from the kit (AP1). The nucleotide sequence of prat 148 is: 5'-ccaagaaggccaaatatgaaagac-3' comprising the nucleotides 105 to 128 of the NECl cDNA (Figure 4) . PCR products were 25 subjected to a second round of PCR, using the nested adapter primer AP2 and the nested gene specific, reversed primer prat 149. The nucleotide sequence of prat 149 is: 5' -aagtcatcagcacgtaattgcgcc-3', comprising the nucleotides 81 to 104 of the NECl cDNA. From the second PCR a 2 kb 30 fragment was isolated from the StuI library, which was cloned in the PMOSBlue T-vector, yielding the construct pMA5-10. Figure 7 (SEQ ID NO:7) shows the DNA sequence of the NECl promoter in the construct pMA5-10, including the translation start of NECl cDNA. 35 SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 24 Example 6: Construction of NECl promoter-GUS A PCR reaction was performed on pMA5-10 (example 5), using 5 the forward vector primer U19 of pMOSBlue and the gene specific primer prat 169. The nucleotide sequence of prat 169 is: 5'-cgctgcagcgccatanttttttttaqtgaaqcccc-3'. The gene-speci fic region is underlined. The primer contains an NcoI and 10 BglII restriction site at the 3' end. The PCR product was digested with KpnI and NcoI and ligated into a pBluescript derived vector (pMO4) that contains the NTM19 promoter (Custers et al., 1997), the reporter gene GUS and the nos terminator. The KpnI/NcoI NTM19 promoter fragment was 15 replaced, resulting in a NECl-promoter/GUS translational fusion. The resulting plasmid pNEP1 was digested with SmaI to release the NECl promoter/GUS/nos fragment and this fragment was ligated into a derivative of the binary plasmid pBIN (Bevan, 1984) yielding the binary plasmid 20 pBNEP1 (Figure 8). pBNEP1 was introduced into Agrobacterium tumefaciens strain LBA4404 or C58pMP90 by electroporation. Plasmid DNA from the Agrobacterium transformants was isolated and the structure of the binary vector was veri fied by restriction analysis and PCR. 25 Example 7: Generation of transgenic Petunia plants Agrobacterium strain LBA4404 transformants were used to 30 transform Petunia hybrida using leaf discs as described by Horsch et al. (1985). After shoot and root induction on kanamycin selection media, plants were transferred to soil in the greenhouse. 35 SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 25 Example 8: Histochemical GUS assay Different plant parts of Kanamycin-resistant plants trans 5 formed with the pBNEP1 construct were analysed for the distribution of -glucuronidase activity (GUS) using the method described by (Jefferson et al., 1987). In transgenic plants with high expression levels diffusion of reaction products to other tissues was observed. To avoid this 10 spreading a modified GUS assay was used. Briefly, tissues were pre-treated with 90% cold acetone at -20 0 C for 1 h, then rinsed three times 20' with 100 mM phosphate buffer containing 1 mM potassium ferricyanide. After this treat ment the standard GUS assay was performed with the modifi 15 cation that ferricyanide was excluded from the reaction mixture. Example 9: Results histochemical GUS assay 20 In very young flowers (<1,4 cm) no blue staining was observed, in flowers of 2-4 cm weak blue staining of the nectaries was observed. In flowers of (4-6 cm) strong blue staining was observed in the nectaries (figure 6B) and in a 25 very restricted region of the upper part of the anther filaments (Figure 6C) . GUS expression was highest in the outer cell layers of the nectary parenchyma. In cross sections of the anther filaments GUS expression was obser ved in all cells except in the xylem of the inner vascular 30 bundle. Example 10: Protein analysis of heather honey and nectar 35 Samples of pure heather honey, together with samples of rapeseed, clover, wattle bark and lavender honey were di luted, dialysed and loaded on a 12% SDS page gel (Laemmli, SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 26 1970). All honey samples showed several identical high molecular weight protein bands. Heather honey contained 2 unique protein bands of 29 and 50 kDa (Figure 9). The proteins were named CVH29 and CVH50 (CVH stands for Calluna 5 vulgaris honey) . To determine the origin of the proteins, nectar and honey samples of rapeseed and heather were prepared and loaded on a 12% SDS page gel. The high molecu lar weight protein bands of around 70 kDa that are present in all honey samples were not observed in rapeseed or 10 heather nectar (Figure 10) . These proteins are added by honeybees during honey processing. Proteins CVH29 and CVH5O are present in heather honey and heather nectar, but not in nectar of rapeseed. Therefore, it was concluded that CVH29 and CVH50 are secreted in nectar of heather and can be 15 recovered from honey derived from this nectar. The protein concentration in the heather honey we tested was around 0.5%. Example 11: 20 N-terminal sequence analysis of CVH29 and CVH50 Honey samples were loaded on an SDS PAGE gel and after electrophoreses the gel was blotted on a PVDF membrane. After staining the CVH29 and CVH5O bands were cut out from 25 the blot and N-terminal sequencing was performed on both proteins. The N-terminal sequence of CVH50 is: SVLDFCVADPS LPDGPAGYSCTEPSTVTSQDF. The N-terminal sequence of CVH29 is: SVLDFCVADPSLPDGPAGYSCKEPAKVTVDDFVFHGLGTA. A gene bank homology search (BLAST) showed high amino acid sequence 30 homology (63%) with germin-like proteins isolated from Arabidopsis (Figure 12). 