AU2008262038A1 - 5-heteroaryl substituted indazoles as kinase inhibitors - Google Patents

Description

WO 2008/154241 PCT/US2008/065727 5-HETEROARYL SUBSTITUTED INDAZOLES AS KINASE INHIBITORS Technical Field The present invention relates to 5-substituted indazole containing compounds, 5 methods of making the compounds, compositions containing the compounds which are useful for inhibiting kinases such as Glycogen Synthase kinase 3 (GSK-3), Rho kinase (ROCK), Janus Kinases (JAK), AKT, PAK4, PLK, CK2, KDR, MK2, JNKI, aurora, pim 1 and nek 2. Background of the Invention 10 Protein kinases are a class of enzymes that catalyze the transfer of a phosphate group from ATP to a tyrosine, serine, threonine, or histidine residue located on a protein substrate. Protein kinases clearly play a role in normal cell growth. Many of the growth factor receptor proteins have intracellular domains that function as protein kinases and it is through this function that they effect signaling. The interaction of growth factors with their receptors is a 15 necessary event in the normal regulation of cell growth, and the phosphorylation state of substrate proteins often is related to the modulation of cell growth. It is widely known that abnormal protein phosphorylation may be directly linked to certain disease states or may be a contributing factor in the onset of such diseases. As a result, protein kinases have become the targets of new pharmaceutical research (Cohen, P. 20 Nature Reviews Drug Discovery, 1:309-315, 2002). Various protein kinase inhibitors have been used clinically in the treatment of a wide variety of diseases, such as cancer, chronic inflammatory diseases, diabetes and stroke. The protein kinases are a large and diverse family of enzymes that catalyze protein phosphorylation and play a key role in cellular signaling. Protein kinases may exert positive 25 or negative regulatory effects, depending upon their target protein. Protein kinases are involved in specific signaling pathways which regulate cell functions such as, but not limited to, metabolism, cell cycle progression, cell adhesion, vascular function, apoptosis, and angiogenesis. As a result, malfunctions of cellular signaling have been associated with many diseases, the most characterized of which include cancer and diabetes. The regulation of 30 signal transduction by cytokines and the association of signal molecules with proto oncogenes and tumor suppressor genes have been well documented. Similarly, the connection between diabetes, viral infections and the conditions related thereto has also been associated with the regulation of protein kinases. Because protein kinases regulate nearly every cellular process, including metabolism, 1 WO 2008/154241 PCT/US2008/065727 cell proliferation, cell differentiation, and cell survival, they are attractive targets for therapeutic intervention for various disease states. For example, cell-cycle control and angiogenesis, in which protein kinases play a pivotal role are cellular processes associated with numerous disease conditions such as, but not limited to, cancer, inflammatory diseases, 5 abnormal angiogenesis and diseases related thereto, atherosclerosis, macular degeneration, diabetes, obesity, and pain. The elucidation of the intricacy of protein kinase pathways and the complexity of the relationship and interaction among and between the various protein kinases and kinase pathways highlights the importance of developing pharmaceutical agents capable of acting as 10 protein kinase modulators, regulators or inhibitors that have beneficial activity on multiple kinases or multiple kinase pathways. It has therefore been suggested that due to the complexity of intracellular signaling cascades of protein kinase pathways, agents that affect multiple pathways simultaneously may be required for meaningful clinical activity. Although it has been suggested that a single 15 agent that provides combinatorial effects is an attractive notion, there is a need to identify and use single agents that target the right combination of multiple pathways that are clinically effective in a particular disease setting. Glycogen synthase kinase-3 (GSK-3) is a serine/threonine kinase encoded by two isoforms, GSK-3a and GSK-3p with molecular weights of 51 and 47 kDa, respectively. 20 These share 97% sequence similarity in their kinase catalytic domains. The GSK-3a isoform has an extended glycine-rich N-terminal tail. A minor splice variant of GSK-3P has been identified (expressed at ~15% of total) with a 13 amino acid insert within the kinase domain. This variant had a reduced activity towards tau. GSK-3 is highly conserved throughout evolution, and found in all mammals thus far with high homology in the kinase domain. Both 25 isoforms are ubiquitously expressed in mammalian tissues, including the brain. Pharmacological GSK-3 inhibitors are not able to selectively inhibit one of the isoforms. GSK-3P plays an important role in the control of metabolism, differentiation and survival. It was initially identified as an enzyme able to phosphorylate and hence inhibit glycogen synthase. Subsequently, it was recognized that GSK-3$ was identical to tau protein 30 kinase 1 (TPKJ), an enzyme that phosphorylates tau protein in epitopes that are also found to be hyperphosphorylated in Alzheimer's disease and in several taupathies. Interestingly, protein kinase B (AKT) phosphorylation of GSK-3p results in a loss of kinase activity, and it has been proposed that this inhibition may mediate some of the effects 2 WO 2008/154241 PCT/US2008/065727 of neurotrophic factors. Moreover, phosphorylation of p-catenin (a protein involved in cell survival) by GSK-3p, results in its degradation by an ubiquitinilation dependent proteasome pathway. Therefore it appears that inhibition of GSK-3p activity may result in neurotrophic 5 activity. There is evidence that lithium, an uncompetitive inhibitor of GSK-3p, enhances neuritogenesis in some models and can also increase neuronal survival, through the induction of survival factors such as Bcl-2 and the inhibition of the expression of proapoptotic factors such as P53 and Bax. Further studies have shown that p-amyloid increases GSK-3p activity and tau protein 10 phosphorylation. Moreover, this hyperphosphorylation as well as the neurotoxic effects of p amyloid are blocked by lithium chloride and by a GSK-3 antisense mRNA. These observations taken together suggest that GSK-3p may be the link between the two major pathological processes in Alzheimer's disease: abnormal APP (Amyloid Precursor Protein) processing and tau protein hyperphosphorylation. 15 These experimental observations indicate that GSK-3p may find application in the prevention and treatment of the neuropathological consequences and the cognitive and attention deficits associated with Alzheimer's disease, as well as other acute and chronic neurodegenerative diseases. These include, but are not limited to: Parkinson's disease, tauopathies (e.g. frontotemporoparietal dementia, corticobasal degeneration, Pick's disease, 20 progressive supranuclear palsy) and other dementia including vascular dementia; acute stroke and other traumatic injuries; cerebrovascular accidents (e.g. age related macular degeneration); brain and spinal cord trauma; peripheral neuropathies; retinopathies and glaucoma. GSK-3 P may also have utility in the treatment of other diseases such as: non-insulin 25 dependent diabetes and obesity; manic depressive illness; schizophrenia; alopecia; inflammation; cancers such as breast cancer, non-small cell lung carcinoma, thyroid cancer, T or B-cell leukemia and several virus-induced tumors. Rho kinases (ROCKs), the first Rho effectors to be described, are serine/threonine kinases that are important in fundamental processes of cell migration, cell proliferation and 30 cell survival. Abnormal activation of the Rho/ROCK pathway has been observed in various disorders. Examples of disease states in which compounds of the present invention have potentially beneficial therapeutic effects due to their anti vasospasm activity includes cardiovascular diseases such as hypertension, chronic and congestive heart failure, cardiac 3 WO 2008/154241 PCT/US2008/065727 hypertrophy, restenosis, chronic renal failure, cerebral vasospasm after subarachnoid bleeding, pulmonary hypertension and atherosclerosis. The muscle relaxing property is also beneficial for treating asthma, male erectile dysfunctions, female sexual dysfunction, and over-active bladder syndrome. Injury to the adult vertebrate brain and spinal cord activates 5 ROCKs, thereby inhibiting neurite growth and sprouting. Inhibition of ROCKs results in induction of new axonal growth, axonal rewiring across lesions within the CNS, accelerated regeneration and enhanced functional recovery after acute neuronal injury in mammals (spinal-cord injury, traumatic brain injury). Inhibition of the Rho/ROCK pathway has also proved to be efficacious in other animal models of neurodegeneration like stroke, 10 inflammatory and demyelinating diseases, Alzheimer's disease as well as the treatment of pain. Rho/ROCK pathway inhibitors therefore have potential for preventing neurodegeneration and stimulating neuroregeneration in various neurological disorders, including spinal-cord injury, Alzheimer's disease, stroke, multiple sclerosis, amyotrophic lateral sclerosis, as well as the treatment of pain. ROCK inhibitors have been shown to 15 possess anti-inflammatory properties. Thus, compounds of the invention can be used as treatment for neuroinflammatory diseases such as stroke, multiple sclerosis, Alzheimer's disease, Huntington's disease, Parkinson's disease, amyotrophic lateral sclerosis, and inflammatory pain, as well as other inflammatory diseases such as rheumatoid arthritis, osteoarthritis, asthma, irritable bowel syndrome, Crohn's disease, psoriasis, ulcerative colitis, 20 Lupus, and inflammatory bowel disease. Since ROCK inhibitors reduce cell proliferation and cell migration, they could be useful in treating cancer and tumor metastasis. Further more, there is evidence suggesting that ROCK inhibitors suppress cytoskeletal rearrangement upon virus invasion, thus they also have potential therapeutic value in anti-viral and anti-bacterial applications. ROCK inhibitors are also useful for the treatment of insulin resistance and 25 diabetes. Further, ROCK inhibitors have been shown to ameliorate progression of cystic fibrosis (Abstract S02.3, 8th World Congress on Inflammation, Copenhagen, Denmark, June 16-20, 2007). In addition, Rho-associated coiled-coil forming protein kinases (ROCK)-1 and -2, have been shown to enhance myosin light chain (MLC) phosphorylation by inhibiting MLC 30 phosphatase as well as phosphorylating MLC. This results in the regulation of actin-myosin contraction. Recent reports have demonstrated that inhibition of ROCK results in disruption of inflammatory cell chemotaxis as well as inhibition of smooth muscle contraction in models of pulmonary inflammation associated with asthma. Therefore, the inhibitors of the Rho/ROCK pathway should be useful for the treatment of asthma. 4 WO 2008/154241 PCT/US2008/065727 The Janus kinases (JAKs) are an important family of intracellular protein tyrosine kinases (PTKs), with 4 mammalian members, JAKI, JAK2, JAK3, and TYK2, as well as homologs in chicken, fish, and Drosophila. The JAKs play critical roles in several important intracellular signaling pathways, including the eponymous JAK/STAT pathway, central to the 5 mediation of cytokine signaling. It is this pivotal role in cytokine signaling that underpins the notion that specific JAK inhibitors may be therapeutically deployed in situations where cytokine activity results in disease. Important examples of this include autoimmune diseases such as rheumatoid arthritis and psoriasis, myeloproliferative syndromes such as, leukemias, lymphomas, and cardiovascular diseases. 10 JAK2, a member of the Janus kinase (JAK) family of protein tyrosine kinases (PTKs), is an important intracellular mediator of cytokine signaling. Mutations of the JAK2 gene are associated with hematologic cancers, and aberrant JAK activity is also associated with a number of immune diseases, including rheumatoid arthritis. Aurora kinases are a family of multigene mitotic serine-threonine kinases that 15 functions as a class of novel oncogenes. These kinases comprise aurora-A, aurora-B, and aurora-B members. These are hyperactivated and/or over-expressed in several solid tumors including but not limited to breast, ovary, prostate, pancreas, and colorectal cancers. In particular aurora-A is a centrosome kinase, and its localization depends on the cell cycle and plays an important role cell cycle progression and cell proliferation. Aurora-A is located in 20 the 20ql3 chromosome region that is frequently amplified in several different types of malignant tumors such as colorectal, breast and bladder cancers. Inhibition of aurora kinase activity could help to reduce cell proliferation, tumor growth and potentially tumorigenesis. Accordingly, there remains a need for the development of methods comprising the use of a single agent drug capable of targeting specific sets of kinases or kinase pathways. In 25 particular such methods affect the right combination of multiple targets thereby achieving clinical efficacy. Summary Of The Invention In the principle embodiment, the present invention provides compounds of Formula (I), AR, A N

(R

3 )m 30 R2 (I), 5 WO 2008/154241 PCT/US2008/065727 or a pharmaceutically acceptable salt thereof, wherein A is (Ri) b (Rii)b (Riii)c (R i ). (R ) N N , 0 N 0 (i) (ii) (iii) (iv) (V) (Rvi)b (Rvi)b (R,,lii)a (Rix a (vi) (vii) (viii) (ix) (Rx)b (Rxi)b (Rxii)a (Rxiii)a N-j'-% I N-I N-N S , S , S (x) (xi) (xii) (xiii) (Rxiy. N (Rxv)a (Rxvi)d (R )d S ~N , N , N N, S N (xiv) (xv) (xvi) (xvii) (Rxylii)c R ) (Rxx)c (R i). , \. N(Rxxi)d N N N N , N NN N, (xviii) (xix) (xx) (xxi) (Rx j)c (Rx i)c or (xxii) (xxiii)

R

1 is hydrogen, alkyl, aryl, heterocycle, heteroaryl, RaRbN-, RcRdN-C(O)- or 5 RcRdN-S(O) 2 -;

R

2 is hydrogen, alkoxycarbonyl, alkyl, alkylcarbonyl, arylcarbonyl, heterocyclecarbonyl or RRfN-alkyl-C(O)-;

R

3 is alkyl, alkoxy, aryl, cyano, cycloalkyl, halogen, haloalkyl, heteroaryl, nitro, or RgRhN-; 10 R 4 is alkyl, alkoxyalkyl, aryl, cycloalkyl, heteroaryl, heterocycle, heterocyclealkyl, RjRkN- or RjRkN-alkyl-; 6 WO 2008/154241 PCT/US2008/065727

R

5 is alkyl, aryl, or heteroaryl;

R

6 is alkyl, alkoxyalkyl, RjRkN-alkyl-, aryl, cycloalkyl or heteroaryl;

R

7 is alkyl, aryl or heteroaryl; Ra and Rb are each independently hydrogen, alkyl, arylalkyl, cycloalkyl, 5 cycloalkylalkyl, heteroarylalkyl, R 4 -C(O)-, or R 5 -S(0) 2 -; Re and Rd are each independently hydrogen, alkyl or heteroaryl; Re and Rf are each independently hydrogen, alkyl, arylalkyl, heteroarylalkyl,

R

6 -C(O)-, or R 7

-S(O)

2 -; R. and Rh are each independently hydrogen, alkyl, or alkylcarbonyl; 10 Rj and Rk are each independently hydrogen, alkyl, aryl, arylalkyl, cycloalkyl, heteroaryl, or heterocycle; Ri, Rii, Riii, Ri,, R,, Rji, Rjii, Riii, Rix, Rx, Rxi, Rxii, Rxiii, Rxi,, Rx,, Rx,q Rxjii, Rxviii, Rxix, Rxx, Rxi Rcxii and Rxxiii are each independently alkyl, alkoxy, alkoxyalkyl, alkoxycarbonyl, alkoxycarbonylalkyl, aryl, arylalkyl, aryl(hydroxy)alkyl, aryloxyalkyl, arylcarbonyl, 15 arylthioalkyl, carboxy, carboxyalkyl, cyanoalkyl, cycloalkyl, cycloalkylalkyl, cycloalkylcarbonyl, halogen, heteroaryl, heteroarylalkyl, heterocycle, heterocyclealkyl, heterocyclecarbonyl, hydroxyalkyl, trialkylsilylalkyl, H 2 NC(O)-alkyl, ZaZbN-, ZaZbNalkyl, ZcZdNC(O)- or ZeZdNS(O) 2 - wherein Rxiv, Rx,, Rxvi, and Rxvii may occur at any open valence on compounds (xiv), (xv), (xvi) or (xvii); 20 Za and Z are each independently hydrogen, alkyl, alkoxycarbonylalkyl, aryl, arylalkyl, cycloalkyl, H 2 NC(O)-, H 2 NalkylC(O)-, H 2 NC(O)-alkyl, dialkylNC(O)- or dialkylNC(O)-alkyl-; Ze and Zd are each independently hydrogen, alkyl, alkoxyalkyl, aryl, arylalkyl, aryl(hydroxy)alkyl, cycloalkyl, cycloalkylalkyl, heteroarylalkyl, heterocycle, 25 heterocyclealkyl, hydroxyalkyl, H 2 NC(O)-alkyl-, dialkylNC(O)-alkyl-, dialkylN-alkyl-, or CHZeZf; Ze is aryl or heteroaryl; Zf is heteroarylalkyl, heterocyclealkyl, or ZIZ 2 N-alkyl-; m is 0, 1 or 2; 30 a is 0 or 1; b is 0, 1, or 2; cisO, 1,2or3; and d is 0, 1, 2, 3 or 4. Also provided are pharmaceutically acceptable compositions comprising a 7 WO 2008/154241 PCT/US2008/065727 therapeutically effective amount of a compound of formula (I) in combination with a pharmaceutically suitable carrier. The object of the present invention is to provide compounds that are useful for the preventive of or treatment of diseases caused by abnormal protein kinase activity. In 5 addition, the invention also provides pharmaceutically effective compositions of the compounds of the present invention that are useful for the prevention of or treatment of said diseases. The present invention also relates to a pharmaceutical composition which comprises at least one 5-substituted indazole compound of the formula (I) which may exist as a 10 pharmaceutically acceptable salt or prodrug thereof, in the presence or absence of pharmaceutically acceptable carriers, dragees, adjuvants or other auxiliary substances. The compounds of the present invention have inhibitory activity against GSK-3, ROCK-1, ROCK-2, JAK2 as well as other kinases and are useful for the inhibition of such kinases. Certain compounds of the present invention are selective toward one or more 15 kinases and may be useful for the selective inhibition of such kinases. Accordingly, the compounds of the present invention are useful as an active ingredient for the preparation of a composition, which enables preventive and/or therapeutic treatment of a disease caused by abnormal GSK-3 activity and more particularly, of neurodegenerative diseases such as Alzheimer's disease. In addition, the compounds of the present invention are also useful as an 20 active ingredient for the preparation of a composition for preventive and/or therapeutic treatment of neurodegenerative diseases such as Parkinson's disease, tauopathies (e.g. frontotemporoparietal dementia, corticobasal degeneration, Pick's disease, progressive supranuclear palsy) and other dementia including vascular dementia; acute stroke and other traumatic injuries; cerebrovascular accidents (e.g. age related macular degeneration); brain 25 and spinal cord trauma; peripheral neuropathies; retinopathies and glaucoma; and other diseases such as non-insulin dependent diabetes (such as diabetes type II) and obesity; manic depressive illness; schizophrenia; alopecia; cancers such as breast cancer, non-small cell lung carcinoma, thyroid cancer, T or B-cell leukemia and several virus-induced tumors. 30 Detailed Description of the Invention Compounds of the present invention have the formula (I) as described above. More particularly, compounds of formula (I) can include, but are not limited to, compounds wherein A is (ii), (iii), (iv), (vii), (x), (xiv), (xv), (xvi), (xvii), (xviii), (xix), (xx), (xxi), (xxii), or (xxiii). 8 WO 2008/154241 PCT/US2008/065727 In another embodiment of the present invention there is disclosed a compound of formula (I), wherein A is (ii), (Rii)b N., -N N (ii); 5 R 1 is hydrogen, aryl, heteroaryl, heterocycle, RaRbN- or ReRdN-C(O)-; R 2 is hydrogen, alkoxycarbonyl, heterocyclecarbonyl, alkylcarbonyl, or ReRfN-alkyl-C(O)-; R 4 is alkyl, alkoxyalkyl, aryl, cycloalkyl, heterocycle, heterocyclealkyl, RjRkN-, or RjRkN-alkyl-; R 5 is alkyl, aryl, or heteroaryl; Ra and Rb are each independently hydrogen, arylalkyl, cycloalkylalkyl, R 4 -C(O)-, or Rs-S(0) 2 -; Re and Rd are each independently hydrogen or 10 heteroaryl, R. and Rf are each independently hydrogen or alkyl, Rj and Rk are each independently hydrogen, alkyl, aryl, cycloalkyl, or heterocycle; Rii is alkyl, alkoxyalkyl, alkoxycarbonyl, aryl, arylalkyl, aryl(hydroxy)alkyl, aryloxyalkyl, arylcarbonyl, alkoxycarbonylalkyl, arylthioalkyl, carboxy, carboxyalkyl, cycloalkyl, cycloalkylalkyl, cycloalkylcarbonyl, halogen, heteroaryl, heteroarylalkyl, heterocycle, heterocyclealkyl, 15 heterocyclecarbonyl, hydroxyalkyl, trialkylsilylalkyl, ZaZbN-, ZaZbNalkyl-, or ZcZdNC(O)-; Za and Zb are each independently hydrogen, alkyl, or H 2 NalkylC(O)-; Ze and Zd are each independently hydrogen, alkyl, alkoxyalkyl, aryl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroarylalkyl, heterocyclealkyl, hydroxyalkyl, or dialkylN-alkyl-; m is 0; and b is 0, 1, or 2. In another embodiment of the present invention, there is disclosed a compound of 20 formula (I), wherein A is (iii), (Riii)c N (iii)

R

1 is hydrogen or RaRbN-; R 2 is hydrogen; R4 is RjRkN-alkyl-; Ra and Rb are each independently hydrogen or R 4 -C(O)-; Rj and Rk are each alkyl; Riii is alkoxycarbonylalkyl, 25 alkyl, arylalkyl, cyanoalkyl, heterocyclealkyl, or H 2 NC(O)-alkyl-; c is 0, 1, or 2; and m is 0. In another embodiment of the present invention, there is disclosed a compound of formula (I), wherein A is (iv), (Ri,)c N (iv) 9 WO 2008/154241 PCT/US2008/065727

R

1 is hydrogen or RaRbN-; R 2 is hydrogen; Ra and Rb are each hydrogen; Ri, is aryl, arylalkyl, heterocycle, heterocyclealkyl, ZaZbNalkyl or ZeZdNS(O) 2 -; Za and Zb are each independently hydrogen or alkyl; Zc and Zd are each alkyl; c is 0, 1, or 2; and m is 0. In another embodiment of the present invention, there is disclosed a compound of 5 formula (I), wherein A is (vii), (Rvii)b (vii)

R

1 is hydrogen, alkyl, or RaRbN; R 2 is hydrogen; Ra and Rb are each hydrogen; Rvii is alkyl, alkoxycarbonyl, aryl, arylalkyl, cycloalkyl, heterocyclealkyl, heterocyclecarbonyl, 10 hydroxyalkyl, or ZeZdNC(O)-; Ze and Zd are each independently hydrogen, alkyl, alkoxyalkyl, aryl, arylalkyl, aryl(hydroxy)alkyl, cycloalkyl, cycloalkylalkyl, heteroarylalkyl, heterocycle, heterocyclealkyl, hydroxyalkyl, or CHZeZf; Ze is aryl or heteroaryl, Zf is heteroarylalkyl, heterocyclealkyl, or ZIZ 2 N-alkyl-; b is 1; and m is 0. In another embodiment of the present invention, there is disclosed a compound of 15 formula (I), wherein A is (x), (Rx)b S (x)

R

1 is hydrogen; R 2 is hydrogen; Rx is alkyl, aryl, or ZaZbN-; Za and Zb are each independently hydrogen, alkyl, aryl, or arylalkyl; b is 1 or 2; and m is 0. 20 In another embodiment of the present invention, there is disclosed a compound of formula (I), wherein A is (xiv), (R \)c S -"N (xiv)

R

1 is hydrogen; R 2 is hydrogen; Rxi is ZaZbN-; Za and Zb are each independently 25 hydrogen or cycloalkyl; c is 1; and m is 0. In another embodiment of the present invention, there is disclosed a compound of formula (I), wherein A is (xv), (Rxv)d 0N 10 WO 2008/154241 PCT/US2008/065727 (xv)

R

1 is hydrogen or RaRbN-; R 2 is hydrogen; Ra and Rb are each hydrogen; Rx, is ZaZbN-; Za and Zb are each independently hydrogen, alkoxycarbonylalkyl, aryl, arylalkyl, or cycloalkyl; d is 0 or 1; and m is 0. 5 In another embodiment of the present invention, there is disclosed a compound of formula (I), wherein A is (xvi), (Rxi) A r N\ N N (xvi)

R

1 is hydrogen; R 2 is hydrogen; Rxvi is ZaZbN-; Za and Zb are each independently 10 hydrogen or cycloalkyl; d is 1; and m is 0. In another embodiment of the present invention, there is disclosed a compound of formula (I), wherein A is (xvii), (Rxyli)d N N (xvii) 15 R 1 is hydrogen; R 2 is hydrogen; Rxii is aryl or ZaZbN-; Za and Zb are each independently hydrogen, alkyl, alkoxycarbonylalkyl, aryl, arylalkyl, cycloalkyl, or

H

2 NC(O)-alkyl-; d is 0 or 1; and m is 0. In another embodiment of the present invention, there is disclosed a compound of formula (I), wherein A is (xviii), N 20 NL (xviii)

R

1 is RaRbN-; R 2 is hydrogen; Ra and Rb are each hydrogen; c is 0; and m is 0. In another embodiment of the present invention, there is disclosed a compound of formula (I), wherein A is (xix), (Rxix)cN N 25 (xix) 11 WO 2008/154241 PCT/US2008/065727 Ri is RaRbN-; R 2 is hydrogen; Ra and Rb are each independently hydrogen; c is 0; and m is 0. In another embodiment of the present invention, there is disclosed a compound of formula (I), wherein A is (xx), N 5 N (xx) R1 is RaRbN-; R 2 is hydrogen; R 4 is RjRkN-alkyl-; Ra and Rb are each hydrogen or R4-C(O)-; R and Rk are independently alkyl; Rxx is ZaZbN- or heterocycle; Za and Zb are independently hydrogen or alkyl; c is 0 or 1; and m is 0. 10 In another embodiment of the present invention, there is disclosed a compound of formula (I), wherein A is (xxi), (Rxxi)d N (xxi) R1 is RaRbN-; R 2 is hydrogen; Ra and Rb are each hydrogen; Rxxi is alkoxy; d is 1; and 15 m is 0. In another embodiment of the present invention, there is disclosed a compound of formula (I), wherein A is (xxii), (xxii) 20 R1 is RaRbN-; R 2 is hydrogen; R4 is RjRkN-alkyl-; Ra and Rb are each independently hydrogen or R 4 -C(O)-; Rj and Rk are each alkyl; c is 0 and m is 0. In another embodiment of the present invention, there is disclosed a compound of formula (I), wherein A is (xxiii), (Rxxiii)c 'S 25 (xxiii) 12 WO 2008/154241 PCT/US2008/065727

R

1 is RaRbN-; R 2 is hydrogen; Ra and Rb are each hydrogen; c is 0; and m is 0. Specific embodiments contemplated as part of the invention include, but are not limited to, compounds of formula (I), for example: 5 5-(1-benzyl-1H-1,2,3-triazol-5-yl)-1H-indazole compound with 5-(1-benzyl-1H 1,2,3-triazol-4-yl)-1H-indazole; 5-(1H- 1,2,3-triazol-5-yl)-1H-indazole; 5-(1 -benzyl-1H-1,2,3-triazol-4-yl)-1H-indazole; 5-[1-(2-methylbenzyl)-1H- 1,2,3-triazol-4-yl]-1 H-indazole; 10 5-[1-(3-methylbenzyl)-1H- 1,2,3-triazol-4-yl]-1 H-indazole; 5-[l-(4-methylbenzyl)-1H- 1,2,3-triazol-4-yl]-1 H-indazole; 5-[1-(3-methoxybenzyl)- 1H- 1,2,3-triazol-4-yl]-1 H-indazole; 5-[1-(2-fluorobenzyl)-1H-1,2,3-triazol-4-yl]- 1H-indazole; 5-[l-(3-fluorobenzyl)-1H-1,2,3-triazol-4-yl]- 1H-indazole; 15 5-[1-(4-fluorobenzyl)-1H-1,2,3-triazol-4-yl]- 1H-indazole; 5-[1-(2-chlorobenzyl)- 1H-1,2,3-triazol-4-yl]-1H-indazole; 5-[1-(3-chlorobenzyl)- 1H-1,2,3-triazol-4-yl]-1H-indazole; 5-[1-(4-chlorobenzyl)- 1H-1,2,3-triazol-4-yl]-1H-indazole; 5-[1-(2-bromobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; 20 5-[1-(2-nitrobenzyl)-1H- 1,2,3-triazol-4-yl]- 1H-indazole; 5-[1-(3-nitrobenzyl)-1H- 1,2,3-triazol-4-yl]- 1H-indazole; 5-[1-(4-nitrobenzyl)-1H- 1,2,3-triazol-4-yl]- 1H-indazole; 2- { [4-(1H-indazol-5-yl)-1 H- 1,2,3-triazol- 1 -yl]methyl}benzonitrile; 3- { [4-(1H-indazol-5-yl)-l H- 1,2,3-triazol- 1 -yl]methyl}benzonitrile; 25 4- { [4-(1H-indazol-5-yl)-l H- 1,2,3-triazol- 1 -yl]methyl}benzonitrile; 5- 1-[2-(trifluoromethyl)benzyl]-1H-1,2,3-triazol-4-yl} -1H-indazole; 5-{1-[3-(trifluoromethyl)benzyl]-1H-1,2,3-triazol-4-yl} -1H-indazole; 5-{1-[4-(trifluoromethyl)benzyl]-1H-1,2,3-triazol-4-yl} -1H-indazole; 5- { 1-[3-(trifluoromethoxy)benzyl]-1H-1,2,3-triazol-4-yl} -1H-indazole; 30 5- { 1-[4-(trifluoromethoxy)benzyl]-1H-1,2,3-triazol-4-yl} -1H-indazole; 5-[1-(4-tert-butylbenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; methyl 3- { [4-(1 H-indazol-5 -yl)- 1 H- 1,2,3 -triazol- 1 -yl]methyl} benzoate; methyl 4- { [4-(1 H-indazol-5 -yl)- 1 H- 1,2,3 -triazol- 1 -yl]methyl} benzoate; 5-[1-(2,4-dimethylbenzyl)- 1 H- 1,2,3 -triazol-4-yl]- 1 H-indazole; 13 WO 2008/154241 PCT/US2008/065727 5-[1-(3,5-dimethylbenzyl)- 1 H- 1,2,3-triazol-4-yl]- 1 H-indazole; 5-[1-(2,3-dichlorobenzyl)- 1H- 1,2,3-triazol-4-yl]- 1 H-indazole; 5-[1-(2,4-dichlorobenzyl)- 1H- 1,2,3-triazol-4-yl]- 1 H-indazole; 5-[1-(2,5-dichlorobenzyl)- 1H- 1,2,3-triazol-4-yl]- 1 H-indazole; 5 5-[1-(3,5-dichlorobenzyl)- 1H- 1,2,3-triazol-4-yl]- 1 H-indazole; 5- { 1-[2,4-bis(trifluoromethyl)benzyl]-1H-1,2,3-triazol-4-yl}-1H-indazole; N-cyclohexyl-6-(1H-indazol-5-yl)imidazo[2,1-b] [1,3]thiazol-5-amine; N-cyclohexyl-2-(1H-indazol-5-yl)imidazo[1,2-a]pyridin-3-amine; N-cyclohexyl-2-(1H-indazol-5-yl)imidazo[1,2-a]pyrazin-3-amine; 10 5-[l -benzyl-4-(4-fluorophenyl)- 1 H-imidazol-5-yl]-l H-indazole; N- {3-[4-(4-fluorophenyl)-5-(1H-indazol-5-yl)- 1 H-imidazol- 1 -yl]propyl} -N,N dimethylamine; N-cyclohexyl-2-(1H-indazol-5-yl)imidazo[1,2-a]pyrimidin-3-amine; 5-[4-(4-fluorophenyl)- 1 -(1 -phenylethyl)- 1 H-imidazol-5-yl]- 1 H-indazole; 15 2-(1 H-indazol-5-yl)-N-isopropylimidazo[1,2-a]pyrimidin-3-amine; 4-(1H-indazol-5-yl)-N-phenyl-1,3-thiazol-2-amine; 5-(2-methyl-1,3-thiazol-4-yl)-1H-indazole; N-ethyl-4-(1 H-indazol-5 -yl)-1,3 -thiazol-2-amine; N-benzyl-4-(1 H-indazol-5-yl)- 1,3-thiazol-2-amine; 20 4-(1 H-indazol-5-yl)-1,3-thiazol-2-amine; 4-(1 H-indazol-5-yl)-N-(2-phenylethyl)- 1,3-thiazol-2-amine; N-benzyl-2-(1 H-indazol-5-yl)imidazo[1,2-a]pyrimidin-3-amine; N-butyl-2-(1H-indazol-5-yl)imidazo[1,2-a]pyrimidin-3-amine; N-(4-chlorophenyl)-2-(1H-indazol-5-yl)imidazo[ 1,2-a]pyrimidin-3-amine; 25 2-(1H-indazol-5-yl)-N-(4-methoxyphenyl)imidazo[1,2-a]pyrimidin-3-amine; 2-(1 H-indazol-5-yl)imidazo[ 1,2-a]pyrimidine; methyl N-[2-(1H-indazol-5-yl)imidazo[1,2-a]pyridin-3-yl]glycinate; N-benzyl-2-(1H-indazol-5-yl)imidazo[1,2-a]pyridin-3-amine; N-(4-chlorophenyl)-2-(1H-indazol-5-yl)imidazo[1,2-a]pyridin-3-amine; 30 2-(1H-indazol-5-yl)-N-(4-methoxyphenyl)imidazo[1,2-a]pyridin-3-amine; tert-butyl 4-[4-(4-fluorophenyl)-5-(1H-indazol-5-yl)-1H-imidazol-1-yl]piperidine-1 carboxylate; 3,5-bis(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazole; 5-(1-benzyl-1H-1,2,3-triazol-4-yl)-3-phenyl-1H-indazole; 14 WO 2008/154241 PCT/US2008/065727 5-(1 -benzyl- 1H-1,2,3-triazol-4-yl)- 1 H-indazol-3-amine; 5-(1 -benzyl- 1H-1,2,3-triazol-4-yl)- 1-[(1 -methylpiperidin-4-yl)carbonyl] -1 H-indazol 3-amine; N-[5-(1 -benzyl- 1 H-1,2,3-triazol-4-yl)- 1 H-indazol-3-yl]-2-methoxyacetamide; 5 N 1 -[5-(1 -benzyl- 1H-1,2,3-triazol-4-yl)- 1H-indazol-3-yl]-N2,N 2 -dimethylglycinamide; N-[5-(1 -benzyl- 1 H- 1,2,3-triazol-4-yl)- 1 H-indazol-3-yl]butanamide; 5- [4-(4-fluorophenyl)- 1 -piperidin-4-yl- 1 H-imidazol-5 -yl]-l H-indazole; 5- {4-(4-fluorophenyl)- 1-[2-(1 -methylpyrrolidin-2-yl)ethyl]-1 H-imidazol-5-yl} -1 H indazole; 10 5- {4-(4-fluorophenyl)- 1 -[3-(4-methylpiperazin- 1 -yl)propyl] -1 H-imidazol-5-yl} -1H indazole; ethyl 5-(1H-indazol-5-yl)isoxazole-3-carboxylate; 5-(1H-indazol-5-yl)-N-methylisoxazole-3-carboxamide; 5-(3-benzylisoxazol-5-yl)-1H-indazole; 15 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]benzamide; 5-(3-propylisoxazol-5-yl)-1H-indazole; N-benzyl-4-(1H-indazol-5-yl)-5-phenyl-1,3-thiazol-2-amine; 4-(1H-indazol-5-yl)-N,5-diphenyl-1,3-thiazol-2-amine; 5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazole; 20 5-(1-benzyl-4-cyclopropyl-1H-1,2,3-triazol-5-yl)-1H-indazole; 2-(1H-indazol-5-yl)-3-phenylimidazo[1,2-a]pyrimidine; 5-[1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; 5-[3-(piperidin-1-ylcarbonyl)isoxazol-5-yl]-1H-indazole; 5-(1H-indazol-5-yl)-N-phenylisoxazole-3-carboxamide; 25 N-cyclohexyl-5-(1H-indazol-5-yl)isoxazole-3-carboxamide; 5-[3-(piperidin-1-ylmethyl)isoxazol-5-yl]-1H-indazole; [5-(1H-indazol-5-yl)isoxazol-3-yl]methanol; 5-(1H-indazol-5-yl)-N-(2-methoxyethyl)isoxazole-3-carboxamide; 5-(1-benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-1H-indazole; 30 5-(4-benzyl-1H-1,2,3-triazol-1-yl)-1H-indazole; 5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-amine; 5-(1-benzyl-4-cyclopropyl-1H-1,2,3-triazol-5-yl)-1H-indazol-3-amine; 5-(3-isobutylisoxazol-5-yl)-1H-indazol-3-amine; 5-(3-benzylisoxazol-5-yl)-1H-indazol-3-amine; 15 WO 2008/154241 PCT/US2008/065727 N- {2-[4-(4-fluorophenyl)-5-( 1 H-indazol-5-yl)- 1 H-imidazol- l -yl] ethyl} -N,N dimethylamine; 5- [4-(4-fluorophenyl)- 1-(3 -morpholin-4-ylpropyl)- 1H-imidazol-5 -yl] -1H-indazole; 5- [4-(4-fluorophenyl)- 1-(3-pyrrolidin- 1-ylpropyl)- 1H-imidazol-5 -yl] -1H-indazole; 5 5- {4-(4-fiuorophenyl)-1- [2-(4-methylpiperidin- 1-yl)ethyl] -1H-imidazol-5 -yl} -1 indazole; 5-[l -(1 -benzylpiperidin-4-yl)-4-(4-fluorophenyl)- 1H-imidazol-5-yl] -1H-indazole; 5- [4-(4-fluorophenyl)- 1-(2-morpholin-4-ylethyl)- 1H-imidazol-5 -yl]-l H-indazole; 5-[l -(1 -benzylpyrrolidin-3-yl)-4-(4-fluoropheny)- 1H-imidazol-5-yl]- 1H-indazole; 10 2- f{4-[4-(4-fluorophenyl)-5 -(1 H-indazol-5 -yl)-l H-imidazol- 1-yl]piperidin- l-yl} -2 oxoethanol; 5 -(1 -benzyl-5 -phenyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -amine; 2-[1 -(1 H-indazol-5 -yl)-l H-i ,2,3-triazol-4-yl]propan-2-ol; 5- [4-(methoxymethyl)- 1H- 1,2,3 -triazol- l-yl] -1H-indazole; 15 1-[l -(1 H-indazol-5 -yl)-l H-i ,2,3-triazol-4-yl]-l1-phenylethanol; 5 -(4-propyl- 1H- 1,2,3 -triazol- l-yl)-l H-indazole; 1-[l -(1 H-indazol-5 -yl)-l H-i ,2,3-triazol-4-yl]propan-2-ol; 3-[l -(1 H-indazol-5 -yl)-l H-i ,2,3-triazol-4-yl]propan-l1-ol; 1- { [1 -(1 H-indazol-5 -yl)-l H- 1,2,3 -triazol-4-yl]methyl} -1H-i ,2,3-benzotriazole; 20 5- f{4-[(phenylthio)methyl] -1H- 1,2,3 -triazol- l-yl} -1 H-indazole; 5 -(4-cyclopropyl- 1H-i ,2,3-triazol- l-yl)-l H-indazole; 5- [4-(2-phenylethyl)- 1H- 1,2,3 -triazol- l-yl] -1H-indazole; 5- [4-(eyclohexylmethyl)- 1H- 1,2,3 -triazol- l-yl] -1H-indazole; 5 -(4-cyclopentyl- 1H-i ,2,3-triazol- l-yl)-l H-indazole; 25 1-[l -(1 H-indazol-5 -yl)-l H-i ,2,3-triazol-4-yl]cyclohexanol; 5- [4-(phenoxymethyl)- 1H- 1,2,3 -triazol- l-yl]-l H-indazole; 5- { 4-[( 1,1-dioxidothiomorpholin-4-yl)methyl]- 1H- 1,2,3 -triazol- l-yl} -1H-indazole; 5- [4-(3 -phenyipropyl)- 1H-i ,2,3 -triazol- l-yl]-l H-indazole; [1 -benzyl-4-(i H-indazol-5-yl)- 1H- 1,2,3 -triazol-5 -yl] (phenyl)methanone; 30 N,N-diethyl-N- { [1 -(1H-indazol-5 -yl)-i H- 1,2,3 -triazol-4-yl]methyl} amine; ethyl N-[2-( 1H-indazol-5 -yl)imidazo [1 ,2-a]pyrimidin-3-yl] -beta-alaninate; 5 -(1 -benzyl-5 -methyl-i H- 1,2,3 -triazol-4-yl)- 1H-indazole; 5 -(1 -benzyl-5 -methyl-i H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -amine;