35 SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 27 Example 12: Identification signal sequence of CVH29 Because the germin-like protein CVH29 is excreted in 5 heather nectar it was expected that part of the cDNA encodes a signal sequence. Based on the N-terminal amino acid sequence, degenerated primers were designed. The sequence of the forward primer prat 176 is: 5'-gayttyt gygtngcngaycc-3' (y= c or t, n= c, t, a or g) . The sequence 10 of the reversed primer prat 177 is: ccrtgraanacraartcrtc (r= g or a) . A PCR reaction performed on genomic DNA of heather yielded a 99 bp DNA fragment. The fragment was sequenced and two reversed, gene-specific 5' primers were designed to clone the 5' cDNA by "Marathon cDNA racing" 15 using the kit and protocol of Clontech laboratories (proto col PT1115-1, Clontech Palo Alto USA). The sequence of gene-specific primer prat 207 that was used is: 5' ggtgactttagagggctccttgc-3' , the sequence of gene-specific nested primer prat 206 is: 20 5'-gctccttgcaggagtagcctgc-3' (Figure 13). RNA was isolated from open flowers of heather and mRNA was prepared using the Pharmacia quickprep micro mRNA kit. After cDNA synthe sis and adapter ligation a PCR reaction was performed, using the adapter primer AP1 and the gene-specific primer 25 prat 207. The PCR product was used for a second PCR, using adapter primer AP2 and the nested gene-specific primer prat 206. A single fragment of around 300 nucleotides was obtained and cloned in a PMOSBlue T-vector. Four clones were sequenced. Figure 14 shows that three clones were 30 identical and one clone had two different nucleotides in the untranslated 5' region. A putative signal sequence of 17 amino acids was identified between the ATG start codon and the first codon of the mature protein CVH29 that was identical in all four clones. The nucleotide sequence of 35 the putative signal sequence (SEQ ID NO:6) is: 5'-atgtttcttccaattctcttcaccatttccctcctcttctcctcctcccatgct 3'. SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 28 Example 13: Construction of an expression cassette for excretion of proteins in nectar 5 To clone the NECI promoter into a PMOSBlue vector a PCR reaction was carried out on pMA5-10 (example 5) using the forward primer prat 247 and the reversed primer prat 248 (Fig. 7). Prat 247 contains an extra Pstl restriction site. The NdeI restriction site of prat 248 coincides with the 10 ATG translation start of NECl. The nucleotide sequence of prat 247 is: 5'-ggctgcagqagtqttctttgatagaata-3', the nucleotide sequence of prat 248 is: 5'-cgcca tatgtttttttatqqaaqcccc-3'. Gene-specific regions are underlined. A 1,8 kb promoter fragment was obtained and 15 cloned into a pMOSBlue vector, yielding the plasmid pNECP. A DNA molecule encoding the signal sequence CVSP as depic ted in SEQ ID NO:6 was produced by synthesis and subsequent annealing of two oligo molecules prat 245 and prat 246. The 20 sequence of prat 245 is: 5'tatqttccttccaattcttttcactatttct cttcttttctcttcttctcatacttctgttcttgatttc'3, the sequence of prat 246 is: 5'gatccgaaatcaagaacagaaqcatqaqaagaagagaaaagaa gagaaataqtgaaaagaattqqaaggaaca'3. The region encoding the signal sequence CVSP is underlined. To ensure correct 25 cleavage of the signal peptide, the linkers were extended with the coding region for the first five amino acids of the mature germin-like protein (Fig. 13) . The codon usage of the signal peptide sequence was optimised for Arabidop sis. By addition of a BamHI restriction site at the 3' end, 30 2 extra amino acids were linked in frame to the mature protein. The resulting DNA molecule is shown in Figure 15. The fragment was ligated into a Ndel/BamH1 cut PMOSBlue vector, yielding the plasmid pCVSP. 35 pNECP was digested with NdeI and PstI to release the NECl promoter fragment which was cloned into the Pstl/Ndel cut SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 29 pCVSP, yielding the plasmid pCV1. A schematic representati on of pCV1 is given in Figure 16. A 250 bp long fragment containing the NOS terminator 5 sequence (NOST) was obtained by PCR, using the forward primer prat 251 and the reversed primer prat 252 on DNA of pRAP 33, which is a pUC 19 derived plasmid. Prat 251 adds a SacI and XhoI site, prat 252 adds a SmaI and EcoRI site. The sequence of prat 251 is: 5'-gggagctcgagtcqttcaaa 10 catttqqcaataaag-3'. The sequence of prat 252 is: 5'-cgaatt cccgggatctaqtaacatagatgacac-3' . The NOST-specific regions are underlined. The PCR product was cloned into pCR-Script TM Amp SK(+) Cloning Kit (Catalog 21188-21190, Stratagene La Jolla USA), yielding the plasmid pCR-NOST. pCR-NOST was 15 digested with Sac and EcoRi and the resulting fragment was cloned into the pUC 19 (ClonTech), derived plasmid pUCAP yielding the plasmid pCVNOS. The plasmid pGUSN358 was purchased from Clontech (catalog 20 6030-1) containing the reporter gene GUS in pUC 119, modified to destroy the N-linked glycosylation site within the 1.814 Kb GUS coding sequence. A PCR reaction was carried out with gene-specific primers prat 249 and prat 250, yielding a fragment that contains the GUS gene coding 25 region and a BamH1 restriction site at the 5'end and a Sac restriction site at the 3'end. The sequence of prat 249 is: 5'-ccggatccatqttacqtcctqtagaaacc-3' . The sequence of prat 250 is: 5'-gggagctcccaccqaqqctatag-3'. The GUS specific regions are underlined. Subsequently, the PCR fragment was 30 digested with BamHI and SacI and ligated into the BamHI/Sa cI