N

3 -[2-( 1H-indazol-5-yl)imidazo [1 ,2-a]pyrimidin-3 -yl]-j3-alaninamide; 16 WO 2008/154241 PCT/US2008/065727 5-(1 -benzyl-5-iodo- 1 H-1,2,3-triazol-4-yl)- 1H-indazol-3-amine; N- {3-[4-(3-amino-i H-indazol-5-yl)-1 -benzyl-1H-1,2,3-triazol-5-yl]phenyl} -N'-(3 methylphenyl)urea; 5 -(1 H-indazol-5 -yl)-N-(2-isopropoxyethyl)isoxazole-3 -carboxamide; 5 5- [3 -(morpholin-4-ylcarbonyl)isoxazol-5 -yl] -1 H-indazole; 5 -(1 H-indazol-5 -yl)-N-(3-morpholin-4-ylpropyl)isoxazole-3-carboxamide; N-[2-(1H-imidazol-4-yl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide; (3R)- 1- {[5-(1H-indazol-5-yl)isoxazol-3-yl]carbonyl} piperidin-3-ol; 1- { [5-(1H-indazol-5-yl)isoxazol-3-yl]carbonyl} piperidine-3-carboxamide; 10 2-[2-(4- { [5-(1 H-indazol-5-yl)isoxazol-3-yl]carbonyl}piperazin- 1 -yl)ethoxy]ethanol; 5- {3-[(4-methyl- 1,4-diazepan- 1 -yl)carbonyl]isoxazol-5-yl} -1 H-indazole; N-(3 -hydroxypropyl)-5 -(1 H-indazol-5 -yl)isoxazole-3-carboxamide; N-[(1R)-2-hydroxy- 1 -phenylethyl]-5-(1 H-indazol-5-yl)isoxazole-3-carboxamide; N-[3-(1H-imidazol- 1 -yl)propyl]-5-(1 H-indazol-5-yl)isoxazole-3-carboxamide; 15 5-(1 H-indazol-5-yl)-N-[3-(2-oxopyrrolidin- 1 -yl)propyl]isoxazole-3-carboxamide; N- {2-[4-(aminosulfonyl)phenyl]ethyl} -5-(1 H-indazol-5-yl)isoxazole-3-carboxamide; [1 -benzyl-4-(1H-indazol-5-yl)- 1 H- 1,2,3-triazol-5-yl](3-chlorophenyl)methanone; [1 -benzyl-4-(1H-indazol-5-yl)- 1 H- 1,2,3-triazol-5-yl](cyclopropyl)methanone; 5-[5-cyclopropyl- 1 -(tetrahydro-2H-pyran-4-ylmethyl)- 1 H- 1,2,3-triazol-4-yl]-1H 20 indazole; N'- { [1 -benzyl-4-(1H-indazol-5-yl)- 1H-1,2,3-triazol-5-yl]methyl} glycinamide; (4-fluorophenyl)[4-(1H-indazol-5-yl)-1 -(tetrahydro-2H-pyran-4-ylmethyl)-1H- 1,2,3 triazol-5-yl]methanone; (4-chlorophenyl) [4-(1 H-indazol-5 -yl)-1 -(tetrahydro-2H-pyran-4-ylmethyl)- 1 H- 1,2,3 25 triazol-5-yl]methanone; (3 -chlorophenyl) [4-(1 H-indazol-5 -yl)-1 -(tetrahydro-2H-pyran-4-ylmethyl)- 1 H- 1,2,3 triazol-5-yl]methanone; (2-chlorophenyl) [4-(1 H-indazol-5 -yl)-1 -(tetrahydro-2H-pyran-4-ylmethyl)- 1 H- 1,2,3 triazol-5-yl]methanone; 30 cyclopentyl[4-(1H-indazol-5-yl)-1 -(tetrahydro-2H-pyran-4-ylmethyl)- 1H- 1,2,3 triazol-5-yl]methanone; 1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazole-5-carboxylic acid; 5-{5-(4-fluorophenyl)-1-[4-(trifluoromethyl)benzyl]-1H-1,2,3-triazol-4-yl}-1H indazol-3-amine; 17 WO 2008/154241 PCT/US2008/065727 5-[1 -benzyl-5-(4-fluorophenyl)- 1 H- 1,2,3-triazol-4-yl] -1 H-indazol-3-amine; [4-(1 H-indazol-5-yl)-l -(tetrahydro-2H-pyran-4-ylmethyl)- 1 H-1,2,3-triazol-5 yl](tetrahydro-2H-pyran-4-yl)methanone; 5-[1 -benzyl-5-(2-methylphenyl)- 1 H- 1,2,3-triazol-4-yl]- 1 H-indazole; 5 5- { 1-benzyl-5-[(4-methylpiperazin-1-yl)carbonyl] -1 H- 1,2,3-triazol-4-yl} -1 H indazole; 1- { [1 -benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazol-5-yl]carbonyl} piperidin-4-ol; 1 -acetyl-5-[5-(4-fluorophenyl)- 1 -(tetrahydro-2H-pyran-4-ylmethyl)-1H- 1,2,3-triazol 4 -yl]-1H-indazole; 10 1 -benzyl-4-(1H-indazol-5-yl)-N,N-dimethyl- 1 H- 1,2,3-triazole-5-carboxamide; N, 1 -dibenzyl-4-(1 H-indazol-5-yl)-1 H- 1,2,3-triazole-5-carboxamide; N-(2-hydroxy-2-phenylethyl)-5-(1H-indazol-5-yl)-N-methylisoxazole-3-carboxamide; N- [(1S)-2-hydroxy- 1 -phenylethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide; N-benzyl-N-(2-hydroxyethyl)-5 -(1 H-indazol-5 -yl)isoxazole-3 -carboxamide; 15 5-[1 -benzyl-5-(2-methylphenyl)- 1 H- 1,2,3-triazol-4-yl]-3-methyl-i H-indazole; 5-[1 -benzyl-5-(2-methylphenyl)- 1 H- 1,2,3-triazol-4-yl]- 1 H-indazol-3-amine; 2- {2-[1 -(1 H-indazol-5-yl)- 1 H-1,2,3 -triazol-4-yl] ethyl} -1 H-isoindole- 1,3(2H)-dione; 5- {4-[(2,4-dichlorophenoxy)methyl]-1H-1,2,3-triazol-1-yl} -1H-indazole; 5- {4-[(2,6-dichlorophenoxy)methyl]-1H-1,2,3-triazol-1-yl} -1H-indazole; 20 5- [5 -(4-fluorophenyl)- 1 -(tetrahydro-2H-pyran-4-ylmethyl)- 1 H-1,2,3-triazol-4-yl]- 1 H indazole; 1- { [1 -(1 H-indazol-5-yl)- 1H- 1,2,3-triazol-4-yl]methyl} -1 H-indazole; 5-[1 -benzyl-5-(piperidin-1 -ylcarbonyl)- 1 H-1,2,3-triazol-4-yl]- 1H-indazole; 5- [5 -(2-methylphenyl)- 1 -(tetrahydro-2H-pyran-4-ylmethyl)- 1 H- 1,2,3 -triazol-4-yl] 25 IH-indazole; 5- [5 -(2-methylphenyl)- 1 -(tetrahydro-2H-pyran-4-ylmethyl)- 1 H- 1,2,3 -triazol-4-yl] 1H-indazol-3-amine; 5-[1 -benzyl-5-(morpholin-4-ylcarbonyl)- 1 H- 1,2,3-triazol-4-yl] -1 H-indazole; 5-[1 -benzyl-5-(4-methoxyphenyl)- 1 H-1,2,3-triazol-4-yl]- 1H-indazol-3-amine; 30 N-[(iS)- 1 -benzyl-2-hydroxyethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide; N-[(iS,2R)-2-hydroxy-2,3-dihydro- 1 H-inden-1 -yl]-5-(1 H-indazol-5-yl)isoxazole-3 carboxamide; 5- {3-[(3-phenylmorpholin-4-yl)carbonyl]isoxazol-5-yl} -1 H-indazole; N-benzyl-5-(1 H-indazol-5-yl)isoxazole-3-carboxamide; 18 WO 2008/154241 PCT/US2008/065727 ((1 S)-2- { [5-(1H-indazol-5-yl)isoxazol-3-yl]carbonyl}-6,7-dimethoxy-1,2,3,4 tetrahydroisoquinolin- 1 -yl)methanol; N- [(1 R)-3 -hydroxy- 1 -phenylpropyl]-5-(l H-indazol-5-yl)isoxazole-3-carboxamide; N- [(1 S)-3 -hydroxy- 1 -phenylpropyl]-5 -(1 H-indazol-5 -yl)isoxazole-3 -carboxamide; 5 N-2,3 -dihydro- 1 H-inden- 1-yl-5-(l H-indazol-5-yl)isoxazole-3 -carboxamide; N-2,3 -dihydro- 1 H-inden-2-yl-5-(1 H-indazol-5-yl)isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-(1 -phenylpropyl)isoxazole-3 -carboxamide; 5- {1 -benzyl-5 -[3 -(dimethylamino)phenyl] -1 H- 1,2,3 -triazol-4-yl} -1 H-indazol-3 amine; 10 5- {1 -benzyl-5 - [4-(dimethylamino)phenyl] -1 H- 1,2,3 -triazol-4-yl} -1 H-indazol-3 amine; N- {3-[4-(3-amino- 1 H-indazol-5-yl)- 1 -benzyl- 1H- 1,2,3-triazol-5 yl]phenyl} acetamide; N- {4-[4-(3-amino- 1 H-indazol-5-yl)- 1 -benzyl- 1H- 1,2,3-triazol-5 15 yl]phenyl} acetamide; 5- {1 -benzyl-5 -[3 -(1 H-pyrazol- 1 -yl)phenyl]- 1 H- 1,2,3 -triazol-4-yl} -1 H-indazol-3 amine; 5-[1 -benzyl-5 -(1-methyl-i H-pyrazol-4-yl)- 1 H- 1,2,3 -triazol-4-yl]- 1 H-indazol-3 amine; 20 3- [4-(3 -amino-i H-indazol-5 -yl)-1 -benzyl- 1 H- 1,2,3 -triazol-5-yl]-N-phenylbenzamide; 3- [4-(3 -amino-i H-indazol-5 -yl)-1 -benzyl- 1 H- 1,2,3 -triazol-5-yl]-N-benzylbenzamide; 5- [ -benzyl-5 -(-methyl- H-indol-5-yl)- 1 H- 1,2,3 -triazol-4-yl]- 1 H-indazol-3 -amine; 5- [1 -benzyl-5 -(3-methoxyphenyl)- 1 H-1,2,3-triazol-4-yl]- 1 H-indazol-3 -amine; 5-[1 -benzyl-5 -(3-morpholin-4-ylphenyl)- 1 H- 1,2,3 -triazol-4-yl] -1 H-indazol-3 -amine; 25 5- [3 -(1,3 -dihydro-2H-isoindol-2-ylcarbonyl)isoxazol-5 -yl]-1 H-indazole; 5- {3-[(4-methyl-2-phenylpiperazin- 1 -yl)carbonyl]isoxazol-5 -yl} -1 H-indazole; 1- { [1 -benzyl-4-(1 H-indazol-5 -yl)-1 H- 1,2,3 -triazol-5-yl] carbonyl} piperidin-4-amine; N- [5 -(1 -benzyl-5 -phenyl- 1 H-1,2,3-triazol-4-yl)- 1 H-indazol-3-yl]benzamide; N- [5 -(1 -benzyl-5 -phenyl- 1 H-1,2,3-triazol-4-yl)- 1 H-indazol-3-yl]benzenesulfonamide; 30 N- [5 -(1 -benzyl-5 -phenyl- 1 H-1,2,3-triazol-4-yl)- 1 H-indazol-3-yl] -N'-(4 methoxyphenyl)urea; N- [5 -(1 -benzyl-5 -phenyl- 1 H-1,2,3-triazol-4-yl)- 1 H-indazol-3-yl]butanamide; N- [5 -(1 -benzyl-5 -phenyl- 1 H-1,2,3-triazol-4-yl)- 1 H-indazol-3-yl]-2 methylpropanamide; 19 WO 2008/154241 PCT/US2008/065727 N-[5-(1-benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3 yl]cyclopropanecarboxamide; N-[1-benzoyl-5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3 yl]benzamide; 5 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-3 fluorobenzamide; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]benzamide; N-benzyl-5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-amine; N-[(1R)-1-benzyl-2-hydroxyethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide; 10 5-(1-benzyl-1H-pyrazol-4-yl)-1H-indazole; N-[(1R)-3-hydroxy-1-phenylpropyl]-5-(3-methyl-1H-indazol-5-yl)isoxazole-3 carboxamide; 3- [4-(3 -amino-i H-indazol-5 -yl)-l -benzyl- 1 H- 1,2,3 -triazol-5-yl]phenol; 3- [4-(3 -amino-i H-indazol-5 -yl)-1 -benzyl- 1 H- 1,2,3 -triazol-5-yl]benzamide; 15 5- { 1-benzyl-5-[4-(methylsulfonyl)phenyl]-1H-1,2,3-triazol-4-yl} -1H-indazol-3 amine; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2 chlorobenzamide; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]- 4 20 chlorobenzamide; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3 yl]ethanesulfonamide; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3 yl]benzenesulfonamide; 25 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]- 2 chlorobenzenesulfonamide; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-3 chlorobenzenesulfonamide; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]- 4 30 chlorobenzenesulfonamide; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]- 2 ,5 dimethylfuran-3-sulfonamide; 5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-N-(2-chlorobenzyl)-1H-indazol-3 amine; 20 WO 2008/154241 PCT/US2008/065727 5-(1 -benzyl-5-cyclopropyl- 1H- 1,2,3-triazol-4-yl)-N-(3-chlorobenzyl)- 1H-indazol-3 amine; N-[5-(1 -benzyl-5-cyclopropyl- 1 H- 1,2,3-triazol-4-yl)-1H-indazol-3-yl]- 3 chlorobenzamide; 5 N-[5-(1 -benzyl-5-cyclopropyl- 1 H- 1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-furamide; 5-(1 -benzyl-5-cyclopropyl- 1H- 1,2,3-triazol-4-yl)-N-ethyl- 1H-indazol-3-amine; 5-(1 -benzyl-5-cyclopropyl- 1H- 1,2,3-triazol-4-yl)-N-(4-chlorobenzyl)- 1H-indazol-3 amine; 5-(1 -benzyl-5-cyclopropyl- 1H- 1,2,3-triazol-4-yl)-N-(3-furylmethyl)- 1 H-indazol-3 10 amine; N-[5-(1 -benzyl-5-cyclopropyl- 1 H- 1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-[5-methyl 2-(trifluoromethyl)-3-furyl]urea; N-[5-(1 -benzyl-5-cyclopropyl- 1 H- 1,2,3-triazol-4-yl)-1H-indazol-3-yl]-3-furamide; 5-(1 H-indazol-5-yl)-N-[(1 S)- 1 -phenylpropyl]isoxazole-3-carboxamide; 15 5-(1 H-indazol-5-yl)-N-[(l R)- 1 -phenylpropyl]isoxazole-3-carboxamide; 5-(1 -benzyl- 1H-pyrazol-4-yl)- 1H-indazol-3-amine; 1 -benzyl-4-(1H-indazol-5-yl)-N-[(2S)-tetrahydrofuran-2-ylmethyl] -1 H- 1,2,3-triazole 5-carboxamide; 1 -benzyl-4-(1H-indazol-5-yl)-N-(2-isopropoxyethyl)- 1 H-1,2,3-triazole-5 20 carboxamide; 1 -benzyl-4-(1H-indazol-5-yl)-N-[(2R)-tetrahydrofuran-2-ylmethyl]- 1 H- 1,2,3-triazole 5-carboxamide; 1 -benzyl-4-(1H-indazol-5-yl)-N-(tetrahydrofuran-3-ylmethyl)- 1 H-1,2,3-triazole-5 carboxamide; 25 1 -benzyl-N-cyclopentyl-4-(1 H-indazol-5-yl)-l H- 1,2,3-triazole-5-carboxamide; 1 -benzyl-N-(cyclopentylmethyl)-4-(1H-indazol-5-yl)- 1 H- 1,2,3-triazole-5 carboxamide; 1 -benzyl-N-ethyl-4-(1 H-indazol-5-yl)-N-methyl- 1 H- 1,2,3-triazole-5-carboxamide; 1 -benzyl-4-(1H-indazol-5-yl)-N-isopropyl-N-methyl- 1 H-1,2,3-triazole-5 30 carboxamide; 1 -benzyl-4-(1H-indazol-5-yl)-N-(2-methoxyethyl)-N-methyl- 1 H-1,2,3-triazole-5 carboxamide; 1 -benzyl-4-(1H-indazol-5-yl)-N-phenyl- 1 H-1,2,3-triazole-5-carboxamide; 1 -benzyl-N-(4-chlorophenyl)-4-(1 H-indazol-5-yl)-l H-1,2,3-triazole-5-carboxamide; 21 WO 2008/154241 PCT/US2008/065727 1 -benzyl-4-(1H-indazol-5-yl)-N-(2-morpholin-4-ylethyl)- 1 H-1,2,3-triazole-5 carboxamide; 1 -benzyl-N-[2-(dimethylamino)ethyl]-4-(1H-indazol-5-yl)-N-methyl- 1 H- 1,2,3 triazole-5-carboxamide; 5 1 -benzyl-N-(2-hydroxyethyl)-4-(l H-indazol-5-yl)-N-propyl- 1 H- 1,2,3-triazole-5 carboxamide; 1 -benzyl-N-[3-(dimethylamino)propyl]-4-(l H-indazol-5-yl)-N-methyl-1H- 1,2,3 triazole-5-carboxamide; 1 -benzyl-N-[2-(diethylamino)ethyl]-4-(1 H-indazol-5-yl)-N-methyl- 1 H-1,2,3-triazole 10 5-carboxamide; N, 1 -dibenzyl-N-ethyl-4-(1H-indazol-5-yl)- 1 H- 1,2,3-triazole-5-carboxamide; N, 1 -dibenzyl-N-(2-hydroxyethyl)-4-(1H-indazol-5-yl)-l H- 1,2,3-triazole-5 carboxamide; (3R)- 1-{ [1 -benzyl-4-(l H-indazol-5-yl)-1 H- 1,2,3-triazol-5-yl]carbonyl}piperidin-3-ol; 15 1- { [1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazol-5-yl]carbonyl} piperidine-4 carboxamide; 5-{ 1-benzyl-5-[(2,6-dimethylmorpholin-4-yl)carbonyl] -1 H-1,2,3-triazol-4-yl} -1 H indazole; 5- {5-[(4-acetylpiperazin-1-yl)carbonyl]- 1 -benzyl- 1 H- 1,2,3-triazol-4-yl} -1 H-indazole; 20 5-{1-benzyl-5-[(4-phenylpiperazin-1-yl)carbonyl]- 1 H-1,2,3-triazol-4-yl} -1 H indazole; 1 -benzyl-N-[(1 R)- 1 -(hydroxymethyl)-2-methylpropyl]-4-(1H-indazol-5-yl)-1H- 1,2,3 triazole-5-carboxamide; 1 -benzyl-N-[(1 S)- 1 -(hydroxymethyl)-2-methylpropyl]-4-(1H-indazol-5-yl)- 1 H- 1,2,3 25 triazole-5-carboxamide; 1 -benzyl-N-[3-(l H-imidazol-1 -yl)propyl]-4-(1H-indazol-5-yl)-l H- 1,2,3-triazole-5 carboxamide; N-[5-(1 -benzyl-5-cyclopropyl- 1 H- 1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-ethylurea; N-[5-(1 -benzyl-5-cyclopropyl- 1 H- 1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-phenylurea; 30 N-benzyl-N'-[5-(1 -benzyl-5-cyclopropyl-1H- 1,2,3-triazol-4-yl)- 1 H-indazol-3-yl]urea; N-[5-(1 -benzyl-5-cyclopropyl- 1 H- 1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-(2 chlorophenyl)urea; N-[5-(1 -benzyl-5-cyclopropyl- 1 H- 1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-(3 chlorophenyl)urea; 22 WO 2008/154241 PCT/US2008/065727 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-(4 chlorophenyl)urea; N-[5-(1-benzyl-5-iodo-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]benzamide; 3- [4-(3 -amino-i H-indazol-5 -yl)-i H-pyrazol- 1 -yl]propanenitrile; 5 2- [4-(3 -amino-i H-indazol-5 -yl)-i H-pyrazol- 1-yl] acetamide; methyl 3- [4-(3-amino- 1 H-indazol-5 -yl)-l H-pyrazol- 1 -yl]propanoate; 3- [4-(3 -amino-i H-indazol-5 -yl)-l H-pyrazol- 1 -yl]propanamide; [4-(3 -amino-i H-indazol-5 -yl)-l H-pyrazol- I-yl] acetonitrile; 4-(3 -amino-i H-indazol-5-yl)-N,N-dimethyl- 1 H-imidazole- 1-sulfonamide; 10 5-pyrazin-2-yl-1H-indazol-3-amine; 5-thien-2-yl-1H-indazol-3-amine; 5-(2-aminopyrimidin-4-yl)-1H-indazol-3-amine; 5-(2-methoxypyridin-3-yl)-1H-indazol-3-amine; 5-imidazo[1,2-a]pyridin-3-yl-iH-indazol-3-amine; 15 N 2

,N

2 -dimethyl-N-[5-(1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]glycinamide; 5-(1H-pyrazol-5-yl)-1H-indazol-3-amine; 5-(4-methyl-iH-imidazol-5-yl)-1H-indazol-3-amine; 5-(1H-imidazol-4-yl)-1H-indazol-3-amine; N2,N 2 -dimethyl-N'-{5-[1-(3-methylbenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazol-3 20 yl} glycinamide; 5 -(1 -benzyl- 1 H-imidazol-4-yl)- 1 H-indazol-3 -amine; N- {5 -[1-(4-tert-butylbenzyl)- 1 H- 1,2,3 -triazol-4-yl] - I H-indazol-3 -yl}-N 2

,N

2 dimethylglycinamide;

N

2

,N

2 -dimethyl-N-{5-[1-(2-piperidin-1-ylethyl)-1H-1,2,3-triazol-4-yl]-1H-indazol-3 25 yl} glycinamide;

N

2

,N

2 -dimethyl-N - {5-[ 1-(2-morpholin-4-ylethyl)- 1 H-1,2,3 -triazol-4-yl] -1 H-indazol 3-yl}glycinamide; N'-(5- { 1- [2-(3,5-dimethylisoxazol-4-yl)ethyl] -1 H-1,2,3 -triazol-4-yl} -1 H-indazol-3 yl)-N 2

,N

2 -dimethylglycinamide; 30 N'-(5- { 1-[2-(3,5-dimethyl- 1 H-pyrazol-4-yl)ethyl]- I H-1,2,3 -triazol-4-yl} - H-indazol 3-yl)-N 2

,N

2 -dimethylglycinamide; 2-(4- {3-[(N,N-dimethylglycyl)amino] - I H-indazol-5 -yl} -1 H- 1,2,3 -triazol- 1 -yl)- 2 methylpropanoic acid; ethyl (4-{3-[(N,N-dimethylglycyl)amino]-1H-indazol-5-yl}-1H-1,2,3-triazol-1 23 WO 2008/154241 PCT/US2008/065727 yl)acetate;

N

2

,N

2 -dimethyl-N-(5- { 1-[(trimethylsilyl)methyl]-1 H-1,2,3-triazol-4-yl} -1H-indazol 3-yl)glycinamide; Nl-[5-(3-furyl)- 1 H-indazol-3-yl]-N 2

,N

2 -dimethylglycinamide; 5 N 2

,N

2 -dimethyl-N-[5-(1 H-pyrazol-5-yl)-l H-indazol-3-yl]glycinamide;

N

2

,N

2 -dimethyl-N-(5-pyrimidin-5-yl-1H-indazol-3-yl)glycinamide; Nl-[5-(2,1,3-benzoxadiazol-5-yl)- 1 H-indazol-3-yl]-N 2,N2 -dimethylglycinamide;

N

2

,N

2 -dimethyl-N-[5-(1 H-pyrazol-4-yl)- 1 H-indazol-3-yl]glycinamide;

N

2

,N

2 -dimethyl-N-[5-(1-methyl-i H-pyrazol-4-yl)- 1H-indazol-3-yl]glycinamide; 10 Nl-[5-(3,5-dimethyl- 1 H-pyrazol-4-yl)- 1 H-indazol-3-yl]-N 2

,N

2 -dimethylglycinamide;

N

1 -{5-[2-(dimethylamino)pyrimidin-5-yl]-1H-indazol-3-yl}-N 2

,N

2 _ dimethylglycinamide;

N

2

,N

2 -dimethyl-N-[5-(2-morpholin-4-ylpyrimidin-5-yl)-1H-indazol-3 yl]glycinamide; 15 N 2

,N

2 -dimethyl-N-{5-[1-(2-morpholin-4-ylethyl)-1H-pyrazol-4-yl]-1H-indazol-3 yl} glycinamide; Nl-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N2 ,N 2_ dimethylglycinamide; N'-[5-(1 -benzyl- 1 H-pyrazol-4-yl)- 1 H-indazol-3 -yl]-N 2

,N

2 -dimethylglycinamide; 20 N-[5-(1 -benzyl- 1 H- 1,2,3 -triazol-4-yl)- 1 H-indazol-3 -yl]-N 2 -methylglycinamide; N- [5 -(1 -benzyl- 1 H- 1,2,3 -triazol-4-yl)- 1 H-indazol-3 -yl]-2-pyrrolidin- 1 -ylacetamide; N'-[5-(1 -benzyl- 1 H- 1,2,3 -triazol-4-yl)- 1 H-indazol-3 -yl]-N 2 -cyclopentylglycinamide; N-[5-(1 -benzyl- 1 H- 1,2,3 -triazol-4-yl)- 1 H-indazol-3 -yl]-N 2 -cyclopropylglycinamide; N-[5-(1 -benzyl- 1 H- 1,2,3 -triazol-4-yl)- 1 H-indazol-3 -yl]-N 2 -tetrahydro-2H-pyran-4 25 ylglycinamide; N- [5 -(1 -benzyl- 1 H- 1,2,3 -triazol-4-yl)- 1 H-indazol-3 -yl]-2-(3-hydroxypyrrolidin- 1 yl)acetamide; N- [5 -(1 -benzyl- 1 H- 1,2,3 -triazol-4-yl)- 1 H-indazol-3 -yl]-2-(3-hydroxypiperidin- 1 yl)acetamide; 30 N 1 -[5-(1 -benzyl- 1 H- 1,2,3 -triazol-4-yl)- 1 H-indazol-3 -yl]-N 3

,N

3 -dimethyl-beta alaninamide; N- [5 -(1 -benzyl- 1 H- 1,2,3 -triazol-4-yl)- 1 H-indazol-3 -yl]-2-morpholin-4-ylacetamide; N- [5 -(1 -benzyl- 1 H- 1,2,3 -triazol-4-yl)- 1 H-indazol-3 -yl]-2-(4-methylpiperazin- 1 yl)acetamide; 24 WO 2008/154241 PCT/US2008/065727 N- [5 -(1-benzyl- 1H-i ,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-2-(3-oxopiperazin- 1 yl)acetamide;

N

1 -115-(1 -benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-N 2 -isopropylglycinamide;

N

1 -115-(1 -benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-N 2 -cyclohexylglycinamide; 5 N- [5 -(1-benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]acetamide;

N

1 -115-(1 -benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-N 2 -cyclobutylglycinamide; N- [5-(1 -benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-N'-propylurea; N- [5-(1 -benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]ethanesulfonamide; 5 -(1 -benzyl- 1H-i ,2,3-triazol-4-yl)-N-(cyclopropylmethyl)- 1H-indazol-3-amine; 10 N- [5 -(1-benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-N'-ethylurea; 1- [5 -(1-benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3-yl]pyrrolidin-2-one; N- [5 -(1-benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]- 4 (dimethylamino)butanamide; N-3 ,4-dihydro- 1H-isochromen-4-yl-5 -(1 H-indazol-5 -yl)isoxazole-3 -carboxamide; 15 N-(cyclohexylmethyl)-5 -(1 H-indazol-5 -yl)isoxazole-3-carboxamide; N-(3 -chlorobenzyl)-5-( 1H-indazol-5-yl)isoxazole-3-carboxamide; 5 -(1 H-indazol-5 -yl)-N-(2-methoxybenzyl)isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-[2-(trifluoromethyl)benzyl]isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-[3-(trifluoromethyl)benzyl]isoxazole-3 -carboxamide; 20 5 -(1 H-indazol-5 -yl)-N-[4-(trifluoromethyl)benzyllsoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-(pyridin-2-ylmethyl)isoxazole-3-carboxamide; 5 -(1 H-indazol-5 -yl)-N-(pyridin-3-ylmethyl)isoxazole-3-carboxamide; 5 -(1 H-indazol-5 -yl)-N-(pyridin-4-ylmethyl)isoxazole-3-carboxamide; N-(2-chlorobenzyl)-5-( 1H-indazol-5-yl)isoxazole-3-carboxamide; 25 N-(4-chlorobenzyl)-5-( 1H-indazol-5-yl)isoxazole-3-carboxamide; 5 -(1 H-indazol-5 -yl)-N-( 1-phenyl-2-piperidin- 1-ylethyl)isoxazole-3 -carboxamide; N- [2-( 1H-imidazol- l-yl)-l -phenylethyl]-5 -(1 H-indazol-5 -yl)isoxazole-3 carboxamide; 5 -(1 H-indazol-5 -yl)-N-(2-morpholin-4-yl-l1-phenylethyl)isoxazole-3-carboxamide; 30 5 -(1 H-indazol-5 -yl)-N-[2-(4-methylpiperazin- l-yl)-l -phenylethyl]isoxazole-3 carboxamide; 5 -(1 H-indazol-5 -yl)-N-( 1-phenyl-2-pyrrolidin- 1-ylethyl)isoxazole-3 -carboxamide; tert-butyl 2-( {[5 -(1H-indazol-5 -yl)isoxazol-3 -yl]carbonyl} amino)-2 phenylethylcarbamate; 25 WO 2008/154241 PCT/US2008/065727 5 -(1 H-indazol-5 -yl)-N-(1 -naphthylmethyl)isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-(2-phenylethyl)isoxazole-3-carboxamide; 5 -(1 H-indazol-5 -yl)-N-(2-pyridin-2-ylethyl)isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-(2-pyridin-3-ylethyl)isoxazole-3 -carboxamide; 5 5 -(1 H-indazol-5 -yl)-N-(2-pyridin-4-ylethyl)isoxazole-3 -carboxamide; N- [2-(2-chlorophenyl)ethyl] -5-(l H-indazol-5-yl)isoxazole-3-carboxamide; N-[2-(3-chlorophenyl)ethyl]-5-(l H-indazol-5-yl)isoxazole-3-carboxamide; N- [2-(4-chlorophenyl)ethyl] -5-(l H-indazol-5-yl)isoxazole-3-carboxamide; N-benzyl-N-ethyl-5-(1H-indazol-5-yl)isoxazole-3-carboxamide; 10 5-(1 H-indazol-5-yl)-N-methyl-N-(1 -naphthylmethyl)isoxazole-3-carboxamide; 5 -(1 H-indazol-5 -yl)-N-methyl-N-(2-phenylethyl)isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-methyl-N-(2-pyridin-2-ylethyl)isoxazole-3 -carboxamide; 5-(1 H-indazol-5-yl)-N-[(l R)- 1 -phenylethyl]isoxazole-3-carboxamide; 5-(1 H-indazol-5-yl)-N- 1,2,3,4-tetrahydronaphthalen- 1 -ylisoxazole-3-carboxamide; 15 5-(1 H-indazol-5-yl)-N-[(I S)- 1 -(1 -naphthyl)ethyl]isoxazole-3-carboxamide; 5-(1 H-indazol-5-yl)-N-[(l R)- 1 -(1 -naphthyl)ethyl]isoxazole-3-carboxamide; N- [3 -(dimethylamino)- 1 -phenylpropyl]-5-(1 H-indazol-5-yl)isoxazole-3-carboxamide; N-(2,3-dihydro- 1,4-benzodioxin-5-ylmethyl)-5-(1 H-indazol-5-yl)isoxazole-3 carboxamide; 20 N-(3,4-dihydro-2H- 1,5-benzodioxepin-6-ylmethyl)-5-(1 H-indazol-5 -yl)isoxazole-3 carboxamide; 5-(1 H-indazol-5-yl)-N-[(1-methyl-i H-indol-4-yl)methyl]isoxazole-3-carboxamide; 5- {3-[(3-phenylpyrrolidin- 1 -yl)carbonyl]isoxazol-5-yl} -1H-indazole; 5- {3-[(2-phenylpyrrolidin- 1 -yl)carbonyl]isoxazol-5-yl} -1H-indazole; 25 5- {3-[(2-phenylpiperidin- 1 -yl)carbonyl]isoxazol-5-yl} -1H-indazole; 5-(1 H-indazol-5-yl)-N-[(l S)- 1 -phenylethyl]isoxazole-3-carboxamide; 5-(1 H-indazol-5-yl)-N-[(l R)- 1 -(4-methylphenyl)ethyl]isoxazole-3-carboxamide; 5-(1 H-indazol-5-yl)-N-[(l S)-1 -(4-methylphenyl)ethyl]isoxazole-3-carboxamide; N-[(1R,2S)-2-hydroxy-2,3-dihydro- 1 H-inden-1 -yl]-5-(1 H-indazol-5-yl)isoxazole-3 30 carboxamide; N-[(1R,2R)-2-hydroxy-2,3-dihydro-1H-inden- 1-yl]-5-(l H-indazol-5-yl)isoxazole-3 carboxamide; N-[(1R)- 1 -(4-bromophenyl)ethyl]-5-(1 H-indazol-5-yl)isoxazole-3-carboxamide; N- [(1S)- 1 -(4-bromophenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide; 26 WO 2008/154241 PCT/US2008/065727 N-[(1R)-1-(4-chlorophenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide; N-[(1S)-1-(4-chlorophenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide; 5-(1H-indazol-5-yl)-N-[(I S)-1-(2-naphthyl)ethyl]isoxazole-3-carboxamide; N-[1-(4-ethoxyphenyl)-2-hydroxyethyl]-5-(1H-indazol-5-yl)isoxazole-3 5 carboxamide; N-[2-hydroxy-1-(4-isopropylphenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3 carboxamide; N-[1-(3,4-dimethylphenyl)-2-hydroxyethyl]-5-(1H-indazol-5-yl)isoxazole-3 carboxamide; 10 N-[2-hydroxy-1-(2-methoxyphenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3 carboxamide; N-[2-hydroxy-1-(4-methylphenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3 carboxamide; 5-(1H-indazol-5-yl)-N-[(1R)-1-(2-methoxyphenyl)ethyl]isoxazole-3-earboxamide; 15 N-[(1S)-1-(3,4-difluorophenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide; 5-(1H-indazol-5-yl)-N-[(1R)-1-(3-methoxyphenyl)ethyl]isoxazole-3-carboxamide; 5-(1H-indazol-5-yl)-N-{(1R)-1-[3-(trifluoromethyl)phenyl]ethyl}isoxazole-3 carboxamide; N-[1-(2,3-dihydro-1,4-benzodioxin-6-yl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3 20 carboxamide; N-[1-(3,5-dichlorophenyl)-2-hydroxyethyl]-5-(1H-indazol-5-yl)isoxazole-3 carboxamide; tert-butyl 5 -(1 -benzyl- 1H- 1,2,3-triazol-4-yl)-3-[({ [6-(trifluoromethyl)pyridin-2 yl] amino} carbonyl)amino]- 1H-indazole- 1 -carboxylate; 25 5 -(1 -benzyl- 1H- 1,2,3 -triazol-4-yl)- 1- [(1 -methylpiperidin-2-yl)carbonyl] - 1H-indazol 3-amine; 5 -(1 -benzyl- 1H- 1,2,3-triazol-4-yl)- 1 -[(dimethylamino)acetyl]- 1H-indazol-3 -amine; tert-butyl 3-amino-5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazole-1-carboxylate; N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-piperidin-1-ylacetamide; 30 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-morpholin-4-ylacetamide; and N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-l-methylpiperidine-2 carboxamide. 27 WO 2008/154241 PCT/US2008/065727 All patents, patent applications, and literature references cited in the specification are herein incorporated by reference in their entirety. In the case of inconsistencies, the present disclosure, including definitions, will prevail. As used throughout this specification and the appended claims, the following terms 5 have the following meanings: The term "alkenyl" as used herein, means a straight or branched chain hydrocarbon containing from 2 to 10 carbons and containing at least one carbon-carbon double bond formed by the removal of two hydrogens. Representative examples of alkenyl include, but are not limited to, ethenyl, 2-propenyl, 2-methyl-2-propenyl, 3-butenyl, 4-pentenyl, 5 10 hexenyl, 2-heptenyl, 2-methyl-1-heptenyl, and 3-decenyl. The term "alkoxy" as used herein, means an alkyl group, as defined herein, appended to the parent molecular moiety through an oxygen atom. Representative examples of alkoxy include, but are not limited to, methoxy, ethoxy, propoxy, 2-propoxy, butoxy, tert-butoxy, pentyloxy, and hexyloxy. 15 The term "alkoxyalkoxy" as used herein, means an alkoxy group, as defined herein, appended to the parent molecular moiety through another alkoxy group, as defined herein. Representative examples of alkoxyalkoxy include, but are not limited to, tert-butoxymethoxy, 2-ethoxyethoxy, 2-methoxyethoxy, and methoxymethoxy. The term "alkoxyalkoxyalkyl" as used herein, means an alkoxyalkoxy group, as 20 defined herein, appended to the parent molecular moiety through an alkylene group, as defined herein. Representative examples of alkoxyalkoxyalkyl include, but are not limited to, tert-butoxymethoxymethyl, ethoxymethoxymethyl, (2-methoxyethoxy)methyl, and 2-(2 methoxyethoxy)ethyl. The term "alkoxyalkyl" as used herein, means an alkoxy group, as defined herein, 25 appended to the parent molecular moiety through an alkylene group, as defined herein. Representative examples of alkoxyalkyl include, but are not limited to, tert-butoxymethyl, 2 ethoxyethyl, 2-methoxyethyl, and methoxymethyl. The term "alkoxycarbonyl" as used herein, means an alkoxy group, as defined herein, appended to the parent molecular moiety through a carbonyl group, as defined herein. 30 Representative examples of alkoxycarbonyl include, but are not limited to, methoxycarbonyl, ethoxycarbonyl, and tert-butoxycarbonyl. The term "alkoxycarbonylalkyl" as used herein, means an alkoxycarbonyl group, as defined herein, appended to the parent molecular moiety through an alkylene group, as defined herein. Representative examples of alkoxycarbonylalkyl include, but are not limited 28 WO 2008/154241 PCT/US2008/065727 to, 3-methoxycarbonylpropyl, 4-ethoxycarbonylbutyl, and 2-tert-butoxycarbonylethyl. The term "alkyl" as used herein, means a straight or branched chain hydrocarbon containing from 1 to 10 carbon atoms. Representative examples of alkyl include, but are not limited to, methyl, ethyl, n-propyl, iso-propyl, n-butyl, sec-butyl, iso-butyl, tert-butyl, n 5 pentyl, isopentyl, neopentyl, n-hexyl, 3-methylhexyl, 2,2-dimethylpentyl, 2,3-dimethylpentyl, n-heptyl, n-octyl, n-nonyl, and n-decyl. The term "alkylcarbonyl" as used herein, means an alkyl group, as defined herein, appended to the parent molecular moiety through a carbonyl group, as defined herein. Representative examples of alkylcarbonyl include, but are not limited to, acetyl, 1 -oxopropyl, 10 2,2-dimethyl-1-oxopropyl, 1-oxobutyl, and 1-oxopentyl. The term "alkylcarbonylalkyl" as used herein, means an alkylcarbonyl group, as defined herein, appended to the parent molecular moiety through an alkylene group, as defined herein. Representative examples of alkylcarbonylalkyl include, but are not limited to, 2-oxopropyl, 3,3-dimethyl-2-oxopropyl, 3-oxobutyl, and 3-oxopentyl. 15 The term "alkylcarbonyloxy" as used herein, means an alkylcarbonyl group, as defined herein, appended to the parent molecular moiety through an oxygen atom. Representative examples of alkylcarbonyloxy include, but are not limited to, acetyloxy, ethylcarbonyloxy, and tert-butylcarbonyloxy. The term "alkylene" means a divalent group derived from a straight or branched chain 20 hydrocarbon of from I to 10 carbon atoms. Representative examples of alkylene include, but are not limited to, -CH 2 -, -CH(CH 3 )-, -C(CH3)2-, -CH 2

CH

2 -, -CH 2

CH

2

CH

2 -,

-CH

2

CH

2

CH

2

CH

2 -, and -CH 2

CH(CH

3

)CH

2 -. The term "alkylene-NRg-" as used herein, means an alkylene group, as defined herein, appended to the parent molecular moiety through a -NRg- group, as defined herein. 25 The term "alkylsulfinyl" as used herein, means an alkyl group, as defined herein, appended to the parent molecular moiety through a sulfinyl group, as defined herein. Representative examples of alkylsulfinyl include, but are not limited to, methylsulfinyl and ethylsulfinyl. The term "alkylsulfinylalkyl" as used herein, means an alkylsulfinyl group, as defined 30 herein, appended to the parent molecular moiety through an alkylene group, as defined herein. Representative examples of alkylsulfinylalkyl include, but are not limited to, methylsulfinylmethyl and ethylsulfinylmethyl. The term "alkylsulfonyl" as used herein, means an alkyl group, as defined herein, appended to the parent molecular moiety through a sulfonyl group, as defined herein. 29 WO 2008/154241 PCT/US2008/065727 Representative examples of alkylsulfonyl include, but are not limited to, methylsulfonyl and ethylsulfonyl. The term "alkylsulfonylalkyl" as used herein, means an alkylsulfonyl group, as defined herein, appended to the parent molecular moiety through an alkylene group, as 5 defined herein. Representative examples of alkylsulfonylalkyl include, but are not limited to, methylsulfonylmethyl and ethylsulfonylmethyl. The term "alkylthio" as used herein, means an alkyl group, as defined herein, appended to the parent molecular moiety through a sulfur atom. Representative examples of alkylthio include, but are not limited to, methylthio, ethylthio, tert-butylthio, and hexylthio. 10 The term "alkylthioalkyl" as used herein, means an alkylthio group, as defined herein, appended to the parent molecular moiety through an alkylene group, as defined herein. Representative examples of alkylthioalkyl include, but are not limited to, methylthiomethyl and 2-(ethylthio)ethyl. The term "alkynyl" as used herein, means a straight or branched chain hydrocarbon 15 group containing from 2 to 10 carbon atoms and containing at least one carbon-carbon triple bond. Representative examples of alkynyl include, but are not limited to, acetylenyl, 1 propynyl, 2-propynyl, 3-butynyl, 2-pentynyl, and 1-butynyl. The term "aryl," as used herein, means phenyl, a bicyclic aryl or a tricyclic aryl. The bicyclic aryl is naphthyl, or a phenyl fused to a cycloalkyl, or a phenyl fused to a 20 cycloalkenyl, or a phenyl fused to a monocyclic heteroaryl ring as defined herein, or a phenyl fused to a monocyclic heterocycle as defined herein. The bicyclic aryl of the present invention must be attached to the parent molecular moiety through any available carbon atom contained within the phenyl ring. Representative examples of the bicyclic aryl include, but are not limited to, 2,3 -dihydro- 1,4-benzodioxin-5 -yl, 2,3 -dihydro- 1,4-benzodioxin-6-yl, 3,4 25 dihydro-2H-1,5-benzodioxepin-6-yl, dihydroindenyl, indenyl, indol-4-yl, naphthyl, dihydronaphthalenyl, and tetrahydronaphthalenyl. The tricyclic aryl is anthracene or phenanthrene, or a bicyclic aryl fused to a cycloalkyl, or a bicyclic aryl fused to a cycloalkenyl, or a bicyclic aryl fused to a phenyl. The tricyclic aryl is attached to the parent molecular moiety through any carbon atom contained within the tricyclic aryl. 30 Representative examples of tricyclic aryl ring include, but are not limited to, azulenyl, dihydroanthracenyl, fluorenyl, and tetrahydrophenanthrenyl. The aryl groups of this invention are optionally substituted with 1, 2, 3, 4 or 5 substituents independently selected from alkenyl, alkoxy, alkoxyalkoxy, alkoxyalkoxyalkyl, alkoxyalkyl, alkoxycarbonyl, alkoxycarbonylalkyl, alkyl, alkylcarbonyl, alkylcarbonylalkyl, 30 WO 2008/154241 PCT/US2008/065727 alkylcarbonyloxy, alkylsulfinyl, alkylsulfinylalkyl, alkylsulfonyl, alkylsulfonylalkyl, alkylthio, alkylthioalkyl, alkynyl, aryl*NC(O)-, aryl*NHC(O)NH-, carboxy, carboxyalkyl, cyano, cyanoalkyl, formyl, formylalkyl, halogen, haloalkyl, heteroaryl, hydroxy, hydroxyalkyl, mercapto, morpholino, nitro, Z 1

Z

2 N-, or (Z 3

Z

4 N)carbonyl. Aryl* is optionally 5 substituted with 1, 2 or 3 substituents independently selected from alkyl, halo, cyano or nitro. Z1 and Z 2 are each independently selected from hydrogen, alkyl or alkylcarbonyl. The term "aryloxy" as used herein, means an aryl group, as defined herein, appended to the parent molecular moiety through an oxygen atom. Representative examples of aryloxy include, but are not limited to, phenoxy, naphthyloxy, 3-bromophenoxy, 4-chlorophenoxy, 4 10 methylphenoxy, and 3,5-dimethoxyphenoxy. The term "aryloxyalkyl" as used herein, means an aryloxy group, as defined herein, appended to the parent molecular moiety through an alkyl group, as defined herein. Representative examples of aryloxyalkyl include, but are not limited to, 2-phenoxyethyl, 3 naphth-2-yloxypropyl and 3-bromophenoxymethyl. 15 The term "arylalkyl" as used herein, means an aryl group, as defined herein, appended to the parent molecular moiety through an alkylene group, as defined herein. Representative examples of arylalkyl include, but are not limited to, benzyl, 2-phenylethyl, 3-phenylpropyl, and 2-naphth-2-ylethyl. The term "aryl(hydroxy)alkyl" as used herein, means an aryl group, as defined herein, 20 appended to the parent molecular moiety through an alkylene group bearing one hydroxy group, as defined herein. Representative examples of aryl(hydroxy)alkyl include, but are not limited to, 2-phenylethanol-2-yl and 2-hydroxy-2-phenylethanyl. The term "arylcarbonyl" as used herein, means an aryl group, as defined herein, appended to the parent molecular moiety through a carbonyl group, as defined herein. 25 Representative examples of arylcarbonyl include, but are not limited to, benzoyl and naphthoyl. The term "arylthio" as used herein, means an aryl group, as defined herein, appended to the parent molecular moiety through a sulfur atom. Representative examples of arylthio include, but are not limited to, phenylthio and 2-naphthylthio. 30 The term "arylthioalkyl" as used herein, means an arylthio group, as defined herein, appended to the parent molecular moiety through an alkylene group, as defined herein. Representative examples of arylthioalkyl include, but are not limited to, phenylthiomethyl, 2 naphth-2-ylthioethyl, and 5-phenylthiomethyl. The term "azido" as used herein, means a -N 3 group. 31 WO 2008/154241 PCT/US2008/065727 The term "azidoalkyl" as used herein, means an azido group, as defined herein, appended to the parent molecular moiety through an alkylene group, as defined herein. The term "carbonyl" as used herein, means a -C(O)- group. The term "carboxy" as used herein, means a -CO 2 H group. 5 The term "carboxyalkyl" as used herein, means a carboxy group, as defined herein, appended to the parent molecular moiety through an alkylene group, as defined herein. Representative examples of carboxyalkyl include, but are not limited to, carboxymethyl, 2 carboxyethyl, and 3-carboxypropyl. The term "cyano" as used herein, means a -CN group. 10 The term "cyanoalkyl" as used herein, means a cyano group, as defined herein, appended to the parent molecular moiety through an alkylene group, as defined herein. Representative examples of cyanoalkyl include, but are not limited to, cyanomethyl, 2 cyanoethyl, and 3-cyanopropyl. The term "cycloalkenyl" as used herein, means a monocyclic or bicyclic ring system 15 containing from 3 to 10 carbons and containing at least one carbon-carbon double bond formed by the removal of two hydrogens. Representative examples of monocyclic ring systems include, but are not limited to, 2-cyclohexen-1-yl, 3-cyclohexen-1-yl, 2,4 cyclohexadien-1-yl and 3-cyclopenten-1-yl. Bicyclic ring systems are exemplified by a monocyclic cycloalkenyl ring system which is fused to another monocyclic cycloalkyl ring as 20 defined herein, a monocyclic aryl ring as defined herein, a monocyclic heterocycle as defined herein or a monocyclic heteroaryl as defined herein. The bicyclic ring systems of the present invention must be appended to the parent molecular moiety through an available carbon atom within the cycloalkenyl ring. Representative examples of bicyclic ring systems include, but are not limited to, 4,5-dihydro-benzo[1,2,5]oxadiazole, 3a, 4, 5, 6, 7, 7a-hexahydro-1H 25 indenyl, 1, 2, 3, 4, 5, 6-hexahydro-pentalenyl, 1, 2, 3, 4, 4a, 5, 6, 8a-octahydro-pentalenyl. The term "cycloalkyl" as used herein, means a monocyclic, bicyclic, or spirocyclic ring system. Monocyclic ring systems are exemplified by a saturated cyclic hydrocarbon group containing from 3 to 8 carbon atoms. Examples of monocyclic ring systems include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl. Bicyclic 30 cycloalkyl groups of the present invention are exemplified by a monocyclic cycloalkyl ring fused to another monocyclic cycloalkyl ring, or a monocyclic cycloalkyl ring fused cycloalkenyl, or a monocyclic cycloalkyl ring fused to a phenyl ring, or a monocyclic cycloalkyl ring fused to a monocyclic heteroaryl ring as defined herein, or a monocyclic cycloalkyl ring fused to a monocyclic heterocycle as defined herein. The bicyclic cycloalkyl 32 WO 2008/154241 PCT/US2008/065727 ring systems of the present invention must be appended to the parent molecular moiety through an available carbon atom within the monocycloalkyl ring. The cycloalkyl groups of the present invention are optionally substituted with 1, 2, 3, or 4 substituents selected from alkenyl, alkoxy, alkoxyalkoxy, alkoxyalkyl, alkoxycarbonyl, 5 alkoxysulfonyl, alkyl, alkylcarbonyl, alkylcarbonyloxy, alkylsulfonyl, alkylthio, alkylthioalkyl, alkynyl, carboxy, cyano, formyl, haloalkoxy, haloalkyl, halogen, hydroxy, hydroxyalkyl, mercapto, oxo, ZiZ 2 N-, or (Z 3