cut plasmid pCVNOS, yielding the plasmid pCV2. A schema tic representation of pCV2 is given in Figure 17. pCV1 is digested with PstI and BamHI and the resulting 35 fragment is cloned into the PstI/BamHI cut plasmid pCV2, yielding the plasmid pCV3. A schematic representation of pCV3 is given in Figure 18. pCV3 is digested with AscI and SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 30 SmaI and the resulting fragment is cloned into a derivati ve of the binary plasmid pBIN, yielding the binary plasmid pBCV3. pBCV3 was transferred from Escherichia coli to the Agrobacterium tumefaciens strain LBA4404 and C58pMP90 by 5 electroporation. The transformed Agrobacterium strain was used to transform Arabidopsis and petunia. Example 14: Protein production in nectar 10 Using the GUS reporter gene, GUS activity in nectar of transgenic plants was measured according to the method as described by Jefferson et al., (1987). Briefly, the assay was carried out by measuring the amount of methyl umbelli 15 ferone (MU) produced by GUS fluorometrically by emission of light of 455 nm. The absolute emission was corrected for artificial quenching using an internal standard of 1nM MU (Angenent et al., 1993). 20 Example 15: Feeding experiments with honeybees In September 1996 a beehive located outside was supplied with a 25% sucrose solution supplemented with 2% BSA 25 (bovine serum albumin). After 3 weeks the bees had consumed 15 litters of the feeding solution and honey was harvested from the hive. Although the flowering season had mostly past, bees still foraged on flowers to collect nectar outside. Therefore, the honey produced during this period 30 is derived from a mixture of the feeding solution and nectar from flowers. An SDS page protein gel was loaded with dialysed honey samples and sugar/BSA solutions. Figure 11 shows that the protein band of BSA was present in all the samples tested and no qualitative changes were observed 35 in the honey samples compared to the sugar/BSA solutions. The BSA concentration in honey was 1.5 times higher than in the feeding samples, demonstrating that protein is concen SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 31 trated in honey. Honeybees that foraged on the sugar/BSA solution did not show any aberrant behaviour and the colony developed normally. 5 Example 16: Process of honey production from transgenic plants Twohundred and fifty transgenic plants that each produce 10 recombinant protein in nectar were grown in a greenhouse of 25 square meters. The facilities were adjusted according to the safety rules according to European law, including safety measures to prevent in- or outflow of insects. A beehive adjusted for small populations, containing around 15 200 worker honeybees and a queen, was placed in the green house when the plants were flowering. When a queen is present, she will start laying eggs and larvae will come out. The presence of brood stimulates the bees to collect nectar and process it into honey. After 2-3 weeks bees 20 processed the nectar into honey and stored in sealed cells of the honeycomb. Under the described conditions the amount of honey that can be harvested is 250-1000 grams. Example 17: 25 Ablation of nectaries By introducing the highly sensitive Rnase BARNASE in plant cells, under the control of a tissue-specific promoter, cell ablation can be achieved in very specific tissues or 30 organs. Ablation of nectaries can be applied to decrease the attractiveness of plants for pest insects that forage on the nectar that is secreted by nectaries. In addition, plants without nectaries can be obtained that are more resistant to bacterial and fungal infections. An example is 35 given for the ablation of nectary tissue by expressing bacterial BARNASE in nectaries, using the NEC1 promoter. SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 32 Plasmid DNA of pNEP1 (example 6) was digested with KpnI and NcoI to release the 1800 bp NECI promoter fragment. The purified promoter fragment was ligated into a pWP90 derived vector, upstream of the BARNASE-BARSTAR bacterial operon 5 construct (Hartley, 1988) . The construct contains a 35SCaMV terminator of polyA signal cauliflower mosaic virus termi nator sequence downstream of the BARNASE-BARSTAR operon. The resulting plasmid pWP126 was digested with KpnI/ XhoI to release the NECl-promoter/BARNASE-BARSTAR/CamVpolyA 10 fragment and this fragment was ligated into a pBIN-derived vector pBIN Plus. The recombinant vector was transferred via Agrobacterium tumefaciens (LBA4404) to petunia variety W115. Transgenic petunia plants were selected with flowers without nectaries or underdeveloped nectaries. 15 Many promoters are less specific than can be concluded based on promoter/GUS expression is concluded. Because the bacterial BARNASE is highly cytotoxic at very low concen trations it can be preferred to protect other plant tissues 20 by expression of a ribonuclease inhibitor gene under the control of a weak, constitutive promoter (e.g. NOS promo ter) or a tissue-specific promoter that is not active in the tissues where cell ablation is to be achieved (Mariani et al., 1992, Beals et al., 1997). 25 30 Example 18: Ectopic nectary development MADS box genes regulate floral meristem and floral organ 35 identity. Ectopic expression of MADS box genes can change the developmental fate of floral organs or cells. Transge nic petunia plants ectopically expressing FBP11, an ovule SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 33 specific MADS box gene, develop ovule-like structures on sepals and petals ( Colombo et al., 1995) . FBP15 is a nectary-specific MADS box gene, involved in the molecular regulation of nectary development. In petunia nectaries 5 develop at the base of the carpel. Ectopic expression of FBPlS in petunia may result in the development of nectaries on other organs of the flower or on vegetative parts of the plant. An example is given of a gene construct that, when transformed to a plant, results in ectopic expression of 10 FBPl5. FBP15 was amplified using a 5' primer that hybridises with FBP15 sequences just upstream of the ATG translation start site and a 3' primer that hybridises with FBP15 sequences 15 just downstream the translation stop site. The 5'primer contains a NcoI recognition site, the 3'primer contains a BamHI recognition site. After the sequence was confirmed, the amplified FBPl5 fragment was inserted as a BamHI/NcoI fragment into the binary vector pCPO31. This binary vector 20 was derived from pPCV708, as described by Florack et al. (1994), and contains three expression cassettes with a multiple cloning site between the left and right T-DNA borders. The cDNA was cloned in sense orientation between a modified CaMV 35S promoter and the nopaline synthase 25 terminator sequence. The chimerical gene construct was transferred via Agrobacterium GV3101 to petunia variety W115, using the transformation method as described in example 7. Transgenic petunia plants were selected that show ectopic nectary development. 30 Example 19: Modification of sugar composition and nectar secretion Although sugar content of nectar from different petunia 35 W115 flowers shows some variation, the ratio between hexoses and sucrose is very stable. Down-regulation or up regulation of genes involved in the establishment of the SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 34 ratio between hexoses and sucrose in nectar will therefore modify nectar composition. An example is given for anti sense expression of a petunia-derived invertase gene. 5 PCR primers were designed that hybridise with the cDNA of an invertase gene cloned from Solanum tuberosum. The 5' primer 5' -AAGGACTTTAGAGAGACCCGACCACTGCTGG-3'and the 3' primer 5' -AAATGTCTTTGATGCATAATATTTCCCATAATC-3' were used for a PCR reaction on genomic DNA of petunia to yield a 10 fragment of around 420 bp. The fragment was sequenced and cloned into a pMOSBlue vector to used as a probe to screen a petunia nectary-specific cDNA library. Hybridizing phage plaques were purified and cDNAs were retrieved by in vivo excision as described in example 2. The expression of the 15 cDNA's was determined by Northern blotting as described in example 3 and the sequence of a nectary-specific invertase was determined as described in example 2. The invertase gene was amplified using a 5' primer that hybridises with sequences just upstream of the ATG translation start site 20 and a 3' primer that hybridises with sequences just down stream of the translation stop site. Extra restriction enzyme recognition sites were generated to allow cloning of the cDNA in sense (overexpression) or antisense direction into the binary vector pCPO31 as described in example 18. 25 The chimerical gene constructs are transferred via Agrobac terium GV3101 to petunia variety W115, using the transfor mation method as described in example 7. Transgenic petunia plants were selected that exhibit modified sugar compositi on in nectar. 30 Example 20 Modification of plant development A DNA which is the NECl gene or a homologous gene is 35 introduced into a plant cell, the said DNA being induced by promoter elements controlling the expression of the introduced DNA in such a way that transcription produces SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 35 sense RNA. Plants were regenerated from the transgenic cells as described in example 7. Plants that ectopically express the NECI gene exhibited modified leaf morphology and modified sugar composition. Furthermore, plants that 5 ectopically express the NECl gene showed a delay in flowe ring time. 10 REFERENCES: Angenent G.C., Franken J., Busscher M., Colombo L. and van Tunen A.J., 1993. Petal and stamen formation in petunia is regulated by the homeotic gene fbpl. Plant J. 4, 101 15 112. Angenent G.C., Franken J., Busscher M., Weiss D. and van Tunen A.J., 1994. Co-suppression of the petunia homeotic gene fbp2 affects the identity of the generative meri 20 stem. Plant J. 5, 33-44. Baker H.G. and Baker I., 1982. Floral nectar constituents in relation to pollinator type. In: Handbook of experi mental pollination biology (ED. by CE Jones and RJ 25 Little), pp 117-141. Scientific and Academic Edition, Van Nostrand Reinhold, New York. Beals T.P. and Goldberg R.B. (1997). A novel cell ablation strategy blocks tobacco anther dehiscence. The Plant 30 Cell 9, 1527-1545. Bevan M. (1984). Binary Agrobacterium vectors for plant transformation. Nucl. Acids Res. 12, 8711-8721 35 Butler C.G. (1962). The world of the honeybee. London: Collins. SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 36 Canis L.A., Busscher M., Angenent G.C., Beltran J-P and van Tunen A.J. (1994) . Nuclear localisation of the petunia MADS box gene protein FBPl. Plant J. 6, 597-604. 5 Colombo L., Franken J., Koetje E., van Went J., Dons H.J.M, Angenent G.C. and van Tunen A.J. (1995). The petunia MADS Box gene FBP11 determines ovule identity. The Plant Cell 7, 1859-1868. 