Z

4 N)carbonyl. The term "cycloalkylalkyl," as used herein, means a cycloalkyl group appended to the parent molecular moiety through an alkyl group, as defined herein. 10 The term "cycloalkylcarbonyl" as used herein, means cycloalkyl group, as defined herein, appended to the parent molecular moiety through a carbonyl group, as defined herein. Representative examples of cycloalkylcarbonyl include, but are not limited to, cyclopropylcarbonyl, 2-cyclobutylcarbonyl, and cyclohexylcarbonyl. The term "formyl" as used herein, means a -C(O)H group. 15 The term "formylalkyl" as used herein, means a formyl group, as defined herein, appended to the parent molecular moiety through an alkylene group, as defined herein. Representative examples of formylalkyl include, but are not limited to, formylmethyl and 2 formylethyl. The term "halo" or "halogen" as used herein, means -Cl, -Br, -I or -F. 20 The term "haloalkoxy" as used herein, means at least one halogen, as defined herein, appended to the parent molecular moiety through an alkoxy group, as defined herein. Representative examples of haloalkoxy include, but are not limited to, chloromethoxy, 2 fluoroethoxy, trifluoromethoxy, and pentafluoroethoxy. The term "haloalkyl" as used herein, means at least one halogen, as defined herein, 25 appended to the parent molecular moiety through an alkylene group, as defined herein. Representative examples of haloalkyl include, but are not limited to, chloromethyl, 2 fluoroethyl, trifluoromethyl, pentafluoroethyl, and 2-chloro-3-fluoropentyl. The term "heteroaryl," as used herein, means a monocyclic heteroaryl or a bicyclic heteroaryl. The monocyclic heteroaryl is a 5 or 6 membered ring containing at least one 30 heteroatom independently selected from 0, N, or S. The 5 membered ring contains two double bonds may contain one, two, three or four heteroatoms. The 6 membered ring contains three double bonds may contain one, two, three or four heteroatoms. The 5 or 6 membered heteroaryl is connected to the parent molecular moiety through any carbon atom or any nitrogen atom contained within the heteroaryl. Representative examples of 33 WO 2008/154241 PCT/US2008/065727 monocyclic heteroaryl include, but are not limited to, furyl, imidazolyl, isoxazolyl, isothiazolyl, oxadiazolyl, oxazolyl, pyridinyl, pyridazinyl, pyrimidinyl, pyrazinyl, pyrazolyl, pyrrolyl, tetrazolyl, thiadiazolyl, thiazolyl, thienyl, triazolyl, and triazinyl. The bicyclic heteroaryl consists of a monocyclic heteroaryl fused to a monocyclic aryl ring as defined 5 herein, a monocyclic cycloalkyl ring as defined herein, a monocyclic cycloalkenyl ring as defined herein, another monocyclic heteroaryl or a monocyclic heterocycle ring as defined herein. The bicyclic heteroaryl ring systems of the present invention must be appended to the parent molecular moiety through an available carbon atom within the heteroaryl ring. The bicyclic heteroaryl is connected to the parent molecular moiety through any carbon atom or 10 any nitrogen atom contained within the bicyclic heteroaryl. Representative examples of bicyclic heteroaryl include, but are not limited to, benzofuranyl, benzoxadiazolyl, 1,3 benzothiazolyl, benzimidazolyl, benzodioxolyl, benzothiophenyl, chromenyl, cinnolinyl, furopyridine, indolyl, indazolyl, isoindolyl, isoquinolinyl, naphthyridinyl, oxazolopyridine, quinolinyl, thienopyridine and thienopyridinyl. 15 The heteroaryl groups of the present invention are optionally substituted with 1, 2, 3, or 4 substituents independently selected from alkenyl, alkoxy, alkoxyalkoxy, alkoxyalkyl, alkoxycarbonyl, alkoxycarbonylalkyl, alkoxysulfonyl, alkyl, alkylcarbonyl, alkylcarbonylalkyl, alkylcarbonyloxy, alkylthio, alkylthioalkyl, alkynyl, benzyl, carboxy, carboxyalkyl, cyano, cyanoalkyl, formyl, haloalkoxy, haloalkyl, halogen, hydroxy, 20 hydroxyalkyl, mercapto, nitro, ZiZ 2 N-, or (Z 3

Z

4 N)carbonyl. Heteroaryl groups of the present invention that are substituted may be present as tautomers. The present invention encompasses all tautomers including non-aromatic tautomers. The term "heteroarylalkyl," as used herein, means a heteroaryl group appended to the parent molecular moiety through an alkyl group, as defined herein. 25 The term "heterocycle" or "heterocyclic" as used herein, refers to a monocyclic, bicyclic, tricyclic or a spirocyclic ring system that contains at least one heteroatom. The monocyclic heterocycle is a 3, 4, 5, 6 or 7 membered ring containing at least one heteroatom independently selected from the group consisting of 0, N, and S. The 3 or 4 membered ring contains 1 heteroatom selected from the group consisting of 0, N and S. The 5 membered 30 ring contains zero or one double bond and one, two or three heteroatoms selected from the group consisting of 0, N and S. The 6 or 7 membered ring contains zero, one or two double bonds and one, two or three heteroatoms selected from the group consisting of 0, N and S. The monocyclic heterocycle is connected to the parent molecular moiety through any carbon atom or any nitrogen atom contained within the monocyclic heterocycle. Representative 34 WO 2008/154241 PCT/US2008/065727 examples of monocyclic heterocycle include, but are not limited to, azetidinyl, azepanyl, aziridinyl, diazepanyl, 1,3-dioxanyl, 1,3-dioxolanyl, 1,3-dithiolanyl, 1,3-dithianyl, imidazolinyl, imidazolidinyl, isothiazolinyl, isothiazolidinyl, isoxazolinyl, isoxazolidinyl, isoindoline-1,3-dione, morpholinyl, oxadiazolinyl, oxadiazolidinyl, oxazolinyl, oxazolidinyl, 5 piperazinyl, piperidinyl, pyranyl, pyrazolinyl, pyrazolidinyl, pyrrolinyl, pyrrolidinyl, tetrahydrofuranyl, tetrahydrothienyl, thiadiazolinyl, thiadiazolidinyl, thiazolinyl, thiazolidinyl, thiomorpholinyl, 1,1 -dioxidothiomorpholinyl (thiomorpholine sulfone), thiopyranyl, and trithianyl. The bicyclic heterocycle of the present invention is defined as a monocyclic heterocycle fused to a phenyl group, a cycloalkylgroup as defined herein, a 10 cycloalkenyl group as defined herein, another monocyclic heterocycle group as defined herein, or a spirocyclic ring wherein one carbon atom of the monocyclic heterocycle is bridged by two ends of an alkylene chain. The bicyclic heterocycle of the present invention is connected to the parent molecular moiety through any carbon atom or any nitrogen atom contained within the heterocyclic ring. Representative examples of bicyclic heterocycle 15 include, but are not limited to, 1,3-benzodioxolyl, 1,3-benzodithiolyl, 2,3-dihydro-1,4 benzodioxinyl, 2,3-dihydro-1-benzofuranyl, 2,3-dihydro-1-benzothienyl, 3,4-dihydro-1H isochromen-4-yl, 2,3-dihydro-1H-indolyl, succinmimidyl, and 1,2,3,4-tetrahydroquinolinyl. The tricyclic heterocycle is a bicyclic heterocycle fused to a phenyl, or a bicyclic heterocycle fused to a cycloalkyl, or a bicyclic heterocycle fused to a cycloalkenyl, or a bicyclic 20 heterocycle fused to a monocyclic heterocycle. The tricyclic heterocycle is connected to the parent molecular moiety through any carbon atom or any nitrogen atom contained within the tricyclic heterocycle. Representative examples of tricyclic heterocycle include, but are not limited to, 2,3,4,4a,9,9a-hexahydro-1H-carbazolyl, 5a,6,7,8,9,9a hexahydrodibenzo[b,d]furanyl, and 5a,6,7,8,9,9a-hexahydrodibenzo[b,d]thienyl. 25 The heterocycles of this invention are optionally substituted with 1, 2,or 3 substituents independently selected from alkenyl, alkoxy, alkoxyalkoxy, alkoxyalkyl, alkoxycarbonyl, alkoxycarbonylalkyl, alkoxysulfonyl, alkyl, alkylcarbonyl, alkylcarbonylalkyl, alkylcarbonyloxy, alkylthio, alkylthioalkyl, alkynyl, aryl, benzyl, carboxy, carboxyalkyl, cyano, cyanoalkyl, formyl, haloalkoxy, haloalkyl, halogen, hydroxy, hydroxyalkyl, 30 hydroxyalkylcarbonyl, hydroxyalkoxyalkyl, mercapto, oxo, Z 1

Z

2 N-, or (Z 3

Z

4 N)carbonyl. The term "heterocyclealkyl," as used herein, means a heterocycle group appended to the parent molecular moiety through an alkyl group, as defined herein. The term "heterocyclecarbonyl" as used herein, means a heterocycle, as defined herein, appended to the parent molecular moiety through a carbonyl group, as defined herein. 35 WO 2008/154241 PCT/US2008/065727 The term "hydroxy" as used herein, means an -OH group. The term "hydroxyalkyl" as used herein, means at least one hydroxy group, as defined herein, is appended to the parent molecular moiety through an alkylene group, as defined herein. Representative examples of hydroxyalkyl include, but are not limited to, 5 hydroxymethyl, 2-hydroxyethyl, 3-hydroxypropyl, 2,3-dihydroxypentyl, and 2-ethyl-4 hydroxyheptyl. The term "hydroxyalkylcarbonyl" as used herein, means a hydroxyalkyl group, as defined herein, as appended to the parent molecular moiety through a carbonyl group, as defined herein. Representative examples include, but are not limited to, 2-hydroxyacetyl, and 10 4-hydroxybutanoyl. The term "hydroxyalkoxyalkyl" as used herein, means a hydroxyalkoxy group, as defined herein, appended to the parent molecular moiety through an alkylene group, as defined herein. Representative examples of hydroxyalkoxyalkyl include, but are not limited to, (2-hydroxy-ethoxy)-ethyl, and (3-hydroxyl-propoxyl)-ethyl. 15 The term "hydroxy-protecting group" or "O-protecting group" means a substituent that protects hydroxyl groups against undesirable reactions during synthetic procedures. Examples of hydroxy-protecting groups include, but are not limited to, substituted methyl ethers, for example, methoxymethyl, benzyloxymethyl, 2-methoxyethoxymethyl, 2 (trimethylsilyl)-ethoxymethyl, benzyl, and triphenylmethyl; tetrahydropyranyl ethers; 20 substituted ethyl ethers, for example, 2,2,2-trichloroethyl and t-butyl; silyl ethers, for example, trimethylsilyl, t-butyldimethylsilyl and t-butyldiphenylsilyl; cyclic acetals and ketals, for example, methylene acetal, acetonide and benzylidene acetal; cyclic ortho esters, for example, methoxymethylene; cyclic carbonates; and cyclic boronates. Commonly used hydroxy-protecting groups are disclosed in T.W. Greene and P.G.M. Wuts, Protective Groups 25 in Organic Synthesis, 3rd edition, John Wiley & Sons, New York (1999). The term "mercapto" as used herein, means a -SH group. The term "nitrogen protecting group" as used herein, means those groups intended to protect an amino group against undesirable reactions during synthetic procedures. Preferred nitrogen protecting groups are acetyl, benzoyl, benzyl, benzyloxycarbonyl (Cbz), formyl, 30 phenylsulfonyl, tert-butoxycarbonyl (Boc), tert-butylacetyl, trifluoroacetyl, and triphenylmethyl (trityl). The term "nitro" as used herein, means a -NO 2 group. The term "trialkylsilyl" as used herein, means three independently selected alkyl groups, as defined herein, appended to the parent molecular moiety through a silicon atom. 36 WO 2008/154241 PCT/US2008/065727 Representative examples of trialkylsilyl include, but are not limited to, trimethylsilyl, triethylsilyl, t-butyldimethylsilyl and triisopropylsilyl. The term "trialkylsilylalkyl" as used herein, means a trialkylsilyl group, as defined herein, appended to the parent molecular through an alkylene group, as defined herein. 5 Representative examples of trialkylsilylalkyl include, but are not limited to, trimethylsilylmethyl, 2-trimethylsilylethyl, and 2-t-butyldimethylsilylethyl. The term "ZiZ 2 N" as used herein, means two groups, Z 1 and Z 2 , which are appended to the parent molecular moiety through a nitrogen atom. Zi and Z 2 are each independently hydrogen, alkoxycarbonyl, alkyl, alkylcarbonyl, aryl, arylalkyl and formyl. In certain 10 instances within the present invention, Z1 and Z 2 taken together with the nitrogen atom to which they are attached form a heterocyclic ring. Representative examples of Z 1

Z

2 N include, but are not limited to, amino, methylamino, acetylamino, acetylmethylamino, phenylamino, benzylamino, azetidinyl, pyrrolidinyl and piperidinyl. The term " Z 3

Z

4 N" as used herein, means two groups, Z 3 and Z 4 , which are appended 15 to the parent molecular moiety through a nitrogen atom. Z 3 and Z4 are each independently hydrogen, alkyl, aryl and arylalkyl. Representative examples of Z 3

Z

4 N include, but are not limited to, amino, methylamino, phenylamino and benzylamino. The term "( Z 3

Z

4 N)carbonyl" as used herein, means a NZ 3

Z

4 group, as defined herein, appended to the parent molecular moiety through a carbonyl group, as defined herein. 20 Representative examples of (Z 3

Z

4 N)carbonyl include, but are not limited to, aminocarbonyl, (methylamino)carbonyl, (dimethylamino)carbonyl, and (ethylmethylamino)carbonyl. The term "oxo" as used herein, means a =0 moiety. The term "sulfinyl" as used herein, means a -S(O)- group. The term "sulfonyl" as used herein, means a -SO 2 - group. 25 The term "sulfonamide" as used herein means a -SO 2

NH

2 group. The term "tautomer" as used herein means a proton shift from one atom of a compound to another atom of the same compound wherein two or more structurally distinct compounds are in equilibrium with each other. Compounds of the present invention may exist as stereoisomers wherein, asymmetric 30 or chiral centers are present. These stereoisomers are "R" or "S" depending on the configuration of substituents around the chiral carbon atom. The terms "R" and "S" used herein are configurations as defined in IUPAC 1974 Recommendations for Section E, Fundamental Stereochemistry, Pure Appl. Chem., 1976, 45: 13-30. The present invention contemplates various stereoisomers and mixtures thereof and these are specifically included 37 WO 2008/154241 PCT/US2008/065727 within the scope of this invention. Stereoisomers include enantiomers and diastereomers, and mixtures of enantiomers or diastereomers. Individual stereoisomers of compounds of the present invention may be prepared synthetically from commercially available starting materials that contain asymmetric or chiral centers or by preparation of racemic mixtures 5 followed by resolution which is well known to those of ordinary skill in the art. These methods of resolution are exemplified by (1) attachment of a mixture of enantiomers to a chiral auxiliary, separation of the resulting mixture of diastereomers by recrystallization or chromatography and liberation of the optically pure product from the auxiliary; or (2) direct separation of the mixture of optical enantiomers on chiral chromatographic columns. 10 The compounds and processes of the present invention will be better understood by reference to the following Examples, which are intended as an illustration of and not a limitation upon the scope of the invention. Further, all citations herein are incorporated by reference. Compound names are assigned by using Name Pro naming software, which is 15 provided by ACD/Labs. Alternatively, compound names are assigned using AUTONOM naming software, which is provided by MDL Information Systems GmbH (formerly known as Beilstein Informationssysteme) of Frankfurt, Germany, and is part of the CHEMDRAW@ ULTRA v. 6.0.2 software suite and ISIS Draw v. 2.5. Also, compound names are assigned using Struct=Name naming algorithm, which is part of the CHEMDRAW@ ULTRA v. 9.0.7 20 software suite. Abbreviations Abbreviations which have been used in the descriptions of the Schemes and the Examples that follow are: DMF for NN-dimethylformamide, DMSO for dimethyl sulfoxide, 25 EtOAc for ethyl acetate, CHCl 3 for chloroform, CH 2 Cl 2 for dichloromethane, CH 3 CN for acetonitrile, THF for tetrahydrofuran, HATU for O-(7-azabenzotriazol- 1 -yl)-N,N,N',N' tetramethyluronium hexafluorophosphate, EDC or EDCI for 1-(3-dimethylaminopropyl)-3 ethylcarbodiimide hydrochloride, LC/MS for liquid chromatography/mass spectroscopy,

NH

4 0Ac for ammonium acetate, NaBH(OAc) 3 for sodium triacetoxyborohydride, PBS for 30 bovine serum albumin, PBS for phosphate buffered saline, TMS for trimethylsilyl, MW for microwave, DMAP for 4-(dimethylamino)pyridine, dppf for 1,1' bis(diphenylphosphino)ferrocene, TFA for trifluoroacetic acid, BINAP for 2,2' bis(diphenylphosphino)- 1,1 -binaphyl, TBAF for tetrabutylammonium fluoride, Tween for polyoxoethylenesorbitan monolaurate HPLC for high pressure liquid chromatography, DME 38 WO 2008/154241 PCT/US2008/065727 for 1,2-dimethoxyethane, Boc for tert-butoxycarbonyl, BSA for bovine serum albumin, DTT for dithiothreitol, ATP for adenosine triphosphate, EDTA for ethylenediaminetetraacetic acid, HPMC for hydroxypropylmethylcellulose, TMB for 3,3',5,5'-tetramethylbenzidine and HEPES for 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid. 5 Preparation of Compounds of the Present Invention The compounds and processes of the present invention will be better understood in connection with the following synthetic Schemes and Examples that illustrate a means by which the compounds of the present invention can be prepared. 10 Scheme 1 R1 R, X, A X1 N A-M1 , N Pd catalyst N 1 R2 2 R2 As shown in Scheme 1, compounds of formula 2 which are representative of compounds of formula (I), may be made accordingly. Compounds of formula . wherein R 1 and R 2 are as defined in formula (I), and Xi is iodo, bromo or chloro, and which may be 15 obtained from commercial sources or may be synthesized according to methods known in the literature, when treated with reagent A-Mi, wherein A is defined in formula (I) and Mi is -Sn(Rz) 3 or -B(ORy) 2 , wherein Rz is alkyl or aryl, and Ry is hydrogen, alkyl, aryl or the two Ry groups together with the boron atom to which they are attached form a 1,3-dioxoborolane, in the presence of a palladium catalyst will provide compounds of formula 2. Such reactions 20 between compounds of formula 1 and compounds of formula A-Sn(Rz) 3 , commonly known as Stille couplings, utilize a palladium catalyst such as, but not limited to, tetrakis(triphenylphosphine)palladium(0), dichlorobis(triphenylphosphine)palladium(II), tris(dibenzylidineacetone)dipalladium or palladium diacetate, in the presence or absence of a ligand such as tri(2-furyl)phosphine or triphenylarsine in a solvent such as toluene or DMF at 25 a temperature from about 25 'C to about 150 'C. In addition, Li(I), Cu(I), or Mn(II) salts may be added to improve reactivity or specificity. Reactions between compounds of formula 1 and compounds of formula A-B(ORy) 2 , commonly known as Suzuki couplings utilize palladium catalysts such as, but not limited to, tetrakis(triphenylphosphine)palladium(0), dichlorobis(triphenylphosphine)palladium(II), tris(dibenzylidineacetone)dipalladium or 30 palladium diacetate. A palladium ligand may be added such as 2 (dicyclohexylphosphino)biphenyl, tri-t-butylphosphine, or tris(2-furyl)phosphine and a base 39 WO 2008/154241 PCT/US2008/065727 such as, but not limited to, aqueous K 3 P0 4 , cesium carbonate, potassium carbonate or Na 2

CO

3 in solvents such as toluene, dimethoxyethane, dioxane, water or DMF at a temperature from about 25 'C to about 150 'C. The reaction may also be achieved with heating in a microwave reactor oven. 5 Although many organo stannanes are commercially available or described in the literature, it is also possible to prepare additional stannanes from A-halides or A-triflates by treatment with a hexa-alkyldistannane of formula ((Rz) 3 Sn)2 in the presence of Pd(Ph 3

P)

4 . Similarly, in the absence of commercially available organoboron reagents, A-B(ORy) 2 may be prepared from the corresponding halides or triflates (A-halo or A-triflate) via metal 10 exchange with an organolithium followed by the addition of the alkyl borate. Scheme 2 R1 R, X, A X, N A-H A SN' 1 R2 2 R2 Compounds of formula 2, wherein R 1 and R 2 are as defined in formula (I) and A is a heteroaryl ring linked to the parent moiety through a nitrogen atom may be prepared as 15 illustrated in Scheme 2. The treatment of compounds of formula 1 with a reagent of formula A-H, wherein the H is a hydrogen on a nitrogen atom contained within the heteroaryl ring A, in the presence of a base such as, but not limited to, sodium t-butoxide or cesium carbonate and a metal catalyst such as, but not limited to, copper metal, Cu or palladium diacetate and optionally with a ligand such as, but not limited to, BINAP, or tri-tertbutylphosphine will 20 provide compounds of formula 2. Scheme 3 Rii Rii N Rii N Rii NI N" / Ris + N R N SnBus +--NN' 3 H N-N P 1 N' N' 3 4 5 1 6 H As previously mentioned in Scheme 1, compounds of formula (I) may be synthesized 25 utilizing Stille couplings as described in Scheme 3. Compounds of formula 3, wherein Rii is defined in formula (I), when treated with compounds of formula 4, wherein R 1 is defined in formula (I) and Pi is a nitrogen protecting group such as, but not limited to, tert 40 WO 2008/154241 PCT/US2008/065727 butyloxycarbonyl or acetyl, in the presence of dichlorobis(triphenylphosphine)palladium(II) and (thiophene-2-carbonyloxy)copper in toluene under heated conditions will provide compounds of formula 5. Compounds of formula 5 when treated with conditions known to remove the protecting group such as hydrochloric acid or trifluoroacetic acid in a solvent 5 such as acetic acid or dioxane when the protecting group is tert-butyloxycarbonyl or sodium hydroxide, lithium hydroxide, or potassium hydroxide in an aqueous mixture of THF, isopropanol, or dioxane when the protecting group is acetyl will provide compounds of formula 6 which are representative of compounds of formula (I) wherein A is (ii). Scheme 4 RiisN. Rii H BuSnNM SnBu 3 9 SnBu 3 or ' i: -nU Bu 3 SnN(Et)C(O)OMe hatane N'N 10 8 3 Compounds of formula 3 utilized in Scheme 3 to generate compounds of formula (I) may be prepared as outlined in Scheme 4. Compounds of formula 7, which are obtained from commercial sources or may be prepared according to methods known to one skilled in the art, when treated with either 1,1,1 -tributyl-NN-dimethylstannamine or methyl 15 ethyl(tributylstannyl)carbamate will provide compounds of formula 8. Alkynes of formula 8 when heated in the presence of compounds of formula 9, wherein Rii is defined in formula (I) and N 3 is an azide, will provide compounds of formula 3. Scheme 5 1. TMS Rq R Cul, (Ph 3

)

2

CI

2 Pd, R1 RjjCI, N R1 X DMF, ET 3 N NaN 3 , N\ 1 95 C, ON N CS4, CU N N N N' 2. TBAF, THF N N H H H 20 10 11 12 As outlined in Scheme 5, compounds of formula 12 which are representative of compounds of formula (I), wherein A is (ii) may be prepared accordingly. Compounds of formula 10 wherein R 1 is defined in formula (I) and X 1 is iodo, bromo, chloro, or triflate, when treated with TMS acetylene in the presence of copper iodide, 25 dichlorobis(triphenylphosphine)palladium(II) and triethylamine followed by treatment with tetrabutylammonium fluoride or potassium hydroxide will provide compounds of formula 11. The reaction may be done in a solvent such as, but not limited to, DMF at ambient 41 WO 2008/154241 PCT/US2008/065727 temperature or under heated conditions. Compounds of formula 11 when treated with Rii-Cl, sodium azide, copper sulfate, and metallic copper under heated conditions in a solvent such as dioxane, will provide compounds of formula 12 which are representative of compounds of formula (I) wherein A is (ii). 5 Scheme 6 1) TMS RiN Rii, ui 9

N

3 ,N XO N PdCl 2 (PPh 3

)

2 CN or NaN 3 N CN N Et 3 N , Cu 2

SO

4 N N2H F 2)TBAF F Cuwire F 2) TAF F Cu wre F heat 13 14 15 Rij Rij N

NH

2 N I

NH

2 N \ Boc 2 O N x N | N' DMAP N 16 H 17 O 0 1) R 4 CI 18 2) TFA pyr, CH 2 Cl 2 N Rii, O N 1 NH2 ,N HN N N R4 | N N R2 19 H Alternatively, compounds of formula 13 when treated with TMS-acetylene in the presence of copper iodide, dichlorobis(triphenylphosphine)palladium(II) and triethylamine followed by treatment with tetrabutylammonium fluoride or potassium hydroxide will 10 provide compounds of formula 14. The reaction may be done in a solvent such as, but not limited to, DMF at ambient temperature or under heated conditions. Compounds of formula 14 when treated with compounds of formula 9 wherein Rii is defined in formula (I), or sodium azide, copper sulfate and metallic copper under heated conditions will provide compounds of formula 15. Compounds of formula 15, when heated in the presence of 15 hydrazine in ethanol, will provide compounds of formula 16. Compounds of formula 16 when treated with di-tert-butyldicarbonate and a catalytic amount of DMAP in a solvent such as THF or acetonitrile will provide compounds of formula 12. Compounds of formula 17 42 WO 2008/154241 PCT/US2008/065727 when treated with compounds of formula 18 in the presence of a base such as, but not limited to, pyridine in a solvent such as dichloromethane followed by treatment with trifluoroacetic acid will provide compounds of formula 19. Compounds of formula 16 when treated with a carboxylic acid using carboxylic acid-amine coupling conditions known to one skilled in the 5 art will provide compounds of formula 1_9A. Standard carboxylic acid amine coupling conditions include adding a coupling reagent such as, but not limited to, 1-(3 dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride (EDCI), 1,3dicyclohexylcarbodiimide (DCC), Bis(2-oxo-3-oxazolidinyl)phosphinic chloride (BOPCl), 0-(7-azabenzotriazol- 1 -yl)-N,N,N',N'-tetramethyluronium hexafluorophosphate 10 (HATU) or O-benzotriazol-1-yl-NN,N',N'-tetramethyluronium tetrafluoroborate (TBTU) with or without an auxiliary reagent such as, but not limited to, 1 -hydroxy-7-azabenzotriazole (HOAT) or 1-hydroxybenzotriazole hydrate (HOBT) in a solvent such as, but not limited to, dichloromethane. Scheme 7 Rii X, Ac 2 0, KOAc, X, N 3 70 C N NaN3, CuSO4,

NH

2 )'N Na 2

CO

3 20 N 21 22 R-. NI N N NN SN' 24 15 O Compounds of formula 24 which are representative of compounds of formula (I) may be prepared accordingly. Compounds of formula 20 wherein X 1 is halo or triflate, when treated with the compound of formula 21, acetic anhydride and a base such as, but not limited to, potassium acetate under heated conditions will provide compounds of formula 22. 20 Compounds of formula 22 when treated with sodium azide, copper sulfate, a base such as sodium carbonate and compounds of formula 23, wherein Rii is defined in formula (I) and are either available from commercial sources or may be prepared by one skilled in the art, will provide compounds of formula 24. 43 WO 2008/154241 PCT/US2008/065727 Scheme 8 R1 Rii -- Rii R, 1 3)Riis-N3 X, 23 9 N N N' PdCl 2 (PPh 3

)

2 N 2) TFA Cul c 25 Boc Et 3 N 27 Boc RiN N Rii N R RN R Neii+ N x N N R N, N' H 29 H 30 As outlined in Scheme 8, compounds of formula 29 and 30, which are representative of compounds of formula (I), may be prepared accordingly. Compounds of formula 25, 5 wherein R 1 is defined in formula (I) and X1 is halo or triflate, when treated with compounds of formula 23 copper iodide, dichlorobis(triphenylphosphine)palladium(II) and triethylamine in DMF at ambient temperature or under heated conditions will provide compounds of formula 27. Compounds of formula 27 when treated with compounds of formula 9, under heated conditions, and either neat or in a solvent such as, but not limited to, dioxane, will 10 provide compounds of formula 29 and 30. Scheme 9 1) NH 2 OH HCI, NaOH Rli RvliNCHO 2) Chloramine-T 3H 2 0 0 N Y R1 3) CuSO 4 , Cu wire 0 N N 314) R 32 IN 'N \32 H I N 11 H Compounds of formula 32 which are representative of compounds of formula (I), wherein A is (vii), and R 1 and Rii are defined in formula (I), may be prepared accordingly. 15 Aldehydes of formula 31, wherein Ri is defined in formula (I) which may be obtained from commercial sources, when treated with hydroxylamine hydrochloride and aqueous sodium hydroxide will provide an oxime intermediate which when oxidized with Chloramine T trihydrate, followed by treatment with copper sulfate and copper wire and compounds of formula I will provide compounds of formula 32. 20 44 WO 2008/154241 PCT/US2008/065727 Scheme 10 0 , H 0 R 1 ' 6~ MCI HO 0 ' NMg IN - - IN N'O H H 33 34 00 OR, O R1 N N N N H 36 35 P 1 Za-NH Za NH 0 R, 1) NH2 S N R1 37S O| N M | IN Br N' N 36A p 2) deprotection 38 Compounds of formula 38 which are representative of compounds of formula (I) wherein A is (x), are prepared accordingly. Compounds of formula 33 wherein R 1 is defined 5 in formula (I) which may be obtained from commercial sources or prepared by one skilled in the art, when treated with N,0-dimethylhydroxylamine using acid coupling conditions known to one skilled in the art will provide compounds of formula 34. Standard carboxylic acid amine coupling conditions include adding a coupling reagent such as, but not limited to, 1-(3 dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride (EDCI), 1,3 10 dicyclohexylcarbodiimide (DCC), bis(2-oxo-3-oxazolidinyl)phosphinic chloride (BOPCl), 0 (7-azabenzotriazol- 1 -yl)-N,N,N',N'-tetramethyluronium hexafluorophosphate (HATU) or 0 benzotriazol- 1 -yl-N,N,N',N'-tetramethyluronium tetrafluoroborate (TBTU) with or without an auxiliary reagent such as, but not limited to, 1 -hydroxy-7-azabenzotriazole (HOAT) or 1 hydroxybenzotriazole hydrate (HOBT) in a solvent such as, but not limited to, 15 dichloromethane. Compounds of formula 34 when treated with a Grignard reagent such as benzylmagnesium bromide in a solvent such as tetrahydrofuran below ambient temperature will provide compounds of formula 35. Compounds of formula 35 when treated with a protecting group reagent such as, but not limited to, di-tert-butyldicarbonate and a catalytic amount of DMAP in a solvent such as THF or acetonitrile will provide compounds of 20 formula 36. Compounds of formula 36 when treated with pyridinium tribromide in a solvent 45 WO 2008/154241 PCT/US2008/065727 such as, but not limited to, THF with or without the use of heat will provide compounds of formula 36A. Compounds of formula 36A when treated with compounds of formula 37 with or without the use of heat followed by treating the product with conditions that will remove the nitrogen protecting group will provide compounds of formula 38. Commonly used 5 nitrogen-protecting groups as well as methods to remove them are disclosed in T.W. Greene and P.G.M. Wuts, Protective Groups in Organic Synthesis, 3rd edition, John Wiley & Sons, New York (1999). Scheme 11 OR, 1) 3 NH2 \ -N R, I N IN SN 2) deprotection

-

N H 36 p 1 40 10 Compounds of formula 36, wherein R 1 is defined in formula (I) and Pi is a nitrogen protecting group, when treated with compounds of formula 39 under heated conditions followed by treating the product with conditions known to one skilled in the art that will remove a nitrogen protecting group or as outlined in the literature, will provide compounds of formula 40 which are representative of compounds of formula (I) wherein A is (xvii). 15 Scheme 12 OEt

RR

1 SnBU 3 O R Br N BOC 2 Br N PdCPPh3)2 pyr HBr 3 ~ 'DMAP j ' dC 2 (rh) 2 N THE 41 H CH 2

C

2 42 0 O -OtBu 44 O OtBu S Br R R, HNH 2 R Br ~46 R -\ N EtOH I N / OtBu 47 H As outlined in Scheme 12, compounds of formula 47 which are representative of compounds of formula (I), wherein A is (x) may be prepared accordingly. Compounds of formula 41, wherein R 1 is defined in formula (I), when treated with di-tert-butyldicarbonate 20 and a catalytic amount of DMAP in a solvent such as THF or acetonitrile will provide compounds of formula 42. Treatment of compounds of formula 42 with tributyl(1 46 WO 2008/154241 PCT/US2008/065727 ethoxyvinyl)stannane and dichlorobis(triphenylphosphine)palladium(II) will provide compounds of formula 44. Compounds of formula 44 when treated with pyridinium tribromide in THF will provide compounds of formula 45. Compounds of formula 45 when treated with compounds of formula 46 in a solvent such as, but not limited to, ethanol, 5 wherein R, is defined in formula (I), will provide compounds of formula 47. Scheme 13 Tols 0 N iv R1 R. N* (N \RN IH,,i 49N I I IN' O CN NH 2 Riv N H Rif H 48 50 51 As shown in Scheme 13, compounds of formula 51 which are representative of compounds of formula (I), wherein A is (iv), may be prepared accordingly. Compounds of 10 formula 48, wherein R 1 is defined in formula (I), and which are either available through commercial sources or may be prepared according to literature procedures or as outlined herein, when heated in the presence of both compounds of formula 49 and compounds of formula 50, both of which are either commercially available or may be prepared by one skilled in the art using procedures described in the literature, will provide compounds of 15 formula 51. Scheme 14 1) H R, X NH2 /\ Ns Br B OHC2Y N |Za R, N1. BuLi N Sc(OTf) 3 x4 SN' 2. DMF ' N 2)IN' H H 2) CEN-Za 55 N 52 48 54 H X = CH, N, S Y = CH, N, bond As outlined in Scheme 14, compounds of formula 55 which are representative of 20 compounds of formula (I) wherein A is (xiv), (xv), (xvi) or (xvii), may be prepared accordingly. Compounds of formula (52), wherein R 1 is defined in formula (I), when treated with butyllithium followed by treatment with DMF followed by an acidic work up will provide compounds of formula 48. Compounds of formula 48 when treated with compounds of formula 53, wherein X is -CH-, -N- or -S-, Y is -CH-, -N- or a bond, and scandium 25 tri(triflate) followed by treatment with compounds of formula 54, wherein Za is define in 47 WO 2008/154241 PCT/US2008/065727 formula (I) will provide compounds of formula 55. Scheme 15 (Ryli)b N'1 N H H 11 56 As outlined in Scheme 15, compounds of formula 56 which are representative of 5 compounds of formula (I) wherein A is (vii) may be prepared accordingly. Compounds of formula (11), wherein R 1 is defined in formula (I), when treated with a reagent such as, but not limited to, ethyl 2-chloro-2-(hydroxyimino)acetate with a base such as, but not limited to, triethylamine will provide compounds of formula 56. The reaction may be performed in a solvent such as but limited to toluene and may require the use of heat. 10 Scheme 16 H R, RiC(O)CI Rii\ R* 1 N RiiN 3 (9) N R, N N N ' N N TEA N N k Cul Boc N 27 29 H As outlined in Scheme 16, compounds of formula 29 which are representative of compounds of formula (I) wherein A is (ii) may be prepared accordingly. Compounds of formula (27), wherein R 1 is defined in formula (I), when treated with a compound of formula 15 2, RiiC(O)Cl or ICI, Cul, and triethylamine in a solvent such as, but not limited to, tetrahydrofuran will provide compounds of formula 29. The reaction may be performed at ambient temperature or with the use of heat. Scheme 17 Br R 0 R 1 Br ammonium formate N N formic acid N 45 O YOtBu 57 H 20 As outlined in Scheme 17, compounds of formula 57 which are representative of compound of formula (I), wherein A is (vi), may be prepared accordingly. Compounds of formula 45, wherein R 1 is defined in formula (I), when treated with ammonium formate and formic acid will provide compound of formula 57. 48 WO 2008/154241 PCT/US2008/065727 Scheme 18 0 0 H N CH 3 -N0 2 N / N H H 48 58 As outlined in Scheme 18, compounds of formula 58 which are representative of compounds of formula (I), wherein A is (vii), may be prepared accordingly. Compounds of 5 formula 48, wherein R 1 is defined in formula (I), when treated with nitromethane will provide compounds of formula 58 (Organic Preparations and Procedures International, 2001, 33, 381 386). Scheme 19 N HN N N H H 48 60 10 As outlined in Scheme 19, compounds of formula 60 which are representative of compounds of formula (I), wherein A is (vi), may be prepared accordingly. Compounds of formula 48, wherein R 1 is defined in formula (I), when treated with 1-(isocyanomethyl sulfonyl)-4-methylbenzene, 59, and a suitable base such as, but not limited to, potassium carbonate in a solvent such as methanol or tetrahydrofuran and subsequently treated with a 15 suitable acid such as hydrochloric acid will provide compounds of formula 60. Scheme 20 Si 0, 0 R, N -NR HO CI N2 NN __ _ 0 H H H 33 61 63 As outlined in Scheme 20, compound of formula 63 which are representative of compounds of formula (I), wherein A is (vi), may be prepared accordingly. Compounds of 20 formula 33, wherein R 1 is defined in formula (I), when treated with a suitable chlorinating agent such as thionyl chloride will provide compounds of formula 61. Compounds of formula 61, when treated with 2-(trimethylsilyl)-2H-1,2,3-triazole, 62, in a solvent such as sulfolane will provide compound of formula 63. 49 WO 2008/154241 PCT/US2008/065727 Scheme 21

OCH

3 0 R R HCO OCH R c1 hydrazine H2N 1 65 N N NI H N ,N A 61 H 64 H 66 H As outlined in Scheme 21, compounds of formula 66 which are representative of 5 compounds of formula (I), wherein A is (ix), may be prepared accordingly. Compounds of formula 61, wherein R 1 is defined in formula (I), when treated with hydrazine in a suitable solvent such as tetrahydrofuran will provide compounds of formula 64. Compounds of formula 64, when treated with trimethylorthoformate, 65, in the presence of a catalytic amount ofp-toluene sulfonic acid in a solvent such as tetrahydrofuran will provide 10 compounds of formula 66. Scheme 22

NH

2 (RyO)2B CN A-1 , A CN Scheme6 A N H2 F Pd-catalyst F N 67 68 69 As outlined in Scheme 22, compounds of formula 69 which are representative of 15 compounds of formula (I), wherein A is as defined in formula (I) can be made accordingly. Compounds of formula 67, wherein Ry is hydrogen, alkyl, aryl or the two Ry groups together with the boron atom to which they are attached form a 1,3-dioxoborolane, in the presence of a palladium catalyst using the Suzuki reaction conditions described in Scheme 1 in the presence of a heteroaryl iodide (A-I) provide compounds of formula 68. Compounds of 20 formula 68 are transformed to compounds of formula 69 upon treatment with hydrazine as described in Scheme 6. 50 WO 2008/154241 PCT/US2008/065727 Scheme 23

NH

2

R

4 C(O)CI H N X CN 1)H 2

NNH

2

X

1 N X18 R4 - ~ 2) Boc 2 0 10.- K0 'N 70 71 O O 72 4 0

-

- O TMS - N R 4 Ril-N 3 R-N N H 3 N Schemes 5 or N N Scheme 6 H 73 74 H As outlined in Scheme 23, compounds of formula 74 which are representative of compounds of formula (I), wherein Rii and R 4 are as defined for formula (I) are prepared 5 starting with compounds of formula 70, wherein X1 is iodo, bromo, or chloro. Treatment of compounds of formula 70 first with hydrazine and then with di-tert-butyldicarbonate as described in Scheme 6 furnishes compounds of formula 71. Compounds of formula 71 upon reaction with acid chlorides of formula 18 in the presence of a base such as potassium carbonate in tetrahydrofuran at ambient temperature over 2 to 8 hours provide compounds of 10 formula 72. Alternatively, compounds of formula 72 can be made from compounds of formula 71 using the conditions described in Scheme 6. Compounds of formula 72 are reacted with (trimethylsilyl)acetylene under the conditions described in Schemes 5 and 6 to give compounds of formula 73. Compounds of formula 74 are obtained from compounds of formula 73 upon treatment with Rii-N 3 in aqueous t-butanol in the presence of copper(II) 15 sulfate and sodium (R)-2-((S)-1,2-dihydroxyethyl)-4-hydroxy-5-oxo-2,5-dihydrofuran-3 olate at 40-80 'C over I to 6 hours. Scheme 24 Br AR4 A N R4 N A-B(0RY) 2 N SN' N 7O 76 As outlined in Scheme 24, compounds of formula 76, which are representative of 20 compounds of formula (I), wherein A and R 4 are as defined for formula (I) are obtained from compounds of formula 75. Compounds of formula 75 can be treated with A-B(ORy) 2 51 WO 2008/154241 PCT/US2008/065727 wherein A is defined as for formula (I) and Ry is hydrogen, alkyl, aryl or the two Ry groups together with the boron atom to which they are attached form a 1,3-dioxoborolane, in the presence of a palladium catalyst using the Suzuki reaction conditions described in Scheme 1 to give compounds of formula 76. 5 Scheme 25 ,NaN Rii SnBu 3 I CN Scheme 3 Ri-N CN Scheme 6 RzN GN N N cem R N N F F 77 78 79 0 ,NzN HNJ0 RiiNN R4 H 80 As outlined in Scheme 25, compounds of formula 80, which are representative of compounds of formula (I), wherein Rii and R 4 are as defined for formula (I) are prepared accordingly. Compounds of formula 77 and 78 reacted under Stille coupling conditions 10 described in Scheme 3 supply compounds of formula 79. Compounds of formula 79 when reacted as described in Scheme 6 provide compounds of formula 80. 52 WO 2008/154241 PCT/US2008/065727 Scheme 26 0

NH

2 1) R 4 C(O)CI HN-( A N 2)18 A N 4 N 2) TFA ~N' O0 H 81 0 82 0 HN

N

R

1 NQO A N R H 83 0 HN-S\

R

5 SO2CI Aj N R \'N N' H 84 HN-Ra RaCHO A N SN' H 85 As outlined in Scheme 26, compounds of formulas 82, 83, 84, and 85, which are representative of compounds of formula (I), wherein A, R 4 , R 5 , Ra and Rj are as defined for 5 formula (I), are prepared from compounds of formula 81. Compounds of formula 81 can be treated with an acid chloride, 18, in solvent such as tetrahydrofuran in the presence of a base such as potassium carbonate or triethylamine to give compounds of formula 82. An alternative solvent is dichloromethane and an alternative base is pyridine. The acid chlorides can be prepared from the corresponding carboxylic acids by treatment with oxalyl chloride 10 with a catalytic amount of N,N-dimethylformamide. To prepare compounds of formula 83, compounds of formula 81 can be treated with RjNCO in heated pyridine. Compounds of formula 84 are prepared from compounds of formula 81 by treatment with R 5

SO

2 Cl in pyridine at or near room temperature. Compounds of formula 85 are also prepared from compounds of formula 81 in a reductive amination reaction with RaCHO in the presence of a 15 reducing agent such as sodium triacetoxyborohydride or sodium cyanoborohydride and acetic acid in a solvent such as 1,2-dichloroethane at or near room temperature and subsequent treatment with trifluoroacetic acid in dichloromethane to remove the t-butoxycarbonyl protecting group. 53 WO 2008/154241 PCT/US2008/065727 Scheme 27 0 0 HN Br A HN N NRRk I ~ N A N H 86 H 87 As outlined in Scheme 27, compounds of formula 87, wherein A, Rj and Rk are defined for formula (I), can be prepared from compounds of formula 86. Compounds of 5 formula 86 are prepared as described for compounds of formula 82 in Scheme 26. Compounds of formula 86 can then be heated in the presence of an amine, HNRjRk, and a base such as triethylamine in a solvent such as acetonitrile to give compounds of formula 87. Alternatively, heterocycles such as pyrrolidine, piperidine, piperazine, and morpholine can be substituted for the amine. 10 Scheme 28 R1Ze R, HO A ZN A 0I NN