10 Crailsheim k., Hrassnigg N., Lorenz W and Lass A. Protein consumption and distribution in a honeybee colony (Apis mellifera carnica Pollm). Apidologie 24 (5), 510-511. Custers J.B.M., Oldenhof, Schrauwen J.A.M., Cordewener 15 J.H.G., Wullems G.J. and Lookeren Campagne M.M. (1997). Analysis of microspore-specific promoters in transgenic tobacco. Plant molecular biology 35, 689-699. Davis A.R., Peterson R.L. and Shuel R.W. (1986) . Anatomy 20 and vasculature of the floral nectaries of Brassica napus (Brassicaceae). Can. J. Bot. vol. 64, 2508-2516. Dumas B., Freyssinet G. and Pallett E. (1995) . Tissue specific expression of germin-like oxalate oxidase 25 during development and fungal infection of barley seed lings. Plant Physiol. 107: 1091-1096. Fahn A. (1979). Ultrastructure of nectaries in relation to nectar secretion. Amer. J. Bot. 66(8), 977-985. 30 Florack D.E.A, Dirkse W.G., Visser B., F. Heidekamp and Stiekema W.J. (1994). Expression of biologically active hordothionins in tobacco: Effects of pre- and pro-sequences at the amino and carboxyl termini of the 35 hordothionin precursor on mature protein expression and sorting. Plant Mol. Biol. 24. 83-96. SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 37 Hartley R.W. (1988). Barnase and Barstar: Expression of its cloned inhibitor permits expression of a cloed ribonu clease. J. Mol. Biol. 202, 913-915 5 Horsch R.B., Fry J.E., Hofman N.L., Eichholz D., Rogers S.G. and Fraley R.T. (1985) . A simple and general method for transferring genes into plants. Science 227, 1229 1231. 10 Huang H., Tudor M., Su T., Hu Y. and Ma H. (1996). DNA binding properties of two Arabidopsis MADS domain pro teins: Binding consensus and dimer formation. The Plant Cell 8, 81-94. 15 Jefferson R.A., Kavanagh T.A. and Bevan M. (1987). GUS fusion: J-glucuronidase as a sensitive and versatile gene fusion marker in higher plants. EMBO J. 6, 3901 3907. 20 Laemmli U.K. (1970). Cleavage of structural proteins during the assembly of the head bacteriophage T4. nature 227, 680-685. Lane B.G., Dunwell J.M., Ray J.A., Schmitt M.R. and Cuming 25 A.C. (1993) . Germin, a protein marker of early plant development, is an oxalate oxidase. The Journal of Biological Chemistry 268 (17), 12239-12242. Mariani C., Gossele V., De Beuckeleer M., De Block M., 30 Goldberg R.B., De Greef W. and Leemans J. (1992). a chimaeric ribonuclease-inhibitor gene restores fertility to male sterile plants. Nature 357, 384-387. Martini M., Schmid A. and Hess D. (1990). Antibiotics, and 35 amino acids in nectar of Rhododendron and Piptanthus species from Nepal. Bot. Acta 103, 343-348. SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 38 Mizukami Y., Huang H., Tudor M. and Ma H. (1996). Functio nal domains of the floral regulator AGAMOUS: Characteri sation of the DNA binding domain and analysis of domi nant negative mutations. The Plant Cell 8, 831-845. 5 Tsuchimoto S., van der Krol A.R. and Chua N.-H, 1993. Ectopic expression of pMADS3 in transgenic petunia phenocopies the petunia blind mutant. Plant Cell 5, 843 853. 10 Verwoerd T.C., Dekker, B.M.M. and Hoekema A. (1989). A small-scale procedure for the rapid isolation of plant RNAs. Nucl. Acids Res. 17, 2362. 15 Zer H. and Fahn A. (1992). Floral nectaries of Rosmarinus officinalis L. Structure, Ultrastructure and Nectar Secretion. Annals of Botany 70, 391-397. SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 39 Sequences: SEQ ID NO:1 amino acid sequence NEC1 1 MAQLRADDLS FIFGLLGNIV SFMVFLAPVP TFYKIYKRKS SEGYQAIPYM 5 51 VALFSAGLLL YYAYLRKNAY LIVSINGFGC AIELTYISLF LFYAPRKSKI 101 FTGWLMLLEL GALGMVMPIT YLLAEGSHRV MIVGWICAAI NVAVFAAPLS 10 151 IMRQVIKTKS VEFMPFTLSL FLTLCATMWF FYGFFKKDFY IAFPNILGFL 201 FGIVQMLLYF VYKDSKRIDD EKSDPVREAT KSKEGVEIII NIEDDNSDNA 251 LQSMEKDFSR LRTSK SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 -40 SEQ ID No: 2 amino acid sequence of FBP15 Met Gly Arg Gly Lys Ile Glu Ile Lys Arg Ile Glu Asn Thr Thr Asn 1 5 10 15 Arg Gin Val Thr Phe Cys Lys Arg Arg Asn Gly Leu Leu Lys Lys Ala 20 25 30 Tyr Glu Leu Ser Val Leu Cys Asp Ala Glu Val Ala Leu Ile Val Phe 35 40 45 Ser Ser Arg Gly Arg Leu Tyr Glu Tyr Ala Asn Asn Ser Val Lys Ala 50 55 60 Thr Ile Asp Arg Tyr Lys Lys Ala Ser Ser Asp Ser Ser Asn Thr Gly 65 70 75 80 Ser Thr Ser Glu Ala Asn Thr Gin Phe Tyr Gin Gin Glu Ala Ala Lys 85 90 95 Leu Arg Val Gin Ile Gly Asn Leu Gin Asn Ser Asn Arg Asn Met Leu 100 105 110 Gly Glu Ser Leu Ser Ser Leu Thr Ala Lys Asp Leu Lys Gly Leu Glu 115 120 125 Thr Lys Leu Glu Lys Gly Ile Ser Arg Ile Arg Ser Lys Lys Asn Glu 130 135 140 Leu Leu Phe Ala Glu Ile Glu Tyr Met Arg Lys Arg Glu Ile Asp Leu 145 150 155 160 His Asn Asn Asn Gin Met Leu Arg Ala Lys Ile Ala Glu Ser Glu Arg 165 170 175 Asn Val Asn Met Met Gly Gly Glu Phe Glu Leu Met Gin Ser His Pro 180 185 190 Tyr Asp Pro Arg Asp Phe Phe Gin Val Asn Gly Leu Gin His Asn His 195 200 205 Gin Tyr Pro Arg Gin Asp Asn Met Ala Leu Gin Leu Val 210 215 220 SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 41 SEQ ID NO:3 amino acid sequence CVSP 5 MFLPILFTISLLFSSSHA SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 42 SEQ ID NO:4 Nucleotide sequence NECl 5 1 TCGAGCGGCC GCCCGGGCAG GTATTCAACA AGAGTATTCA CCACTTGAAC 51 TCAAAAGGGG CTTCACTAAA AAAAAATCAT GGCGCAATTA CGTGCTGATG 101 ACTTGTCTTT CATATTTGGC CTTCTTGGTA ATATTGTATC ATTCATGGTC 10 151 TTCCTAGCAC CCGTGCCAAC ATTTTACAAA ATATATAAA.A GGAAATCATC 201 AGAAGGATAT CAAGCAATAC