(R

3 )m R2

(R

3 )m R2 88 89 As outlined in Scheme 28, compounds of formula 89, wherein A, R 1 , R 2 , R 3 , m, Ze and Zd are as defined for formula (I), can be prepared form compound of formula 88. 15 Compounds of formula 88 can be prepared as described in Schemes 1-4, 7-9, 22, 24, and 26. During the preparation of compounds of formula 88, the carboxylic acid moiety pendant on A can be protected as an ester and subsequently hydrolyzed to expose the carboxylic acid by methods known to one skilled in the art of organic synthesis. Compounds of formula 88 when treated with an amine (HNZcZd) using carboxylic acid-amine coupling conditions 20 known to one skilled in the art will provide compounds of formula 89. Standard carboxylic acid amine coupling conditions include adding a coupling reagent such as, but not limited to, 1-(3-dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride (EDCI), 1,3dicyclohexylcarbodiimide (DCC), bis(2-oxo-3-oxazolidinyl)phosphinic chloride (BOPCl), 0-(7-azabenzotriazol- 1 -yl)-N,N,N',N'-tetramethyluronium hexafluorophosphate (HATU) or 25 O-benzotriazol-1-yl-N,N,N',N'-tetramethyluronium tetrafluoroborate (TBTU) optionally in the presence of a base such as triethylamine or diisopropylethylamine with or without an 54 WO 2008/154241 PCT/US2008/065727 auxiliary reagent such as, but not limited to, 1 -hydroxy-7-azabenzotriazole (HOAT) or 1 hydroxybenzotriazole hydrate (HOBT) in a solvent such as, but not limited to, dichloromethane or N,N-dimethylformamide. 5 EXAMPLES The compounds and processes of the invention will be better understood by reference to the following examples, which are intended as an illustration of and not a limitation upon the scope of the invention. 10 Example 1 5 -(1 -benzyl- 1 H- 1,2,3 -triazol-5 -yl)- 1 H-indazole compound with 5 -(1 -benzyl- 1 H- 1,2,3 -triazol 4 -yl)-1H-indazole Example 1A 15 tert-Butyl 5-iodo-1H-indazole-1-carboxylate To an ice bath cooled solution of 4-iodo-2-methylaniline (20 g, 83.24 mmol) in chloroform (250 mL) was added dropwise a solution of acetic anhydride (21.2 g, 208.11 mmol) in chloroform (50 mL). Upon completion of the addition, the mixture was stirred at room temperature for 1 hour. Potassium acetate (2.5 g, 24.97 mmol) and isoamylnitrite (22.3 20 mL, 166.48 mmol) were added and the mixture was heated at 70 C for 20 hours. The mixture was cooled and quenched with saturated aqueous NaHCO 3 to pH 7. The mixture was extracted with dichloromethane, and the organics were dried over sodium sulfate and filtered. The solvent was evaporated under reduced pressure. The crude solid was washed with methanol, dissolved in tetrahydrofuran (200 mL) and treated with a warm solution of KOH 25 (60 g) in water (200 mL). The mixture was stirred for 15 minutes and was treated with 6N HCl to pH 1. The layers were separated, the organic layer was dried over sodium sulfate and filtered, and the solvent was evaporated under reduced pressure. The crude solid was dissolved in dichloromethane (500 mL) and triethylamine (23 mL, 166.48 mmol), and di-tert butyldicarbonate (23.6 g, 108.2 mmol) and a catalytic amount of dimethylaminopyridine (~ 5 30 mg) were added. The mixture was stirred at room temperature for 2 hours, diluted with water, extracted with dichloromethane, and dried with sodium sulfate and filtered. The solvent was evaporated under reduced pressure to afford the title compound. MS (ESI+) m/z 344.9 (M+H)+. Example lB 55 WO 2008/154241 PCT/US2008/065727 tert-Butyl 5-((trimethylsilyl)ethynyl)-1H-indazole-1-carboxylate Example 1A (10.81 g, 31.4 mmol), dichlorobis(triphenylphosphine)palladium(II) (1.1 g, 1.57 mmol), and copper (I) iodide (365 mg, 1.92 mmol) were combined in triethylamine (70 mL) under an inert atmosphere. Trimethylsilyl acetylene (5.0 mL, 36.0 mmol) was added 5 and the mixture was stirred at 60 C overnight. The solvent was removed under reduced pressure and the resulting residue was dissolved in methylene chloride and washed with 1 N hydrochloric acid. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 5-40 % ethyl acetate in hexanes to afford the title compound. MS (ESI-) m/z 215.0 (M-99)+. 10 Example IC 5-Ethynyl-1H-indazole Example 1B (7.93 g, 25.2 mmol) was dissolved in methanol (150 mL). A solution of 1 N potassium hydroxide (50 mL) was added, and the mixture was stirred at ambient 15 temperature for 1 hour. The solvent was removed under reduced pressure, and the resulting slurry was dissolved in ethyl acetate and washed with water and brine. The organic layer was dried over sodium sulfate and filtered, and the solvent was removed under reduced pressure to afford the title compound. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.24 (s, 1 H) 8.10 (s, 1 H) 7.95 (s, 1 H) 7.55 (d, J=8.82 Hz, 1 H) 7.39 (dd, J=8.48, 1.36 Hz, 1 H) 4.03 (s, 1 H). 20 Example ID 5 -(1 -benzyl- 1 H- 1,2,3 -triazol-5 -yl)- 1 H-indazole compound with 5 -(1 -benzyl- 1 H- 1,2,3 -triazol 4 -yl)-1H-indazole Into a microwave vial were added 100.0 mg (0.70 mmol) of Example 1C and 94 mg 25 (0.70 mmol) of benzyl azide. The mixture was heated at 160 'C for 20 minutes using microwave irradiation (CEM-Discover, 100 Watts, 1 minute ramp time). The mixture was dissolved in ethyl acetate and purified by silica gel chromatography eluting with 75% ethyl acetate in hexane to afford the title compounds. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.28 (s, 1 H) 13.12 (s, 1 H) 8.61 (s, 1 H) 8.23 (s, 1 H) 8.13 (s, 1 H) 8.11 (s, 1 H) 7.94 (s, 1 30 H) 7.82 - 7.89 (in, 2 H) 7.56 - 7.70 (in, 2 H) 7.20 - 7.44 (in, 9 H) 6.97 - 7.02 (in, 2 H) 5.69 (s, 2 H) 5.65 (s, 2 H). MS (CI) m/z 276 (M+H)+. Example 2 56 WO 2008/154241 PCT/US2008/065727 5-(1H-1,2,3-triazol-5-yl)- 1 H-indazole Into a microwave vial were added 100.0 mg (0.70 mmol) of Example 1C, 81 mg (0.7 mmol) of trimethylsilyl azide, Cu (4 mg), and dimethylformamide/methanol (lImL, 9:1). The mixture was heated at 160 'C for 20 minutes using microwave irradiation (CEM 5 Discover, 100 Watts, 1 minute ramp time). The mixture was dissolved in ethyl acetate, and the organic layer was washed with water. The organic layer was dried over anhydrous MgSO 4 , filtered and concentrated under reduced pressure, and purified by silica gel chromatography eluting with 80% ethyl acetate in hexanes to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.16 (s, 1 H) 8.31 (s, 1 H) 8.25 (s, 1 H) 8.13 (s, 1 H) 10 7.87 (d, J=8.82 Hz, 1 H) 7.62 (d, J=8.82 Hz, 1 H). MS (CI) m/z 186 (M+H). Example 3 5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazole 15 Example 3A tert-Butyl 5-iodo-1H-indazole-1-carboxylate To an ice bath cooled solution of 4-iodo-2-methylaniline (20 g, 83.24 mmol) in chloroform (250 mL) was added dropwise with an addition funnel a solution of acetic anhydride (21.2 g, 208.11 mmol) in chloroform (50 mL). Upon completion of the addition, 20 the mixture was stirred at room temperature for 1 hour. Potassium acetate (2.5 g, 24.97 mmol) and isoamylnitrite (22.3 mL, 166.48 mmol) were added, and the mixture was heated at 70'C for 20 hour. The mixture was then cooled and quenched with saturated aqueous NaHCO 3 to pH 7. The mixture was extracted with dichloromethane, dried over sodium sulfate, filtered, and the solvent was evaporated under reduced pressure. The crude solid was 25 washed with methanol, dissolved in tetrahydrofuran (200 mL) and treated with a warm solution of KOH (60 g) in water (200 mL). The mixture was stirred for 15 minutes and was treated with 6N HCl to pH 1. The layers were separated, the organic layer was dried over sodium sulfate and filtered, and the solvent was evaporated under reduced pressure. The crude material was dissolved in dichloromethane (500 mL) and triethylamine (23 mL, 166.48 30 mmol), and di-tert-butyldicarbonate (23.6 g, 108.2 mmol), and a catalytic amount of dimethylaminopyridine (- 5 mg) were added. The mixture was stirred at room temperature for 2 hours, quenched with water, extracted with dichloromethane, and dried over sodium sulfate and filtered. The solvent was evaporated under reduced pressure to afford the title 57 WO 2008/154241 PCT/US2008/065727 compound. MS (ESI+) m/z 344.9 (M+H)*. Example 3B tert-Butyl 5-((trimethylsilyl)ethynyl)-1H-indazole-1-carboxylate 5 Example 3A, (10.81 g, 31.4 mmol), dichlorobis(triphenylphosphine)palladium(II) (1.1 g, 1.57 mmol), and copper (I) iodide (365 mg, 1.92 mmol) were combined in triethylamine (70 mL) under an inert atmosphere. Trimethylsilyl acetylene (5.0 mL, 36.0 mmol) was added and the mixture was stirred at 60 C overnight. The solvent was removed under reduced pressure and the resulting residue was dissolved in methylene chloride and washed with 1 N 10 hydrochloric acid. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 5-40% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 215.0 (M-99)+. Example 3C 15 5-Ethynyl-1H-indazole Example 3B (7.93 g, 25.2 mmol) was dissolved in methanol (150 mL). A solution of 1 N potassium hydroxide (50 mL) was added and the mixture was stirred at ambient temperature for 1 hour. The solvent was removed under reduced pressure, and the resulting slurry was dissolved in ethyl acetate and washed with water and brine. The organic layer was 20 dried over sodium sulfate, filtered, and the solvent was removed under reduced pressure to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.24 (s, 1 H) 8.10 (s, 1 H) 7.95 (s, 1 H) 7.55 (d, J=8.82 Hz, 1 H) 7.39 (dd, J=8.48, 1.36 Hz, 1 H) 4.03 (s, 1 H). Example 3D 25 5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazole Example 3C (40 mg, 0.28 mmol), benzyl azide (37 mg, 0.28 mmol), CuSO 4 (14 mg, 0.056 mmol) and Cu wire (14 mg) were combined in tert-butanol (0.5 mL) and water (0.5 mL) and heated in a CEM-Discover microwave for 10 minutes at 125 0 C and 100 Watts. To the mixture was added 1 M HCI and water, the product was extracted with dichloromethane, 30 and purified by silica gel chromatography (50% ethyl acetate in hexanes) to afford the title compound. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 13.10 (s, 1 H) 8.60 (s, 1 H) 8.23 (s, 1 H) 8.11 (s, 1 H) 7.85 (d, J=8.59, 1.53 Hz, 1 H) 7.59 (d, J=8.59 Hz, 1 H) 7.26 - 7.49 (in, 5 H) 5.65 (s, 2 H). MS (ESI+) m/z 276.0 (M+H)j. 58 WO 2008/154241 PCT/US2008/065727 Example 4 5-[1-(2-methylbenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole Into a 5 mL CEM Microwave reaction tube which contained a Teflon-coated micro 5 flea stirring bar were added 17.6 mg (0.124 mmol) of Example 3C, 300 uL aqueous solution containing 7.80 mg (0.118 mmol) of sodium azide; followed by 15.79 pL (0. 118 mmol; 21.80 mg 0.95 equivalents) of 2-methyl-benzyl bromide (added neat). To the suspension were then added 300 pL of tert-butanol; 25 mg of copper wire; and finally 50 pL of 1 N aqueous copper sulfate pentahydrate solution. The microwave reaction vessel was then 10 capped and heated with stirring for 10 minutes at 125 C at 100 Watts power on a CEM Discover microwave. After cooling to ambient temperature, the mixture was diluted with 0.25 N aqueous HCl; and the aqueous suspension was extracted with dichloromethane. The organic layer was washed with distilled water; saturated aqueous NaCl; and then dried over anhydrous sodium sulfate and filtered. The dried solution was diluted with acetonitrile; and 15 the soluble organic material was then filtered thru a glass wool plug which was overlaid with additional anhydrous sodium sulfate. An aliquot of the filtrate was then removed for subsequent LC/MS analysis. Those solutions that contained the desired triazole product were then evaporated in-vacuo and then redissolved in 1.50 mL of 1:1 DMSO/methanol. The solution of the crude triazole product was then purified by reverse-phase HPLC using an 20 acetonitrile/water 0.1% TFA gradient elution method to afford the title compound. 1 H NMR (500 MHz, DMSO-dj/D 2 0) 6 ppm 2.37 (s, 3 H) 5.66 (s, 2 H) 7.16 - 7.34 (m, 4 H) 7.63 (d, J=8.54 Hz, 1 H) 7.87 (d, J=8.70, 1.37 Hz, 1 H) 8.14 (s, 1 H) 8.25 (s, 1 H) 8.49 (s, 1 H). MS (ESI+) m/z 289.9 (M+H)+. 25 Example 5 5-[1-(3-methylbenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methylbenzylbromide with 3-methyl-benzyl bromide. 1 H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.58 (s, 1 H) 8.25 (s, 1 H) 8.14 (s, 1 H) 7.87 (d, J=8.85, 1.53 Hz, 1 H) 30 7.64 (d, J=8.54 Hz, 1 H) 7.30 (t, J=7.63 Hz, 1 H) 7.14 - 7.24 (in, 3 H) 5.60 (s, 2 H) 2.31 (s, 3 H). MS (ESI+) m/z 289.8 (M+H)+. Example 6 59 WO 2008/154241 PCT/US2008/065727 5-[1-(4-methylbenzyl)- 1 H- 1,2,3-triazol-4-yl]- 1 H-indazole The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methylbenzylbromide with 4-methyl-benzyl bromide. 1 H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.55 (s, 1 H) 8.24 (s, 1 H) 8.14 (s, 1 H) 7.86 (d, J=8.54, 1.53 Hz, 1 H) 5 7.63 (d, J=8.85 Hz, 1 H) 7.25 - 7.33 (m, 2 H) 7.18 - 7.24 (m, 2 H) 5.59 (s, 2 H) 2.29 (s, 3 H). MS (ESI+) m/z 290.1 (M+H). Example 7 5-[1-(3-methoxybenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole 10 The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 3-methoxylbenzylbromide. 1H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.59 (s, 1 H) 8.25 (s, 1 H) 8.14 (s, 1 H) 7.87 (d, J=8.54, 1.53 Hz, 1 H) 7.64 (d, J=8.85 Hz, 1 H) 7.33 (t, J=7.93 Hz, 1 H) 6.89 - 7.00 (in, 3 H) 5.62 (s, 2 H) 3.76 (s, 3 H). MS (ESI+) m/z 306.1 (M+H)*. 15 Example 8 5-[1-(2-fluorobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 2-fluorobenzylbromide. 1 H NMR (500 MHz, 20 DMSO-d 6

/D

2 0) 6 ppm 8.57 (s, 1 H) 8.25 (s, 1 H) 8.12 - 8.17 (m, 1 H) 7.87 (d, J=8.54, 1.53 Hz, 1 H) 7.64 (d, J=8.54 Hz, 1 H) 7.41 - 7.49 (in, J=7.32, 7.32 Hz, 2 H) 7.22 - 7.33 (m, J=7.02 Hz, 2 H) 5.71 (s, 2 H). MS (ESI+) m/z 293.9 (M+H)+. Example 9 25 5-[1-(3-fluorobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 3-fluorobenzylbromide. 1 H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.61 (s, 1 H) 8.25 (s, 1 H) 8.15 (s, 1 H) 7.87 (d, J=8.85, 1.53 Hz, 1 H) 7.64 (d, J=8.54 Hz, 1 H) 7.41 - 7.51 (m, 1 H) 7.15 - 7.28 (m, 3 H) 5.68 (s, 2 H). MS (ESI+) 30 m/z 293.8 (M+H). Example 10 5-[1-(4-fluorobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole 60 WO 2008/154241 PCT/US2008/065727 The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 4-fluorobenzylbromide. 1 H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.58 (s, 1 H) 8.24 (s, 1 H) 8.14 (s, 1 H) 7.86 (d, J=8.85, 1.53 Hz, 1 H) 7.64 (d, J=8.85 Hz, 1 H) 7.46 (d, J=8.85, 5.49 Hz, 2 H) 7.24 (t, J=9.00 Hz, 2 H) 5.64 (s, 2 H). 5 MS (ESI+) m/z 293.9 (M+H). Example 11 5-[1-(2-chlorobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 4, 10 substituting 2-methyl-benzyl bromide with 2-chlorobenzylbromide. 1 H NMR (500 MHz, DMSO-d 6

/D

2 0) S ppm 8.56 (s, 1 H) 8.26 (s, 1 H) 8.14 (s, 1 H) 7.88 (d, J=8.54, 1.53 Hz, 1 H) 7.64 (d, J=8.54 Hz, 1 H) 7.55 (d, J=7.63, 1.53 Hz, 1 H) 7.32 - 7.48 (m, 3 H) 5.76 (s, 2 H). MS (ESI+) m/z 309.8 (M+H). 15 Example 12 5-[1-(3-chlorobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 3-chlorobenzylbromide. 1 H NMR (500 MHz, DMSO-d 6

/D

2 0) S ppm 8.62 (s, 1 H) 8.26 (s, 1 H) 8.15 (s, 1 H) 7.87 (d, J=8.54, 1.53 Hz, 1 H) 20 7.64 (d, J=8.54 Hz, 1 H) 7.40 - 7.49 (in, J=7.63 Hz, 3 H) 7.35 (d, J=6.41 Hz, 1 H) 5.67 (s, 2 H). MS (ESI+) m/z 309.8 (M+H)+. Example 13 5-[1-(4-chlorobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole 25 The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 4-chlorobenzylbromide. 1 H NMR (500 MHz, DMSO-d 6

/D

2 0) S ppm 8.58 (s, 1 H) 8.24 (s, 1 H) 8.15 (s, 1 H) 7.86 (d, J=8.54, 1.53 Hz, 1 H) 7.64 (d, J=8.85 Hz, 1 H) 7.45 - 7.52 (m, 2 H) 7.38 - 7.44 (m, 2 H) 5.65 (s, 2 H). MS (ESI-) m/z 307.7 (M-H)-. 30 Example 14 5-[1-(2-bromobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 4, 61 WO 2008/154241 PCT/US2008/065727 substituting 2-methyl-benzyl bromide with 2-bromobenzylbromide. 'H NMR (500 MHz, DMSO-d 6

/D

2 0) S ppm 8.55 (s, 1 H) 8.26 (s, 1 H) 8.14 (s, 1 H) 7.88 (d, J=8.54, 1.53 Hz, 1 H) 7.72 (d, J=7.93 Hz, 1 H) 7.64 (d, J=8.54 Hz, 1 H) 7.41 - 7.50 (m, 1 H) 7.27 - 7.40 (m, 2 H) 5.74 (s, 2 H). MS (ESI+) m/z 353.5 (M+H)*. 5 Example 15 5-[1-(2-nitrobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 2-nitrobenzylbromide. 1 H NMR (500 MHz, 10 DMSO-d 6

/D

2 0) S ppm 8.57 (s, 1 H) 8.27 (s, 1 H) 8.12 - 8.22 (m, 2 H) 7.88 (d, J=8.54, 1.53 Hz, 1 H) 7.75 - 7.83 (m, 1 H) 7.60 - 7.72 (m, 2 H) 7.27 (d, J=7.63 Hz, 1 H) 6.02 (s, 2 H). MS (ESI+) m/z 320.8 (M+H)+. Example 16 15 5-[1-(3-nitrobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 3-nitrobenzylbromide. 1 H NMR (500 MHz, DMSO-d 6

/D

2 0) S ppm 8.65 (s, 1 H) 8.21 - 8.28 (m, 3 H) 8.15 (s, 1 H) 7.80 - 7.91 (m, 2 H) 7.73 (t, J=7.78 Hz, 1 H) 7.65 (d, J=8.54 Hz, 1 H) 5.83 (s, 2 H). MS (ESI+) m/z 320.8 20 (M+H)y. Example 17 5-[1-(4-nitrobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 4, 25 substituting 2-methyl-benzyl bromide with 4-nitrobenzylbromide. 1 H NMR (500 MHz, DMSO-d 6

/D

2 0) S ppm 8.64 (s, 1 H) 8.22 - 8.31 (m, 3 H) 8.15 (s, 1 H) 7.88 (d, J=8.70, 1.37 Hz, 1 H) 7.57 - 7.68 (m, 3 H) 5.83 (s, 2 H). MS (ESI+) m/z 320.7 (M+H)+. Example 18 30 2-{[4-(1H-indazol-5-yl)-1H-1,2,3-triazol-1-yl]methyl}benzonitrile The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 2-cyanobenzylbromide. 1 H NMR (500 MHz, DMSO-d 6

/D

2 0) S ppm 8.61 (s, 1 H) 8.26 (s, 1 H) 8.15 (s, 1 H) 7.93 (d, J=7.63 Hz, 1 H) 7.88 62 WO 2008/154241 PCT/US2008/065727 (d, J=8.54, 1.53 Hz, 1 H) 7.72 - 7.80 (m, 1 H) 7.57 - 7.68 (m, 2 H) 7.53 (d, J=7.93 Hz, 1 H) 5.86 (s, 2 H). MS (ESI+) m/z 300.9 (M+H)+. Example 19 5 3-{ [4-(1H-indazol-5-yl)-1H-1,2,3-triazol-1-yl]methyl}benzonitrile The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 3-cyanobenzylbromide. 'H NMR (500 MHz, DMSO-d 6

/D

2 0) S ppm 8.63 (s, 1 H) 8.26 (s, 1 H) 8.15 (s, 1 H) 7.85 - 7.93 (m, 2 H) 7.83 (d, J=7.63 Hz, 1 H) 7.72 (d, J=8.24 Hz, 1 H) 7.56 - 7.68 (m, 2 H) 5.74 (s, 2 H). MS (ESI+) m/z 10 300.9 (M+H)*. Example 20 4-{[4-(1H-indazol-5-yl)-1H-1,2,3-triazol-1-yl]methyl}benzonitrile The title compound was prepared according to the procedure outlined in Example 4, 15 substituting 2-methyl-benzyl bromide with 4-cyanobenzylbromide. 'H NMR (500 MHz, DMSO-d 6

/D

2 0) S ppm 8.62 (s, 1 H) 8.26 (s, 1 H) 8.15 (s, 1 H) 7.82 - 7.93 (m, J=8.24 Hz, 3 H) 7.65 (d, J=8.54 Hz, 1 H) 7.54 (d, J=8.24 Hz, 2 H) 5.78 (s, 2 H). MS (ESI+) m/z 300.7 (M+H)y. 20 Example 21 5-{1-[2-(trifluoromethyl)benzyl]-1H-1,2,3-triazol-4-yl} -1H-indazole The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 2-trifluoromethylbenzylbromide. 'H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.56 (s, 1 H) 8.27 (s, 1 H) 8.15 (s, 1 H) 7.89 (d, J=8.85, 1.53 25 Hz, 1 H) 7.85 (d, J=7.93 Hz, 1 H) 7.72 (t, J=7.63 Hz, 1 H) 7.55 - 7.68 (in, 2 H) 7.33 (d, J=7.93 Hz, 1 H) 5.85 (s, 2 H). MS (ESI+) m/z 300.7 (M+H). Example 22 5-{1-[3-(trifluoromethyl)benzyl]-1H-1,2,3-triazol-4-yl} -1H-indazole 30 The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 3-trifluoromethylbenzylbromide. 'H NMR (500 MHz, DMSO-d 6

/D

2 0) 5 ppm 8.65 (s, 1 H) 8.25 (s, 1 H) 8.14 (s, 1 H) 7.87 (d, J=8.70, 1.37 Hz, 1 H) 7.77 (s, 1 H) 7.71 - 7.76 (in, 1 H) 7.61 - 7.69 (m, 3 H) 5.78 (s, 2 H). MS (ESI+) m/z 63 WO 2008/154241 PCT/US2008/065727 344.0 (M+H)j. Example 23 5-{1-[4-(trifluoromethyl)benzyl]-1H-1,2,3-triazol-4-yl} -1H-indazole 5 The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 4-trifluoromethylbenzylbromide. 1 H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.63 (s, 1 H) 8.25 (s, 1 H) 8.14 (s, 1 H) 7.87 (d, J=8.54 Hz, 1 H) 7.78 (d, J=7.93 Hz, 2 H) 7.63 (d, J=8.54 Hz, 1 H) 7.58 (d, J=7.93 Hz, 2 H) 5.78 (s, 2 H). MS (ESI+) m/z 344.2 (M+H)*. 10 Example 24 5- { 1-[3-(trifluoromethoxy)benzyl]-1H-1,2,3-triazol-4-yl}-1H-indazole The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 3-trifluoromethoxybenzylbromide. 'H NMR (500 15 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.64 (s, 1 H) 8.25 (s, 1 H) 8.14 (s, 1 H) 7.87 (d, J=8.54 Hz, 1 H) 7.64 (d, J=8.54 Hz, 1 H) 7.56 (t, J=8.24 Hz, 1 H) 7.31 - 7.45 (in, 3 H) 5.73 (s, 2 H). MS (ESI+) m/z 359.9 (M+H)*. Example 25 20 5- { 1-[4-(trifluoromethoxy)benzyl]-1H-1,2,3-triazol-4-yl}-1H-indazole The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 4-trifluoromethoxybenzylbromide. 'H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.61 (s, 1 H) 8.25 (s, 1 H) 8.14 (s, 1 H) 7.87 (d, J=8.70, 1.37 Hz, 1 H) 7.63 (d, J=8.54 Hz, 1 H) 7.52 (d, J=8.85 Hz, 2 H) 7.40 (d, J=8.24 Hz, 2 H) 5.70 (s, 2 25 H). MS (ESI+) m/z 359.9 (M+H)+. Example 26 5-[1-(4-tert-butylbenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 4, 30 substituting 2-methyl-benzyl bromide with 4-tert-butylbenzylbromide. 1H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.58 (s, 1 H) 8.24 (s, 1 H) 8.13 (s, 1 H) 7.86 (d, J=8.85, 1.53 Hz, 1 H) 7.63 (d, J=8.54 Hz, 1 H) 7.42 (d, J=8.24 Hz, 2 H) 7.32 (d, J=8.24 Hz, 2 H) 5.60 (s, 2 H) 1.26 (s, 9 H). MS (ESI+) m/z 332.1 (M+H)+. 64 WO 2008/154241 PCT/US2008/065727 Example 27 methyl 3-{[4-(1H-indazol-5-yl)-1H-1,2,3-triazol-1-yl]methyl}benzoate The title compound was prepared according to the procedure outlined in Example 4, 5 substituting 2-methyl-benzyl bromide with 3-carbomethoxybenzylbromide. 1 H NMR (500 MHz, DMSO-d 6

/D

2 0) S ppm 8.62 (s, 1 H) 8.25 (s, 1 H) 8.14 (s, 1 H) 7.92 - 7.99 (m, 2 H) 7.87 (d, J=8.54, 1.53 Hz, 1 H) 7.68 (d, J=7.63 Hz, 1 H) 7.63 (d, J=8.54 Hz, 1 H) 7.58 (t, J=7.63 Hz, 1 H) 5.75 (s, 2 H) 3.86 (s, 3 H). MS (ESI+) m/z 333.9 (M+H). 10 Example 28 methyl 4-{[4-(1H-indazol-5-yl)-1H-1,2,3-triazol-1-yl]methyl}benzoate The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 4-carbomethoxybenzylbromide. 1 H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.62 (s, 1 H) 8.25 (s, 1 H) 8.14 (s, 1 H) 7.99 (d, J=8.24 Hz, 2 H) 15 7.87 (d, J=8.85 Hz, 1 H) 7.63 (d, J=8.54 Hz, 1 H) 7.49 (d, J=8.24 Hz, 2 H) 5.76 (s, 2 H) 3.85 (s, 3 H). MS (ESI+) m/z 333.9 (M+H)+. Example 29 5-[1-(2,4-dimethylbenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole 20 The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 2,4-dimethylbenzylchloride. H NMR (500 MHz, DMSO-d 6

/D

2 0) S ppm 8.45 (s, 1 H) 8.24 (s, 1 H) 8.13 (s, 1 H) 7.86 (d, J=8.54 Hz, 1 H) 7.62 (d, J=8.54 Hz, 1 H) 7.12 (d, J=7.93 Hz, 1 H) 7.07 (s, 1 H) 7.04 (d, J=7.63 Hz, 1 H) 5.60 (s, 2 H) 2.32 (s, 3 H) 2.26 (s, 3 H). MS (ESI+) m/z 304.0 (M+H)+. 25 Example 30 5-[1-(3,5-dimethylbenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 3,5-dimethylbenzylbromide. H NMR (500 MHz, 30 DMSO-d 6

/D

2 0) S ppm 8.56 (s, 1 H) 8.24 (s, 1 H) 8.13 (s, 1 H) 7.87 (d, J=8.54 Hz, 1 H) 7.63 (d, J=8.54 Hz, 1 H) 6.95 - 7.01 (in, 3 H) 5.55 (s, 2 H) 2.26 (s, 6 H). MS (ESI+) m/z 304.2 (M+H)y. 65 WO 2008/154241 PCT/US2008/065727 Example 31 5-[1-(2,3-dichlorobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 2,3-dichlorobenzylchloride. 1H NMR (500 MHz, 5 DMSO-d 6

/D

2 0) S ppm 8.59 (s, 1 H) 8.26 (s, 1 H) 8.14 (s, 1 H) 7.88 (d, J=8.70, 1.37 Hz, 1 H) 7.69 (d, J=8.09, 1.37 Hz, 1 H) 7.63 (d, J=8.54 Hz, 1 H) 7.44 (t, J=7.78 Hz, 1 H) 7.31 (d, J=7.78, 1.07 Hz, 1 H) 5.81 (s, 2 H). MS (ESI+) m/z 343.8 (M+H). Example 32 10 5-[i-(2,4-dichlorobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 2,4-dichlorobenzylchloride. 1H NMR (500 MHz, DMSO-d 6

/D

2 0) S ppm 8.56 (s, 1 H) 8.25 (s, 1 H) 8.13 (s, 1 H) 7.87 (d, J=8.54 Hz, 1 H) 7.72 (d, J=2.14 Hz, 1 H) 7.63 (d, J=8.54 Hz, 1 H) 7.50 (d, J=8.39, 1.98 Hz, 1 H) 7.40 (d, J=8.24 15 Hz, 1 H) 5.74 (s, 2 H). MS (ESI-) m/z 341.8 (M-H)-. Example 33 5-[i-(2,5-dichlorobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 4, 20 substituting 2-methyl-benzyl bromide with 2,5-dichlorobenzylchloride. 1H NMR (500 MHz, DMSO-d 6

/D

2 0) S ppm 8.59 (s, 1 H) 8.26 (s, 1 H) 8.14 (s, 1 H) 7.88 (d, J=8.85 Hz, 1 H) 7.63 (d, J=8.85 Hz, 1 H) 7.56 - 7.61 (m, 1 H) 7.49 - 7.55 (m, 1 H) 7.47 (d, J=2.44 Hz, 1 H) 5.75 (s, 2 H). MS (ESI+) m/z 343.8 (M+H)*. 25 Example 34 5-[i-(3,5-dichlorobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 3,5-dichlorobenzylchloride. 1H NMR (500 MHz, DMSO-d 6

/D

2 0) S ppm 8.64 (s, 1 H) 8.26 (s, 1 H) 8.15 (s, 1 H) 7.87 (d, J=8.85 Hz, 1 H) 7.57 30 - 7.71 (m, 2 H) 7.44 (d, J=1.53 Hz, 2 H) 5.69 (s, 2 H). MS (ESI+) m/z 344.1 (M+H)+. Example 35 5-{1-[2,4-bis(trifluoromethyl)benzyl]-1H-1,2,3-triazol-4-yl}-1H-indazole 66 WO 2008/154241 PCT/US2008/065727 The title compound was prepared according to the procedure outlined in Example 4, substituting 2-methyl-benzyl bromide with 2,4-bis(trifluoromethyl)bromide. 1 H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.62 (s, 1 H) 8.27 (s, 1 H) 8.07 - 8.18 (in, 3 H) 7.89 (d, J=8.70, 1.37 Hz, 1 H) 7.64 (d, J=8.54 Hz, 1 H) 7.49 (d, J=7.93 Hz, 1 H) 5.96 (s, 2 H). MS (ESI+) 5 m/z 411.7 (M+H). Example 36 N-cyclohexyl-6-(1H-indazol-5-yl)imidazo[2,1-b][1,3]thiazol-5-amine 10 Example 36A 1H-indazole-5-carbaldehyde To a solution of 5-bromoindazole (5 g, 25.38 mmol) in tetrahydrofuran (100 mL) cooled at -50 C under argon was added dropwise a solution of 1.6 M n-butyllithium in hexanes (40 mL, 63.44 mmol). Dimethylformamide (3.9 mL, 50.75 mmol) was added, and 15 the mixture was allowed to warm to room temperature and stirred for 15 minutes. The mixture was then quenched with water, extracted with ethyl acetate, preabsorbed onto silica gel and purified by silica gel chromatography eluting with a gradient of 10-30% ethyl acetate in hexanes to afford the title compound. H NMR (500 MHz, DMSO-d 6 ) 6 ppm 10.03 (s, 1 H) 8.45 (s, 1 H) 8.35 (s, 1 H) 7.85 (dd, J=8.70, 1.37 Hz, 1 H) 7.69 (d, J=8.54 Hz, 1 H). 20 Example 36B N-cyclohexyl-6-(1H-indazol-5-yl)imidazo[2,1-b][1,3]thiazol-5-amine Example 36A (50 mg, 0.34 mmol) and 2-aminothiazole (28 mg, 0.34 mmol) were combined with scandium triflate (8 mg, 0.0 17 mmol) in anhydrous methanol (1 mL) in a 4 25 mL vial. The vial was sealed and shaken at ambient temperature for 30 minutes. Cyclohexyl isocyanide (42 mL, 0.34 mmol) was added, and the mixture was shaken for 2 days at room temperature. The mixture was purified by reverse-phase HPLC using an acetonitrile/water 0.1% TFA gradient elution method to afford the title compound as the TFA salt. 'H NMR (500 MHz, DMSO-d 6 ) 6 ppm 13.12 (s, 1 H) 8.32 (s, 1 H) 8.13 (s, 1 H) 8.05 (d, J=8.85, 1.22 30 Hz, 1 H) 7.92 (d, J=4.27 Hz, 1 H) 7.60 (d, J=8.54 Hz, 1 H) 7.37 (d, J=3.66 Hz, 1 H) 4.89 (s, 1 H) 2.78 - 2.94 (m,1 H) 1.73 - 1.83 (m, 2 H) 1.58 - 1.68 (m, 2 H) 1.45 - 1.53 (m,1 H) 1.16 1.29 (m, 2 H) 1.04 - 1.14 (in, 3 H). MS (ESI+) m/z 338.1 (M+H). 67 WO 2008/154241 PCT/US2008/065727 Example 37 N-cyclohexyl-2-(1H-indazol-5-yl)imidazo[1,2-a]pyridin-3-amine The title compound was prepared according to the procedure outlined in Example 36B, substituting 2-aminothiazole with 2-aminopyridine. H NMR (500 MHz, DMSO 5 d 6 ) 6 ppm 13.04 (s, 1 H) 8.57 (s, 1 H) 8.23 - 8.39 (in, 2 H) 8.11 (s, 1 H) 7.57 (d, J=8.54 Hz, 1 H) 7.46 (d, J=8.85 Hz, 1 H) 7.12 - 7.21 (in, 1 H) 6.88 (t, J=6.71 Hz, 1 H) 4.78 (d, J=5.80 Hz, 1 H) 2.78 - 2.91 (in, 1 H) 1.69 - 1.77 (in, J=10.98 Hz, 2 H) 1.57 - 1.67 (in, 2 H) 1.45 - 1.53 (in, 1 H) 1.21 - 1.34 (in, 2 H) 1.01 - 1.16 (in, 3 H). MS (ESI+) m/z 332.1 (M+H). 10 Example 38 N-cyclohexyl-2-(1H-indazol-5-yl)imidazo[1,2-a]pyrazin-3-amine The title compound was prepared according to the procedure outlined in Example 36B, substituting 2-aminothiazole with 2-aminopyrazine. H NMR (500 MHz, DMSO d 6 ) 6 ppm 13.12 (s, 1 H) 8.90 (d, J=1.22 Hz, 1 H) 8.61 (s, 1 H) 8.37 (d, J=4.58, 1.53 Hz, 1 H) 15 8.29 (d, J=8.70, 1.37 Hz, 1 H) 8.15 (s, 1 H) 7.85 (d, J=4.58 Hz, 1 H) 7.62 (d, J=8.85 Hz, 1 H) 5.05 (d, J=6.71 Hz, 1 H) 2.81 - 2.99 (in, 1 H) 1.70 - 1.77 (in, J=10.68 Hz, 2 H) 1.58 - 1.67 (in, 2 H) 1.47 (s, 1 H) 1.24 - 1.38 (in, 2 H) 1.00 - 1.16 (in, 3 H). MS (ESI+) m/z 333.1 (M+H)*. Example 39 20 5-[1-benzyl-4-(4-fluorophenyl)-1H-imidazol-5-yl]-1H-indazole Into a 20 mL scintillation vial was added 50.0 mg (0.34 mmol) of Example 36A. To the solid was added a 2.0 mL dimethylformamide solution containing 0.46 mmol (49 mg) of benzylamine and 50 mg of powdered activated 4A molecular sieves. The vial was then capped and heated at 60 'C for 4 hours on an orbital shaker. The vial was allowed to cool to 25 ambient temperature; and was uncapped. To the suspension was added 32 mg (0.23 mmol) of anhydrous potassium carbonate followed by 66 mg (0.23 mmol) c-(p-toluenesulfonyl)-4 fluorobenzylisonitrile. The vial was then capped and heated overnight at 60 C on a shaker. The vial was removed from the shaker; allowed to cool to ambient temperature; and the resulting suspension was filtered. The filtrate was evaporated under reduced pressure at 30 medium heat on a Savant Speed Vac. The crude residues were redissolved in 1:1 DMSO/methanol and purified by reverse-phase HPLC using an acetonitrile/water TFA gradient elution method to afford the title compound as the TFA salt. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 9.01 (s, 1 H) 8.12 (s, 1 H) 7.76 (s, 1 H) 7.60 (d, J=8.48 Hz, 2 H) 7.32 - 7.45 68 WO 2008/154241 PCT/US2008/065727 (in, 2 H) 7.09 - 7.30 (in, 6 H) 6.96 (d, J=6.61, 2.88 Hz, 2 H) 5.23 (s, 2 H). MS (DCI) m/z 369 (M+H)f. Example 40 5 N-f{3-[4-(4-fluorophenyl)-5-(1H-indazol-5-yl)-1H-imidazol-1-yl]propyl}-N,N-dimethylamine The title compound was prepared as a TFA salt according to the procedure outlined in Example 39 substituting benzylamine with N 1 ,N-dimethylpropane-1,3-diamine. 1 H NMR (300 MHz, DMSO-ds) a ppm 9.49 (s, 1 H) 8.88 (s, 1 H) 8.19 (s, 1 H) 7.94 (s, 1 H) 7.73 (d, J=8.81 Hz, 1 H) 7.29 - 7.44 (m, 3 H) 7.17 (t, J=8.98 Hz, 2 H) 4.01 (t, J=7.12 Hz, 2 H) 2.89 10 3.04 (in, J=10.51 Hz, 2 H) 2.68 (s, 3 H) 2.67 (s, 3 H) 1.87 - 2.02 (in, 2 H). MS (DCI) m/z 364 (M+H). Example 41 N-cyclohexyl-2-(1H-indazol-5-yl)imidazo[1,2-a]pyrimidin-3-amine 15 The title compound was prepared as a TFA salt according to the procedure outlined in Example 36B substituting pyrimidin-2-amine for thiazol-2-amine. 1H NMR (500 MHz, DMSO-d 6 ) S ppm 13.21 - 13.41 (m, 1 H) 9.07 (d, J=5.80 Hz, 1 H) 8.85 (d, J=3.05 Hz, 1 H) 8.51 (s, 1 H) 8.24 (s, 1 H) 8.14 (d, J=8.70, 1.37 Hz, 1 H) 7.73 (d, J=8.85 Hz, 1 H) 7.47 - 7.56 (in, 1 H) 5.25 - 5.41 (in, J=2.75 Hz, 1 H) 2.81 - 2.91 (in, J=10.53, 10.53 Hz, 1 H) 1.74 - 1.83 20 (m, 2 H) 1.56 - 1.66 (in, 2 H) 1.43 - 1.50 (m, 1 H) 1.24 (q, J=11.09 Hz, 2 H) 1.00 - 1.14 (m, 3 H). MS (ESI+) m/z 333.1 (M+H)f. Example 42 5-[4-(4-fluorophenyl)-1-(1-phenylethyl)-1H-imidazol-5-yl]-1H-indazole 25 The title compound was prepared according to the procedure outlined in Example 39 substituting 1 -phenylethanamine for benzylamine. H NMR (300 MHz, CDC 3 ) S ppm 8.04 (s, 1 H) 7.75 - 7.84 (in, 1 H) 7.35 - 7.55 (in, 4 H) 7.20 - 7.31 (in, 5 H) 6.76 - 7.01 (in, 4 H) 5.09 (q, J=7.12 Hz, 1 H) 1.82 (d, 3 H). MS (DCI) m/z 383 (M+H)f. 30 Example 43 2-(1H-indazol-5-yl)-N-isopropylimidazo[1,2-a]pyrimidin-3-amine Example 36A (42 mg, 0.287 mmol) and 2-aminopyrimidine (27 mg, 0.284 mmol) were combined with scandium triflate (7 mg, 0.0 14 mmol) in anhydrous methanol (2 mL) in 69 WO 2008/154241 PCT/US2008/065727 a 4 mL vial. The vial was sealed and shaken at ambient temperature for 30 minutes. Isopropyl isocyanide (27 mL, 0.286 mmol) was added and the mixture was shaken at ambient temperature overnight, followed by 40 0 C for 2 hours. The mixture was absorbed on silica gel and purified using silica gel chromatography eluting using a gradient of 0-5% methanol in 5 dichloromethane to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.08 (s, 1 H) 8.75 (d, J=6.95, 1.86 Hz, 1 H) 8.60 (s, 1 H) 8.31 (d, J=8.82, 1.36 Hz, 1 H) 8.20 (d, J=4.75 Hz, 1 H) 8.14 (s, 1 H) 7.60 (d, J=8.82 Hz, 1 H) 7.03 (d, J=6.78, 4.07 Hz, 1 H) 6.54 (d, J=4.75 Hz, 1 H) 4.86 (d, J=5.09 Hz, 1 H) 1.05 (d, J=6.10 Hz, 6 H). MS (ESI+) m/z 293.0 (M+H)y. 10 Example 44 4-(1H-indazol-5-yl)-N-phenyl-1,3-thiazol-2-amine Example 44A 15 tert-Butyl 5-bromo-1H-indazole-1-carboxylate 5-Bromoindazole (4.40 g, 22.3 mmol) and a catalytic amount of dimethylaminopyridine (-50 mg) were dissolved in dichloromethane (100 mL). Di-tert-butyl dicarbonate (5.43 g, 24.9 mmol) was added, and the mixture was stirred at ambient temperature overnight. The mixture was absorbed on silica gel and purified by silica gel 20 chromatography eluting with a gradient of 0-40% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 297.2 (M+H)*. Example 44B tert-Butyl 5-acetyl-1H-indazole-1-carboxylate 25 Example 44A (5.12 g, 17.2 mmol), tributyl (1-ethoxyvinyl) tin (7.0 mL, 20.7 mmol), and dichlorobis(triphenylphosphine)palladium(II) (672 mg, 0.957 mmol) were combined in toluene (85 mL). Nitrogen was bubbled into the mixture for 5 minutes, and the mixture was heated to 100 C in a sealed tube overnight. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 0-40% ethyl acetate in 30 hexanes to afford the title compound. MS (ESI+) m/z 283.0 (M+Na). Example 44C tert-Butyl 5-(2-bromoacetyl)-1H-indazole-1-carboxylate 70 WO 2008/154241 PCT/US2008/065727 Example 44B (1.60 g, 6.15 mmol) and pyridinium tribromide (1.98 g, 6.19 mmol) were combined in tetrahydrofuran and heated to 40 C for 2 hours. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 0 40% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 360.9 (M+Na). 5 Example 44D 4-(1H-indazol-5-yl)-N-phenyl-1,3-thiazol-2-amine Example 44C (71 mg, 0.208 mmol) and 1-phenyl-2-thiourea (33 mg, 0.217 mmol) were combined in ethanol (300 mL) in a 4 mL vial. The vial was shaken at 80 C overnight. 10 The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of methanol in dichloromethane (0-5%) to afford the title compound. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 13.08 (s, 1 H) 10.23 (s, 1 H) 8.32 (s, 1 H) 8.14 (s, 1 H) 7.93 (d, J=8.59, 1.53 Hz, 1 H) 7.75 (d, J=8.75, 1.07 Hz, 1 H) 7.58 (d, J=8.90 Hz, 1 H) 7.36 (d, J=8.59, 7.36 Hz, 1 H) 7.25 (s, 1 H) 6.92 - 7.02 (in, 1 H). MS (ESI+) m/z 292.9 (M+H)+. 15 Example 45 5-(2-methyl-1,3-thiazol-4-yl)-1H-indazole The title compound was prepared according to the procedure outlined in Example 44D substituting 1-phenyl-2-thiourea with thioacetamide. 1 H NMR (300 MHz, DMSO 20 d 6 ) 6 ppm 13.10 (s, 1 H) 8.34 (s, 1 H) 8.12 (s, 1 H) 7.94 (d, J=8.82, 1.70 Hz, 1 H) 7.85 (s, 1 H) 7.57 (d, J=8.82 Hz, 1 H) 2.73 (s, 3 H). MS (ESI+) m/z 215.9 (M+H). Example 46 N-ethyl-4-(1H-indazol-5-yl)-1,3-thiazol-2-amine 25 The title compound was prepared according to the procedure outlined in Example 44D substituting 1-phenyl-2-thiourea with ethylthiourea. 1H NMR (300 MHz, DMSO d 6 ) 6 ppm 13.04 (s, 1 H) 8.21 (s, 1 H) 8.09 (s, 1 H) 7.83 (d, J=8.65, 1.53 Hz, 1 H) 7.58 (t, J=5.43 Hz, 1 H) 7.51 (d, J=8.82 Hz, 1 H) 6.96 (s, 1 H) 3.22 - 3.34 (m, 2 H) 1.21 (t, J=7.29 Hz, 3 H). MS (ESI+) m/z 244.9 (M+H)+. 30 Example 47 N-benzyl-4-(1H-indazol-5-yl)-1,3-thiazol-2-amine The title compound was prepared according to the procedure outlined in Example 71 WO 2008/154241 PCT/US2008/065727 44D substituting 1-phenyl-2-thiourea with 1-benzyl-2-thiourea. H NMR (400 MHz, DMSO d 6 ) 6 ppm 13.02 (s, 1 H) 8.21 (s, 1 H) 8.12 (t, J=5.83 Hz, 1 H) 8.08 (s, 1 H) 7.83 (d, J=8.90, 1.53 Hz, 1 H) 7.50 (d, J=8.90 Hz, 1 H) 7.39 - 7.45 (in, 2 H) 7.35 (t, J=7.52 Hz, 2 H) 7.26 (t, J=7.21 Hz, 1 H) 6.97 (s, 1 H) 4.54 (d, J=5.83 Hz, 1 H). MS (ESI+) m/z 306.9 (M+H)*. 5 Example 48 4-(1H-indazol-5-yl)-1,3-thiazol-2-amine The title compound was prepared according to the procedure outlined in Example 44D substituting 1-phenyl-2-thiourea with thiourea. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 10 13.03 (s, 1 H) 8.17 (s, 1 H) 8.07 (s, 1 H) 7.81 (d, J=8.82, 1.36 Hz, 1 H) 7.50 (d, J=8.82 Hz, 1 H) 7.01 (s, 2 H) 6.92 (s, 1 H). MS (ESI+) m/z 216.9 (M+H)*. Example 49 4-(1H-indazol-5-yl)-N-(2-phenylethyl)-1,3-thiazol-2-amine 15 The title compound was prepared according to the procedure outlined in Example 44D substituting 1-phenyl-2-thiourea with 1-phenethylthiourea. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.03 (s, 1 H) 8.23 (s, 1 H) 8.09 (s, 1 H) 7.85 (d, J=8.65, 1.53 Hz, 1 H) 7.71 (t, J=5.43 Hz, 1 H) 7.51 (d, J=8.82 Hz, 1 H) 7.26 - 7.36 (in, 4 H) 7.18 - 7.26 (m, 1 H) 6.97 (s, 1 H) 3.47 - 3.59 (in, 1 H) 2.94 (t, J=7.44 Hz, 1 H). MS (ESI+) m/z 321.0 (M+H)*. 20 Example 50 N-benzyl-2-(1H-indazol-5-yl)imidazo[1,2-a]pyrimidin-3-amine The title compound was prepared according to the procedure outlined in Example 43 substituting benzylisocyanide for isopropyl isocyanide. 1 H NMR (300 MHz, DMSO 25 d 6 ) 6 ppm 13.10 (s, 1 H) 8.50 - 8.58 (m, 2 H) 8.39 (d, J=4.07, 2.03 Hz, 1 H) 8.25 (d, J=8.81, 1.36 Hz, 1 H) 8.13 (s, 1 H) 7.61 (d, J=8.81 Hz, 1 H) 7.24 (s, 5 H) 6.92 (d, J=6.78, 4.07 Hz, 1 H) 5.44 (t, J=6.27 Hz, 1 H) 4.13 (d, J=6.10 Hz, 2 H). MS (ESI+) m/z 341.0 (M+H). Example 51 30 N-butyl-2-(1H-indazol-5-yl)imidazo[1,2-a]pyrimidin-3-amine The title compound was prepared according to the procedure outlined in Example 43 substituting butylisocyanide for isopropyl isocyanide. 1 H NMR (300 MHz, DMSO-d 6 ) S ppm 13.09 (s, 1 H) 8.70 (d, J=6.78, 2.03 Hz, 1 H) 8.55 (s, 1 H) 8.44 (d, J=4.07, 2.03 Hz, 1 H) 8.25 72 WO 2008/154241 PCT/US2008/065727 (d, J=8.82, 1.36 Hz, 1 H) 8.14 (s, 1 H) 7.61 (d, J=8.82 Hz, 1 H) 7.03 (d, J=6.78, 4.07 Hz, 1 H) 4.90 (t, J=5.93 Hz, 1 H) 2.96 (s, 2 H) 1.49 (s, 2 H) 1.34 (s, 2 H) 0.82 (t, J=7.29 Hz, 3 H). MS (ESI+) m/z 307.0 (M+H)+. 5 Example 52 N-(4-chlorophenyl)-2-(1H-indazol-5-yl)imidazo[1,2-a]pyrimidin-3-amine The title compound was prepared according to the procedure outlined in Example 43 substituting 4-chlorophenylisocyanide for isopropyl isocyanide. 1 H NMR (500 MHz, DMSO-d 6 ) 6 ppm 13.12 (s, 1 H) 8.58 (dd, J=4.12, 1.98 Hz, 1 H) 8.46 (d, J=15.87 Hz, 2 H) 10 8.40 (dd, J=6.71, 1.83 Hz, 1 H) 8.06 - 8.16 (in, 2 H) 7.58 (d, J=8.85 Hz, 1 H) 7.18 (d, J=8.85 Hz, 2 H) 7.05 (dd, J=6.71, 3.97 Hz, 1 H) 6.57 (d, J=8.85 Hz, 2 H). MS (ESI+) m/z 361.0 (M+H)y. Example 53 15 2-(1H-indazol-5-yl)-N-(4-methoxyphenyl)imidazo[1,2-a]pyrimidin-3-amine The title compound was prepared according to the procedure outlined in Example 43 substituting 4-methoxyphenylisocyanide for isopropyl isocyanide. 1 H NMR (500 MHz, DMSO-d) S ppm 13.10 (s, 1 H) 8.56 (dd, J=3.97,2.14 Hz, 1 H) 8.47 (s, 1 H) 8.36 (dd, J=6.56, 1.98 Hz, 1 H) 8.15 (dd, J=8.70, 1.37 Hz, 1 H) 8.10 (s, 1 H) 7.99 (s, 1 H) 7.57 (d, 20 J=8.54 Hz, 1 H) 7.03 (dd, J=6.71, 4.27 Hz, 1 H) 6.76 (d, J=8.85 Hz, 2 H) 6.50 (d, J=8.85 Hz, 2 H) 3.63 (s, 3 H). MS (ESI+) m/z 357.4 (M+H)+. Example 54 2-(1H-indazol-5-yl)imidazo[1,2-a]pyrimidine 25 The title compound was prepared according to the procedure outlined in Example 44D substituting 2-aminopyrimidine for 1-phenyl-2-thiourea. 'H NMR (300 MHz, DMSO d 6 ) S ppm 13.13 (s, 1 H) 8.96 (dd, J=6.78, 2.03 Hz, 1 H) 8.51 (dd, J=4.41, 2.03 Hz, 1 H) 8.42 (s, 1 H) 8.36 (s, 1 H) 8.15 (s, 1 H) 8.01 (dd, J=8.82, 1.70 Hz, 1 H) 7.62 (d, J=8.48 Hz, 1 H) 7.04 (dd, J=6.61, 4.24 Hz, 1 H). MS (ESI+) m/z 236.1 (M+H)f. 30 Example 55 methyl N-[2-(1H-indazol-5-yl)imidazo[1,2-a]pyridin-3-yl]glycinate The title compound was prepared as a TFA salt according to the procedure outlined in 73 WO 2008/154241 PCT/US2008/065727 Example 36B substituting 2-aminopyridine for 2-aminothiazole and methyl 2-isocyanoacetate for cyclohexyl isocyanide. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 13.41 (s, 1 H) 8.90 (d, J=6.75 Hz, 1 H) 8.38 (s, 1 H) 8.27 (s, 1 H) 7.84 - 7.98 (m, 3 H) 7.77 (d, J=8.90 Hz, 1 H) 7.55 (td, J=6.75, 1.23 Hz, 1 H) 5.95 - 6.06 (m, 1 H) 3.87 (d, J=4.60 Hz, 2 H) 3.51 (s, 3 H). MS 5 (ESI+) m/z 340.1 (M+H)+. Example 56 N-benzyl-2-(1H-indazol-5-yl)imidazo[1,2-a]pyridin-3-amine The title compound was prepared according to the procedure outlined in Example 36B 10 substituting 2-aminopyridine for 2-aminothiazole and benzyl isocyanide for cyclohexyl isocyanide. The final product precipitated out of solution and was isolated after filtration. 1 H NMR (400 MHz, DMSO-d 6 ) d ppm 13.04 (s, 1 H) 8.49 (s, 1 H) 8.16 - 8.27 (m, 2 H) 8.09 (s, 1 H) 7.58 (d, J=8.90 Hz, 1 H) 7.44 (d, J=8.90 Hz, 1 H) 7.19 - 7.35 (m, 5 H) 7.13 (ddd, J=8.98, 6.67, 0.92 Hz, 1 H) 6.80 (td, J=6.75, 0.92 Hz, 1 H) 5.32 (t, J=6.14 Hz, 1 H) 4.12 (d, J=6.14 15 Hz, 2 H). MS (ESI+) m/z 322.1 (M+H). Example 57 N-(4-chlorophenyl)-2-(1H-indazol-5-yl)imidazo[1,2-a]pyridin-3-amine The title compound was prepared according to the procedure outlined in Example 36B 20 substituting 2-aminopyridine for 2-aminothiazole and 1-chloro-4-isocyanobenzene for cyclohexyl isocyanide. H NMR (400 MHz, DMSO-d 6 ) 6 ppm 13.06 (s, 1 H) 8.39 (s, 2 H) 8.05 - 8.14 (in, 2 H) 7.94 (d, J=6.75 Hz, 1 H) 7.62 (d, J=8.90 Hz, 1 H) 7.55 (d, J=8.59 Hz, 1 H) 7.28 - 7.34 (in, 1 H) 7.17 (d, J=8.90 Hz, 2 H) 6.88 - 6.96 (in, J=6.75, 6.75 Hz, 1 H) 6.53 (d, J=8.59 Hz, 2 H). MS (ESI+) m/z 360.0 (M+H)f. 25 Example 58 2-(1H-indazol-5-yl)-N-(4-methoxyphenyl)imidazo[1,2-a]pyridin-3-amine The title compound was prepared according to the procedure outlined in Example 36B substituting 2-aminopyridine for 2-aminothiazole and 1-isocyano-4-methoxybenzene for 30 cyclohexyl isocyanide. H NMR (400 MHz, DMSO-d 6 ) 6 ppm 13.04 (s, 1 H) 8.44 (s, 1 H) 8.14 (d, J=8.90, 1.23 Hz, 1 H) 8.06 (s, 1 H) 7.87 - 7.96 (in, 2 H) 7.59 (d, J=8.90 Hz, 1 H) 7.54 (d, J=8.59 Hz, 1 H) 7.24 - 7.33 (in, 1 H) 6.86 - 6.93 (m, J=6.75, 6.75 Hz, 1 H) 6.75 (d, J=9.21 Hz, 2 H) 6.47 (d, J=9.21 Hz, 2 H) 3.63 (s, 3 H). MS (ESI+) m/z 356.1 (M+H). 74 WO 2008/154241 PCT/US2008/065727 Example 59 tert-butyl 4-[4-(4-fluorophenyl)-5-(1H-indazol-5-yl)-1H-imidazol-1-yl]piperidine-1 carboxylate 5 The title compound was prepared according to the procedure outlined in Example 39 substituting tert-butyl 4-aminopiperidine-1-carboxylate for benzylamine. HNMR (400 MHz, DMSO-d 6 ) 6 ppm 13.32 (s, 1 H) 8.14 (s, 1 H) 8.01 (s, 1 H) 7.79 (s, 1 H) 7.68 (d, J=8.59 Hz, 2 H) 7.24 - 7.39 (in, 2 H) 6.97 (t, J=8.90 Hz, 2 H) 3.91 - 4.05 (in, 2 H) 3.71 - 3.84 (m, 1 H) 2.53 - 2.69 (m, 2 H) 1.76 - 1.94 (m, 4 H) 1.35 - 1.40 (m, 9 H). MS (DCI) m/z 462 10 (M+H)y. Example 60 3,5-bis(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazole 15 Example 60A tert-Butyl 5-bromo-3-iodo-1H-indazole-1-carboxylate To a solution of 5-bromoindazole (10 g, 50.75 mmol) in dimethylformamide (100 mL) was added KOH (10 g, 177.63 mmol). Over a period of 2 hours, iodine (20 g, 78.80 mmol) was added. The mixture was treated with a solution of Na 2