CATATATGGT AGCACTGTTC AGCGCCGGAC 15 251 TATTGCTATA TTATGCTTAT CTCAGGAAGA ATGCCTATCT TATCGTCAGC 301 ATTAATGGCT TTGGATGTGC CATTGAATTA ACATATATCT CTCTGTTTCT 351 CTTTTACGCG CCCAGAAAGT CTAAGATTTT CACAGGGTGG CTGATGCTCT 20 401 TAGAATTGGG AGCCCTAGGA ATGGTGATGC CAATTACTTA TTTATTAGCA 451 GAAGGCTCAC ATAGAGTGAT GATAGTGGGA TGGATTTGTG CAGCTATCAA 25 501 TGTTGCTGTC TTTGCTGCTC CTTTAAGCAT CATGAGGCAA GTAATAAAAA 551 CAAAGAGTGT AGAGTTCATG CCCTTCACTT TATCTTTGTT CCTCACTCTC 601 TGTGCCACTA TGTGGTTTTT CTATGGGTTT TTCAAGAAGG ACTTTTACAT 30 651 TGCGTTTCCA AATATACTGG GCTTTCTATT CGGAATCGTT CAAATGCTAT 701 TATATTTTGT TTACAAGGAT TCAAAGAGAA TAGATGATGA AAAATCTGAT 35 751 CCTGTTCGAG AAGCTACAAA ATCAAAAGAA GGTGTAGAAA TCATTATCAA 801 CATTGAAGAT GATAATTCTG ATAACGCATT GCAGTCCATG GAGAAGGATT 851 TTTCCAGACT GCGGACATCA AAATAAGCAA GAAGATGATC AAAAAATGAC 40 901 AAAGCTAAGG AGTTTGAAGT AAGGCAAGGA ACTTGACACT GAATATCTAA 951 GCTAATTAGC AAGACTTTAG CAGCTTGTAA TATTTAGTGT TTGTGAGGTG 45 1001 TTACCTTATA ATTAGCTTGT AGCATAGCCT TCCCACTAAT AATTCTGCTT 1051 AGCGAATCTT ATATATGGGA AATACTTACA CTAGTATGCA TCTTCTATAT 1101 ACATGTTTGG CACTTGACTA TACATAGAAA AATTAACAAG CATTTCTCAC 50 1151 CTCAATTTGT CACTTACTTA TAAGTAGCTG AATAATATAA TGCAATTTTC 1201 ACCCC 55 60 SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 43 SEQ ID NO:5 Nucleotide sequence FBPl5 1 TCTGAATACAAGCTGTGTGTGTAGAGAGATTTCATAAAGACAGCAAACAT 5 51 CCCTTCTTTTTGTTCTGTTTTAAAAGTTCCCTTCTTCAACCAGCTCTTTT 101 CCTCATCAGGGTAAGTTGCAAATAAAGGGGATGTTCCAGAATCAAGAAGA 151 GAAGATGTCAGACTCGCCTCAGAGGAAGATGGGAAGAGGAAAGATTGAGA 10 201 TTAAGAGGATTGAAAATACAACAAATCGTCAAGTCACTTTCTGTAAGAGA 251 AGAAATGGGTTGCTTAAAAAAGCTTATGAACTTTCTGTTCTTTGTGATGC 15 301 TGAAGTTGCTCTCATCGTTTTCTCAAGCCGTGGCCGCCTCTATGAATATG 351 CTAACAACAGTGTGAAGGCAACAATTGATAGATATAAGAAAGCATCCTCA 401 GATTCCTCCAACACTGGATCTACTTCTGAAGCTAACACTCAGTTTTATCA 20 451 ACAAGAAGCTGCCAAACTCCGAGTTCAGATTGGTAACTTACAGAACTCAA 501 ACAGGAACATGCTAGGCGAGTCTCTAAGTTCTCTGACTGCAAAAGATCTG 25 551 AAAGGCCTGGAGACCAAACTTGAGAAAGGAATTAGTAGAATTAGGTCCAA 601 AAAGAATGAACTCCTGTTTGCTGAGATTGAGTATATGCGAAAAAGGGAAA 651 TTGATTTGCACAACAACAATCAGATGCTTCGGGCAAAGATAGCTGAGAGT 30 701 GAAAGAAATGTGAACATGATGGGAGGAGAATTTGAGCTGATGCAATCTCA 751 TCCGTACGATCCAAGAGACTTCTTCCAAGTGAACGGCTTACAGCATAATC 35 801 ATCAATATCCACGCCAAGACAACATGGCTCTTCAATTAGTATAAGTTTAT 851 AATAAAATGCATGGTTTGAAGCACTCTGATTGTGGTGGATTTGGATTATG 901 TATAAGGGAGTGCAGGCCATTTGCCAATTATTGAAAGGTACTCAAACAGG 40 951 AAGTTGAAGAAGTTCATCATCTCTCTCATCTATATGTCTTAACAAAAGTC 1001 TTAGCTTATGGACTCTAAAACAAAGACTTAATTTAACATATAAATATAAT 45 1051 TGTGTAATGCTGTTGTATTGTATGGTATGTATCCAAAAACATTAATAACC 1101 TATCTTTTTCTTCAAATTATGTCTCCTTTGATACAAACTACTAACATATT 1151 TTCTTAT 50 SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 44 SEQ ID NO:6 Nucleotide sequence CVSP ATGTTTCTTCCAATTCTCTTCACCATTTCCCTCCTCTTCTCCTCCTCCCATGCT SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 45 SEQ ID NO:7 Nucleotide sequence NECl promoter 1 CCTAGGAGAAATCAAGCCTACTCTTAAGATGGATGACTCACTTGCCCCGA 5 51 TGGTAAGGTGAAGGATCTGTTGATTAGAGTTGGGAAGTTCATGTTCTCTG 101 CTGATTTTATTATTCTAGACTATGAAGAGGACCAAGAAGCTCCAATAATT 151 TTGGGAAGAGCATTCTTAATCACATCGATGGCAATTATTGACATGGAACT 10 201 TGGGGAGATGACTGTGAGAGCGCATGGAGAAAAGGTTACTTTCAAGGTTT 251 ATAATAAAAAGGATCATATGGCTAAGTTTGAAGAGTGTTCTTTGATAGAA 15 301 TGTGTCAGACGAGAACATGAAAGTAAACCGAAAGAGGTGTTTGAGCGGAA 351 TGTAGAACAAAGTGACCACGGCACAATAATTGACAAGTTGAAGGAAAATT 401 CACCTAAAGGAAGGAAGAAGACAAAAGTTCGTCGTAACAAGAGGAGACGT 20 451 AAATGCTGGAAGTGAGCTTAAAGGTGTTGTCGTACTACGACGTTAACTAA 501 GGCGCTTGTCGGGAGGCAACCCTAGCTTTGTATGTAAATGTAAAGTAAA 25 551 AAATATATATATAGAAAAAGGAAAATACAAAAAGAGTCGTGCCGCGACGT 601 TAAATCAAGCGCTTGTTGGAAGGCAACCCAATTTTTATTGTTTTAGTTGT 651 TTTACTTATTTAGTATTACGTAGTTTCTTGTTGTTTTTGTAGGGCTCGGG 30 701 ACTTTCGGAAGGTGAGGTAATTTCAAGGCATCGCGGTGTGTATTGCAGCG 751 AGGTAAGTGTAAGAGTTGAGTTGGAAGCGTTTGGCCAAGTGTTGCACCGT 35 801 GAGAGGCTTTCAACCTGTTGCGACACGTGAAAAATTAAGAGCCAGATCTG 851 CTACATTAGCACTGAAGCATCGCTTGGCCAATAGCTTGGAATGGAAGCAA 901 GAATTCAAACCAAAATCAGAAACGCCACAAGAGATGTGTCGCACACTGCA 40 951 AAGCTTTGTGCAAACTAGTGAACGCAGAAATAGAAATGCTACAGCCCATG 1001 CGTCGCTTGGCTTATGGCAGGCAGCAAAAATTCAGCAGCAAAACAGAAAC 45 1051 GCTGCGAGAAACGCGTCGCATACGCCATAGCTTTGTGTCAAACAGAACGT 1101 CCAGAAATTGAAAAGCTATAAGCCTGCGTCGCTTGGCTCATGGCGTGCAG 1151 ACTAGAAAAGCTCTAGCAGATGCGTCGCGTATTGTATAGCTTGGTGTGAA 50 1201 ACAGAAAGTTCGAAACTTGGAAAACGATAACCCAGCGTCGCCTCTTCAAC 1251 CGCGTCCAGGTAAGTTCAAGATTCTTACGGGTTGACCCATTAACCCATTG 55 1301 ATCGGCTGATTATAAACAATAAAACATCACCTTCAACTATCACATGATTT 1351 CATAAGTTTGACCTAGGATATTTTATATATATATATATATATATACACAC 1401 ACACACCATTTCCAGCGATCTTACCTCATTTTTATTCAAACCATTTTTCT 60 SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 46 1451 GCTTCAAAAGTTTAAATTATTAATATGATAAGTCATCCATAGTCAAACAA 1501 GATTTTCTATACTATTTTGTCCCTTGTAATTTTAAAAAAAAAATGAGCGA 5 1551 TGGTAAGATAAACATTGTTTGCAAGTGTACAATTTTAGTATATGCAAACC 1601 AACGCTTCTTCTTCCAACTATCACCTAAAACTACATCATTTATGGCGGGC 1651 GGACTAGACGTAGCCAAATATAAAAACGCAATGGCCATTCAGTTCATGTC 10 1701 ATTTTTATATCCTTCATCCAATAATATTACTCAAAATTGATGTACAGTTT 1751 GGTCTCTGATGTGCACTTTACTATACGTAATACGGAATTTACATTATAAT 15 1801 TAAAGAGAACTGTTCCACTAAATTTTAATGATTTAATTAATTTAACTCGG 1851 TTACTTGTATTATTATTATTGCTGTATTTGTTTGTCATTTGAATTTGGCA 1901 CCGCAGATTTTTGTATGCAATTAACCCTCATATATCTTTTGGCCAAATAA 20 1951 AGAAAAAGTCTGCATATTTCTTGCCAAACATTTATCATACTTTACCGAAT 2001 TCTTGTTTTTTGTTTCTCTGTTGTTGTTCTCCACTATAAATAACATTTGC 25 2051 AGTGAGTAAAGTTTCTTCAGGTCTCTTTTGTAGATTCAACAAGAGTATTC 2101 AGCACTTGAACTCAAAAGGGGCTTCACTAAAAAAAATCATG SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 47 SEQ ID NO:8 Nucleotide sequence FBPl5 promoter SUBSTITUTE SHEET (RULE 26)

Claims (38)

1. An isolated DNA sequence from the promoter region upstream of a nectary-specific expressed sequence, which nectary-specific expressed sequence encodes a protein comprising the amino acid sequence given in SEQ ID NO: 1, or 5 a homologous protein.
2. An isolated DNA sequence according to claim 1, wherein the nectary-specific expressed sequence has: a) a nucleotide sequence given in SEQ ID NO:4, or 10 b) a nucleotide sequence obtainable by hybridisation with the nucleotide sequence of (a) or with a fragment of (a).
3. An isolated DNA sequence according to claim 1 or 2, obtained from a plant of Petunia hybrida, the sequence 15 consisting essentially of the sequence given in SEQ ID NO:7, or a functional fragment thereof having promoter activity.
4. An isolated DNA sequence from the promoter region upstream of a nectary-specific expressed sequence, which 20 nectary-specific expressed sequence encodes a protein comprising the amino acid sequence given in SEQ ID NO:2, or a homologous protein.
5. An isolated DNA sequence according to claim 4, wherein 25 the nectary-specific expressed sequence has: a) a nucleotide sequence given in SEQ ID NO:5, or b) a nucleotide sequence obtainable by hybridisation with the nucleotide sequence of (a) or with a fragment of (a). 30
6. An isolated DNA sequence according to claim 4 or 5, obtained from a plant of Petunia hybrida, the sequence consisting essentially of the sequence given in SEQ ID NO:8 or a functional fragment thereof having promoter activity. SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 49
7. An isolated DNA sequence encoding a protein comprising the amino acid sequence given in SEQ ID NO:1, or a homolo gous protein, the expression of the DNA sequence being predominantly confined to the nectaries of a plant. 5
8. An isolated DNA sequence according to claim 7 having: a) a nucleotide sequence given in SEQ ID NO:4, or b) a nucleotide sequence obtainable by hybridisation with the nucleotide sequence of (a) or with a fragment of (a). 10
9. An isolated DNA sequence that results from the sequence shown in SEQ ID NO:4 by insertion, deletion or substitution of one or more nucleotides, including naturally occurring variations or variations introduced by targeted mutagenesis 15 or recombination.
10. An isolated DNA sequence according to claim 7 having a nucleotide sequence given in SEQ ID NO:4, said sequence being produced by current DNA synthesis techniques. 20
11. An isolated DNA sequence encoding a protein comprising the amino acid sequence given in SEQ ID NO:2, or a homolo gous protein, the expression of the DNA sequence being 25 predominantly confined to the nectaries of a plant.
12. An isolated DNA sequence according to claim 11, having: a) a nucleotide sequence given in SEQ ID NO:5, or b) a nucleotide sequence obtainable by hybridisation with 30 the nucleotide sequence of (a) or with a fragment of (a).
13. An isolated DNA sequence that results from the sequence shown in SEQ ID NO:5 by insertion, deletion or substitution 35 of one or more nucleotides, including naturally occurring variations or variations introduced by targeted mutagenesis or recombination. SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 50
14. An isolated DNA sequence according to claim 11 having a nucleotide sequence given in SEQ ID NO:5, said sequence being produced by current DNA synthesis techniques. 5
15. Any sequence that encodes a nectary-specific MADS box gene.
16. An isolated DNA sequence comprising the coding region for a signal peptide, wherein the information contained in 10 the DNA sequence permits, upon translational fusion with a DNA sequence encoding a protein that is expressed in necta ries, targeting of the protein to nectar.
17. An isolated DNA sequence according to claim 16, compri 15 sing the nucleotide sequence given in SEQ ID NO: 6 obtained from a plant of Calluna vulgaris, or a nucleotide sequence obtainable by hybridisation with the nucleotide sequence given in SEQ ID NO:6. 20
18. A recombinant double-stranded DNA molecule comprising an expression cassette comprising the following constituents: i) a promoter functional in plants, ii) a DNA sequence coding for a protein as defined in any 25 of claims 7 to 15 which is fused to the promoter se quence in sense or antisense orientation, and opti onally iii) a signal sequence functional in plants for the trans cription termination and polyadenylation of an RNA 30 molecule.
19. A recombinant double-stranded DNA molecule comprising an expression cassette comprising the following constituents: i) a promoter functional in nectaries of plants, 35 ii) a DNA sequence coding for a protein which is fused to the promoter sequence in sense or antisense orientati on, and optionally SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 51 iii) a signal sequence functional in plants for the trans cription termination and polyadenylation of an RNA molecule. 5
20. A recombinant double-stranded DNA molecule comprising an expression cassette comprising the following constituents: i) a promoter functional in nectaries of plants, ii) a DNA sequence encoding a protein which is fused to the promoter, 10 iii) a DNA sequence encoding a signal peptide that targets the recombinant protein to nectar, which is translati onally fused to the DNA sequence encoding the recombi nant protein, and optionally iv) a signal sequence functional in plants for the trans 15 cription termination and polyadenylation of an RNA molecule.
21. A recombinant double-stranded DNA molecule according to claim 19 or 20 wherein the promoter is as defined in any of 20 claims 1-6.
22. A recombinant double-stranded DNA molecule according to claim 20 or 21 wherein the DNA sequence encoding a signal peptide is as defined in claim 16 or 17. 25
23. A process for producing a transgenic plant exhibiting excretion of a recombinant protein in its nectar, compri sing: i) introducing in a plant cell a recombinant double-stran 30 ded DNA-molecule as defined in any of claims 20 to 22, wherein the recombinant protein is excreted in nectar ii) regenerating plants from the transgenic cell, and iii) selecting transgenic plants. 35
24. A process for producing a transgenic plant exhibiting a modified nectar composition, comprising: i) introducing in a plant cell a recombinant double-stran ded DNA-molecule as defined in any of claims 19 to 22, SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 52 wherein the recombinant protein interferes with meta bolic pathways in the nectaries, ii) regenerating plants from the transgenic cell, and iii) selecting transgenic plants. 5
25. A process for producing a transgenic plant exhibiting a modified nectar secretion, comprising: i) introducing in a plant cell a recombinant double-stran ded DNA-molecule as defined in any of claims 19 to 22, 10 wherein the recombinant protein interferes with sink strength of nectaries ii) regenerating plants from the transgenic cell, and iii) selecting transgenic plants. 15
26. A process for producing a transgenic plant exhibiting a modified nectary development, comprising: i) introducing in a plant cell a recombinant double-stran ded DNA-molecule as defined in claims 19 or 22, wherein the recombinant protein interferes with the development 20 of nectaries ii) regenerating plants from the transgenic cell, and iii) selecting transgenic plants. 25
27. A process for producing honey from modified nectar of transgenic plants, comprising: i) producing a transgenic plant by introducing in a plant cell a recombinant double-stranded DNA molecule as defined in any of claims 19 to 22, regenerating plants 30 from the transgenic cell, and selecting modified plants exhibiting the excretion of nectar with a modified composition, ii) allowing insects, preferably bees, to collect nectar from the transgenic plants and to process the nectar 35 into honey.
28. A process for producing a recombinant gene product from honey, comprising: SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 53 i) producing a transgenic plant by introducing in a plant cell a recombinant double-stranded DNA molecule as defined in any of claims 20 to 22, regenerating plants from the transgenic cell, and selecting modified plants. 5 exhibiting excretion of the recombinant gene product in nectar, ii) allowing insects, preferably bees, to collect nectar from the transgenic plants and to process the nectar into honey, and 10 iii) isolating and purifying the gene product from the honey.
29. A process for producing a metabolite from honey, compri sing: 15 i) producing a plant that excretes this metabolite in nectar and which plant has been produced by current breeding and selection methods, ii) allowing insects, preferably bees, to collect nectar from the selected plants and to process the nectar into 20 honey, and iii) isolating and purifying the metabolite from the honey.
30. Micro organisms containing DNA sequences according to 25 one or more of claims 1 to 17.
31. Micro organisms containing recombinant DNA molecules according to any of claims 18 to 22. 30
32. A plant cell or plant cell culture transformed with one or more DNA sequences according to claims 1 to 17.
33. A plant cell or plant cell culture transformed with recombinant DNA molecules according to any of 18 to 22. 35
34. A plant consisting essentially of the plant cells of claims 32 or 33. SUBSTITUTE SHEET (RULE 26) WO 00/04176 PCT/NL99/00453 - 54
35. A transgenic plant obtained by the process of any of claims 23 to 26.
36. Seeds, tissue culture, plant parts or progeny plants 5 derived from a transgenic plant according to claim 35.
37. Honey obtained from nectar from transgenic plants, which nectar has a modified composition. 10
38. Honey obtained from nectar from transgenic plants, which nectar comprises a recombinant gene product. SUBSTITUTE SHEET (RULE 26)
AU50706/99A 1998-07-16 1999-07-15 Process to collect metabolites from modified nectar by insects Ceased AU772119B2 (en)