S

2 0 5 (20 g) in water (200 20 mL), extracted with ethyl acetate, washed with brine, dried over sodium sulfate and filtered, and the solvent was removed under reduced pressure. The solid was dissolved in dichloromethane (350 mL) and treated with di-tert-butyl dicarbonate (14.4 g, 65.98 mmol) and dimethylaminopyridine (10 mg, 0.08 mmol). The mixture was stirred for 20 minutes at room temperature and passed directly through a bed of silica gel to afford the title compound. 25 MS (DCI/NH 3 ) m/z 422.9 (M+H)f. Example 60B tert-butyl 5-bromo-3-phenyl-1H-indazole-1-carboxylate and tert-butyl 5-bromo-3-iodo-1H indazole- 1 -carboxylate 30 To a solution of Example 60A (2.1 g, 5 mmol) in toluene (10 mL) was added Pd(PPh 3

)

4 (173 mg, 0.15 mmol), a solution of Na 2

CO

3 (1.1 g, 10 mmol) in water (5 mL), and a solution of phenyl boronic acid (671 mg, 5.5 mmol) in methanol (3 mL). The mixture was stirred at room temperature for 5 days, quenched with water, extracted with ethyl acetate and 75 WO 2008/154241 PCT/US2008/065727 purified by silica gel chromatography eluting with 5% ethyl acetate / hexanes to afford the title compounds as a mixture. 1H NMR (500 MHz, DMSO-d 6 ) 6 ppm 8.28 (d, J=1.53 Hz, 1 H) 8.12 (d, J=8.85 Hz, 1 H) 7.97 - 8.04 (in, 3 H) 7.80 - 7.86 (in, 2 H) 7.75 (d, J=1.83 Hz, 1 H) 7.54 - 7.63 (in, 3 H) 1.68 (s, 9 H) 1.64 (s, 9 H). MS (ESI+) m/z 373.9 (M+H)*. 5 Example 60C tert-Butyl 3,5 -bis((trimethylsilyl)ethynyl)- 1 H-indazole- 1 -carboxylate and tert-butyl 5 -bromo 3 -((trimethylsilyl)ethynyl)- 1 H-indazole- 1 -carboxylate Example 60B (1 g, 2.55 mmol), dichlorobis(triphenylphosphine)palladium(II) (89 mg, 10 0.13 mmol), triethylamine (1.78 mL, 12.75 mmol), trimethylsilyl acetylene (0.432 mL, 3.06 mmol), and Cul (24 mg, 0.13 mmol) were combined in dimethylformamide (10 mL) and stirred at room temperature for 20 hours. The mixture was diluted with ethyl acetate, washed with water, and purified by silica gel chromatography to afford the title compounds. 1 H NMR (500 MHz, DMSO-d 6 ) 6 ppm 8.10 (d, J=8.85 Hz, 1 H) 8.07 (d, J=8.85 Hz, 1 H) 7.97 15 (d, J=1.83 Hz, 1 H) 7.84 (s, 1 H) 7.82 (dd, J=8.85, 1.83 Hz, 1 H) 7.71 (dd, J=8.54, 1.53 Hz, 1 H) 1.65 (s, 18 H) 0.33 (d, J=0.92 Hz, 18 H). Example 60D tert-butyl 3,5 -diethynyl- 1 H-indazole- 1 -carboxylate and tert-butyl 5 -bromo-3 -ethynyl- 1 H 20 indazole- 1 -carboxylate To a solution of Example 60C (350 mg, 0.85 mmol) in tetrahydrofuran (5mL) was added a IM solution of TBAF in tetrahydrofuran (2 mL, 2 mmol). After 10 minutes, the solvent was evaporated under reduced pressure and the crude mixture was purified by silica gel chromatography eluting with 5% ethyl acetate in hexanes to afford the title compounds. 25 1 H NMR (500 MHz, DMSO-d 6 ) S ppm 8.12 (d, J=7.93 Hz, 1 H) 8.07 (d, J=8.85 Hz, 1 H) 8.01 (d, J=1.53 Hz, 1 H) 7.90 (s, 1 H) 7.83 (dd, J=8.85, 1.83 Hz, 1 H) 7.74 (dd, J=8.85, 1.53 Hz, 1 H) 4.91 (s, 1 H) 4.90 (s, 1 H) 4.29 (s, 1 H) 1.66 (s, 9 H) 1.65 (s, 9 H). Example 60E 30 3,5-bis(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazole The title compound was prepared according to the procedure outlined in Example 3D substituting Example 60D for Example 3C. H NMR (500 MHz, DMSO-d 6 ) 6 ppm 13.35 (s, 1 H) 8.76 (s, 1 H) 8.71 (s, 1 H) 8.70 (s, 1 H) 7.92 (d, J=8.61, 1.28 Hz, 1 H) 7.64 (d, J=8.79 76 WO 2008/154241 PCT/US2008/065727 Hz, 1 H) 7.38 - 7.43 (in, 8 H) 7.33 - 7.37 (in, 2 H) 5.73 (s, 2 H) 5.66 (s, 2 H). MS (ESI+) m/z 433.2 (M+H)+. Example 61 5 5-(1-benzyl-1H-1,2,3-triazol-4-yl)-3-phenyl-1H-indazole Example 61A tert-Butyl 3-phenyl-5-((trimethylsilyl)ethynyl)-1H-indazole-1-carboxylate and tert-butyl 5 bromo-3-phenyl-1H-indazole-1-carboxylate 10 Example 60B (1 g, 2.55 mmol), dichlorobis(triphenylphosphine)palladium(II) (89mg, 0.13 mmol), triethylamine (1.78 mL, 12.75 mmol), trimethylsilyl acetylene (0.432 mL, 3.06 mmol), and Cul (24 mg, 0.13 mmol) were combined in dimethylformamide (10 mL) and stirred at room temperature for 20 hours. The mixture was diluted with ethyl acetate and purified by silica gel chromatography to afford the title compound. 1 H NMR (500 MHz, 15 DMSO-d 6 ) 6 ppm 8.29 (d, J=1.53 Hz, 1 H) 8.09 - 8.19 (in, 3 H) 7.96 - 8.03 (in, 4 H) 7.83 (dd, J=8.85, 1.83 Hz, 1 H) 7.72 (dd, J=8.85, 1.53 Hz, 1 H) 7.50 - 7.65 (in, 6 H) 1.68 (s, 18 H) 0.26 - 0.27 (in, 9 H). Example 61B 20 tert-Butyl 5-ethynyl-3-phenyl-1H-indazole-1-carboxylate and tert-butyl 5-bromo-3-phenyl 1 H-indazole- 1 -carboxylate The title compound was prepared according to the procedure outlined in Example 60D substituting Example 61A for Example 60C. 1H NMR (500 MHz, DMSO-d 6 ) S ppm 8.28 (d, J=1.53 Hz, 1 H) 8.21 (s, 1 H) 8.16 (d, J=8.54 Hz, 1 H) 8.12 (d, J=8.85 Hz, 1 H) 7.97 25 - 8.05 (in, 4 H) 7.83 (dd, J=8.85, 1.83 Hz, 1 H) 7.75 (dd, J=8.85, 1.53 Hz, 1 H) 7.53 - 7.64 (in, 6 H) 4.27 (s, 1 H) 1.68 (s, 9 H) 1.68 (s, 9 H). Example 61C 5 -(1 -benzyl- 1 H- 1,2,3-triazol-4-yl)-3-phenyl- 1 H-indazole 30 The title compound was prepared according to the procedure outlined in Example 3D substituting Example 61B for Example 3C. 1 H NMR (500 MHz, DMSO-d 6 ) 6 ppm 13.38 (s, 1 H) 8.77 (s, 1 H) 8.52 (s, 1 H) 8.06 (d, J=7.33 Hz, 2 H) 7.98 (d, J=8.79 Hz, 1 H) 7.69 (d, J=8.79 Hz, 1 H) 7.53 - 7.61 (m, J=7.51, 7.51 Hz, 2 H) 7.33 - 7.48 (in, 6 H) 5.68 (s, 2 H). MS 77 WO 2008/154241 PCT/US2008/065727 (ESI+) m/z 352.0 (M+H)f. Example 62 5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-amine 5 Example 62A 2-Fluoro-5-((trimethylsilyl)ethynyl)benzonitrile 5-Bromo-2-fluorobenzonitrile (5.01 g, 25.0 mmol), dichlorobis(triphenylphosphine)palladium(II) (652 mg, 0.929 mmol), and copper (I) iodide 10 (413 mg, 2.17 mmol) were combined in triethylamine (15 mL) under an atmosphere of nitrogen. Trimethylsilyl acetylene (4.2 mL, 29.7 mmol) was added and the mixture was heated to 100 C. The mixture solidified and was monitored by LC/MS. After completion, the mixture was diluted with methylene chloride and washed with 1 N HCl. The organic layer was absorbed on silica gel and purified by silica gel chromatography eluting with a 15 gradient of ethyl acetate in hexanes (5-45%) to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 5 ppm 8.09 (dd, J=6.10, 2.03 Hz, 1 H) 7.77 - 7.97 (in, 1 H) 7.54 (t, J=9.15 Hz, 1 H) 0.15 - 0.32 (m, 9 H). Example 62B 20 5-Ethynyl-2-fluorobenzonitrile Tetrabutylammonium fluoride (1.0 M solution in tetrahydrofuran, 70 mL) was added to a solution of Example 62A (5.05 g, 23.2 mmol) in tetrahydrofuran (50 mL) and allowed to stir for 20 minutes. The mixture was diluted with methylene chloride and washed with water. The organic layer was absorbed on silica gel and purified by silica gel chromatography 25 eluting with a gradient of 5-40% ethyl acetate in hexanes to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 8.13 (dd, J=6.27, 2.20 Hz, 1 H) 7.82 - 7.95 (m, 1 H) 7.56 (t, J=8.99 Hz, 1 H) 4.40 (s, 1 H). Example 62C 30 5-(1-Benzyl-1H-1,2,3-triazol-4-yl)-2-fluorobenzonitrile Example 62B (1.68 g, 11.6 mmol) was dissolved in tert-butanol (14 mL). Benzyl azide (2.14 g, 15.8 mmol) was added and the mixture was transferred to 14 microwave vials (1.0 mL each). Water (0.5 mL), a small piece of copper wire, and a 1 M solution of copper 78 WO 2008/154241 PCT/US2008/065727 (II) sulfate (0.5 mL) were added to each microwave vial and the vials were heated in a CEM Discover microwave at 125 C using 100 Watts for 10 minutes each. The vials were recombined, diluted with ethyl acetate, and washed with water and brine. The organic material was absorbed on silica gel and purified by silica gel chromatography eluting with a 5 gradient of 5-50% ethyl acetate in hexanes to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 8.73 (s, 1 H) 8.33 - 8.44 (in, 1 H) 8.19 - 8.32 (in, 1 H) 7.56 - 7.70 (in, 1 H) 7.28 - 7.47 (in, 5 H) 5.68 (s, 2 H). Example 62D 10 5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-amine Hydrazine hydrate (18 mL) was added to Example 62C (1.93 g, 6.94 mmoL) in ethanol (10 mL). The mixture was heated to 95 0 C overnight. The mixture was diluted with ethyl acetate and washed with water. Some of the product precipitated in the separatory funnel and was filtered to afford the title compound. The ethyl acetate layer was 15 concentrated under reduced pressure and the resulting solid was triturated with methanol to afford additional title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 11.43 (s, 1 H) 8.42 (s, 1 H) 8.21 (s, 1 H) 7.67 (d, J=8.82, 1.70 Hz, 1 H) 7.38 (s, 5 H) 7.26 (d, J=8.48 Hz, 1 H) 5.64 (s, 2 H) 5.38 (s, 2 H). MS (ESI+) m/z 291.0 (M+H)*. 20 Example 63 5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1-[(1-methylpiperidin-4-yl)carbonyl]-1H-indazol-3-amine Example 62D (44 mg, 0.152 mmol), 1-methylpiperdine-4-carboxylic acid hydrochloride (27 mg, 0.150 mmol), and HATU (61 mg, 0.160 mmol) were combined in tetrahydrofuran (2 mL). Diisopropylethylamine (110 mL, 0.631 mmol) was added and the 25 mixture was heated to 90 0 C for 30 minutes. The mixture was diluted with methylene chloride and washed with 1 N sodium hydroxide. The organic layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 5-15% methanol in dichloromethane to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 8.58 (s, 1 H) 8.47 (s, 1 H) 8.26 (d, J=8.48 Hz, 1 H) 7.97 (d, J=8.48, 1.70 Hz, 1 H) 7.38 (s, 5 H) 30 6.58 (s, 2 H) 5.67 (s, 2 H) 3.35 - 3.47 (in, 1 H) 2.95 (d, J=11.19 Hz, 2 H) 2.28 (s, 3 H) 2.03 2.20 (in, 2 H) 1.92 (s, 2 H) 1.77 (s, 2 H). MS (ESI+) m/z 416.2 (M+H). 79 WO 2008/154241 PCT/US2008/065727 Example 64 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-methoxyacetamide Example 64A 5 tert-Butyl 3-amino-5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazole-1-carboxylate Example 62D (1.80 g, 6.20 mmol) was suspended in methylene chloride (100 mL) with a catalytic amount of dimethylaminopyridine. A solution of di-tert-butyl dicarbonate (1.36 g, 6.23 mmol) in methylene chloride (50 mL) was added dropwise over 1 hour. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a 10 gradient of 0-5% methanol in dichloromethane to afford the title compound. MS (ESI+) m/z 391.1 (M+H)f. Example 64B N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-methoxyacetamide 15 Example 64A (45 mg, 0.115 mmol) was dissolved in methylene chloride (1.5 mL) and pyridine (0.5 mL). Methoxy acetyl chloride (18 uL, 0.197 mmol) was added and the mixture was stirred at ambient temperature for 2 hours. The solvents were removed using a warm stream of nitrogen, the mixture was injected on a silica gel column, and the product was purified by silica gel chromatography eluting with a gradient of 0-5% methanol in 20 dichloromethane to afford tert-butyl 5-(1 -benzyl- 1 H- 1,2,3-triazol-4-yl)-3-(2 methoxyacetamido)-1H-indazole-1-carboxylate (58 mg). The intermediate was dissolved in methylene chloride (2 mL) and trifluoroacetic acid (1 mL) and stirred at ambient temperature overnight. The solvents were removed under reduced pressure, and the mixture was purified by preparative HPLC on a C8 column using a gradient of 10% to 100% acetonitrile/water 25 containing 0.1% trifluoroacetic acid to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 12.79 (s, 1 H) 10.16 (s, 1 H) 8.59 (s, 1 H) 8.20 (s, 1 H) 7.83 (d, J=8.65, 1.53 Hz, 1 H) 7.51 (d, J=8.82 Hz, 1 H) 7.37 (s, 5 H) 5.64 (s, 2 H) 4.12 (s, 2 H) 3.42 (s, 3 H). MS (ESI+) m/z 363.0 (M+H)+. 30 Example 65 N -[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N 2

,N

2 -dimethylglycinamide Example 64A (81 mg, 0.207 mmol) was dissolved in methylene chloride (2 mL) and pyridine (0.5 mL). Dimethylaminoacetylchloride hydrochloride, 80% (120 mg, 0.607 mmol) 80 WO 2008/154241 PCT/US2008/065727 was added in three portions over 2 hours and the mixture was stirred at ambient temperature overnight. Trifluoroacetic acid (2 mL) was added and the mixture was stirred for 3 hours. The mixture was diluted with methylene chloride and washed with 1 N sodium hydroxide. The organic layer was absorbed on silica get and purified using silica gel chromatography 5 eluting with a gradient of 5-15% methanol in dichloromethane to afford the title compound. H NMR (300 MHz, DMSO-d 6 ) 6 ppm 12.77 (s, 1 H) 10.05 (s, 1 H) 8.58 (s, 1 H) 8.24 (s, 1 H) 7.82 (d, J=8.65, 1.53 Hz, 1 H) 7.50 (d, J=8.82 Hz, 1 H) 7.30 - 7.44 (m, 5 H) 5.64 (s, 2 H) 3.16 - 3.20 (m, 2 H) 2.34 (s, 6 H). MS (ESI+) m/z 376.1 (M+H)+. 10 Example 66 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]butanamide Example 64A (76 mg, 0.195 mmol) was dissolved in methylene chloride (2 mL) and pyridine (0.2 mL). Butyryl chloride (26 uL, 0.250 mmol) was added and the mixture was stirred at ambient temperature for 2 hours. Trifluoroacetic acid (1 mL) was added and the 15 mixture was stirred for 3 hours. The mixture was diluted with methylene chloride and washed with water. The organic layer was absorbed on silica gel and purified using silica gel chromatography eluting with a gradient of 1-8% methanol in dichloromethane to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) S ppm 12.70 (s, 1 H) 10.30 (s, 1 H) 8.57 (s, 1 H) 8.23 (s, 1 H) 7.81 (d, J=8.82 Hz, 1 H) 7.49 (d, J=8.82 Hz, 1 H) 7.37 (s, 5 H) 5.64 (s, 2 20 H) 2.39 (t, J=7.29 Hz, 2 H) 1.67 (s, 2 H) 0.97 (t, J=7.46 Hz, 3 H). MS (ESI+) m/z 361.1 (M+H)y. Example 67 5-[4-(4-fluorophenyl)-1-piperidin-4-yl-1H-imidazol-5-yl]-1H-indazole 25 The title compound was prepared according to the procedure outlined in Example 39 substituting piperidin-4-amine for benzylamine. H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.28 (s, 1 H) 8.14 (s, 1 H) 7.94 (s, 1 H) 7.78 (s, 1 H) 7.63 - 7.72 (in, 2 H) 7.21 - 7.43 (in, 2 H) 6.90 - 7.04 (m, 2 H) 4.14 (d, J=5.59, 1.86 Hz, 1 H) 3.53 - 3.74 (m, J=5.76 Hz, 1 H) 2.94 (d, J=12.21 Hz, 2 H) 2.21 - 2.35 (in, 2 H) 1.74 - 1.88 (m, 3 H). MS (DCI) m/z 362 (M+H). 30 Example 68 5-{4-(4-fluorophenyl)-1-[2-(1-methylpyrrolidin-2-yl)ethyl]-1H-imidazol-5-yl}-1H-indazole The title compound was prepared according to the procedure outlined in Example 39 81 WO 2008/154241 PCT/US2008/065727 substituting 2-(1-methylpyrrolidin-2-yl)ethanamine for benzylamine. H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.30 (s, 1 H) 8.14 (s, 1 H) 7.86 (s, 1 H) 7.82 (s, 1 H) 7.68 (d, J=8.48 Hz, 1 H) 7.24 - 7.47 (m, 3 H) 6.92 - 7.08 (in, 2 H) 3.83 (t, J=7.80 Hz, 2 H) 2.71 - 2.93 (in, 1 H) 1.88 - 2.01 (in, 3 H) 1.74 - 1.88 (m, 1 H) 1.00 - 1.83 (m, 7 H). MS (DCI) m/z 390 (M+H)*. 5 Example 69 5-{4-(4-fluorophenyl)-1-[3-(4-methylpiperazin-1-yl)propyl]-1H-imidazol-5-yl}-1H-indazole The title compound was prepared according to the procedure outlined in Example 39 substituting 3-(4-methylpiperazin-1-yl)propan-1-amine for benzylamine. H NMR (300 10 MHz, DMSO-d 6 ) 6 ppm 13.36 (s, 1 H) 8.13 (s, 1 H) 7.81 (s, 2 H) 7.67 (d, J=8.48 Hz, 1 H) 7.32 - 7.45 (in, 2 H) 7.27 (d, J=8.48, 1.36 Hz, 1 H) 6.87 - 7.06 (m, 2 H) 3.72 - 3.91 (in, 2 H) 1.92 - 2.21 (in, 10 H) 1.91 - 2.20 (s, 3 H) 1.51 - 1.66 (m, 2 H). MS (ESI+) m/z 419 (M+H)*. Example 70 15 ethyl 5-(1H-indazol-5-yl)isoxazole-3-carboxylate Example 3C (1.83 g, 12.9 mmol) was dissolved in toluene (60 mL) and triethylamine (2.2 mL) and warmed to 90 C. Ethyl 2-chloro-2-(hydroxyimino)acetate (1.89 g, 12.5 mmol) was dissolved in toluene (15 mL) and was added dropwise over 30 minutes. Following the addition, the mixture was diluted with ethyl acetate and washed with 1 N hydrochloric acid. 20 The organic layer was concentrated under reduced pressure and the resulting residue was triturated with methanol to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.38 (s, 1 H) 8.43 (s, 1 H) 8.23 (s, 1 H) 7.92 (d, J=8.82, 1.36 Hz, 1 H) 7.70 (d, J=8.82 Hz, 1 H) 7.44 (s, 1 H) 4.41 (q, J=7.12 Hz, 2 H) 1.35 (t, J=7.12 Hz, 3 H). MS (ESI+) m/z 257.9 (M+H)+. 25 Example 71 5-(1H-indazol-5-yl)-N-methylisoxazole-3-carboxamide Example 71A 30 5-(1H-indazol-5-yl)isoxazole-3-carboxylic acid Example 70 (1.50 g, 5.83 mmol) was dissolved in tetrahydrofuran (100 mL), methanol (10 mL), and water (10 mL). Potassium hydroxide (680 mg, 12.1 mmol) was added, and the mixture was stirred at ambient temperature for 2 hours. The solvents were 82 WO 2008/154241 PCT/US2008/065727 removed under reduced pressure, and the resulting residue was triturated with a mixture of 1 N hydrochloric acid and methanol to provide a solid that was filtered to afford the title compound. 'H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.37 (s, 1 H) 8.39 (s, 1 H) 8.22 (s, 1 H) 7.90 (dd, J=8.81, 1.36 Hz, 1 H) 7.69 (d, J=8.82 Hz, 1 H) 7.30 (s, 1 H). 5 Example 71B 5-(1H-indazol-5-yl)-N-methylisoxazole-3-carboxamide Example 71A (46 mg, 0.201 mmol), HATU (88 mg, 0.231 mmol), and diisopropylethylamine (133 uL, 0.764 mmol) were combined in tetrahydrofuran (2 mL). 10 Monomethylamine (40% solution in water) (50 uL) was added, and the reaction was stirred at 50 C for 2 hours. The mixture was diluted with methylene chloride and washed with 1 N sodium hydroxide, 1 N hydrochloric acid, and brine. The organic layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 10-50% ethyl acetate in hexanes to afford the title compound. 'H NMR (300 MHz, DMSO-ds) 6 ppm 15 13.36 (s, 1 H) 8.72 (q, J=4.30 Hz, 1 H) 8.39 (s, 1 H) 8.23 (s, 1 H) 7.89 (d, J=8.65, 1.53 Hz, 1 H) 7.69 (d, J=8.82 Hz, 1 H) 7.28 (s, 1 H) 2.80 (d, J=4.75 Hz, 3 H). MS (ESI+) m/z 243.0 (M+H)*. Example 72 20 5-(3-benzylisoxazol-5-yl)-1H-indazole Phenylacetaldehyde (90+ %) (266 mg, 2.38 mmol) was dissolved in tert-butanol (1 mL) and water (1 mL). Hydroxylamine hydrochloride (79 mg, 1.14 mmol) was added followed by a 6N solution of sodium hydroxide (19 uL, 31.7 mmol). The mixture was stirred for 30 minutes. Chloramine-T trihydrate (308 mg, 1.09 mmol) was added slowly over 5 25 minutes followed by the addition of copper (II) sulfate and a small piece of copper wire. Example 3C (154 mg, 1.08 mmol) was added and the mixture was stirred at 50'C for 2 hours then ambient temperature overnight. The mixture was diluted with methylene chloride and washed with water. The organic layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 10-50% ethyl acetate in hexanes to afford the title 30 compound. 'H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.31 (s, 1 H) 8.28 (s, 1 H) 8.18 (s, 1 H) 7.79 (dd, J=8.65, 1.53 Hz, 1 H) 7.64 (d, J=8.81 Hz, 1 H) 7.13 - 7.46 (in, 5 H) 6.83 (s, 1 H) 4.04 (s, 2 H). MS (ESI+) m/z 275.7 (M+H)+. 83 WO 2008/154241 PCT/US2008/065727 Example 73 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]benzamide Example 64A (72 mg, 0.184 mmol) was dissolved in methylene chloride (2 mL) and pyridine (0.2 mL). Benzoyl chloride (36 uL, 0.310 mmol) was added, and the mixture was 5 stirred at ambient temperature for 2 hours. Trifluoroacetic acid (1 mL) was added and the mixture was stirred for 3 hours. The mixture was diluted with methylene chloride and washed with water. The organic layer was absorbed on silica gel and purified using silica gel chromatography eluting with a gradient of 1-8% methanol in dichloromethane to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 12.88 (s, 1 H) 10.81 (s, 1 H) 8.63 (s, 10 1 H) 8.16 (s, 1 H) 8.06 - 8.13 (in, 2 H) 7.88 (d, J=8.82, 1.36 Hz, 1 H) 7.59 - 7.64 (in, J=7.12 Hz, 1 H) 7.51 - 7.59 (in, 3 H) 7.31 - 7.42 (in, 5 H) 5.63 (s, 2 H). MS (ESI+) m/z 395.1 (M+H)y. Example 74 15 5-(3-propylisoxazol-5-yl)-1H-indazole The title compound was prepared according to the procedure outlined in Example 72 substituting butyraldehyde for phenylacetaldehyde. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.31 (s, 1 H) 8.28 (s, 1 H) 8.20 (s, 1 H) 7.76 - 7.85 (in, 1 H) 7.63 - 7.70 (in, 1 H) 6.88 (s, 1 H) 2.63 (t, J=7.46 Hz, 2 H) 1.61 - 1.79 (in, 2 H) 0.96 (t, J=7.29 Hz, 3 H). MS (ESI+) m/z 20 228.0 (M+H)*. Example 75 N-benzyl-4-(1H-indazol-5-yl)-5-phenyl-1,3-thiazol-2-amine 25 Example 75A 1H-indazole-5-carboxylic acid The title compound was prepared according to the procedure outlined in Example 3A, substituting methyl 4-amino-3-methylbenzoate for 4-iodo-2-methylaniline. During the final workup, addition of 6 N HCl until pH 6 resulted in the formation of a solid, which was 30 filtered, washed twice with water and dried in vacuo to afford the title compound. H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.32 (s, 1 H) 12.83 (s, 1 H) 8.46 (s, 1 H) 8.24 (s, 1 H) 7.92 (dd, J=8.82, 1.70 Hz, 1 H) 7.60 (d, J=8.82 Hz, 1 H). 84 WO 2008/154241 PCT/US2008/065727 Example 75B N-Methoxy-N-methyl-1H-indazole-5-carboxamide To a suspension of Example 75A (1.6 g, 10 mmol) and N,O-dimethylhydroxylamine (1.1 g, 11 mmol) in dichloromethane (40 mL) and dimethylformamide (10 mL) was added 5 triethylamine (1.67 mL, 12 mmol) and EDC (2.1 g, 11 mmol), and the mixture was stirred at room temperature for 24 hours. The solvents were evaporated under reduced pressure, and the resulting residue was diluted with ethyl acetate and washed with water. The organic layer was dried over sodium sulfate and purified by silica gel column chromatography in ethyl acetate to afford the title compound. MS (ESI-) m/z 206.0 (M+H)+. 10 Example 75C 1-(1H-indazol-5-yl)-2-phenylethanone A solution of Example 75B (900 mg, 4.39 mmol) in tetrahydrofuran (10 mL) was cooled under argon with an ice bath and treated with a 2M solution of benzyl magnesium 15 chloride in tetrahydrofuran (6.6 mL, 13.16 mmol). The reaction was stirred overnight at room temperature followed by the addition of one more equivalent of benzyl magnesium chloride. The mixture was heated at 70 C for 9 hours. One more equivalent of benzylmagnesium chloride was added, and the reaction was heated at 70 C for another 90 minutes and was allowed to cool to room temperature. Aqueous saturated ammonium 20 chloride was added, and the product was extracted with ethyl acetate and purified by silica gel column chromatography using 30% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 237.1 (M+H). Example 75D 25 tert-Butyl 5-(2-phenylacetyl)-1H-indazole-1-carboxylate To a suspension of Example 75C (236 mg, 1 mmol) in dichloromethane (2 mL) was added di-tert-butyl dicarbonate (327 mg, 1.5 mmol) and a pinch of dimethylaminopyridine (~2 mg). The mixture was stirred for 15 minutes, and passed through a bed of silica gel and eluted with dichlormethane. The solvent was evaporated under reduced pressure to afford the 30 title compound. MS (ESI+) m/z 337.0 (M+H)+. Example 75E 2-Bromo-1-(1H-indazol-5-yl)-2-phenylethanone To a solution of Example 75D (336 mg, 1 mmol) in tetrahydrofuran (20 mL) heated at 85 WO 2008/154241 PCT/US2008/065727 40 C with an oil bath was added dropwise with an addition funnel a solution of pyridinium tribromide (352 mg, 1.1 mmol) in tetrahydrofuran (20 mL) over 10 minutes. The reaction mixture was heated for an extra 2 hours, and was cooled, filtered, and the filtrate was evaporated to afford the title compound. MS (ESI-) m/z 212.9 (M-H)-. 5 Example 75F N-benzyl-4-(1H-indazol-5-yl)-5-phenyl-1,3-thiazol-2-amine A vial containing Example 75E (50 mg, 0.16 mmol) and 1-benzylthiourea (26 mg, 0.16 mmol) in ethanol (1 mL) was capped and heated in a heater shaker at 80 0 C for 2 hours. 10 The solution of the crude product was purified by reverse-phase HPLC using an acetonitrile/water 0.1% TFA gradient elution method to afford the title compound as a TFA salt. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 12.99 (s, 1 H) 8.33 - 8.37 (in, 1 H) 8.01 (s, 1 H) 7.92 - 7.99 (in, 1 H) 7.82 (s, 1 H) 7.60 - 7.67 (in, J=7.83, 7.83 Hz, 1 H) 7.31 - 7.45 (m, 5 H) 7.17 - 7.30 (in, 5 H) 4.53 (d, J=4.60 Hz, 2 H). MS (ESI+) m/z 383.0 (M+H)+. 15 Example 76 4-(1H-indazol-5-yl)-N,5-diphenyl-1,3-thiazol-2-amine The title compound was prepared as a TFA salt according to the procedure outlined in Example 75F substituting 1 -phenylthiourea for 1-benzylthiourea. 1H NMR (400 MHz, 20 DMSO-d 6 ) 6 ppm 13.09 (s, 1 H) 10.29 (s, 1 H) 8.05 (d, J=0.92 Hz, 1 H) 7.89 (d, J=1.53, 0.92 Hz, 1 H) 7.69 (d, J=8.59, 1.23 Hz, 2 H) 7.47 (dt, J=8.59, 0.92 Hz, 1 H) 7.40 - 7.44 (in, 1 H) 7.26 - 7.37 (in, 7 H) 6.94 - 7.02 (m, J=7.36, 7.36 Hz, 1 H). MS (ESI+) m/z 369.0 (M+H)f. Example 77 25 5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazole Example 77A tert-butyl 5-(cyclopropylethynyl)-1H-indazole-1-carboxylate Example 44A (2.31 g, 7.77 mmol), cyclopropyl acetylene (620 mg, 9.37 mmol), 30 dichlorobis(triphenylphosphine)palladium(II) (170 mg, 0.242 mmol), and copper (I) iodide (92 mg, 0.483 mmol) were combined in triethylamine (10 mL) under an inert atmosphere of nitrogen. The mixture was heated to 100 0 C in a sealed tube for 4 hours. The mixture was diluted with methylene chloride and washed with 1 N hydrochloric acid. The organic layer 86 WO 2008/154241 PCT/US2008/065727 was absorbed onto silica gel and purified by silica gel chromatography eluting with a gradient of 5-50% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 283.0 (M+H)+. 5 Example 77B 5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazole Example 77A (145 mg, 0.51 mmol) and benzyl azide (82 mg, 0.62 mmol) were heated neat in a CEM-Discover microwave at 150 C and 150 Watts, for 10 minutes. The crude mixture was dissolved in dichloromethane and purified by silica gel column chromatography 10 using 50% ethyl acetate in hexanes as the eluent. H NMR (400 MHz, DMSO-d 6 ) 5 ppm 13.12 (s, 1 H) 8.11 (d, J=5.52 Hz, 2 H) 7.79 (d, J=8.59, 1.53 Hz, 1 H) 7.60 (d, J=8.59 Hz, 1 H) 7.26 - 7.45 (in, 5 H) 5.69 (s, 2 H) 1.78 - 1.92 (in, 1 H) 0.98 - 1.09 (m, 2 H) 0.31 - 0.45 (in, 2 H). MS (ESI+) m/z 316.0 (M+H)*. 15 Example 78 5-(1-benzyl-4-cyclopropyl-1H-1,2,3-triazol-5-yl)-1H-indazole The title compound was isolated as a by-product according to the procedure outlined in Example 77B. H NMR (500 MHz, DMSO-d 6 ) 6 ppm 13.29 (s, 1 H) 8.14 (s, 1 H) 7.80 (s, 1 H) 7.65 (d, J=8.85 Hz, 1 H) 7.29 (d, J=8.54, 1.53 Hz, 1 H) 7.21 - 7.27 (m, 3 H) 6.93 (d, 20 J=7.48, 1.98 Hz, 2 H) 5.49 (s, 2 H) 1.70 - 1.80 (in, 1 H) 0.81 - 0.92 (in, 4 H). MS (ESI+) m/z 316.0 (M+H)j. Example 79 2-(1H-indazol-5-yl)-3-phenylimidazo[1,2-a]pyrimidine 25 A vial containing Example 75E (80 mg, 0.25 mmol) and pyrimidin-2-amine (23 mg, 0.25 mmol) in ethanol (1 mL) was capped and heated in a heater shaker at 80 C for 21 hours. The solution of the crude product was purified by reverse-phase HPLC using an acetonitrile/water 0.1% TFA gradient elution method to afford the title compound. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 8.69 (dd, J=4.30, 1.84 Hz, 1 H) 8.59 (dd, J=6.75, 1.84 Hz, 1 H) 30 8.07 (s, 1 H) 8.02 (s, 1 H) 7.46 - 7.65 (in, 7 H) 7.16 (dd, J=6.75, 3.99 Hz, 1 H). MS (ESI+) m/z 312.0 (M+H). 87 WO 2008/154241 PCT/US2008/065727 Example 80 5-[1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol-4-yl]-1H-indazole Example 80A 5 4-(azidomethyl)tetrahydro-2H-pyran 4-(Iodomethyl)tetrahydro-2H-pyran (4.76 g, 21.1 mmol) was dissolved in dimethyl sulfoxide (25 mL). Sodium azide (2.70 g, 41.5 mmol) was added and the mixture was stirred at ambient temperature overnight. The resulting slurry was diluted with diethyl ether and washed with water. The organic layer was concentrated under reduced pressure to afford the 10 title compound. The product was used directly in subsequent reactions without characterization. Example 80B 5-[1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol-4-yl]-1H-indazole 15 Example 80A (122 mg, 0.864 mmol) and Example 3C (150 mg, 0.619 mmol) were combined in a microwave vial with tert-butanol (1 mL) and water (1 mL). A small piece of copper wire followed by copper(II) sulfate (5 mg, 0.02 mmol) was added, and the vial was stirred in a microwave (CEM-Discover) at 125 0 C at 100 W for 10 minutes. The mixture was diluted with methylene chloride and washed with 1 N hydrochloric acid. The organic layer 20 was absorbed onto silica gel and purified by silica gel chromatography eluting with a gradient of 0-5% methanol in dichloromethane to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.11 (s, 1 H) 8.53 (s, 1 H) 8.22 (s, 1 H) 8.12 (s, 1 H) 7.85 (d, J=8.48, 1.36 Hz, 1 H) 7.60 (d, J=8.82 Hz, 1 H) 4.32 (d, J=7.12 Hz, 2 H) 3.85 (d, J= 11.70, 2.54 Hz, 2 H) 3.21 - 3.36 (m, 2 H) 2.14 (s, 1 H) 1.47 (s, 2 H) 1.30 (s, 2 H). MS (ESI-) m/z 284.0 (M+H)f. 25 Example 81 5-[3-(piperidin-1-ylcarbonyl)isoxazol-5-yl]-1H-indazole Example 81A 30 5-(1H-indazol-5-yl)isoxazole-3-carboxylic acid Example 70 (1.50 g, 5.83 mmol) was dissolved in tetrahydrofuran (100 mL), methanol (10 mL), and water (10 mL). Potassium hydroxide (680 mg, 12.1 mmol) was added and the mixture was stirred at ambient temperature for 2 hours. The solvents were 88 WO 2008/154241 PCT/US2008/065727 removed under reduced pressure, and the resulting residue was triturated with a mixture of 1 N hydrochloric acid and methanol to provide a solid that was filtered to afford the title compound. 'H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.36 (s, 1 H) 8.41 (s, 1 H) 8.23 (s, 1 H) 7.91 (dd, J=8.82, 1.70 Hz, 1 H) 7.70 (d, J=8.82 Hz, 1 H) 7.36 (s, 1 H). 5 Example 81B 5-[3-(piperidin-1-ylcarbonyl)isoxazol-5-yl]-1H-indazole Example 81A (110 mg, 0.480 mmol), piperidine (55 uL, 0.556 mmol), and HATU (101 mg, 0.266 mmol) were combined in dimethylformamide (2 mL). 10 Diisopropylethylamine (133 uL, 0.764 mmol) was added and the reaction was stirred at 45 0 C for 2 hours. The mixture was diluted with ethyl acetate and washed with 1 N sodium hydroxide, 1 N hydrochloric acid, water (3 times), and brine. The organic layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 0-5% methanol in dichloromethane to afford the title compound. 1 H NMR (300 MHz, DMSO 15 d 6 ) 6 ppm 13.37 (s, 1 H) 8.34 - 8.40 (m, 1 H) 8.21 - 8.25 (in, 1 H) 7.84 - 7.91 (in, 1 H) 7.66 7.72 (in, 1 H) 7.20 (s, 1 H) 3.59 - 3.69 (in, 2 H) 3.48 - 3.58 (in, 2 H) 1.47 - 1.72 (m, 6 H). MS (ESI+) m/z 297.0 (M+H). Example 82 20 5-(1H-indazol-5-yl)-N-phenylisoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81B substituting aniline for piperidine. 1 H NMR (500 MHz, DMSO-d 6 ) 6 ppm 13.40 (s, 1 H) 10.74 (s, 1 H) 8.44 (s, 1 H) 8.25 (s, 1 H) 7.93 (d, J=8.85, 1.53 Hz, 1 H) 7.82 (d, J=7.63 Hz, 2 H) 7.72 (d, J=8.85 Hz, 1 H) 7.44 (s, 1 H) 7.35 - 7.42 (in, 2 H) 7.16 (t, J=7.32 Hz, 1 H). MS 25 (ESI+) m/z 304.9 (M+H)+. Example 83 N-cyclohexyl-5-(1H-indazol-5-yl)isoxazole-3-carboxamide Example 81A (53 mg, 0.231 mmol), cyclohexylamine (29 uL, 0.253 mmol), and 30 HATU (101 mg, 0.266 mmol) were combined in dimethyl formamide (2 mL). Diisopropylethylamine (133 uL, 0.764 mmol) was added, and the reaction was stirred at 45 C for 2 hours. The mixture was diluted with ethyl acetate and washed with 1 N sodium hydroxide, 1 N hydrochloric acid, water (3 times), and brine. The organic layer was absorbed 89 WO 2008/154241 PCT/US2008/065727 on silica gel and purified by silica gel chromatography eluting with a gradient of 0-5% methanol in dichloromethane to afford the title compound. 1 H NMR (300 MHz, DMSO d 6 ) 6 ppm 13.36 (s, 1 H) 8.58 (d, J=8.14 Hz, 1 H) 8.38 (s, 1 H) 8.22 (s, 1 H) 7.88 (d, J=8.81, 1.70 Hz, 1 H) 7.69 (d, J=8.81 Hz, 1 H) 7.28 (s, 1 H) 3.69 - 3.86 (m, 1 H) 1.77 (s, 4 H) 1.60 5 (d, J=12.21 Hz, 1 H) 1.20 - 1.46 (in, 4 H) 1.06 - 1.20 (in, 1 H). MS (ESI+) m/z 311.0 (M+H)y. Example 84 5-[3-(piperidin-1-ylmethyl)isoxazol-5-yl]-1H-indazole 10 Example 81B (22 mg, 0.0742 mmol) was dissolved in tetrahydrofuran (2.5 mL) under an inert atmosphere of nitrogen. Lithium aluminum hydride (1.0 M solution in tetrahydrofuran) (250 uL) was added and the mixture was heated to 70 0 C for 20 minutes. Methanol was added, and the mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of methanol in dichloromethane (0-7%) to afford the 15 title compound. 1 H NMR (400 MHz, DMSO-d 6 ) S ppm 13.30 (s, 1 H) 8.31 (s, 1 H) 8.20 (s, 1 H) 7.84 (d, J=8.59, 1.53 Hz, 1 H) 7.66 (d, J=8.59 Hz, 1 H) 6.92 (s, 1 H) 3.54 (s, 2 H) 2.32 2.46 (m, 2 H) 1.47 - 1.59 (in, 4 H) 1.33 - 1.46 (in, 2 H). MS (ESI+) m/z 283.0 (M+H)'. Example 85 20 [5-(1H-indazol-5-yl)isoxazol-3-yl]methanol Example 70 (84 mg, 0.366 mmol) was dissolved in tetrahydrofuran (8 mL). Lithium aluminum hydride (1.0 M solution in tetrahydrofuran) (3.0 mL) was added in 1.0 mL portions over 2 hours. After the final addition, the mixture was stirred for an additional 30 minutes. The mixture was diluted with methylene chloride and washed with water and the organic 25 layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 0-20% methanol in dichloromethane to afford the title compound. 1 H NMR (400 MHz, DMSO-d 6 ) S ppm 13.31 (s, 1 H) 8.31 (s, 1 H) 8.21 (s, 1 H) 7.83 (d, J=8.59, 1.53 Hz, 1 H) 7.67 (d, J=8.90 Hz, 1 H) 6.93 (s, 1 H) 5.51 (s, 1 H) 4.56 (d, J=2.45 Hz, 1 H). MS (ESI+) m/z 215.9 (M+H)f. 30 Example 86 5-(1H-indazol-5-yl)-N-(2-methoxyethyl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81B 90 WO 2008/154241 PCT/US2008/065727 substituting 2-methoxyethyl amine for piperidine. H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.36 (s, 1 H) 8.74 (t, J=4.92 Hz, 1 H) 8.39 (s, 1 H) 8.23 (s, 1 H) 7.89 (d, J=8.65, 1.53 Hz, 1 H) 7.69 (d, J=8.82 Hz, 1 H) 7.30 (s, 1 H) 3.38 - 3.53 (m, 4 H) 3.28 (s, 3 H). MS (ESI+) m/z 287.0 (M+H)f. 5 Example 87 5-(1-benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-1H-indazole Example 87A 10 1-(5-lodo-1H-indazol-1-yl)ethanone 4-Iodo-2-methylaniline (30.2 g, 130 mmol) was dissolved in chloroform (300 ml) and cooled to 5 C. Acetic anhydride (35 mL, 343 mmol) was added dropwise, and the mixture was allowed to warm to ambient temperature. Potassium acetate (4.21 g, 42.9 mmol) and isoamylnitrite (37 mL, 277 mmol) were added, and the mixture was heated to 70 C 15 overnight. The mixture was neutralized with saturated aqueous sodium bicarbonate and extracted with methylene chloride. The solvents were removed under reduced pressure and the resulting residue was triturated with methanol to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 8.41 (s, 1 H) 8.33 (s, 1 H) 8.05 - 8.21 (m, 1 H) 7.90 (dd, J=8.48, 1.70 Hz, 1 H) 2.71 (s, 3 H). 20 Example 87B 1-Benzyl-5-phenyl-4-(tributylstannyl)-1H-1,2,3-triazole Phenylethynyltri-n-butyltin (8.25 g, 21.1 mmol) and benzyl azide (2.3 mL, 18.4 mmol) were combined and heated to 150 C overnight. The mixture was purified by silica gel 25 chromatography eluting with a gradient of 5-40% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 526.3 (M+H)+. Example 87C 1-(5-(1-Benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-1H-indazol-1-yl)ethanone 30 Example 87A (139 mg, 0.486 mmol), Example 87B (284 mg, 0.542 mmol), dichlorobis(triphenylphosphine)palladium(II) (40 mg, 0.057 mmol) and copper thiophene-2 carboxylate (167 mg, 0.876 mmol) were combined in toluene (1.5 mL) in a microwave vial under an inert atmosphere of nitrogen. The vial was heated in a microwave (CEM-Discover) 91 WO 2008/154241 PCT/US2008/065727 to 150 0 C at 125 Watts for 20 minutes. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 5-40% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 394.1 (M+H)j. 5 Example 87D 5-(1-benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-1H-indazole Example 87C (95 mg, 0.242 mmol) was dissolved in tetrahydrofuran (2.0 mL), methanol (1.0 mL) and water (1.0 mL), and potassium hydroxide (64 mg, 1.14 mmol) was added. The mixture was stirred for 2 hours, and diluted with ethyl acetate and washed with 10 water. The organic layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 0-5% methanol in dichloromethane to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) S ppm 13.08 (s, 1 H) 8.00 (s, 1 H) 7.79 (s, 1 H) 7.44 - 7.56 (m, 5 H) 7.24 - 7.36 (m, 5 H) 6.95 - 7.03 (m, 2 H) 5.49 (s, 2 H). MS (ESI+) m/z 252.1 (M+H)f. 15 Example 88 5-(4-benzyl-1H-1,2,3-triazol-1-yl)-1H-indazole Example 87A (969 mg, 3.39 mmol), 3-phenyl-1-propyne (392 mg, 3.37 mmol), sodium azide (278 mg, 4.28 mmol), sodium ascorbate (68 mg, 3.43 mmol), sodium carbonate 20 (75 mg, 0.708 mmol), and L-proline (78 mg, 8.98 mmol) were combined in a 1:1 mixture of dimethyl sulfoxide and water (10 mL). Copper(II) sulfate pentahydrate (46 mg, 0.184 mmol) was added and the mixture was stirred at 65 C for 3 hours. 6N Sodium hydroxide (1 mL) was added, and the mixture was stirred for 30 minutes to deprotect the indazole. The mixture was diluted with ethyl acetate and washed with 1 N hydrochloric acid. The organic layer was 25 concentrated under reduced pressure, and the resulting residue was triturated with methanol. The remaining solids were absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 0-5% methanol in dichloromethane to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.35 (s, 1 H) 8.58 (s, 1 H) 8.17 - 8.27 (m, 1 H) 7.86 (d, J=8.82, 2.03 Hz, 1 H) 7.67 - 7.77 (in, 1 H) 7.27 - 7.36 (m, 2 H) 7.18 - 7.27 (m, 1 H) 4.10 30 (s, 1 H). MS (ESI+) m/z 276.0 (M+H)f. Example 89 5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-amine 92 WO 2008/154241 PCT/US2008/065727 Example 89A 5-(Cyclopropylethynyl)-2-fluorobenzonitrile 5-Bromo-2-fluorobenzonitrile (3.06 g, 15.3 mmol), dichlorobis(triphenylphosphine)palladium(II) (478 mg, 0.681 mmol), and copper(I) iodide 5 (165 mg, 0.866 mmol) were combined in triethylamine (15 mL) under an inert atmosphere of nitrogen. Cyclopropylacetylene (1.8 mL) was added, and the mixture was heated to 60 0 C until it turned to a black solid. The mixture was diluted with methylene chloride and washed with 1 N hydrochloric acid. The organic layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 5-40% ethyl acetate in hexanes to afford 10 the title compound. MS (ESI+) m/z 319.0 (M+H)+. Example 89B 5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-amine Example 89A (211 mg, 1.14 mmol) and benzyl azide (143 uL, 1.14 mmol) were 15 combined in a microwave (CEM-Discover) vial and heated to 160 0 C using 100 Watts for 26 minutes. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 20-60% ethyl acetate in hexanes to afford a mixture of inseparable triazole regiomers. The mixture of regiomers were treated with hydrazine hydrate (3.0 mL) and ethanol (3.0 mL) and heated to 90 0 C for 1 hour. The mixture was diluted with 20 methylene chloride and washed with water. The organic layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 1-6% methanol in dichloromethane to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 5 ppm 11.43 (s, 1 H) 8.07 (s, 1 H) 7.63 (d, J=8.65, 1.53 Hz, 1 H) 7.32 - 7.45 (m, 3 H) 7.24 - 7.32 (in, 3 H) 5.68 (s, 2 H) 5.40 (s, 2 H) 1.69 - 1.83 (in, 1 H) 0.98 - 1.08 (m, 2 H) 0.32 - 0.42 (in, 2 H). MS 25 (ESI+) m/z 331.1 (M+H)+. Example 90 5-(1-benzyl-4-cyclopropyl-1H-1,2,3-triazol-5-yl)-1H-indazol-3-amine The title compound was isolated as a by-product according to the procedure outlined 30 in Example 89B. H NMR (300 MHz, DMSO-d 6 ) 6 ppm 11.62 (s, 1 H) 7.79 (s, 1 H) 7.32 (d, J=8.48 Hz, 1 H) 7.20 - 7.27 (m, 3 H) 7.15 (d, J=8.65, 1.53 Hz, 1 H) 6.93 (d, J=7.12, 2.37 Hz, 2 H) 5.49 (s, 2 H) 5.45 (s, 2 H) 1.71 - 1.82 (m, 1 H) 0.80 - 0.89 (m, 4 H). MS (ESI+) m/z 331.1 (M+H)-'. 93 WO 2008/154241 PCT/US2008/065727 Example 91 5-(3-isobutylisoxazol-5-yl)-1H-indazol-3-amine 5 Example 91A 2-fluoro-5-(3-isobutylisoxazol-5-yl)benzonitrile The title compound was prepared according to the procedure outlined in Example 72 substituting isovaleraldehyde for phenylacetaldehyde and Example 62B for Example 3C. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 8.47 (dd, J=6.10, 2.03 Hz, 1 H) 8.19 - 8.29 (in, 1 H) 7.71 10 (t, J=8.99 Hz, 1 H) 7.08 (s, 1 H) 2.56 (d, J=7.12 Hz, 2 H) 1.86 - 2.10 (in, 1 H) 0.94 (d, J=6.78 Hz, 6 H). Example 91B 5-(3-isobutylisoxazol-5-yl)-1H-indazol-3-amine 15 To Example 91A (75 mg, 0.307 mmol) was added hydrazine hydrate (1.5 mL) in ethanol (1.0 mL). The mixture was heated to 70 C overnight in a sealed vial. The mixture was diluted with methylene chloride and washed with water. The organic layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 0-5% methanol in dichloromethane to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 20 ppm 11.67 (s, 1 H) 8.26 (s, 1 H) 7.66 (dd, J=8.82, 1.70 Hz, 1 H) 7.32 (d, J=8.48 Hz, 1 H) 6.67 (s, 1 H) 5.56 (s, 2 H) 2.51 - 2.58 (in, 2 H) 1.89 - 2.11 (in, 1 H) 0.95 (d, J=6.44 Hz, 6 H). MS (ESI+) m/z 257.0 (M+H)+. Example 92 25 5-(3-benzylisoxazol-5-yl)-1H-indazol-3-amine Example 92A 5-(3-benzylisoxazol-5-yl)-2-fluorobenzonitrile The title compound was prepared according to the procedure outlined in Example 72 30 substituting Example 62B for Example 3C. The crude product was used in the next step without further purification or characterization. Example 92B 94 WO 2008/154241 PCT/US2008/065727 5-(3-benzylisoxazol-5-yl)- 1H-indazol-3-amine To Example 92A (65 mg, 0.234 mmol) was added hydrazine hydrate (1.5 mL) in ethanol (1.0 mL). The mixture was heated to 70 C overnight in a sealed vial. The mixture was diluted with methylene chloride and washed with water. The organic layer was absorbed 5 on silica gel and purified by silica gel chromatography eluting with a gradient of 0-20% methanol in dichloromethane to afford the title compound. 1 H NMR (300 MHz, DMSO d 6 ) 6 ppm 11.67 (s, 1 H) 8.26 (s, 1 H) 7.66 (d, J=8.82, 1.70 Hz, 1 H) 7.32 (d, J=8.48 Hz, 1 H) 6.67 (s, 1 H) 5.56 (s, 2 H) 2.45 - 2.57 (m, 2 H) 1.91 - 2.08 (m, 1 H) 0.95 (d, J=6.44 Hz, 6 H). MS (ESI+) m/z 291.0 (M+H). 10 Example 93 N- {2-[4-(4-fluorophenyl)-5 -(1 H-indazol-5 -yl)- 1 H-imidazol- 1 -yl]ethyl} -N,N-dimethylamine The title compound was prepared according to the procedure outlined in Example 39 substituting 2-dimethylaminoethylamine for benzylamine. 1 H NMR (500 MHz, c) 6 ppm 15 13.28 (s, 1 H) 8.14 (s, 1 H) 7.78 - 7.87 (in, 2 H) 7.68 (d, J=8.54 Hz, 1 H) 7.33 - 7.41 (m, 2 H) 7.28 (d, J=8.54, 1.53 Hz, 1 H) 6.95 - 7.05 (in, 2 H) 3.86 (t, J=6.56 Hz, 2 H) 2.31 (t, J=6.71 Hz, 2 H) 2.00 (s, 6 H). Example 94 20 5-[4-(4-fluorophenyl)-1-(3-morpholin-4-ylpropyl)-1H-imidazol-5-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 39 substituting 3-morpholinopropylamine for benzylamine. 1H NMR (500 MHz, DMSO-d 6 /

D

2 0) 6 ppm 13.28 (s, 1 H) 8.14 (s, 1 H) 7.79 - 7.87 (m, 2 H) 7.68 (d, J=8.24 Hz, 1 H) 7.34 7.42 (m, 2 H) 7.28 (d, J=8.54, 1.53 Hz, 1 H) 6.92 - 7.03 (in, 2 H) 3.77 - 3.89 (m, 2 H) 3.24 25 3.30 (m, 4 H) 2.10 (t, J=6.56 Hz, 2 H) 1.96 - 2.05 (m, 4 H) 1.54 - 1.66 (m, 2 H). MS (ESI+) m/z 406.1 (M+H)f. Example 95 5-[4-(4-fluorophenyl)-1-(3-pyrrolidin-1-ylpropyl)-1H-imidazol-5-yl]-1H-indazole 30 The title compound was prepared according to the procedure outlined in Example 39 substituting 3-pyrrolidinopropylamine for benzylamine. 1H NMR (500 MHz, DMSO-d 6 /

D

2 0) 6 ppm 8.13 (d, J=0.92 Hz, 1 H) 7.79 - 7.85 (in, 2 H) 7.68 (d, J=8.54 Hz, 1 H) 7.38 (d, J=8.85, 5.49 Hz, 2 H) 7.27 (d, J=8.54, 1.53 Hz, 1 H) 6.99 (t, J=9.00 Hz, 2 H) 3.82 - 3.90 (m, 95 WO 2008/154241 PCT/US2008/065727 2 H) 2.21 (t, J=6.71 Hz, 2 H) 2.08 - 2.18 (m, 4 H) 1.56 - 1.65 (m, 2 H) 1.44 - 1.53 (m, 4 H). MS (ESI+) m/z 390.2 (M+H)+. Example 96 5 5- {4-(4-fluorophenyl)-1-[2-(4-methylpiperidin-1-yl)ethyl]-1H-imidazol-5-yl} -1H-indazole The title compound was prepared according to the procedure outlined in Example 39 substituting 2-(4-methylpiperidin- 1 -yl)ethanamine for benzylamine. IH NMR (500 MHz, DMSO-d 6 / D 2 0) 6 ppm 13.29 (s, 1 H) 8.14 (s, 1 H) 7.83 (s, 1 H) 7.81 (s, 1 H) 7.67 (d, J=8.54 Hz, 1 H) 7.32 - 7.40 (m, 2 H) 7.28 (dd, J=8.54, 1.53 Hz, 1 H) 6.93 - 7.04 (m, 2 H) 10 3.85 (t, J=6.56 Hz, 2 H) 2.60 (d, J=11.60 Hz, 2 H) 2.37 (t, J=6.56 Hz, 2 H) 1.71 - 1.85 (m, 2 H) 1.45 (d, J=11.29 Hz, 2 H) 1.15 - 1.30 (m, 1 H) 0.95 - 1.07 (in, 2 H) 0.83 (d, J=6.71 Hz, 3 H) MS (ESI+) m/z 404.1 (M+H)*. Example 97 15 5-[1-(1-benzylpiperidin-4-yl)-4-(4-fluorophenyl)-1H-imidazol-5-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 39 substituting 4-amino-N-benzylpiperidine for benzylamine. 1H NMR (500 MHz, DMSO-d 6 /

D

2 0) 6 ppm 13.32 (s, 1 H) 8.14 (s, 1 H) 8.02 (s, 1 H) 7.78 (s, 1 H) 7.69 (d, J=8.54 Hz, 1 H) 7.17 - 7.40 (m, 8 H) 6.97 (t, J=8.85 Hz, 2 H) 3.50 - 3.63 (m, 1 H) 3.40 (s, 2 H) 2.82 (d, 20 J=1 1.90 Hz, 2 H) 1.90 - 2.05 (m, 2 H) 1.72 - 1.89 (m, 4 H). MS (ESI+) m/z 452.2 (M+H)*. Example 98 5-[4-(4-fluorophenyl)-1-(2-morpholin-4-ylethyl)-1H-imidazol-5-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 39 25 substituting 2-morpholinoethylamine for benzylamine. 1H NMR (500 MHz, DMSO-d 6 /

D

2 0) 6 ppm 13.27 (s, 1 H) 8.14 (s, 1 H) 7.86 (s, 1 H) 7.81 (s, 1 H) 7.67 (d, J=8.54 Hz, 1 H) 7.33 - 7.42 (m, 2 H) 7.29 (d, J=8.54 Hz, 1 H) 6.95 - 7.06 (m, 2 H) 3.87 (t, J=6.41 Hz, 2 H) 3.42 - 3.51 (m, 4 H) 2.40 (t, J=6.56 Hz, 2 H) 2.21 (d, J=3.97 Hz, 4 H). MS (ESI+) m/z 392.1 (M+H)y. 30 Example 99 5-[1-(1-benzylpyrrolidin-3-yl)-4-(4-fluorophenyl)-1H-imidazol-5-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 39 96 WO 2008/154241 PCT/US2008/065727 substituting 3-pyrrlidinobenzylamine for benzylamine. H NMR (500 MHz, DMSO-d 6 /

D

2 0) 6 ppm 13.29 (s, 1 H) 8.13 (s, 1 H) 8.03 (s, 1 H) 7.76 (s, 1 H) 7.67 (d, J=8.54 Hz, 1 H) 7.29 - 7.38 (in, 6 H) 7.20 - 7.28 (in, 2 H) 6.98 (t, J=9.00 Hz, 2 H) 4.25 - 4.34 (in, 1 H) 3.53 3.69 (in, 2 H) 2.89 - 2.97 (in, 1 H) 2.84 (d, J=9.76, 3.05 Hz, 1 H) 2.55 (d, J=10.07, 6.71 Hz, 1 5 H) 2.17 - 2.34 (in, 2 H) 1.92 - 2.03 (in, 1 H). MS (ESI+) m/z 438.1 (M+H)+. Example 100 Example 100 has been removed and is not part of this document. 10 Example 101 2-{4-[4-(4-fluorophenyl)-5-(1H-indazol-5-yl)-1H-imidazol-1-yl]piperidin-1-yl}-2-oxoethanol The title compound was prepared according to the procedure outlined in Example 39 substituting 1-(4-aminopiperidin- 1 -yl)-2-hydroxyethanone for benzylamine. 1H NMR (300 MHz, DMSO-d 6 / D 2 0) 6 ppm 13.27 (s, 1 H) 8.14 (s, 1 H) 7.99 (s, 1 H) 7.81 (s, 1 H) 7.69 (d, 15 J=8.48 Hz, 1 H) 7.25 - 7.39 (in, 4 H) 6.91 - 7.03 (in, 2 H) 4.48 (t, J=5.43 Hz, 1 H) 4.34 - 4.44 (in, 1 H) 4.07 (t, J=5.59 Hz, 1 H) 3.79 - 3.91 (in, 1 H) 3.64 - 3.77 (in, 1 H) 2.85 (in, 1H) 2.77 - 2.90 (in, 5 H). MS (DCI) m/z 420 (M+H){. Example 102 20 5-(1-benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-amine Example 102A 5-(1-Benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-2-fluorobenzonitrile Example 87B (415 mg, 0.792 mmol), 5-bromo-2-fluorobenzonitrile (158 mg, 0.790 25 mmol), dichlorobis(triphenylphosphine)palladium(II) (52 mg, 0.074 mmol), and copper thiophene-2-carboxylate (226 mg, 1.19 mmol) were combined in toluene (2 mL) in a microwave vial under an inert atmosphere of nitrogen. The vial was heated in a microwave (CEM-Discover) to 150 C at 125 Watts for 20 minutes. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of ethyl acetate in 30 hexanes (5-40%) to afford the title compound. MS (ESI+) m/z 355.1 (M+H)*. Example 102B 5-(1-benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-amine 97 WO 2008/154241 PCT/US2008/065727 Example 102A (120 mg, 0.339 mmol) was treated with hydrazine hydrate (1.0 mL) in ethanol (1.0 mL) and heated to 60 C overnight. The mixture was diluted with methylene chloride and washed with water. The organic layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 0-5% methanol in dichloromethane to 5 afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 11.40 (s, 1 H) 8.06 (s, 1 H) 7.42 - 7.55 (m, 3 H) 7.23 - 7.33 (m, 5 H) 7.02 - 7.10 (m, 2 H) 6.94 - 7.02 (m, 2 H) 5.49 (s, 2 H) 5.34 (s, 2 H). MS (ESI+) m/z 367.1 (M+H)+. Example 103 10 2-[1-(1H-indazol-5-yl)-1H-1,2,3-triazol-4-yl]propan-2-ol The title compound was prepared according to the procedure outlined in Example 88 substituting 2-methyl-3-butyn-2-ol for 3-phenyl-1-propyne except that the crude reaction mixture was quenched with 2 mL of 1 N aqueous NaOH; and stirred for 1.5 hours at ambient temperature. The suspension was then dried by heated forced nitrogen gas evaporation prior 15 to extraction. 1H NMR (500 MHz, DMSO-d 6 / D 2 0) 6 ppm 8.51 (s, 1 H) 8.22 - 8.29 (m, 2 H) 7.88 (d, J=9.00, 1.98 Hz, 1 H) 7.77 (d, J=8.85 Hz, 1 H) 1.57 (s, 6 H). MS (ESI+) m/z 244.0 (M+H)*. Example 104 5-[4-(methoxymethyl)-1H-1,2,3-triazol-1-yl]-1H-indazole 20 The title compound was prepared according to the procedure outlined in Example 88 substituting methyl propargyl ether for 3-phenyl-1-propyne. H NMR (500 MHz, DMSO-d 6 /

D

2 0) 6 ppm 8.73 (s, 1 H) 8.23 - 8.29 (m, J=1.83 Hz, 2 H) 7.88 (d, J=8.85, 2.14 Hz, 1 H) 7.78 (d, J=9.15 Hz, 1 H) 4.57 (s, 2 H) 3.35 (s, 3 H). MS (ESI+) m/z 230.0 (M+H)+. 25 Example 105 1-[1-(1H-indazol-5-yl)-1H-1,2,3-triazol-4-yl]-1-phenylethanol The title compound was prepared according to the procedure outlined in Example 88 substituting 2-phenyl-3-butyn-2-ol for 3-phenyl-1-propyne. HNMR (500 MHz, DMSO-d 6 /

D

2 0) 6 ppm 8.52 (s, 1 H) 8.21 - 8.28 (in, 2 H) 7.87 (d, J=8.85, 2.14 Hz, 1 H) 7.76 (d, J=9.15 30 Hz, 1 H) 7.51 - 7.57 (m, 2 H) 7.34 (t, J=7.78 Hz, 2 H) 7.24 (t, J=7.32 Hz, 1 H) 1.92 (s, 3 H). MS (ESI+) m/z 306.0 (M+H). 98 WO 2008/154241 PCT/US2008/065727 Example 106 5-(4-propyl-1H-1,2,3-triazol-1-yl)-1H-indazole The title compound was prepared according to the procedure outlined in Example 88 substituting 1-pentyne for 3-phenyl-1-propyne. HNMR (500 MHz, DMSO-d 6 / D 2 0) 6 ppm 5 8.50 (s, 1 H) 8.20 - 8.30 (m, 2 H) 7.87 (d, J=9.00, 1.98 Hz, 1 H) 7.77 (d, J=8.85 Hz, 1 H) 2.71 (t, J=7.48 Hz, 2 H) 1.64 - 1.78 (in, 2 H) 0.97 (t, J=7.32 Hz, 3 H). MS (ESI+) m/z 228.0 (M+H)y. Example 107 10 1-[i-(1H-indazol-5-yl)-1H-1,2,3-triazol-4-yl]propan-2-ol The title compound was prepared according to the procedure outlined in Example 88 substituting pent-4-yn-2-ol for 3-phenyl-1-propyne. H NMR (500 MHz, DMSO-d 6 / D 2 0) 6 ppm 8.49 (s, 1 H) 8.20 - 8.33 (m, 2 H) 7.88 (dd, J=9.00, 1.98 Hz, 1 H) 7.74 - 7.82 (m, 1 H) 3.95 - 4.08 (m, 1 H) 2.74 - 2.89 (m, 2 H) 1.16 (d, J=6.10 Hz, 3 H). MS (ESI+) m/z 244.0 15 (M+H)y. Example 108 3-[1-(1H-indazol-5-yl)-1H-1,2,3-triazol-4-yl]propan-1-ol The title compound was prepared according to the procedure outlined in Example 88 20 substituting 4-pentyn-1-ol for 3-phenyl-1-propyne. H NMR (500 MHz, DMSO-d 6 / D 2 0) 6 ppm 8.50 (s, 1 H) 8.28 (s, 1 H) 8.23 (d, J=1.83 Hz, 1 H) 7.83 - 7.91 (m, 1 H) 7.74 - 7.82 (m, 1 H) 4.50 (t, J=6.41 Hz, 1 H) 3.51 (t, J=6.41 Hz, 2 H) 2.77 (t, J=7.63 Hz, 2 H) 1.80 - 1.90 (m, 2 H)MS (ESI+) m/z 244.0 (M+H)*. 25 Example 109 1-{[1-(1H-indazol-5-yl)-1H-1,2,3-triazol-4-yl]methyl}-1H-1,2,3-benzotriazole The title compound was prepared according to the procedure outlined in Example 88 substituting 1-propargyl-1H-benzotriazole for 3-phenyl-1-propyne. 1 H NMR (500 MHz, DMSO-d 6 / D 2 0) 6 ppm 8.91 (s, 1 H) 8.21 - 8.29 (m, 2 H) 8.07 (d, J=8.54 Hz, 1 H) 7.99 (d, 30 J=8.54 Hz, 1 H) 7.84 (d, J=9.00, 1.98 Hz, 1 H) 7.72 - 7.81 (in, 1 H) 7.57 - 7.65 (m, 1 H) 7.41 - 7.52 (m, 1 H) 6.16 (s, 2 H). MS (ESI-) m/z 315.0 (M-H)-. 99 WO 2008/154241 PCT/US2008/065727 Example 110 5- {4-[(phenylthio)methyl]-1H-1,2,3-triazol-1-yl}-1H-indazole The title compound was prepared according to the procedure outlined in Example 88 substituting phenyl propargyl sulfide for 3-phenyl-1-propyne. H NMR (500 MHz, DMSO 5 d 6 / D 2 0) 6 ppm 8.59 (s, 1 H) 8.26 (s, 1 H) 8.21 (d, J=1.22 Hz, 1 H) 7.80 - 7.86 (m, 1 H) 7.72 - 7.79 (m, 1 H) 7.43 (d, J=8.39, 1.37 Hz, 2 H) 7.35 (t, J=7.78 Hz, 2 H) 7.22 (t, J=7.32 Hz, 1 H) 4.38 (s, 2 H). MS (ESI+) m/z 308.3 (M+H)+. Example 111 10 5-(4-cyclopropyl-1H-1,2,3-triazol-1-yl)-1H-indazole The title compound was prepared according to the procedure outlined in Example 88 substituting cyclopropylacetylene for 3-phenyl-1-propyne. H NMR (500 MHz, DMSO-d 6 /

D

2 0) 6 ppm 8.46 (s, 1 H) 8.25 (s, 1 H) 8.20 (d, J=1.53 Hz, 1 H) 7.84 (d, J=9.00, 1.98 Hz, 1 H) 7.76 (d, J=8.85 Hz, 1 H) 1.97 - 2.14 (m, 1 H) 0.93 - 1.06 (m, 2 H) 0.77 - 0.91 (m, 2 H). 15 MS (ESI+) m/z 226.0 (M+H)*. Example 112 5-[4-(2-phenylethyl)-1H-1,2,3-triazol-1-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 88 20 substituting 1 -phenyl- 1 -butyne for 3 -phenyl- 1 -propyne. The product was a 1:1 mixture of starting material and title compound. 1H NMR (500 MHz, DMSO-d 6 / D 2 0) 6 ppm 8.48 (s, 1 H) 8.25 (s, 1 H) 8.21 (d, J=1.53 Hz, 1 H) 8.06 (s, 1 H) 7.81 - 7.89 (m, 1 H) 7.73 - 7.80 (m, 1 H) 7.61 (dd, J=8.85, 1.53 Hz, 1 H) 7.45 (d, J=8.54 Hz, 1 H) 7.25 - 7.36 (m, 4 H) 7.17 - 7.25 (m, 1 H) 3.04 (s, 4 H). MS (ESI+) m/z 290.1 (M+H)+. 25 Example 113 5-[4-(cyclohexylmethyl)-1H-1,2,3-triazol-1-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 88 substituting 3-cyclohexyl-1-propyne for 3-phenyl-1-propyne. H NMR (50O MHz, DMSO-d 6 30 / D 2 0) 6 ppm 8.49 (s, 1 H) 8.21 - 8.29 (m, 2 H) 7.88 (d, J=9.00, 1.98 Hz, 1 H) 7.77 (d, J=8.85 Hz, 1 H) 2.61 (d, J=6.71 Hz, 2 H) 1.54 - 1.77 (m, 6 H) 1.08 - 1.30 (m, 3 H) 0.91 - 1.05 (m, 2 H). MS (ESI+) m/z 282.2 (M+H)+. 100 WO 2008/154241 PCT/US2008/065727 Example 114 5-(4-cyclopentyl-1H-1,2,3-triazol-1-yl)-1H-indazole The title compound was prepared according to the procedure outlined in Example 88 substituting cyclopentylacetylene for 3-phenyl-1-propyne. HNMR (500 MHz, DMSO-d 6 / 5 D 2 0) 6 ppm 8.52 (s, 1 H) 8.19 - 8.30 (m, 2 H) 7.88 (d, J=9.00, 1.98 Hz, 1 H) 7.77 (d, J=8.85 Hz, 1 H) 3.13 - 3.27 (m, 1 H) 1.98 - 2.15 (m, 2 H) 1.57 - 1.84 (m, 6 H). MS (ESI+) m/z 254.0 (M+H)f. Example 115 10 1-[1-(1H-indazol-5-yl)-1H-1,2,3-triazol-4-yl]cyclohexanol The title compound was prepared according to the procedure outlined in Example 88 substituting 1-ethynyl-1-cyclohexanol for 3-phenyl-1-propyne. 1 H NMR (500 MHz, DMSO d 6 / D 2 0) 6 ppm 8.52 (s, 1 H) 8.21 - 8.30 (m, J=1.53 Hz, 2 H) 7.89 (dd, J=9.00, 1.98 Hz, 1 H) 7.77 (d, J=8.85 Hz, 1 H) 2.16 - 2.46 (m, 1 H) 1.92 - 2.05 (m, 2 H) 1.77 - 1.86 (m, 2 H) 1.61 15 1.77 (m, 2 H) 1.51 - 1.59 (m, 1 H) 1.42 - 1.51 (m, 2 H) 1.28 - 1.40 (m, J=9.92,2.90 Hz, 1 H)MS (ESI+) m/z 284.0 (M+H)+. Example 116 5-[4-(phenoxymethyl)-1H-1,2,3-triazol-1-yl]-1H-indazole 20 The title compound was prepared according to the procedure outlined in Example 88 substituting phenyl propargyl ether for 3-phenyl-1-propyne. H NMR (500 MHz, DMSO-d 6 /

D

2 0) 6 ppm 8.87 (s, 1 H) 8.22 - 8.34 (m, 2 H) 7.89 (d, J=8.85, 1.83 Hz, 1 H) 7.79 (d, J=9.15 Hz, 1 H) 7.29 - 7.41 (m, 2 H) 7.09 (d, J=7.63 Hz, 2 H) 6.99 (t, J=7.32 Hz, 1 H) 5.25 (s, 2 H). MS (ESI+) m/z 292.0 (M+H)+. 25 Example 117 5-{4-[(1,1-dioxidothiomorpholin-4-yl)methyl]-1H-1,2,3-triazol-1-yl}-1H-indazole The title compound was prepared according to the procedure outlined in Example 88 substituting N-propargyl thiomorpholine-sulfone for 3-phenyl-1-propyne. H NMR (500 30 MHz, DMSO-d 6 / D 2 0) 6 ppm 8.81 (s, 1 H) 8.24 - 8.36 (m, 2 H) 7.89 (d, J=9.00, 1.98 Hz, 1 H) 7.80 (d, J=9.15 Hz, 1 H) 4.38 (s, 2 H) 3.30 - 3.56 (m, J=39.36 Hz, 8 H). MS (ESI+) m/z 332.9 (M+H)f. 101 WO 2008/154241 PCT/US2008/065727 Example 118 5-[4-(3-phenylpropyl)-1H-1,2,3-triazol-1-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 88 substituting 1-phenyl-1-pentyne for 3-phenyl-1-propyne. 1 H NMR (500 MHz, DMSO-d 6 / 5 D 2 0) 6 ppm 8.52 (s, 1 H) 8.26 (s, 1 H) 8.23 (d, J=1.53 Hz, 1 H) 7.87 (d, J=9.00, 1.98 Hz, 1 H) 7.76 (d, J=9.15 Hz, 1 H) 7.31 (t, J=7.32 Hz, 2 H) 7.23 - 7.28 (m, 2 H) 7.20 (t, J=7.32 Hz, 1 H) 2.74 (t, J=7.63 Hz, 2 H) 2.65 - 2.72 (m, 2 H) 1.95 - 2.05 (in, 2 H). MS (ESI+) m/z 304.2 (M+H)+. 10 Example 119 [1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazol-5-yl](phenyl)methanone Example 119A tert-Butyl 5-ethynyl-1H-indazole-1-carboxylate 15 To a solution of Example 3C (230 mg, 1.62 mmol) in dichloromethane (10 mL) was added di-tert-butyl dicarbonate (459 mg, 2.1 mmol) and a pinch of dimethylaminopyridine (-3 mg), and the mixture was stirred fro 30 minutes at room temperature. Water was added, and the product was extracted with dichloromethane, dried over sodium sulfate, filtered, and the solvent was evaporated under reduced pressure to afford the title compound. MS (ESI+) 20 m/z 265.0 (M+Na)+. Example 119B [1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazol-5-yl](phenyl)methanone A vial under argon containing Example 119A (90 mg, 0.37 mmol), benzyl azide 25 (0.047 mL, 0.37 mmol), tetrahydrofuran (3 mL), triethylamine (0.062 mL, 0.44 mmol), Cul (71 mg, 0.37 mmol) and benzoyl chloride (0.059 mL, 0.51 mmol) was capped and shaken for 16 hours. The solvents were evaporated, and the product was purified by silica gel column chromatography in 5-30% ethyl acetate in hexanes. The crude material was treated with TFA (0.5 mL) in dichloromethane (1 mL) and purified by reverse-phase HPLC using an 30 acetonitrile/water 0.1% TFA gradient elution method to afford the title compound. 'H NMR (500 MHz, DMSO-d 6 / D 2 0) 6 ppm 13.08 (s, 1 H) 7.98 (s, 1 H) 7.77 (s, 1 H) 7.54 (d, J=8.24, 1.22 Hz, 2 H) 7.43 - 7.48 (in, 1 H) 7.33 - 7.40 (in, 2 H) 7.22 - 7.30 (in, 5 H) 7.17 - 7.21 (in, 2 H) 5.74 (s, 2 H). MS (ESI+) m/z 380.1 (M+H)+. 102 WO 2008/154241 PCT/US2008/065727 Example 120 N,N-diethyl-N-{[1-(1H-indazol-5-yl)-1H-1,2,3-triazol-4-yl]methyl}amine The title compound was prepared according to the procedure outlined in Example 88 substituting 1,1-diethylpropargylamine for 3-phenyl-1-propyne. H NMR (300 MHz, 5 DMSO-d 6 ) 6 ppm 8.98 (s, 1 H) 8.30 (d, J=1.36 Hz, 1 H) 8.27 (s, 1 H) 7.85 - 7.93 (m, 1 H) 7.75 - 7.83 (m, 1 H) 4.53 (d, J=4.07 Hz, 2 H) 3.11 - 3.23 (m, 4 H) 1.31 (t, J=7.12 Hz, 6 H). MS (ESI+) m/z 271.0 (M+H)+. Example 121 10 ethyl N-[2-(1H-indazol-5-yl)imidazo[1,2-a]pyrimidin-3-yl]-beta-alaninate The title compound was prepared according to the procedure outlined in Example 43 substituting ethyl isocyanopropionate for isopropyl isocyanide. 1 H NMR (300 MHz, DMSO d 6 ) 6 ppm 13.09 (s, 1 H) 8.71 (d, J=6.78, 2.03 Hz, 1 H) 8.54 (s, 1 H) 8.46 (d, J=4.24, 1.87 Hz, 1 H) 8.23 (d, J=8.82, 1.36 Hz, 1 H) 8.14 (s, 1 H) 7.61 (d, J=8.82 Hz, 1 H) 7.05 (d, J=6.78, 15 4.07 Hz, 1 H) 5.03 (t, J=5.93 Hz, 1 H) 3.96 (q, J=7.12 Hz, 2 H) 3.23 (q, J=6.22 Hz, 2 H) 2.47 - 2.55 (m, 2 H) 1.08 (t, J=7.12 Hz, 3 H). MS (ESI+) m/z 351.1 (M+H). Example 122 5-(1-benzyl-5-methyl-1H-1,2,3-triazol-4-yl)-1H-indazole 20 Example 122A 1-Benzyl-5-methyl-4-(tributylstannyl)-1H-1,2,3-triazole Tributyl(1-propynyl)tin (3.87 g, 11.8 mmol) and benzyl azide (2.2 mL, 17.6 mmol) were combined and heated to 150 0 C overnight. The mixture was purified by silica gel 25 chromatography eluting with a gradient of 5-40% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 464.2 (M+H)+. Example 122B 1-(5-(1-Benzyl-5-methyl-1H-1,2,3-triazol-4-yl)-1H-indazol-1-yl)ethanone 30 Example 87A (235 mg, 0.821 mmol), Example 122A (380 mg, 0.822 mmol), dichlorobis(triphenylphosphine)palladium(II) (60 mg, 0.085 mmol), and copper thiophene-2 carboxylate (325 mg, 1.23 mmol) were combined in toluene (2.0 mL) in a microwave vial under an inert atmosphere of nitrogen. The vial was heated in a microwave (CEM-Discover) 103 WO 2008/154241 PCT/US2008/065727 to 150 C at 125 Watts for 20 minutes. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 5-40% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 332.2 (M+H)+. 5 Example 122C 5-(1-benzyl-5-methyl-1H-1,2,3-triazol-4-yl)-1H-indazole Example 122B (109 mg, 0.329 mmol) was dissolved in tetrahydrofuran (3.0 mL) and water (0.5 mL), and potassium hydroxide (53 mg, 0.945 mmol) was added. The mixture was stirred for 2 hours, diluted with ethyl acetate, and washed with water. The organic layer was 10 absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 0 5% methanol in dichloromethane to afford the title compound. 1 H NMR (300 MHz, DMSO d 6 ) 6 ppm 13.13 (s, 1 H) 8.12 (s, 1 H) 8.01 (s, 1 H) 7.71 - 7.78 (m, 1 H) 7.59 - 7.66 (in, 1 H) 7.31 - 7.45 (in, 3 H) 7.23 - 7.29 (m, 2 H) 5.65 (s, 2 H) 2.43 (s, 3 H). MS (ESI+) m/z 290.1 (M+H)+. 15 Example 123 5-(1-benzyl-5-methyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-amine Example 123A 20 5-(1-Benzyl-5-methyl-iH-1,2,3-triazol-4-yl)-2-fluorobenzonitrile Example 122A (415 mg, 0.792 mmol), 5-bromo-2-fluorobenzonitrile (158 mg, 0.790 mmol), dichlorobis(triphenylphosphine)palladium(II) (52 mg, 0.074 mmol), and copper thiophene-2-carboxylate (226 mg, 1.19 mmol) were combined in toluene (2 mL) in a microwave vial under an inert atmosphere of nitrogen. The vial was heated in a microwave 25 (CEM-Discover) at 150 0 C at 125 Watts for 20 minutes. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 5-40% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 293.0 (M+H). 30 Example 123B 5-(1-benzyl-5-methyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-amine Example 123A (120 mg, 0.339 mmol) was treated with hydrazine hydrate (1.0 mL) in ethanol (1.0 mL) and heated to 60 0 C overnight. The mixture was diluted with methylene 104 WO 2008/154241 PCT/US2008/065727 chloride and washed with water. The organic layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of methanol in dichloromethane (0-5%) to afford the title compound. 'H NMR (300 MHz, DMSO-d 6 ) 6 ppm 11.43 (s, 1 H) 7.98 (s, 1 H) 7.60 (d, J=8.65, 1.53 Hz, 1 H) 7.27 - 7.44 (in, 4 H) 7.21 - 7.27 (in, 2 H) 5.65 (s, 2 H) 5.41 5 (s, 2 H) 2.41 (s, 3 H). MS (ESI+) m/z 305.1 (M+H)+. Example 124