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
EP98202375 1998-07-16
EP98202375A EP0974667A1 (en) 1998-07-16 1998-07-16 Process to collect metabolites from modified nectar by insects
EP98204215 1998-12-14
EP98204215 1998-12-14
PCT/NL1999/000453 WO2000004176A1 (en) 1998-07-16 1999-07-15 Process to collect metabolites from modified nectar by insects

Publications (2)

Publication Number Publication Date
AU5070699A true AU5070699A (en) 2000-02-07
AU772119B2 AU772119B2 (en) 2004-04-08

Family

ID=26150536

Family Applications (1)

Application Number Title Priority Date Filing Date
AU50706/99A Ceased AU772119B2 (en) 1998-07-16 1999-07-15 Process to collect metabolites from modified nectar by insects

Country Status (7)

Country Link
EP (1) EP1097229A1 (en)
JP (1) JP2002520064A (en)
AU (1) AU772119B2 (en)
CA (1) CA2333897A1 (en)
IL (1) IL140911A0 (en)
NZ (1) NZ509813A (en)
WO (1) WO2000004176A1 (en)

Families Citing this family (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8022274B2 (en) 1998-09-22 2011-09-20 Mendel Biotechnology, Inc. Plant tolerance to low water, low nitrogen and cold
WO2004082373A1 (en) * 2003-03-17 2004-09-30 Kikuji Yamaguchi Honey, novel honey composition and process for producing the same
US8097712B2 (en) 2007-11-07 2012-01-17 Beelogics Inc. Compositions for conferring tolerance to viral disease in social insects, and the use thereof
BRPI1007708A2 (en) 2009-05-05 2020-08-18 Beeologics Inc isolated nucleic acid agent, nucleic acid construction, isolated nucleic acid, composition ingestible by bees, method to reduce a bee's susceptibility to nosema infection and method to reduce the susceptibility of honey bees to nosema infection
CA2770276A1 (en) * 2009-08-21 2012-02-24 Beeologics, Inc. Preventing and curing beneficial insect diseases via plant transcribed molecules
US8962584B2 (en) 2009-10-14 2015-02-24 Yissum Research Development Company Of The Hebrew University Of Jerusalem, Ltd. Compositions for controlling Varroa mites in bees
CN105189759A (en) * 2013-03-13 2015-12-23 华盛顿卡内基研究所 Methods of modulating plant seed and nectary content
RU2703498C2 (en) 2013-07-19 2019-10-17 Монсанто Текнолоджи Ллс Compositions and methods for controlling leptinotarsa
WO2015153339A2 (en) 2014-04-01 2015-10-08 Monsanto Technology Llc Compositions and methods for controlling insect pests
RU2021123470A (en) 2014-07-29 2021-09-06 Монсанто Текнолоджи Ллс COMPOSITIONS AND METHODS FOR COMBATING PESTS
WO2016118762A1 (en) 2015-01-22 2016-07-28 Monsanto Technology Llc Compositions and methods for controlling leptinotarsa

Also Published As

Publication number Publication date
IL140911A0 (en) 2002-02-10
CA2333897A1 (en) 2000-01-27
WO2000004176A1 (en) 2000-01-27
NZ509813A (en) 2004-01-30
JP2002520064A (en) 2002-07-09
EP1097229A1 (en) 2001-05-09
AU772119B2 (en) 2004-04-08

Similar Documents

Publication Publication Date Title
CA2105592A1 (en) Male-sterile plants, method for obtaining male-sterile plants and recombinant dna for use therein
JP2001086987A (en) Plant gene construct
US20120278949A1 (en) Shine clade of transcription factors and their use
US5962769A (en) Induction of male sterility in plants by expression of high levels of avidin
JP2000507808A (en) Modified Bacillus surlingensis gene for control of Lepidoptera in plants
HU228694B1 (en) Nucleotide sequences mediating male fertility and method of using same
JP2000116258A (en) Binary cryptocytotoxic method of hybrid seed production
US20030106089A1 (en) Cotton fiber transcriptional factors
WO2009021448A1 (en) A plant height regulatory gene and uses thereof
JPH06507065A (en) Tapetum-specific promoters of Brassica subsp.
ES2211864T3 (en) SEQUENCES OF cDNA SPECIFIC ANTERA, SEQUENCES OF GENOMIC DNA AND SEQUENCES OF RECOMBINANT DNA.
US7439416B2 (en) Indeterminate gametophyte 1 (ig1)gene from Zea mays and uses thereof
AU772119B2 (en) Process to collect metabolites from modified nectar by insects
CA2375535C (en) Use of the bnm3 transcriptional activator to control plant embryogenesis and regeneration processes
US5990386A (en) Genes controlling floral development and apical dominance in plants
WO1999000501A1 (en) Materials and methods relating to a plant regulatory protein
JP2002522079A (en) Gene switch
EP0974667A1 (en) Process to collect metabolites from modified nectar by insects
KR100455621B1 (en) Method for lowering pollen fertility by using pollen-specific zinc finger transcriptional factor genes
US5861542A (en) Gene controlling floral development and apical dominance in plants
JP2001145430A (en) Method for lowering pollen fertility with gene of pollen- specific zinc finger transcription factor
KR100455620B1 (en) Method for lowering pollen fertility by using tapetal layer-specific zinc finger transcriptional factor gene
CN112321693A (en) Application of wheat TaCCT1-6A protein in regulation and control of crop heading period
JP2001145429A (en) Method for lowering pollen fertility with gene of tapetum-specific zinc finger transcription factor
Li Rho GTPase signaling in cell development of Arabidopsis

Legal Events

Date Code Title Description
PC1 Assignment before grant (sect. 113)

Owner name: PLANT RESEARCH INTERNATIONAL B.V.

Free format text: THE FORMER OWNER WAS: STICHTING CENTRUM VOOR PLANTENVEREDELINGS-EN REPRODUKTIEONDERZOEK (CPRO-DLO)

FGA Letters patent sealed or granted (standard patent)