N

3 -[2-(1H-indazol-5-yl)imidazo[1,2-a]pyrimidin-3-yl]-p-alaninamide Example 121 (42 mg, 0.120 mmol) and a solution of 7 N ammonia in methanol (1.0 10 mL) were combined and heated to 60 C overnight. The mixture was absorbed on silica get and purified by silica gel chromatography eluting with a gradient of methanol in dichloromethane (1-7%) to afford the title compound. 'H NMR (300 MHz, DMSO d 6 ) 6 ppm 13.09 (s, 1 H) 8.76 (d, J=6.78, 2.03 Hz, 1 H) 8.56 (s, 1 H) 8.45 (d, J=4.07, 2.03 Hz, 1 H) 8.24 (d, J=8.82, 1.36 Hz, 1 H) 8.15 (s, 1 H) 7.61 (d, J=8.48 Hz, 1 H) 7.32 (s, 1 H) 7.03 15 (d, J=6.78, 4.07 Hz, 1 H) 6.85 (s, 1 H) 4.93 (t, J=6.10 Hz, 1 H) 3.11 - 3.23 (in, 2 H) 2.32 (t, J=6.78 Hz, 2 H). MS (ESI+) m/z 322.0 (M+H). Example 125 5-(1-benzyl-5-iodo-1H-1,2,3-triazol-4-yl)-1H-indazol-3-amine 20 Example 125A 5-(1-Benzyl-5-iodo-1H-1,2,3-triazol-4-yl)-2-fluorobenzonitrile A mixture of Example 62B (200 mg, 1.38 mmol), benzyl azide (0.176 mL, 1.38 mmol), tetrahydrofuran (12 mL), triethylamine (0.230, 1.56 mmol), Cul (263 mg, 1.38 mmol) 25 and ICI (0.069 mL, 1.38 mmol) under argon was stirred at room temperature for 24 hours. The solvent was evaporated and the crude mixture was dissolved in dichloromethane, loaded directly onto a silica gel column and eluted with ethyl acetate / hexanes (10-20%) to afford the title compound. MS (ESI+) m/z 404.9 (M+H)*. 30 Example 125B 5-(1-benzyl-5-iodo-1H-1,2,3-triazol-4-yl)-1H-indazol-3-amine Example 125A (50 mg, 0.12 mmol) and hydrazine monohydrate (1mL) in ethanol (1 mL) were heated at 95 C for 2 hours. Water was added, and the solid was collected by 105 WO 2008/154241 PCT/US2008/065727 filtration and further purified by reverse-phase HPLC using an acetonitrile/water 0.1% TFA gradient elution method to afford the title compound as a TFA salt. 'H NMR (500 MHz, DMSO-d 6 ) 6 ppm 12.07 (s, 1 H) 8.30 (s, 1 H) 7.83 (d, J=8.85, 1.53 Hz, 1 H) 7.44 (d, J=8.54 Hz, 1 H) 7.38 - 7.43 (in, J=7.32, 7.32 Hz, 2 H) 7.32 - 7.37 (m, 1 H) 7.23 - 7.27 (m, J=7.02 5 Hz, 2 H) 5.74 (s, 2 H) 4.00 (s, 2 H). MS (ESI+) m/z 417.0 (M+H). Example 126 N- {3 - [4-(3 -amino-i H-indazol-5 -yl)-1 -benzyl- 1 H- 1,2,3 -triazol-5-yl]phenyl} -N'-(3 methylphenyl)urea 10 Example 126A 1-(3-(1-Benzyl-4-(3-cyano-4-fluorophenyl)-1H-1,2,3-triazol-5-yl)phenyl)-3-m-tolylurea A vial under argon containing Example 125A (94 mg, 0.23 mmol), 1-(3-(4,4,5,5 tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)-3-m-tolylurea (prepared according to a 15 procedure described in W02004/113304) (990 mg, 0.26 mmol), PdCl 2 dppf-dichloromethane (19 mg, 0.02 mmol), potassium carbonate (64 mg, 0.46 mmol), DME (2 mL) and water (0.2 mL) was capped and heated in a heater shaker at 80 C for 90 minutes. The solvents were evaporated and the product was extracted with methanol / dichloromethane. Silica gel column chromatography using 10% ethyl acetate in hexanes afforded the title compound. 20 MS (ESI+) m/z 503.2 (M+H). Example 126B N- {3 - [4-(3 -amino-i H-indazol-5 -yl)- 1 -benzyl- 1 H- 1,2,3 -triazol-5-yl]phenyl} -N'-(3 methylphenyl)urea 25 Example 126A (25 mg, 0.05 mmol) and hydrazine monohydrate (0.5mL) in ethanol (2 mL) were heated at 80 C for 1 hour. The crude mixture was loaded onto a silica gel column and eluted with a gradient of 0-5% methanol in dichloromethane to afford the title compound. 1 H NMR (500 MHz, DMSO-d 6 ) 6 ppm 11.40 (s, 1 H) 8.79 (s, 1 H) 8.63 (s, 1 H) 8.12 (s, 1 H) 7.57 (d, J=8.24, 1.22 Hz, 1 H) 7.43 (t, J=1.83 Hz, 1 H) 7.38 (t, J=7.93 Hz, 1 H) 7.23 - 7.34 30 (m, 4 H) 7.08 - 7.22 (in, 4 H) 7.03 (d, J=6.71 Hz, 2 H) 6.88 (d, J=7.63 Hz, 1 H) 6.78 (d, J=7.32 Hz, 1 H) 5.50 (s, 2 H) 5.36 (s, 2 H) 2.26 (s, 3 H). MS (ESI+) m/z 515.3 (M+H)+. 106 WO 2008/154241 PCT/US2008/065727 Example 127 5-(1H-indazol-5-yl)-N-(2-isopropoxyethyl)isoxazole-3-carboxamide In a 20 mL vial a solution of 81A (37 mg, 0.18 mmol) dissolved in dimethylformamide (0.8 mL) was added, followed by the addition of HATU (61 mg, 0.18 5 mmol) dissolved in dimethylformamide (0.8 mL). Then a solution of 2 isopropoxyethanamine (20 mg, 0.20 mmol) dissolved in dimethylformamide (0.9 mL) was added followed by diisopropylethylamine (42 mg, 0.36 mmol) dissolved in dimethylformamide (0.8 mL). The mixture was then shaken at 40 'C for three hours. The crude reaction mixture was filtered through a Si-carbonate cartridge (6 mL, 2 g) supplied by 10 Silicycle Chemical Division with methanol, checked with LC/MS, and concentrated to dryness. The residue was dissolved in 1:1 DMSO/methanol and purified by reverse phase HPLC (Agilent, 5%-100% TFA/water gradient, 8 minute run). 1 H NMR (300 MHz, DMSO d 6

/D

2 0) 6 ppm 8.38 - 8.43 (in, 1 H) 8.22 - 8.30 (in, 1 H) 7.90 (d, 1 H) 7.73 (d, 1 H) 7.21 7.29 (in, 1 H) 3.56 - 3.65 (in, 1 H) 3.52 (t, 2 H) 3.43 (t, 2 H) 1.10 (d, 6 H). MS (ESI+) m/z 15 315 (M+H). Example 128 5-[3-(morpholin-4-ylcarbonyl)isoxazol-5-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 127 20 substituting morpholine for 2-isopropoxyethanamine. 1H NMR (300 MHz, DMSO d 6

/D

2 0) 6 ppm 8.36 - 8.43 (in, 1 H) 8.22 - 8.29 (in, 1 H) 7.89 (d, 1 H) 7.72 (d, 1 H) 7.11 7.22 (in, 1 H) 3.68 - 3.72 (in, 4 H) 3.61 - 3.68 (in, 4 H). MS (ESI+) m/z 299 (M+H)+. Example 129 25 5-(1H-indazol-5-yl)-N-(3-morpholin-4-ylpropyl)isoxazole-3-carboxamide The title compound was prepared as a TFA salt according to the procedure outlined in Example 127 substituting 3-morpholinopropan-1-amine for 2-isopropoxyethanamine. 1H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.37 - 8.46 (m, 1 H) 8.20 - 8.31 (m, 1 H) 7.91 (d, 1 H) 7.73 (d, 1 H) 7.17 - 7.36 (m, 1 H) 3.98 - 4.08 (in, 2 H) 3.57 - 3.73 (in, 2 H) 3.42 - 3.51 (m, 30 2 H) 3.35 - 3.41 (m, 2 H) 3.14 - 3.22 (m, 2 H) 3.01 - 3.14 (m, 2 H) 1.88 - 2.06 (m, 2 H). MS (ESI+) m/z 356 (M+H)+. 107 WO 2008/154241 PCT/US2008/065727 Example 130 N-[2-(1H-imidazol-4-yl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 127 substituting 2-(1H-imidazol-4-yl)ethanamine for 2-isopropoxyethanamine. H NMR (300 5 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.90 - 8.97 (in, 1 H) 8.34 - 8.46 (in, 1 H) 8.20 - 8.32 (in, 1 H) 7.90 (d, 1 H) 7.72 (d, 1 H) 7.38 - 7.49 (in, 1 H) 7.14 - 7.28 (in, 1 H) 3.57 (t, 2 H) 2.96 (t, 2 H). MS (ESI+) m/z 323 (M+H)+. Example 131 10 (3R)-1-{[5-(1H-indazol-5-yl)isoxazol-3-yl]carbonyl}piperidin-3-ol The title compound was prepared according to the procedure outlined in Example 127 substituting (R)-piperidin-3-ol hydrochloride for 2-isopropoxyethanamine. H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.34 - 8.45 (in, 1 H) 8.19 - 8.30 (in, 1 H) 7.89 (d, 1 H) 7.72 (d, 1 H) 7.13 (d, 1 H) 4.03 - 4.19 (in, 1 H) 3.64 - 3.72 (in, 1 H) 3.54 - 3.62 (in, 1 H) 3.34 - 3.44 15 (in, 1 H) 3.20 - 3.32 (m,1 H) 2.99 - 3.10 (m,1 H) 1.67 - 2.03 (m, 2 H) 1.36 - 1.61 (m, 2 H). MS (ESI+) m/z 313 (M+H)+. Example 132 1-{[5-(1H-indazol-5-yl)isoxazol-3-yl]carbonyl}piperidine-3-carboxamide 20 The title compound was prepared according to the procedure outlined in Example 127 substituting piperidine-3-carboxamide for 2-isopropoxyethanamine. H NMR (300 MHz, DMSO-d 6

/D

2 0) S ppm 8.36 - 8.45 (in, 1 H) 8.22 - 8.32 (in, 1 H) 7.90 (d, 1 H) 7.72 (d, 1 H) 7.07 - 7.23 (in, 1 H) 4.27 - 4.56 (in, 1 H) 3.91 - 4.05 (in, 1 H) 3.09 - 3.37 (in, 1 H) 2.85 - 3.04 (in, 1 H) 2.31 - 2.45 (in, 1 H) 1.89 - 2.05 (in, 1 H) 1.73 - 1.86 (m, 1 H) 1.60 - 1.72 (m, 1 H) 25 1.36 - 1.55 (in, 1 H). MS (ESI-) m/z 338 (M-H)-. Example 133 2- [2-(4- { [5 -(1 H-indazol-5 -yl)isoxazol-3 -yl]carbonyl} piperazin- 1 -yl)ethoxy] ethanol The title compound was prepared as a TFA salt according to the procedure outlined in 30 Example 127 substituting 2-(2-(piperazin- 1 -yl)ethoxy)ethanol for 2-isopropoxyethanamine. IH NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.39 - 8.48 (in, 1 H) 8.19 - 8.32 (in, 1 H) 7.92 (d, 1 H) 7.74 (d, 1 H) 7.17 - 7.27 (in, 1 H) 4.49 - 4.60 (in, 1 H) 3.94 - 4.01 (in, 1 H) 3.76 - 3.81 (in, 4 H) 3.56 - 3.63 (in, 2 H) 3.51 - 3.56 (m, 2 H) 3.33 - 3.43 (in, 3 H) 3.13 - 3.23 (in, 1 H) 108 WO 2008/154241 PCT/US2008/065727 2.65 - 2.75 (m, 2 H). MS (ESI+) m/z 386 (M+H)*. Example 134 5-{3-[(4-methyl-1,4-diazepan-1-yl)carbonyl]isoxazol-5-yl}-1H-indazole 5 The title compound was prepared as a TFA salt according to the procedure outlined in Example 127 substituting 1-methyl-1,4-diazepane for 2-isopropoxyethanamine. 1H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.38 - 8.46 (m, 1 H) 8.22 - 8.32 (m, 1 H) 7.85 - 7.98 (m, 1 H) 7.75 (d, 1 H) 7.22 (d, 1 H) 4.07 - 4.19 (m, 1 H) 3.69 - 3.77 (m, 2 H) 3.59 - 3.67 (in, 1 H) 3.44 - 3.59 (m, 1 H) 3.35 - 3.44 (m, 1 H) 3.24 - 3.35 (m, 2 H) 2.84 - 2.95 (m, 3 H) 2.66 - 2.74 10 (m, 1 H) 2.10 - 2.26 (m, 2 H). MS (ESI+) m/z 326 (M+H)f. Example 135 N-(3-hydroxypropyl)-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 127 15 substituting 3-aminopropan-1-ol for 2-isopropoxyethanamine. 'H NMR (300 MHz, DMSO d 6

/D

2 0) S ppm 8.36 - 8.45 (m, 1 H) 8.20 - 8.30 (m, 1 H) 7.84 - 7.94 (m, 1 H) 7.71 (d, 1 H) 7.18 - 7.28 (m, 1 H) 3.48 (t, 2 H) 3.35 (t, 2 H) 1.64 - 1.78 (in, 2 H). MS (ESI+) m/z 387 (M+H)y. 20 Example 136 N-[(1R)-2-hydroxy-1-phenylethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 127 substituting (R)-2-amino-2-phenylethanol for 2-isopropoxyethanamine. 1H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 9.11 (d, 1 H) 8.37 - 8.46 (m, 1 H) 8.23 - 8.28 (m, 1 H) 7.91 (d, 1 H) 25 7.73 (d, 1 H) 7.40 - 7.45 (in, 2 H) 7.32 - 7.39 (in, 2 H) 7.23 - 7.32 (m, 2 H) 5.05 - 5.13 (in, 1 H) 3.66 - 3.72 (m, 2 H). MS (ESI+) m/z 349 (M+H)+. Example 137 N-[3-(1H-imidazol-1-yl)propyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide 30 The title compound was prepared according to the procedure outlined in Example 127 substituting 3-(1H-imidazol-1-yl)propan-1-amine for 2-isopropoxyethanamine. 'HNMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 9.02 - 9.10 (m, 1 H) 8.40 - 8.44 (m, 1 H) 8.25 - 8.29 (m, 1 H) 7.87 - 7.95 (m, 1 H) 7.71 - 7.82 (m, 2 H) 7.61 - 7.69 (in, 1 H) 7.20 - 7.29 (m, 1 H) 4.28 (t, 109 WO 2008/154241 PCT/US2008/065727 2 H) 3.33 (t, 2 H) 2.06 - 2.19 (m, 2 H). MS (ESI+) m/z 337 (M+H)*. Example 138 5-(1H-indazol-5-yl)-N-[3-(2-oxopyrrolidin-1-yl)propyl]isoxazole-3-carboxamide 5 The title compound was prepared according to the procedure outlined in Example 127 substituting 1-(3-aminopropyl)pyrrolidin-2-one for 2-isopropoxyethanamine. 1H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.38 - 8.43 (m, 1 H) 8.24 - 8.30 (m, 1 H) 7.87 - 7.93 (in, 1 H) 7.73 (d, 1 H) 7.22 - 7.26 (in, 1 H) 3.39 (t, 2 H) 3.21 - 3.30 (m, 4 H) 2.26 (t, 2 H) 1.90 - 2.00 (m, 2 H) 1.70 - 1.79 (m, 2 H). MS (ESI+) m/z 354 (M+H). 10 Example 139 N- {2-[4-(aminosulfonyl)phenyl] ethyl} -5 -(1 H-indazol-5 -yl)isoxazole-3 -carboxamide The title compound was prepared according to the procedure outlined in Example 127 substituting 4-(2-aminoethyl)benzenesulfonamide for 2-isopropoxyethanamine. 1H NMR 15 (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.37 - 8.42 (m, 1 H) 8.24 - 8.29 (m, 1 H) 7.86 - 7.93 (m, 1 H) 7.70 - 7.80 (m, 3 H) 7.47 (d, 2 H) 7.20 - 7.24 (in, 1 H) 3.57 (t, 2 H) 2.96 (t, 2 H). MS (ESI+) m/z 412 (M+H)*. Example 140 20 [1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazol-5-yl](3-chlorophenyl)methanone The title compound was prepared according to the procedure outlined in Example 119B substituting 3-chlorobenzoyl chloride for benzoyl chloride. 1 H NMR (500 MHz, DMSO-d 6 ) 6 ppm 13.09 (s, 1 H) 7.99 (s, 1 H) 7.77 (s, 1 H) 7.38 - 7.51 (in, 4 H) 7.28 - 7.37 (m, 3 H) 7.20 - 7.27 (m, 4 H) 5.78 (s, 2 H). MS (ESI+) m/z 414.1 (M+H)+. 25 Example 141 [1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazol-5-yl](cyclopropyl)methanone The title compound was prepared according to the procedure outlined in Example 119B substituting cyclopropanecarbonyl chloride for benzoyl chloride. H NMR (500 MHz, 30 DMSO-d 6 ) 6 ppm 13.26 (s, 1 H) 8.18 (s, 1 H) 8.08 (s, 1 H) 7.61 - 7.70 (in, 2 H) 7.29 - 7.40 (m, 3 H) 7.24 (d, J=7.02 Hz, 2 H) 5.79 (s, 2 H) 1.86 - 2.00 (in, 1 H) 0.98 - 1.12 (m, 2 H) 0.77 - 0.93 (m, 2 H). MS (ESI+) m/z 344.1 (M+H)+. 110 WO 2008/154241 PCT/US2008/065727 Example 142 5-[5-cyclopropyl-1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol-4-yl]-1H-indazole Example 142A 5 5-Cyclopropyl-1-((tetrahydro-2H-pyran-4-yl)methyl)-4-(tributylstannyl)-1H-1,2,3-triazole Cyclopropyl acetylene (142 mg, 2.15 mmol) was added to 1,1,1-tributyl-N,N dimethylstannanamine (716 mg, 2.14 mmol) in hexane (3.0 mL) and stirred in a sealed vial at 70'C for 2 hours. The mixture was cooled to ambient temperature, and the vial was stirred unsealed for 10 minutes. Example 80A (455 mg, 3.22 mmol) was added, and the vial was 10 resealed and heated to 130 0 C overnight. The mixture was purified by silica gel chromatography eluting with a gradient of ethyl acetate in hexanes (5-50%) to afford the title compound. MS (ESI-) m/z 498.3 (M+H)j. Example 142B 15 1-(5-(5-Cyclopropyl-1-((tetrahydro-2H-pyran-4-yl)methyl)-1H-1,2,3-triazol-4-yl)-1H indazol- 1 -yl)ethanone Example 142A (220 mg, 0.444 mmol), Example 87A (128 mg, 0.447 mmol), dichlorobis(triphenylphosphine)palladium(II) (33 mg, 0.047 mmol), and copper thiophene-2 carboxylate (127 mg, 0.666 mmol) were combined in toluene (2.0 mL) in a 4 mL vial under 20 an inert atmosphere of nitrogen. The vial was sealed and heated 150 0 C for 20 minutes. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 5

-

70 % ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 366.0 (M+H)f. 25 Example 142C 5-[5-cyclopropyl-1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol-4-yl]-1H-indazole Example 142B (46 mg, 0.126 mmol) was dissolved in tetrahydrofuran (2.0 mL) and water (0.5 mL) and potassium hydroxide (80 mg, 1.43 mmol) was added. The mixture was stirred for 2 hours, and was diluted with methylene chloride and washed with water. The 30 organic layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 0-8% methanol in dichloromethane to afford the title compound. 1 H NMR (300 MHz, CDCl 3 ) S ppm 8.19 (s, 1 H) 7.96 (d, J=8.82 Hz, 1 H) 7.61 (d, J=7.80 Hz, 1 H) 7.25 - 7.28 (in, 1 H) 4.34 (d, J=6.44 Hz, 2 H) 4.02 (d, J=I 1.36, 3.56 Hz, 2 H) 3.42 (t, J=11.53 111 WO 2008/154241 PCT/US2008/065727 Hz, 2 H) 2.33 - 2.46 (in, 1 H) 1.81 - 1.95 (in, 1 H) 1.59 - 1.70 (in, 2 H) 1.43 - 1.58 (in, 2 H) 1.23 - 1.28 (in, 1 H) 1.10 - 1.20 (in, 2 H) 0.47 - 0.62 (in, 2 H). MS (ESI+) m/z 324.1 (M+H). 5 Example 143

N

1 -{[1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazol-5-yl]methyl}glycinamide Example 143A 2-((1-Benzyl-4-(tributylstannyl)-1H-1,2,3-triazol-5-yl)methyl)isoindoline-1,3-dione 10 N-Propargylphthalimide (2.35 g mg, 12.7 mmol) was added to 1,1,1-tributyl-N,N dimethylstannanamine (4.23 mg, 12.7 mmol) in hexane (3.0 mL) and stirred in a sealed vial at 70 C for 2 hours. The mixture was cooled to ambient temperature and the vial was stirred unsealed for 10 minutes. Benzyl azide (2.0 mL, 16.0 mmol) was added and the vial was resealed and heated to 130 C overnight. The mixture was purified by silica gel 15 chromatography eluting with a gradient of 10-50% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 609.3 (M+H)f. Example 143B 2-((4-(1-Acetyl-1H-indazol-5-yl)-1-benzyl-1H-1,2,3-triazol-5-yl)methyl)isoindoline-1,3 20 dione Example 143A (567 mg, 0.934 mmol), Example 87A (268 mg, 0.934 mmol), dichlorobis(triphenylphosphine)palladium(II) (67 mg, 0.095 mmol), and copper thiophene-2 carboxylate (268 mg, 1.41 mmol) were combined in toluene (2.5 mL) in a microwave vial under an inert atmosphere of nitrogen. The vial was heated in a microwave (CEM-Discover) 25 to 150 C at 125 Watts for 20 minutes. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 10-50% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 477.2 (M+H)f. Example 143C 30 (1-Benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazol-5-yl)methanamine Example 143B (140 mg, 0.294 mmol) was treated with hydrazine hydrate (0.7 mL) in ethanol (0.7 mL) and stirred at ambient temperature overnight. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 1-6% methanol in dichloromethane to afford the title compound. MS (ESI+) m/z 305.0 (M+H)f. 112 WO 2008/154241 PCT/US2008/065727 Example 143D

N

1 -{[1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazol-5-yl]methyl}glycinamide Example 143C (66 mg, 0.217 mmol), N-(tert-butoxycarbonyl)-glycine (39 mg, 0.223 mmol), and HATU (85 mg, 0.224 mmol) were combined in methylene chloride (2.5 mL). 5 Diisopropylethylamine (150 uL, 0.865 mmol) was added and the mixture was stirred at ambient temperature overnight. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 0-6% methanol in dichloromethane to afford tert-butyl 2-((1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazol-5-yl)methylamino)-2 oxoethylcarbamate. This carbamate was dissolved in tetrahydrofuran (2 mL) and 0.5 mL of a 10 solution of 1 N hydrochloric acid in diethyl ether was added and the mixture was stirred for 20 minutes at room temperature. The solvents were removed under reduced pressure, and diethyl ether was added to the mixture and stirred at room temperature overnight. The solvent was decanted, and the resulting residue was dried under a stream of nitrogen to afford the title compound as a hydrochloride salt. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.21 (s, 15 1 H) 9.02 (t, J=5.09 Hz, 1 H) 8.11 - 8.16 (m, 2 H) 8.06 (s, 2 H) 7.75 - 7.82 (m, 1 H) 7.64 (d, J=8.82 Hz, 1 H) 7.30 - 7.45 (m, 3 H) 7.23 - 7.31 (m, 2 H) 5.72 (s, 2 H) 4.57 (d, J=5.09 Hz, 2 H) 3.41 (q, J=5.76 Hz, 2 H). MS (ESI+) m/z 362.1 (M+H)+. Example 144 20 (4-fluorophenyl)[4-(1H-indazol-5-yl)-1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol 5-yl]methanone The title compound was prepared according to the procedure outlined in Example 11 9B substituting 4-fluorobenzoyl chloride for benzoyl chloride and Example 80A for benzyl azide. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.10 (s, 1 H) 8.00 (s, 1 H) 7.72 - 7.80 (m, 3 25 H) 7.38 - 7.44 (m, 1 H) 7.30 - 7.36 (m, 1 H) 7.09 - 7.19 (m, 2 H) 4.41 (d, J=7.12 Hz, 2 H) 3.80 (d, J=11.36, 2.54 Hz, 2 H) 3.14 - 3.26 (in, 2 H) 2.04 - 2.19 (in, 1 H) 1.38 - 1.49 (in, 2 H) 1.19 - 1.35 (in, 2 H). MS (ESI+) m/z 406.1 (M+H)j. Example 145 30 (4-chlorophenyl)[4-(1H-indazol-5-yl)-1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol 5-yl]methanone The title compound was prepared according to the procedure outlined in Example 11 9B substituting 4-chlorobenzoyl chloride for benzoyl chloride and Example 80A for benzyl 113 WO 2008/154241 PCT/US2008/065727 azide. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.10 (s, 1 H) 8.00 (s, 1 H) 7.77 (s, 1 H) 7.68 (d, J=8.48 Hz, 2 H) 7.29 - 7.45 (in, 4 H) 4.42 (d, J=7.12 Hz, 2 H) 3.81 (d, J=11.19, 2.71 Hz, 2 H) 3.14 - 3.27 (m, 2 H) 2.03 - 2.19 (m, 1 H) 1.38 - 1.51 (m, 2 H) 1.22 - 1.36 (m, 2 H). MS (ESI+) m/z 422.1 (M+H)*. 5 Example 146 (3-chlorophenyl)[4-(1H-indazol-5-yl)-1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol 5-yl]methanone The title compound was prepared according to the procedure outlined in Example 10 119B substituting 3-chlorobenzoyl chloride for benzoyl chloride and Example 80A for benzyl azide. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.04 (s, 1 H) 7.95 (s, 1 H) 7.64 (s, 1 H) 7.48 7.54 (m, 1 H) 7.29 - 7.35 (in, 1 H) 7.22 - 7.28 (m, 1 H) 7.13 - 7.22 (in, 3 H) 4.58 (d, J=7.12 Hz, 2 H) 3.86 (d, J=11.53, 2.37 Hz, 2 H) 3.20 - 3.30 (in, 2 H) 2.11 - 2.24 (m, 1 H) 1.45 - 1.54 (m, 2 H) 1.33 - 1.44 (in, 2 H). MS (ESI+) m/z 422.1 (M+H). 15 Example 147 (2-chlorophenyl)[4-(1H-indazol-5-yl)-1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol 5-yl]methanone The title compound was prepared according to the procedure outlined in Example 20 11 9B substituting 2-chlorobenzoyl chloride for benzoyl chloride and Example 80A for benzyl azide. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.08 (s, 1 H) 7.99 (s, 1 H) 7.75 (s, 1 H) 7.66 (t, J=1.86 Hz, 1 H) 7.56 (d, J=7.80 Hz, 1 H) 7.47 - 7.53 (m, 1 H) 7.36 - 7.42 (in, 1 H) 7.23 7.34 (m, 2 H) 4.45 (d, J=6.78 Hz, 2 H) 3.82 (d, J=11.19, 2.37 Hz, 2 H) 3.18 - 3.29 (in, 2 H) 2.09 - 2.23 (m, 1 H) 1.41 - 1.53 (m, 2 H) 1.28 - 1.38 (m, 2 H). MS (ESI+) m/z 422.1 25 (M+H)+. Example 148 cyclopentyl[4-(1H-indazol-5-yl)-1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol-5 yl]methanone 30 The title compound was prepared according to the procedure outlined in Example 11 9B substituting cyclopentanecarbonyl chloride for benzoyl chloride and Example 80A for benzyl azide. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.27 (s, 1 H) 8.18 (s, 1 H) 7.95 (s, 1 H) 7.68 (d, J=8.48 Hz, 1 H) 7.52 (d, J=8.48, 1.70 Hz, 1 H) 4.47 (d, J=7.12 Hz, 2 H) 3.85 (d, 114 WO 2008/154241 PCT/US2008/065727 J=11.53, 2.37 Hz, 2 H) 3.18 -3.30 (m, 2 H) 3.02- 3.14 (in, 1 H) 2.00 -2.17 (m, 1 H) 1.19 1.76 (in, 12 H). MS (ESI+) m/z 380.1 (M+H)f. Example 149 5 1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazole-5-carboxylic acid Example 149A Methyl 1-benzyl-4-(tributylstannyl)-1H-1,2,3-triazole-5-carboxylate Methyl propiolate (5.75 g, 68.4 mmol) was added to methyl 10 ethyl(tributylstannyl)carbamate (26.9 g, 68.6 mmol) in a large sealed tube. The mixture was heated to 70 C overnight. The mixture was cooled to ambient temperature and the vial was stirred unsealed for 10 minutes. Benzyl azide (10.2 mL, 81.6 mmol) was added, and the vial was resealed and heated to 130 C overnight. The mixture was purified by silica gel chromatography eluting with a gradient of 5-40% ethyl acetate in hexanes to afford the title 15 compound. MS (ESI-) m/z 508.3 (M+H)+. Example 149B Methyl 4-(1-acetyl-1H-indazol-5-yl)-1-benzyl-1H-1,2,3-triazole-5-carboxylate Example 149A (7.17 g, 14.1 mmol), Example 87A (4.02 g, 14.1 mmol), 20 dichlorobis(triphenylphosphine)palladium(II) (1.01 mg, 1.44 mmol), and copper thiophene-2 carboxylate (4.07 mg, 21.3 mmol) were combined in toluene (55 mL) in a large sealed tube under an inert atmosphere of nitrogen. The tube was sealed and heated at 150 C for 30 minutes. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 10-50% ethyl acetate in hexanes to afford the title compound. MS 25 (ESI+) m/z 376.1 (M+H)*. Example 149C 1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazole-5-carboxylic acid Example 149B (3.40 mg, 9.06 mmol) was dissolved in tetrahydrofuran (100 mL), 30 methanol (10 mL), and water (10 mL), and potassium hydroxide (1.63 g, 29.1 mmol) was added. The mixture was stirred for 3 hours, was diluted with ethyl acetate and washed with 1 N hydrochloric acid, washed with brine, and the combined organic layers were dried over sodium sulfate. After filtration, the solvents were removed under reduced pressure to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.16 (s, 1 H) 8.11 - 8.18 (m, 2 115 WO 2008/154241 PCT/US2008/065727 H) 7.66 - 7.76 (in, 1 H) 7.54 - 7.62 (m, 1 H) 7.31 - 7.43 (in, 3 H) 7.22 - 7.29 (in, 2 H) 5.93 (s, 2 H). MS (ESI+) m/z 320.0 (M+H)+. Example 150 5 5-{5-(4-fluorophenyl)-1-[4-(trifluoromethyl)benzyl]-1H-1,2,3-triazol-4-yl}-1H-indazol-3 amine Example 150A 1 -(Azidomethyl)-4-(trifluoromethyl)benzene 10 Sodium azide (2.30 g, 35.4 mmol) was added to a solution of 4 (trifluoromethyl)benzyl bromide (4.26 g, 17.8 mmol) dissolved in dimethyl sulfoxide (15 mL) and stirred at ambient temperature overnight. The mixture was diluted with ethyl acetate, washed with water and brine, and dried over sodium sulfate. After filtration, the solvent was removed under reduced pressure to afford the title compound. The crude product 15 was used in the next step without further characterization. Example 150B 5-(4-Fluorophenyl)-4-(tributylstannyl)-1-(4-(trifluoromethyl)benzyl)-1H-1,2,3-triazole 4-Fluorophenyl acetylene (524 mg, 4.36 mmol) was added to 1,1,1-tributyl-N,N 20 dimethylstannanamine (1.46 g, 4.37 mmol), and the mixture was stirred in a sealed vial at 50 C for 30 minutes. The mixture was cooled to ambient temperature, and the vial was stirred unsealed for 10 minutes. Example 150A (1.28 g, 6.30 mmol) was added and the vial was resealed and heated to 130 C overnight. The mixture was purified by silica gel chromatography eluting with a gradient of 5-35% ethyl acetate in hexanes to afford the title 25 compound. MS (ESI-) m/z 612.3 (M+H)*. Example 150C 2-Fluoro-5-(5-(4-fluorophenyl)-1-(4-(trifluoromethyl)benzyl)-1H-1,2,3-triazol-4 yl)benzonitrile 30 Example 150B (485 mg, 0.795 mmol), 5-bromo-2-fluorobenzonitrile (143 mg, 0.715 mmol), dichlorobis(triphenylphosphine)palladium(II) (49 mg, 0.070 mmol), and copper thiophene-2-carboxylate (205 mg, 1.08 mmol) were combined in toluene (2.0 mL) in a 4 mL vial under an inert atmosphere of nitrogen. The vial was sealed and heated at 150 C for 30 minutes. The mixture was absorbed onto silica gel and purified by silica gel chromatography 116 WO 2008/154241 PCT/US2008/065727 eluting with a gradient of 10-50% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 441.2 (M+H)f. Example 150D 5 5-{5-(4-fluorophenyl)-1-[4-(trifluoromethyl)benzyl]-1H-1,2,3-triazol-4-yl}-1H-indazol-3 amine Example 150C was treated with hydrazine hydrate (1.0 mL) in ethanol (1.0 mL), and the reaction mixture was stirred and heated to 65 C for 3 hours. The mixture was diluted with methylene chloride and washed with water. The organic layer was absorbed on silica 10 gel and purified by silica gel chromatography eluting with a gradient of 0-6% methanol in dichloromethane to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 11.42 (s, 1 H) 8.04 (s, 1 H) 7.67 (d, J=8.14 Hz, 2 H) 7.26 - 7.41 (in, 4 H) 7.22 (d, J=8.48 Hz, 2 H) 7.03 - 7.15 (in, 2 H) 5.62 (s, 2 H) 5.36 (s, 2 H). MS (ESI+) m/z 453.1 (M+H)f. 15 Example 151 5-[1-benzyl-5-(4-fluorophenyl)-1H-1,2,3-triazol-4-yl]-1H-indazol-3-amine Example 151A 1-Benzyl-5-(4-fluorophenyl)-4-(tributylstannyl)-1H-1,2,3-triazole 20 4-Fluorophenyl acetylene (525 mg, 4.37 mmol) was added to 1,1,1-tributyl-N,N dimethylstannanamine (1.46 g, 4.37 mmol), and the mixture was stirred in a sealed vial at 50 C for 2 hours. The mixture was cooled to ambient temperature, and the vial was stirred unsealed for 10 minutes. Benzyl azide (850 uL, 6.80 mmol) was added, and the vial was resealed and heated to 130 C overnight. The mixture was purified by silica gel 25 chromatography eluting with a gradient of 5-35% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 544.4 (M+H)f. Example 151B 5-(1-Benzyl-5-(4-fluorophenyl)-1H-1,2,3-triazol-4-yl)-2-fluorobenzonitrile 30 Example 15IA (361 mg, 0.666 mmol), 5-bromo-2-fluorobenzonitrile (119 mg, 0.595 mmol), dichlorobis(triphenylphosphine)palladium(II) (45 mg, 0.064 mmol), and copper thiophene-2-carboxylate (193 mg, 1.01 mmol) were combined in toluene (2.0 mL) in a 4 mL vial under an inert atmosphere of nitrogen. The vial was sealed and heated 150 C for 30 117 WO 2008/154241 PCT/US2008/065727 minutes. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 10-50% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 373.0 (M+H)+. 5 Example 151C 5-[1-benzyl-5-(4-fluorophenyl)-1H-1,2,3-triazol-4-yl]-1H-indazol-3-amine Example 151B (135 mg, 0.363 mmol) was treated with hydrazine hydrate (1.0 mL) in ethanol (1.0 mL) and stirred and heated to 65 C for 3 hours. The mixture was diluted with methylene chloride and washed with water. The organic layer was absorbed on silica gel and 10 purified by silica gel chromatography eluting with a gradient of 0-6% methanol in dichloromethane to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 11.40 (s, 1 H) 8.02 (s, 1 H) 7.24 - 7.38 (in, 7 H) 7.03 - 7.14 (in, 2 H) 6.98 (d, J=7.29, 2.20 Hz, 2 H) 5.50 (s, 2 H) 5.35 (s, 2 H). MS (ESI+) m/z 385.1 (M+H)*. 15 Example 152 [4-(1H-indazol-5-yl)-1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol-5-yl](tetrahydro 2H-pyran-4-yl)methanone The title compound was prepared according to the procedure outlined in Example 11 9B substituting Example 80A for benzyl azide and tetrahydro-2H-pyran-4-carbonyl 20 chloride for benzoyl chloride. 1H NMR (300 MHz, DMSO-d 6 ) S ppm 13.30 (s, 1 H) 8.18 (s, 1 H) 8.00 (s, 1 H) 7.69 (d, J=8.48 Hz, 1 H) 7.53 (d, J=8.65, 1.53 Hz, 1 H) 4.48 (d, J=7.12 Hz, 2 H) 3.79 - 3.90 (in, 2 H) 3.62 - 3.74 (m, 2 H) 3.18 - 3.30 (in, 2 H) 2.76 - 2.88 (in, 1 H) 2.64 2.76 (in, 2 H) 2.00 - 2.17 (in, 1 H) 1.20 - 1.58 (in, 8 H). MS (ESI+) m/z 396.0 (M+H). 25 Example 153 5-[1-benzyl-5-(2-methylphenyl)-1H-1,2,3-triazol-4-yl]-1H-indazole Example 153A 1-Benzyl-5-o-tolyl-4-(tributylstannyl)-1H-1,2,3-triazole 30 2-Ethynyl toluene (456 uL, 3.62 mmol) was added to 1,1,1-tributyl-N,N dimethylstannanamine (1.21 g, 3.62 mmol), and the mixture was stirred in a sealed vial at 70 0 C for 3 hours. The mixture was cooled to ambient temperature, and the vial was stirred unsealed for 10 minutes. Benzyl azide (678 uL, 5.42 mmol) was added, and the vial was 118 WO 2008/154241 PCT/US2008/065727 resealed and heated to 130 C overnight. The mixture was purified by silica gel chromatography eluting with a gradient of 5-45% ethyl acetate in hexanes to afford the title compound. MS (ESI-) m/z 539.8 (M+H)+. 5 Example 153B 1-(5-(1-Benzyl-5-o-tolyl-1H-1,2,3-triazol-4-yl)-1H-indazol-1-yl)ethanone Example 153A (119 mg, 0.221 mmol), Example 87A (63 mg, 0.221 mmol), dichlorobis(triphenylphosphine)palladium(II) (16 mg, 0.023 mmol), and copper thiophene-2 carboxylate (65 mg, 0.341 mmol) were combined in toluene (2.0 mL) in a 4 mL vial under an 10 inert atmosphere of nitrogen. The vial was sealed and heated at 150 0 C for 20 minutes. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient 5-45% of ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 408.7 (M+H)'. 15 Example 153C 5-[1-benzyl-5-(2-methylphenyl)-1H-1,2,3-triazol-4-yl]-1H-indazole Example 153B (42 mg, 0.103 mmol) was dissolved in tetrahydrofuran (2.0 mL) and water (0.3 mL), and potassium hydroxide (48 mg, 0.856 mmol) was added. The mixture was stirred for 1 hour, was diluted with methylene chloride and washed with water. The organic 20 layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 1-6% methanol in dichloromethane to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.07 (s, 1 H) 7.97 (s, 1 H) 7.73 (s, 1 H) 7.44 - 7.53 (in, 3 H) 7.39 (t, J=6.95 Hz, 1 H) 7.28 - 7.35 (in, 2 H) 7.21 - 7.29 (in, 3 H) 6.86 - 6.95 (in, 2 H) 5.28 - 5.45 (in, 2 H) 1.59 (s, 3 H). MS (ESI+) m/z 366.1 (M+H)*. 25 Example 154 5-{1-benzyl-5-[(4-methylpiperazin-1-yl)carbonyl]-1H-1,2,3-triazol-4-yl}-1H-indazole The title compound was prepared according to the procedure outlined in Example 81B substituting Example 149C for Example 81A and 1-methyl piperazine for piperidine and 30 tetrahydrofuran for dimethylformamide. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.20 (s, 1 H) 8.16 (s, 1 H) 7.96 (s, 1 H) 7.57 - 7.69 (in, 2 H) 7.31 - 7.44 (in, 3 H) 7.23 - 7.30 (m, 2 H) 5.36 - 5.83 (in, 2 H) 3.40 - 3.65 (in, J=4.75 Hz, 2 H) 2.38 - 2.49 (m, 2 H) 2.10 - 2.22 (in, 2 H) 1.89 (s, 3 H) 1.40 (t, J=4.92 Hz, 2 H). MS (ESI+) m/z 402.2 (M+H)j. 119 WO 2008/154241 PCT/US2008/065727 Example 155 1-{[1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazol-5-yl]carbonyl}piperidin-4-ol The title compound was prepared according to the procedure outlined in Example 81B 5 substituting Example 149C for Example 8 1A and 4-hydroxy piperidine for piperidine and tetrahydrofuran for dimethylfornamide. 'H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.15 13.24 (m, 1 H) 8.16 (s, 1 H) 7.97 (s, 1 H) 7.55 - 7.68 (m, 2 H) 7.32 - 7.43 (in, 3 H) 7.23 - 7.30 (m, 2 H) 5.41 - 5.83 (in, J=65.10 Hz, 2 H) 4.58 (d, J=3.39 Hz, 1 H) 3.74 - 3.91 (m, 1 H) 3.37 - 3.48 (in, 2 H) 2.66 - 2.79 (m, 1 H) 2.25 - 2.47 (in, 1 H) 1.54 - 1.68 (in, 1 H) 1.20 - 1.36 (in, 10 1 H) 0.74 - 0.90 (in, 1 H) 0.40 - 0.60 (m, 1 H). MS (ESI+) m/z 403.1 (M+H)*. Example 156 1-acetyl-5-[5-(4-fluorophenyl)-1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol-4-yl] 1H-indazole 15 Example 156A 5-(4-Fluorophenyl)-1-((tetrahydro-2H-pyran-4-yl)methyl)-4-(tributylstannyl)-1H-1,2,3 triazole 4-Fluorophenyl acetylene (440 uL, 3.88 mmol) was added to 1,1,1-tributyl-N,N 20 dimethylstannanamine (1.30 g, 3.89 mmol), and the mixture was stirred in a sealed vial at 50 C for 40 minutes. The mixture was cooled to ambient temperature, and the vial was stirred unsealed for 10 minutes. Example 80A (710 uL, 5.68 mmol) was added and the vial was resealed and heated to 130 C overnight. The mixture was purified by silica gel chromatography eluting with a gradient of 5-50% ethyl acetate in hexanes to afford the title 25 compound. MS (ESI+) m/z 552.4 (M+H)*. Example 156B 1-acetyl-5-[5-(4-fluorophenyl)-1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol-4-yl] 1H-indazole 30 Example 156A (433 mg, 0.787 mmol), Example 87A (205 mg, 0.717 mmol), dichlorobis(triphenylphosphine)palladium(II) (55 mg, 0.078 mmol), and copper thiophene-2 carboxylate (224 mg, 1.17 mmol) were combined in toluene (2.0 mL) in a 4 mL vial under an inert atmosphere of nitrogen. The vial was sealed and heated to 150 C for 20 minutes. The 120 WO 2008/154241 PCT/US2008/065727 mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 5-45% ethyl acetate in hexanes, and was triturated with methanol to afford the title compound. 'H NMR (300 MHz, DMSO-d 6 ) 6 ppm 8.40 - 8.48 (in, J=0.68 Hz, 1 H) 8.25 (d, J=8.82 Hz, 1 H) 7.82 - 7.91 (in, 1 H) 7.73 (d, J=8.48, 1.70 Hz, 1 H) 7.50 - 7.60 (in, 2 H) 5 7.38 - 7.49 (m, 2 H) 4.13 (d, J=7.12 Hz, 2 H) 3.76 (d, J=11.36, 2.54 Hz, 2 H) 3.10 - 3.25 (in, 2 H) 2.70 (s, 3 H) 1.86 - 2.08 (in, 1 H) 1.37 (d, J=12.55, 1.70 Hz, 2 H) 1.03 - 1.23 (m, 2 H). MS (ESI+) m/z 420.2 (M+H)+. Example 157 10 1-benzyl-4-(1H-indazol-5-yl)-N,N-dimethyl-1H-1,2,3-triazole-5-carboxamide The title compound was prepared according to the procedure outlined in Example 81B substituting Example 149C for Example 8 1A and dimethylamine for piperidine and tetrahydrofuran for dimethylformamide. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.19 (s, 1 H) 8.15 (s, 1 H) 7.96 (t, J=1.19 Hz, 1 H) 7.62 (d, J=1.36 Hz, 2 H) 7.33 - 7.44 (m, 3 H) 7.24 15 7.33 (in, 2 H) 5.59 (s, 2 H) 2.92 (s, 3 H) 2.21 (s, 3 H). MS (ESI+) m/z 347.1 (M+H)*. Example 158 N,1-dibenzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazole-5-carboxamide The title compound was prepared according to the procedure outlined in Example 81B 20 substituting Example 149C for Example 8 1A and benzyl amine for piperidine and tetrahydrofuran for dimethylfornamide. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.15 (s, 1 H) 9.35 (t, J=6.10 Hz, 1 H) 8.01 (d, J=12.55 Hz, 2 H) 7.68 (d, J=8.82, 1.36 Hz, 1 H) 7.53 (d, J=8.82 Hz, 1 H) 7.17 - 7.41 (in, 10 H) 5.66 (s, 2 H) 4.41 (d, J=6.10 Hz, 2 H). MS (ESI+) m/z 409.1 (M+H)+. 25 Example 159 N-(2-hydroxy-2-phenylethyl)-5-(1H-indazol-5-yl)-N-methylisoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81B substituting DL-alpha-(methylaminomethyl)benzyl alcohol for piperidine. 1H NMR (300 30 MHz, DMSO-d 6 ) 6 ppm 13.01 (s, 1 H) 8.29 (s, 1 H) 8.17 (s, 1 H) 7.73 - 7.85 (m, 1 H) 7.62 7.72 (in, 1 H) 7.16 - 7.43 (in, 5 H) 6.86 (s, 1 H) 5.17 (d, J=4.39 Hz, 1 H) 4.89 (s, 1 H) 3.71 (d, J=5.49 Hz, 2 H) 3.10 (s, 3 H). MS (ESI+) m/z 363.1 (M+H)f. 121 WO 2008/154241 PCT/US2008/065727 Example 160 N-[(1S)-2-hydroxy-1-phenylethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81B substituting (S)-2-amino-2-phenylethanol for piperidine. 1 H NMR (300 MHz, DMSO 5 d 6 ) 6 ppm 13.37 (s, 1 H) 9.05 (d, J=8.14 Hz, 1 H) 8.40 (s, 1 H) 8.23 (s, 1 H) 7.89 (d, J=8.65, 1.53 Hz, 1 H) 7.70 (d, J=8.82 Hz, 1 H) 7.20 - 7.46 (m, 6 H) 5.02 - 5.13 (m, 1 H) 4.98 (t, J=5.59 Hz, 1 H) 3.61 - 3.82 (m, 2 H). MS (ESI+) m/z 349.0 (M+H)*. Example 161 10 N-benzyl-N-(2-hydroxyethyl)-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81B substituting 2-(benzylamino)ethanol for piperidine. H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.37 (s, 1 H) 9.05 (d, J=8.48 Hz, 1 H) 8.40 (s, 1 H) 8.23 (s, 1 H) 7.89 (d, J=8.65, 1.53 Hz, 1 H) 7.70 (d, J=8.82 Hz, 1 H) 7.22 - 7.45 (m, 6 H) 5.02 - 5.14 (m, 1 H) 4.98 (t, J=5.76 Hz, 1 H) 15 3.61 - 3.81 (m, 2 H). MS (ESI+) m/z 349.0 (M+H)f. Example 162 5-[1-benzyl-5-(2-methylphenyl)-1H-1,2,3-triazol-4-yl]-3-methyl-iH-indazole 20 Example 162A 1-(5-Bromo-3-methyl-iH-indazol-1-yl)ethanone 5-Bromo-3-methyl-1H-indazole (838 mg, 3.97 mmol) was dissolved in methylene chloride (15 mL) and diisopropylethylamine (0.7 mL). Acetic anhydride (500 uL, 5.29 mmol) was added and the mixture was stirred at ambient temperature overnight. The mixture 25 was diluted with ethyl acetate, washed with 1 N sodium hydroxide followed by 1 N hydrochloric acid and then brine. The organic layer was dried over sodium sulfate and the solvent was removed under reduced pressure to afford the title compound. MS (ESI+) m/z 252.7 (M+H)+. 30 Example 162B 1-(5-(1-Benzyl-5-o-tolyl-1H-1,2,3-triazol-4-yl)-3-methyl-iH-indazol-1-yl)ethanone Example 153A (436 mg, 0.808 mmol), Example 162A (205 mg, 0.8 10 mmol), dichlorobis(triphenylphosphine)palladium(II) (56 mg, 0.080 mmol), and copper thiophene-2 122 WO 2008/154241 PCT/US2008/065727 carboxylate (239 mg, 1.25 mmol) were combined in toluene (2.0 mL) in a 4 mL vial under an inert atmosphere of nitrogen. The vial was sealed and heated 150 0 C for 30 minutes. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 10-50% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 5 422.6 (M+H)+. Example 162C 5-[i-benzyl-5-(2-methylphenyl)-1H-1,2,3-triazol-4-yl]-3-methyl-iH-indazole Example 162B (202 mg, 0.548 mmol) was dissolved in tetrahydrofuran (5.0 mL), 10 methanol (0.5 mL) and water (0.5 mL) and potassium hydroxide (133 mg, 2.37 mmol) was added. The mixture was stirred for 1 hour and then was diluted with methylene chloride and washed with water. The organic layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 30-80% ethyl acetate in hexanes to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 12.63 (s, 1 H) 7.70 (s, 1 H) 7.44 - 7.52 15 (in, 1 H) 7.38 - 7.43 (in, 1 H) 7.29 - 7.38 (m, 4 H) 7.22 - 7.29 (in, 3 H) 6.89 - 6.96 (m, J=6.44, 3.05 Hz, 2 H) 5.30 - 5.48 (in, 2 H) 2.32 (s, 3 H) 1.58 (s, 3 H). MS (ESI+) m/z 380.1 (M+H)*. Example 163 5-[i-benzyl-5-(2-methylphenyl)-1H-1,2,3-triazol-4-yl]-1H-indazol-3-amine 20 Example 163A 5-(1-Benzyl-5-o-tolyl-1H-1,2,3-triazol-4-yl)-2-fluorobenzonitrile Example 153A (450 mg, 0.834 mmol), 5-bromo-2-fluorobenzonitrile (167 mg, 0.835 mmol), dichlorobis(triphenylphosphine)palladium(II) (56 mg, 0.080 mmol), and copper 25 thiophene-2-carboxylate (242 mg, 1.27 mmol) were combined in toluene (2.0 mL) in a 4 mL vial under an inert atmosphere of nitrogen. The vial was sealed and heated at 150 C for 30 minutes. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 10-50% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 369.2 (M+H)+. 30 Example 163B 5-[i-benzyl-5-(2-methylphenyl)-1H-1,2,3-triazol-4-yl]-1H-indazol-3-amine Example 163A (202 mg, 0.548 mmol) was treated with hydrazine hydrate (1.0 mL) in 123 WO 2008/154241 PCT/US2008/065727 ethanol (1.0 mL) and stirred and heated to 60 0 C overnight. The mixture was diluted with methylene chloride and washed with water. The organic layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 35-85% ethyl acetate in hexanes to afford the title compound. H NMR (300 MHz, DMSO-d 6 ) 6 ppm 11.38 (s, 1 H) 5 8.11 (s, 1 H) 7.41 - 7.49 (in, 1 H) 7.33 - 7.40 (in, J=6.95, 6.95 Hz, 1 H) 7.28 - 7.32 (in, 2 H) 7.21 - 7.28 (in, 3 H) 7.00 - 7.06 (in, 1 H) 6.86 - 6.95 (in, 3 H) 5.27 - 5.44 (in, 4 H) 1.58 (s, 3 H). MS (ESI+) m/z 381.1 (M+H)*. Example 164 10 2-{2-[ 1 -(1 H-indazol-5 -yl)- 1 H- 1,2,3 -triazol-4-yl] ethyl} -1 H-isoindole- 1,3 (2H)-dione The title compound was prepared according to the procedure outlined in Example 88 substituting 2-(but-3-ynyl)isoindoline- 1,3-dione for 3-phenyl-1-propyne. The crude product was subjected to 25% TFA / dichloromethane and purified by reverse-phase HPLC using an acetonitrile/water 0.1% TFA gradient elution method to afford the title compound. 1 H NMR 15 (400 MHz, DMSO-d 6 ) 6 ppm 13.33 (s, 1 H) 8.65 (s, 1 H) 8.22 (s, 1 H) 8.18 (d, J=1.53 Hz, 1 H) 7.78 - 7.90 (in, 5 H) 7.71 - 7.75 (in, 1 H) 3.92 (t, J=7.21 Hz, 2 H) 3.08 (t, J=7.21 Hz, 2 H). MS (ESI+) m/z 359.0 (M+H). Example 165 20 5-{4-[(2,4-dichlorophenoxy)methyl]-1H-1,2,3-triazol-1-yl}-1H-indazole The title compound was prepared according to the procedure outlined in Example 88 substituting 2,4-dichloro-1-(prop-2-ynyloxy)benzene for 3-phenyl-1-propyne. The crude product was subjected to 25% TFA / dichloromethane and was purified by reverse-phase HPLC using an acetonitrile/water 0.l1% TFA gradient elution method to afford the title 25 compound. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 13.38 (s, 1 H) 8.93 (s, 1 H) 8.28 (d, J=1.53 Hz, 1 H) 8.23 (s, 1 H) 7.88 (d, J=8.90, 1.84 Hz, 1 H) 7.76 (d, J=8.90 Hz, 1 H) 7.59 (d, J=2.46 Hz, 1 H) 7.39 - 7.49 (in, 2 H) 5.37 (s, 2 H). MS (ESI+) m/z 359.9 (M+H)+. Example 166 30 5-{4-[(2,6-dichlorophenoxy)methyl]-1H-1,2,3-triazol-1-yl}-1H-indazole The title compound was prepared according to the procedure outlined in Example 88 substituting 1,3-dichloro-2-(prop-2-ynyloxy)benzene for 3-phenyl-1-propyne. The crude product was subjected to 25% TFA / dichloromethane and purified by reverse-phase HPLC 124 WO 2008/154241 PCT/US2008/065727 using an acetonitrile/water 0.1 % TFA gradient elution method to afford the title compound. H NMR (500 MHz, DMSO-d 6 ) S ppm 13.39 (s, 1 H) 8.97 (s, 1 H) 8.29 (d, J=1.53 Hz, 1 H) 8.24 (s, 1 H) 7.89 (d, J=9.00, 1.98 Hz, 1 H) 7.76 (d, J=8.85 Hz, 1 H) 7.51 - 7.55 (in, 2 H) 7.19 - 7.26 (in, J=8.24, 8.24 Hz, 1 H) 5.23 (s, 2 H). MS (ESI+) m/z 359.9 (M+H)f. 5 Example 167 5-[5-(4-fluorophenyl)-1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol-4-yl]-1H indazole Example 156B (168 mg, 0.401 mmol) was dissolved in tetrahydrofuran (5.0 mL), 10 methanol (0.5 mL) and water (0.5 mL) and potassium hydroxide (138 mg, 2.46 mmol) was added. The mixture was stirred for 1 hour, and was diluted with methylene chloride and washed with water. The organic layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 0-7% methanol in dichloromethane to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) S ppm 13.08 (s, 1 H) 8.02 (s, 1 H) 7.77 (s, 1 15 H) 7.50 - 7.58 (in, 2 H) 7.37 - 7.49 (in, 4 H) 4.11 (d, J=7.12 Hz, 2 H) 3.76 (d, J=11.53, 2.71 Hz, 2 H) 3.11 - 3.24 (in, 2 H) 1.88 - 2.03 (in, 1 H) 1.30 - 1.43 (in, J=12.72, 1.86 Hz, 2 H) 1.04 - 1.22 (in, 2 H). MS (ESI+) m/z 378.1 (M+H)*. Example 168 20 1-{[1-(1H-indazol-5-yl)-1H-1,2,3-triazol-4-yl]methyl}-1H-indazole Example 168A 1 -(Prop-2-ynyl)- 1 H-indazole Indazole (530 mg, 4.49 mmol) was dissolved in dimethylformamide (4 mL). Sodium 25 hydride (60% suspension in mineral oil, 231 mg, 5.78 mmol) was added slowly, and the mixture was stirred for 10 minutes. Propargyl bromide (80% wt in toluene, 5.0 mL) was added, and the mixture was stirred at ambient temperature overnight. The mixture was diluted with ethyl acetate, washed excessively with water, absorbed on silica gel, and purified by silica gel chromatography eluting with a gradient of 5-30% ethyl acetate in hexanes to 30 afford the title compound. MS (ESI+) m/z 157.1 (M+H)*. Example 168B 1-{[1-(1H-indazol-5-yl)-1H-1,2,3-triazol-4-yl]methyl}-1H-indazole 125 WO 2008/154241 PCT/US2008/065727 The title compound was prepared according to the procedure outlined in Example 88 substituting Example 168A for 3-phenyl-1-propyne. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.36 (s, 1 H) 8.78 (s, 1 H) 8.22 (d, J=2.03, 0.68 Hz, 1 H) 8.20 (s, 1 H) 8.10 (d, J=1.02 Hz, 1 H) 7.80 - 7.87 (in, 2 H) 7.75 - 7.80 (m, 1 H) 7.68 - 7.74 (in, 1 H) 7.39 - 7.46 (in, 1 H) 7.13 5 7.19 (m, 1 H) 5.81 (s, 2 H). MS (ESI+) m/z 316.0 (M+H)+. Example 169 5-[1-benzyl-5-(piperidin-1-ylcarbonyl)-1H-1,2,3-triazol-4-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 81B 10 substituting Example 149C for Example 8 1A and tetrahydrofuran for dimethylformamide. 1 H NMR (300 MHz, DMSO-d 6 ) S ppm 13.20 (s, 1 H) 8.16 (s, 1 H) 7.95 - 8.00 (in, J=1.02 Hz, 1 H) 7.62 - 7.68 (in, 1 H) 7.57 - 7.63 (m, 1 H) 7.31 - 7.44 (in, 3 H) 7.24 - 7.30 (in, 2 H) 5.36 5.84 (m, J=69.17 Hz, 2 H) 3.43 - 3.59 (in, 2 H) 2.43 - 2.59 (m, 2 H) 1.17 - 1.46 (in, J=39.67 Hz, 4 H) 0.49 - 0.65 (in, 2 H). MS (ESI+) m/z 387.1 (M+H). 15 Example 170 5-[5-(2-methylphenyl)-1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol-4-yl]-1H indazole 20 Example 170A 1-((Tetrahydro-2H-pyran-4-yl)methyl)-5-o-tolyl-4-(tributylstannyl)-1H-1,2,3-triazole 2-Ethynyl toluene (576 mg, 4.57 mmol) was added to 1,1,1-tributyl-N,N dimethylstannanamine (1.53 g, 4.58 mmol), and the mixture stirred in a sealed vial at 70 C for 2 hours. The mixture was cooled to ambient temperature, and the vial was stirred 25 unsealed for 10 minutes. Example 80A (648 mg, 4.59 mmol) was added and the vial was resealed and heated to 130 C overnight. The mixture was purified by silica gel chromatography eluting with a gradient of 5-50% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 548.4 (M+H)+. 30 Example 170B 1-(5-(1-((Tetrahydro-2H-pyran-4-yl)methyl)-5-o-tolyl-1H-1,2,3-triazol-4-yl)-1H-indazol-1 yl)ethanone Example 170A (432 mg, 0.791 mmol), Example 87A (222 mg, 0.776 mmol), 126 WO 2008/154241 PCT/US2008/065727 dichlorobis(triphenylphosphine)palladium(II) (58 mg, 0.083 mmol), and copper thiophene-2 carboxylate (231 mg, 1.21 mmol) were combined in toluene (2.0 mL) in a 4 mL vial under an inert atmosphere of nitrogen. The vial was sealed and heated at 150 0 C for 20 minutes. The mixture was absorbed on silica gel and purified by silica gel chromatography eluting with a 5 gradient of 20-70% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 416.2 (M-H). Example 170C 5-[5-(2-methylphenyl)-1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol-4-yl]-1H 10 indazole Example 170B (184 mg, 0.443 mmol) was dissolved in tetrahydrofuran (3.0 mL), methanol (0.3 mL), and water (0.3 mL) and potassium hydroxide (140 mg, 2.50 mmol) was added. The mixture was stirred for 3 hours, and was diluted with methylene chloride and washed with water. The organic layer was absorbed on silica gel and purified by silica gel 15 chromatography eluting with a gradient of 35-100% ethyl acetate in hexanes to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.08 (s, 1 H) 7.98 (s, 1 H) 7.68 - 7.74 (in, J=1.02, 1.02 Hz, 1 H) 7.49 - 7.56 (in, 1 H) 7.45 - 7.49 (m, 3 H) 7.41 - 7.45 (in, J=7.46 Hz, 2 H) 4.10 (d, J=13.73, 6.95 Hz, 1 H) 3.89 (d, J=13.90, 7.80 Hz, 1 H) 3.77 (d, J=10.51, 2.71 Hz, 2 H) 3.10 - 3.24 (in, 2 H) 1.92 (s, 3 H) 1.88 - 1.98 (in, 1 H) 1.26 - 1.43 (m, 2 H) 1.04 20 1.21 (in, 2 H). MS (ESI+) m/z 374.1 (M+H)+. Example 171 5-[5-(2-methylphenyl)-1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol-4-yl]-1H indazol-3-amine 25 Example 171A 2-Fluoro-5-(1-((tetrahydro-2H-pyran-4-yl)methyl)-5-o-tolyl-1H-1,2,3-triazol-4 yl)benzonitrile Example 170A (411 mg, 0.752 mmol), 5-bromo-2-fluorobenzonitrile (151 mg, 0.755 30 mmol), dichlorobis(triphenylphosphine)palladium(II) (52 mg, 0.074 mmol), and copper thiophene-2-carboxylate (223 mg, 1.17 minol) were combined in toluene (2.0 mL) in a 4 mL vial under an inert atmosphere of nitrogen. The vial was sealed and heated 150 C for 30 minutes. The mixture was absorbed on silica gel and purified by silica gel chromatography 127 WO 2008/154241 PCT/US2008/065727 eluting with a gradient of 10-50% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 377.6 (M+H)f. Example 171B 5 5-[5-(2-methylphenyl)-1-(tetrahydro-2H-pyran-4-ylmethyl)-1H-1,2,3-triazol-4-yl]-1H indazol-3-amine Example 171A (175 mg, 0.465 mmol) was treated with hydrazine hydrate (2.0 mL) in ethanol (2.0 mL), and the mixture was stirred and heated to 65 C for 2 hours. The mixture was diluted with methylene chloride and washed with water. The organic layer was absorbed 10 on silica gel and purified by silica gel chromatography eluting with a gradient of 1-8% methanol in dichloromethane to afford the title compound. H NMR (300 MHz, DMSO d 6 ) S ppm 11.39 (s, 1 H) 8.08 (s, 1 H) 7.45 - 7.55 (in, 1 H) 7.37 - 7.45 (in, 3 H) 7.01 - 7.08 (in, J=8.48 Hz, 1 H) 6.89 - 6.97 (in, 1 H) 5.34 (s, 2 H) 4.09 (d, J=13.73, 6.95 Hz, 1 H) 3.89 (d, J=13.73, 7.63 Hz, 1 H) 3.70 - 3.81 (in, 2 H) 3.08 - 3.24 (in, 2 H) 1.91 (s, 3 H) 1.84 - 1.99 15 (in, 1 H) 1.22 - 1.41 (in, 2 H) 1.04 - 1.20 (in, 2 H). MS (ESI+) m/z 389.1 (M+H)f. Example 172 5-[1-benzyl-5-(morpholin-4-ylcarbonyl)-1H-1,2,3-triazol-4-yl]-1H-indazole The title compound was prepared according to the procedure outlined in Example 81B 20 substituting Example 149C for Example 8 1A, morpholine for piperidine, and tetrahydrofuran for dimethylformamide. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.22 (s, 1 H) 8.18 (s, 1 H) 7.95 - 8.03 (in, 1 H) 7.64 - 7.70 (in, 1 H) 7.57 - 7.64 (in, 1 H) 7.33 - 7.45 (in, 3 H) 7.24 - 7.31 (in, 2 H) 5.76 (s, 1 H) 5.52 (s, 1 H) 3.33 - 3.59 (in, 4 H) 2.61 - 2.74 (in, 2 H) 2.45 - 2.59 (in, 2 H). MS (ESI+) m/z 389.1 (M+H)f. 25 Example 173 5-[1-benzyl-5-(4-methoxyphenyl)-1H-1,2,3-triazol-4-yl]-1H-indazol-3-amine A vial under argon containing Example 125B (50 mg, 0.12 mmol), 4 methoxyphenylboronic acid (20 mg, 0.13 mmol), PdCl 2 (dppf) dichloromethane (10 mg, 0.01 30 mmol) and potassium carbonate (33 mg, 0.24 mmol) in DME (2 mL) and water (0.2 mL) was capped and heated at 80 C in a heater shaker for 48 hours. The solvent was evaporated under reduced pressure, and the product was purified by reverse-phase HPLC using an acetonitrile/water 0.1% TFA gradient elution method to afford the title compound. 1 H NMR 128 WO 2008/154241 PCT/US2008/065727 (400 MHz, DMSO-d 6 ) 6 ppm 11.85 (s, 1 H) 8.18 (s, 1 H) 7.26 - 7.34 (m, 3 H) 7.19 - 7.25 (in, 2 H) 7.16 - 7.19 (in, 2 H) 7.02 (t, J=8.13 Hz, 4 H) 5.47 (s, 2 H) 3.80 (s, 3 H). MS (ESI+) m/z 397.1 (M+H)'. 5 Example 174 N-[(1S)-1-benzyl-2-hydroxyethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81B substituting (S)-(-)-2-amino-3-phenyl-1-propanol for piperidine. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.36 (s, 1 H) 8.47 (d, J=8.82 Hz, 1 H) 8.38 (s, 1 H) 8.22 (s, 1 H) 7.87 (d, 10 J=8.82, 1.70 Hz, 1 H) 7.69 (d, J=8.82 Hz, 1 H) 7.23 - 7.31 (in, 3 H) 7.22 (s, 1 H) 7.12 - 7.21 (m, 1 H) 4.90 (t, J=5.59 Hz, 1 H) 4.07 - 4.28 (m, 1 H) 3.40 - 3.58 (m, 2 H) 2.89 - 3.00 (m, 1 H) 2.75 - 2.86 (m, 1 H). MS (ESI+) m/z 363.0 (M+H)f. Example 175 15 N-[(1S,2R)-2-hydroxy-2,3-dihydro-1H-inden-1-yl]-5-(1H-indazol-5-yl)isoxazole-3 carboxamide The title compound was prepared according to the procedure outlined in Example 81 B substituting (1S,2R)-(-)-cis-1-amino-2-indanol for piperidine. H NMR (300 MHz, DMSO d 6 ) S ppm 13.38 (s, 1 H) 8.42 (s, 1 H) 8.24 (s, 1 H) 8.16 (d, J=8.48 Hz, 1 H) 7.91 (d, J=8.82, 20 1.70 Hz, 1 H) 7.71 (d, J=8.48 Hz, 1 H) 7.45 (s, 1 H) 7.16 - 7.32 (m, 4 H) 5.36 - 5.47 (m, 2 H) 4.50 - 4.61 (m, 1 H) 3.14 (d, J=15.43, 5.26 Hz, 1 H) 2.90 (d, J=16.28, 1.70 Hz, 1 H). MS (ESI+) m/z 361.0 (M+H)+. Example 176 25 5-{3-[(3-phenylmorpholin-4-yl)carbonyl]isoxazol-5-yl}-1H-indazole The title compound was prepared according to the procedure outlined in Example 81B substituting 3-phenylmorpholine hydrochloride for piperidine. 1H NMR (300 MHz, DMSO d 6 ) S ppm 13.38 (s, 1 H) 8.32 - 8.46 (m, 1 H) 8.24 (s, 1 H) 7.81 - 7.96 (m, 1 H) 7.70 (d, J=8.82 Hz, 1 H) 7.37 - 7.55 (m, 4 H) 7.26 - 7.37 (in, 2 H) 5.34 - 5.71 (m, 1 H) 4.51 (d, 30 J=13.22 Hz, 1 H) 3.78 - 4.39 (m, 3 H) 3.59 (t, J=11.36 Hz, 1 H) 3.33 - 3.41 (m, 1 H). MS (ESI+) m/z 375.0 (M+H)*. 129 WO 2008/154241 PCT/US2008/065727 Example 177 N-benzyl-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81B substituting benzylamine for piperidine. H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.36 (s, 1 5 H) 9.35 (t, J=6.27 Hz, 1 H) 8.40 (s, 1 H) 8.23 (s, 1 H) 7.89 (d, J=8.82, 1.70 Hz, 1 H) 7.69 (d, J=8.82 Hz, 1 H) 7.33 - 7.40 (m, 4 H) 7.32 (s, 1 H) 7.22 - 7.30 (in, 1 H) 4.48 (d, J=6.10 Hz, 2 H). MS (ESI+) m/z 319.0 (M+H). Example 178 10 ((1S)-2-{[5-(1H-indazol-5-yl)isoxazol-3-yl]carbonyl}-6,7-dimethoxy-1,2,3,4 tetrahydroisoquinolin- 1 -yl)methanol The title compound was prepared according to the procedure outlined in Example 81B substituting (S)-(6,7-dimethoxy-1,2,3,4-tetrahydroisoquinolin-1-yl)methanol for piperidine. MS (ESI+) m/z 435.1 (M+H). 15 Example 179 N-[(1R)-3-hydroxy-1-phenylpropyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81 B substituting (R)-3-amino-3-phenylpropanol for piperidine. H NMR (300 MHz, DMSO 20 d 6 ) 6 ppm 13.37 (s, 1 H) 9.24 (d, J=8.48 Hz, 1 H) 8.39 (s, 1 H) 8.23 (s, 1 H) 7.88 (d, J=8.82, 1.70 Hz, 1 H) 7.69 (d, J=8.82 Hz, 1 H) 7.38 - 7.46 (in, 2 H) 7.34 (t, J=7.46 Hz, 2 H) 7.19 7.30 (in, 2 H) 5.09 - 5.27 (in, 1 H) 4.62 (t, J=4.92 Hz, 1 H) 3.37 - 3.52 (in, 2 H) 2.00 - 2.16 (in, 1 H) 1.84 - 2.00 (in, 1 H). MS (ESI+) m/z 363.1 (M+H). 25 Example 180 N-[(1S)-3-hydroxy-1-phenylpropyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81B substituting (S)-3-amino-3-phenylpropanol for piperidine. 1 H NMR (300 MHz, DMSO d 6 ) 6 ppm 13.36 (s, 1 H) 9.24 (d, J=8.14 Hz, 1 H) 8.39 (s, 1 H) 8.22 (s, 1 H) 7.88 (d, J=8.65, 30 1.53 Hz, 1 H) 7.69 (d, J=8.81 Hz, 1 H) 7.37 - 7.45 (in, 2 H) 7.29 - 7.37 (in, 2 H) 7.19 - 7.29 (in, 2 H) 5.08 - 5.30 (m,1 H) 4.55 - 4.68 (m,1 H) 3.37 - 3.51 (m, 2 H) 2.00 - 2.14 (m,1 H) 1.83 - 1.99 (in, 1 H). MS (ESI+) m/z 363.0 (M+H)*. 130 WO 2008/154241 PCT/US2008/065727 Example 181 N-2,3-dihydro-1H-inden-1-yl-5-(lH-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81B substituting 1-aminoindane for piperidine. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.37 (s, 1 5 H) 9.13 (d, J=8.14 Hz, 1 H) 8.39 (s, 1 H) 8.23 (s, 1 H) 7.89 (d, J=8.82, 1.36 Hz, 1 H) 7.70 (d, J=8.82 Hz, 1 H) 7.35 (s, 1 H) 7.15 - 7.32 (in, 4 H) 5.55 (q, J=7.91 Hz, 1 H) 2.95 - 3.08 (in, 1 H) 2.76 - 2.94 (in, 1 H) 2.37 - 2.49 (in, 1 H) 2.01 - 2.15 (in, 1 H). MS (ESI+) m/z 345.0 (M+H)+. 10 Example 182 N-2,3-dihydro-1H-inden-2-yl-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81B substituting 2-aminoindane for piperidine. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.37 (s, 1 H) 9.08 (d, J=7.46 Hz, 1 H) 8.39 (s, 1 H) 8.23 (s, 1 H) 7.89 (d, J=8.82, 1.70 Hz, 1 H) 7.69 (d, 15 J=8.82 Hz, 1 H) 7.31 (s, 1 H) 7.10 - 7.28 (in, 4 H) 4.63 - 4.79 (in, 1 H) 3.24 (d, J=15.77, 7.63 Hz, 2 H) 2.96 - 3.08 (in, 2 H). MS (ESI+) m/z 345.0 (M+H). Example 183 5-(1H-indazol-5-yl)-N-(1-phenylpropyl)isoxazole-3-carboxamide 20 The title compound was prepared according to the procedure outlined in Example 81B substituting alpha-ethylbenzylamine for piperidine. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.36 (s, 1 H) 9.18 (d, J=8.82 Hz, 1 H) 8.38 (s, 1 H) 8.22 (s, 1 H) 7.88 (d, J=8.82, 1.36 Hz, 1 H) 7.69 (d, J=8.48 Hz, 1 H) 7.39 - 7.48 (in, 2 H) 7.34 (t, J=7.29 Hz, 2 H) 7.19 - 7.29 (in, 2 H) 4.84 - 5.00 (in, 1 H) 1.69 - 2.04 (in, 2 H) 0.91 (t, J=7.29 Hz, 3 H). MS (ESI+) m/z 347.1 25 (M+H)+. Example 184 5-{1-benzyl-5-[3-(dimethylamino)phenyl]-1H-1,2,3-triazol-4-yl}-1H-indazol-3-amine The title compound was prepared as a TFA salt according to the procedure outlined in 30 Example 173 substituting 3-(dimethylamino)phenylboronic acid for 4-methoxyphenylboronic acid. 1H NMR (500 MHz, DMSO-d 6 ) 6 ppm 11.52 (s, 1 H) 8.17 (s, 1 H) 7.22 - 7.35 (in, 4 H) 7.08 - 7.15 (in, 2 H) 7.03 (d, J=6.71 Hz, 2 H) 6.82 (d, J=8.39, 2.29 Hz, 1 H) 6.48 - 6.54 (in, 2 H) 5.47 (s, 2 H) 2.78 (s, 6 H). MS (ESI+) m/z 410.2 (M+H)+. 131 WO 2008/154241 PCT/US2008/065727 Example 185 5-{ 1-benzyl-5-[4-(dimethylamino)phenyl]-1H-1,2,3-triazol-4-yl}-1H-indazol-3-amine The title compound was prepared as a TFA salt according to the procedure outlined in Example 173 substituting 4-(dimethylamino)phenylboronic acid for 4-methoxyphenylboronic 5 acid. 1 H NMR (500 MHz, DMSO-d 6 ) 6 ppm 11.65 (s, 1 H) 8.17 (s, 1 H) 7.23 - 7.38 (in, 3 H) 7.12 - 7.16 (m, 2 H) 7.01 - 7.09 (m, 4 H) 6.74 - 6.78 (m, 2 H) 5.45 (s, 2 H) 2.95 (s, 6 H). MS (ESI+) m/z 410.2 (M+H)+. Example 186 10 N- {3-[4-(3-amino- 1 H-indazol-5-yl)- 1 -benzyl- 1 H- 1,2,3-triazol-5 -yl]phenyl} acetamide The title compound was prepared according to the procedure outlined in Example 173 substituting 3-acetamidophenylboronic acid for 4-methoxyphenylboronic acid. 1 H NMR (500 MHz, DMSO-d 6 ) 6 ppm 10.05 (s, 1 H) 8.14 (s, 1 H) 7.69 (d, J=8.54 Hz, 1 H) 7.54 (s, 1 H) 7.41 (t, J=7.93 Hz, 1 H) 7.24 - 7.32 (m, 3 H) 7.08 - 7.16 (in, 2 H) 6.93 - 7.04 (m, 3 H) 5.48 15 (s, 2 H) 2.01 (s, 3 H). MS (ESI+) m/z 424.2 (M+H)+. Example 187 N- {4-[4-(3-amino- 1 H-indazol-5-yl)- 1 -benzyl- 1 H- 1,2,3-triazol-5 -yl]phenyl} acetamide The title compound was prepared according to the procedure outlined in Example 173 20 substituting 4-acetamidophenylboronic acid for 4-methoxyphenylboronic acid. 1 H NMR (500 MHz, DMSO-d 6 ) 6 ppm 10.14 (s, 1 H) 8.07 (s, 1 H) 7.66 (d, J=8.85 Hz, 2 H) 7.24 - 7.32 (m, 3 H) 7.18 - 7.22 (m, 2 H) 7.04 - 7.11 (m, 2 H) 6.98 - 7.02 (in, 2 H) 5.48 (s, 2 H) 5.35 (s, 2 H) 2.04 - 2.10 (m, 3 H). MS (ESI+) m/z 424.1 (M+H). 25 Example 188 5-{1-benzyl-5-[3-(1H-pyrazol-1-yl)phenyl]-1H-1,2,3-triazol-4-yl}-1H-indazol-3-amine The title compound was prepared according to the procedure outlined in Example 173 substituting 3-(1H-pyrazol-1-yl)phenylboronic acid for 4-methoxyphenylboronic acid. 1 H NMR (500 MHz, DMSO-d 6 ) 6 ppm 11.40 (s, 1 H) 8.45 (d, J=2.75 Hz, 1 H) 8.09 (s, 1 H) 7.99 30 (d, J=8.24, 1.53 Hz, 1 H) 7.80 - 7.85 (m, 1 H) 7.74 (d, J=1.83 Hz, 1 H) 7.56 (t, J=7.93 Hz, 1 H) 7.20 - 7.30 (m, 3 H) 7.06 - 7.16 (m, 3 H) 6.98 - 7.04 (m, 2 H) 6.53 - 6.54 (m, 1 H) 5.55 (s, 2 H) 5.35 (s, 2 H). MS (ESI+) m/z 433.2 (M+H)*. 132 WO 2008/154241 PCT/US2008/065727 Example 189 5-[1-benzyl-5-(1-methyl-iH-pyrazol-4-yl)-1H-1,2,3-triazol-4-yl]-1H-indazol-3-amine The title compound was prepared according to the procedure outlined in Example 173 substituting 1-methyl-iH-pyrazol-4-ylboronic acid for 4-methoxyphenylboronic acid. 1 H 5 NMR (500 MHz, DMSO-d 6 ) 6 ppm 11.78 (s, 1 H) 8.11 (s, 1 H) 7.87 (s, 1 H) 7.43 (s, 1 H) 7.27 - 7.41 (in, 4 H) 7.24 (d, J=8.54 Hz, 1 H) 7.05 - 7.11 (in, J=7.02 Hz, 2 H) 5.54 (s, 2 H) 3.86 (s, 3 H). MS (ESI+) m/z 370.9 (M+H)+. Example 190 10 3 -[4-(3 -amino-i H-indazol-5 -yl)-1 -benzyl- 1 H- 1,2,3 -triazol-5-yl] -N-phenylbenzamide The title compound was prepared according to the procedure outlined in Example 173 substituting 3-(phenylcarbamoyl)phenylboronic acid for 4-methoxyphenylboronic acid. 1 H NMR (500 MHz, DMSO-d) 6 ppm 11.41 (s, 1 H) 10.22 (s, 1 H) 8.07 - 8.12 (m, 2 H) 7.95 (s, 1 H) 7.73 (d, J=7.63 Hz, 2 H) 7.60 (t, J=7.78 Hz, 1 H) 7.43 (d, J=7.63 Hz, 1 H) 7.32 - 7.39 15 (in, 2 H) 7.21 - 7.30 (in, 3 H) 7.05 - 7.15 (in, 3 H) 7.00 (d, J=6.71 Hz, 2 H) 5.54 (s, 2 H) 5.36 (s, 2 H). MS (ESI+) m/z 486.2 (M+H)+. Example 191 3- [4-(3 -amino-i H-indazol-5 -yl)-1 -benzyl- 1 H- 1,2,3 -triazol-5-yl] -N-benzylbenzamide 20 The title compound was prepared according to the procedure outlined in Example 173 substituting 3-(benzylcarbamoyl)phenylboronic acid for 4-methoxyphenylboronic acid. 1 H NMR (500 MHz, DMSO-d 6 ) 6 ppm 11.41 (s, 1 H) 9.04 (t, J=5.95 Hz, 1 H) 8.07 (s, 1 H) 8.01 (d, J=7.93 Hz, 1 H) 7.85 (s, 1 H) 7.56 (t, J=7.78 Hz, 1 H) 7.41 (d, J=7.63 Hz, 1 H) 7.21 - 7.35 (in, 8 H) 7.01 - 7.11 (in, 2 H) 6.96 (d, J=7.32, 2.14 Hz, 2 H) 5.52 (s, 2 H) 5.35 (s, 2 H) 4.45 25 (d, J=5.80 Hz, 2 H). MS (ESI+) m/z 500.2 (M+H). Example 192 5-[1 -benzyl-5-(1-methyl-i H-indol-5 -yl)-1 H- 1,2,3 -triazol-4-yl]-1 H-indazol-3-amine The title compound was prepared as a TFA salt according to the procedure outlined in 30 Example 173 substituting 1-methyl-iH-indol-5-ylboronic acid for 4-methoxyphenylboronic acid. 1H NMR (500 MHz, DMSO-d 6 ) 6 ppm 11.35 (s, 1 H) 8.14 (s, 1 H) 7.54 (d, J=8.54 Hz, 1 H) 7.50 (d, J=1.53 Hz, 1 H) 7.42 (d, J=3.05 Hz, 1 H) 7.24 - 7.33 (in, 3 H) 6.97 - 7.05 (in, 5 H) 6.44 (d, J=2.75 Hz, 1 H) 5.46 (s, 2 H) 5.33 (s, 2 H) 3.83 (s, 3 H). MS (ESI+) m/z 420.1 133 WO 2008/154241 PCT/US2008/065727 (M+H)y. Example 193 5-[1-benzyl-5-(3-methoxyphenyl)-1H-1,2,3-triazol-4-yl]-1H-indazol-3-amine 5 The title compound was prepared according to the procedure outlined in Example 173 substituting 3-methoxyphenylboronic acid for 4-methoxyphenylboronic acid. 1 H NMR (500 MHz, DMSO-d 6 ) 6 ppm 11.40 (s, 1 H) 8.08 (s, 1 H) 7.34 - 7.40 (m, 1 H) 7.24 - 7.32 (m, 3 H) 7.03 - 7.11 (m, 3 H) 6.98 - 7.02 (m, 2 H) 6.80 - 6.85 (m, 2 H) 5.49 (s, 2 H) 5.35 (s, 2 H) 3.66 (s, 3 H). MS (ESI+) m/z 397.1 (M+H)*. 10 Example 194 5-[1-benzyl-5-(3-morpholin-4-ylphenyl)-1H-1,2,3-triazol-4-yl]-1H-indazol-3-amine A vial under argon containing Example 125B (35 mg, 0.09 mmol), 3 morpholinophenylboronic acid (21 mg, 0.09 mmol), PdCl 2 (dppf)-dichloromethane (7 mg, 15 0.009 mmol) and potassium carbonate (24 mg, 0.18 mmol) in DME (1 mL) and water (0.1 mL) was capped and heated at 80 C in a heater shaker for 3 days. The solvent was evaporated under reduced pressure, and the product was purified by reverse-phase HPLC using an acetonitrile/water 0.1 % TFA gradient elution method to afford the title compound as a TFA salt. 1 H NMR (500 MHz, DMSO-d 6 ) 6 ppm 11.52 (s, 1 H) 8.14 (s, 1 H) 7.26 - 7.34 20 (m, 4 H) 6.98 - 7.12 (m, 5 H) 6.67 - 6.75 (m, 2 H) 5.47 (s, 2 H) 3.57 - 3.73 (m, 4 H) 2.91 3.03 (m, 4 H). MS (ESI+) m/z 452.2 (M+H)+. Example 195 5-[3-(1,3-dihydro-2H-isoindol-2-ylcarbonyl)isoxazol-5-yl]-1H-indazole 25 The title compound was prepared according to the procedure outlined in Example 81B substituting isoindoline for piperidine. H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.38 (s, 1 H) 8.43 (s, 1 H) 8.25 (s, 1 H) 7.93 (d, J=8.82, 1.36 Hz, 1 H) 7.71 (d, J=8.48 Hz, 1 H) 7.30 - 7.47 (m, 5 H) 5.18 (s, 2 H) 4.92 (s, 2 H). MS (ESI+) m/z 331.0 (M+H)+. 30 Example 196 5-{3-[(4-methyl-2-phenylpiperazin-1-yl)carbonyl]isoxazol-5-yl}-1H-indazole The title compound was prepared according to the procedure outlined in Example 81B substituting 1-methyl-3-phenylpiperazine for piperidine. 1 H NMR (300 MHz, DMSO 134 WO 2008/154241 PCT/US2008/065727 d 6 ) 6 ppm 13.12 (s, 1 H) 8.28 - 8.36 (m, 1 H) 8.18 (s, 1 H) 7.83 (d, J=8.79, 1.46 Hz, 1 H) 7.67 (d, J=8.79 Hz, 1 H) 7.48 (d, J=7.69 Hz, 2 H) 7.30 - 7.40 (in, 2 H) 7.21 - 7.29 (m, 1 H) 7.14 (s, 1 H) 5.56 - 5.73 (m, J=5.86 Hz, 1 H) 3.99 - 4.19 (in, J=8.42 Hz, 1 H) 3.38 - 3.47 (m, 1 H) 3.05 - 3.21 (m, J=7.69 Hz, 1 H) 2.80 (d, J=11.72 Hz, 1 H) 2.41 (d, J=12.08, 4.39 Hz, 1 H) 5 2.24 (s, 3 H) 2.02 - 2.16 (m, 1 H). MS (ESI+) m/z 388.1 (M+H). Example 197 1-{[1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazol-5-yl]carbonyl}piperidin-4-amine 10 Example 197A tert-Butyl 1-(1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazole-5-carbonyl)piperidin-4 ylcarbamate The title compound was prepared according to the procedure outlined in Example 81B substituting Example 149C for Example 81B and 4-Boc-aminopiperidine for piperidine. MS 15 (ESI+) m/z 502.3 (M+H)f. Example 197B 1-{[1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazol-5-yl]carbonyl}piperidin-4-amine Example 197A (101 mg, 0.201 mmol) was dissolved in 4 M hydrochloric acid in 20 dioxane (4 mL) and methanol (1 mL) and stirred at ambient temperature for 2 hours. The solvents were removed under reduced pressure to afford the title compound as an HCl salt. 1 H NMR (300 MHz, DMSO-d 6 ) S ppm 8.18 (s, 1 H) 7.92 - 8.08 (m, J=1.36 Hz, 3 H) 7.53 7.70 (m, 2 H) 7.24 - 7.47 (m, 5 H) 5.40 - 5.73 (m, J=3.39 Hz, 2 H) 4.34 - 4.63 (m, 1 H) 3.44 3.53 (m, J=3.39 Hz, 1 H) 2.95 - 3.17 (m, 2 H) 2.76 - 2.94 (in, J=11.02, 11.02 Hz, 1 H) 1.87 25 2.03 (m, J=11.87 Hz, 1 H) 1.30 - 1.52 (m, J=10.85 Hz, 2 H) 0.66 - 0.91 (m, J=10.17 Hz, 1 H). MS (ESI+) m/z 402.2 (M+H). Example 198 N-[5-(1-benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]benzamide 30 Example 198A tert-butyl 3-amino-5-(1-benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-1H-indazole-1-carboxylate Example 102B (200 mg, 0.55 mmol) and N,N-dimethylpyridin-4-amine (5 mg, 0.04 135 WO 2008/154241 PCT/US2008/065727 mmol) were dissolved in methylene chloride. The mixture was stirred at room temperature while a solution of di-tert-butyl dicarbonate (120 mg, 0.55 mmol) in 5 mL methylene chloride was added dropwise. The reaction mixture was allowed to stir at room temperature for 8 hours, was concentrated under vacuum, dissolved in methylene chloride (10 mL) and washed 5 with dilute aqueous HCl solution (1 N, 10 mL) and saturated NaHCO 3 aqueous solution (10 mL). The organic layer was concentrated and purified by reverse phase-HPLC (CH 3 CN/ H 2 0

/NH

4 0Ac) to afford the title compound. H NMR (300 MHz, DMSO-d 6 ) 6 ppm 8.29 (s, 2 H), 7.43 - 7.59 (in, 3 H), 7.23 - 7.38 (in, 6 H), 6.98 (d, J=7.17, 2.39 Hz, 2 H), 6.38 (s, 2 H), 5.52 (s, 2 H), 1.55 (s, 9 H). MS (ESI+) m/z 467 (M+H)*. 10 Example 198B N-[5-(1-benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]benzamide Example 198A (37.5 mg, 0.08 mmol) and pyridine ( 12.7 mg, 0.16 mmol) were dissolved in methylene chloride (2 mL). The mixture was allowed to stir at room temperature. 15 Benzoyl chloride (14 mg, 0.1 mmol) was added to the mixture. The reaction mixture was allowed to stir at room temperature overnight, concentrated under vacuum and purified by reverse phase-HPLC (CH 3 CN/ H 2 0 /NH 4 0Ac) to afford the Boc-protected precursor. The precursor was treated with 1:1 TFA / dichloromethane (2 mL) for 1 hour and was concentrated under vacuum to afford the title compound as a TFA salt. 1H NMR (300 MHz, 20 DMSO-d 6 ) 6 ppm 12.84 (s, 1 H), 10.70 (s, 1 H), 8.01 (d, J=6.99 Hz, 2 H), 7.87 (s, 1 H), 7.50 7.69 (m, 3 H), 7.36 - 7.48 (m, 5 H), 7.18 - 7.35 (in, 5 H), 6.92 - 7.03 (in, 2 H), 5.48 (s, 2 H). MS (ESI+) m/z 471 (M+H)+. Example 199 25 N-[5-(1-benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]benzenesulfonamide The title compound was prepared according to the procedure outlined in Example 198B substituting benzenesulfonyl chloride for benzoyl chloride. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 12.69 (s, 1 H), 10.61 (s, 1 H), 7.99 (s, 1 H), 7.70 - 7.76 (m, 2 H), 7.45 7.62 (m, 6 H), 7.24 - 7.36 (m, 7 H), 6.99 (d, J=6.99, 2.21 Hz, 2 H), 5.50 (s, 2 H). MS (ESI+) 30 m/z 507 (M+H)+. Example 200 N-[5-(1-benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-(4-methoxyphenyl)urea 136 WO 2008/154241 PCT/US2008/065727 Example 198A (25 mg, 0.54 mmol) was dissolved in dioxane (2 mL) and 1 isocyanato-4-methoxybenzene(24 mg, 0.16 mmol) was added to the solution. The reaction mixture was stirred at 80 C for 12 hours, concentrated, and purified by reverse phase-HPLC

(CH

3 CN/ H 2 0 /NH 4 0Ac) to afford the Boc-protected precursor. The precursor was treated 5 with 1:1 TFA / dichloromethane (2 mL) for 1 hour and concentrated under vacuum to afford the title compound as a TFA salt. 'H NMR (300 MHz, DMSO-d 6 ) 6 ppm 12.54 (s, 1 H), 9.51 (s, 1 H), 9.42 (s, 1 H), 8.28 (s, 1 H), 7.45 - 7.51 (m, 3 H), 7.36 - 7.42 (m, 2 H), 7.24 7.35 (m, 7 H), 6.98 (d, J=7.17, 2.39 Hz, 2 H), 6.87 - 6.94 (m, 2 H), 5.50 (s, 2 H), 3.74 (s, 3 H). MS (ESI+) m/z 516 (M+H)*. 10 Example 201 N-[5-(1-benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]butanamide The title compound was prepared as a TFA salt according to the procedure outlined in Example 198B substituting butyryl chloride for benzoyl chloride. 1H NMR (300 MHz, 15 DMSO-d 6 ) 6 ppm 10.77 - 10.84 (in, 1 H), 8.07 (s, 1 H), 7.97 (d, J=8.82 Hz, 1 H), 7.64 (d, J=8.82, 1.47 Hz, 1 H), 7.43 - 7.57 (in, 3 H), 7.22 - 7.38 (m, 5 H), 6.91 - 7.06 (m, 2 H), 5.50 (s, 2 H), 2.33 (t, J=7.17 Hz, 2 H), 1.54 - 1.60 (in, 2 H), 0.91 (t, J=7.35 Hz, 3 H). MS (ESI+) m/z 437 (M+H)*. 20 Example 202 N-[5-(1-benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-methylpropanamide The title compound was prepared according to the procedure outlined in Example 198B substituting isobutyryl chloride for benzoyl chloride. 'H NMR (300 MHz, DMSO d 6 ) 6 ppm 12.66 (s, 1 H), 10.12 (s, 1 H), 7.80 (s, 1 H), 7.42 - 7.55 (m, 4 H), 7.33 - 7.39 (m, 1 25 H), 7.22 - 7.32 (in, 5 H), 6.97 (d, J=6.99, 2.57 Hz, 2 H), 5.48 (s, 1 H), 2.59 - 2.69 (m, 1 H), 1.07 (d, J=6.99 Hz, 6 H). MS (ESI+) m/z 437 (M+H)*. Example 203 N-[5-(1-benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]cyclopropanecarboxamide 30 The title compound was prepared according to the procedure outlined in Example 198B substituting cyclopropanecarbonyl chloride for benzoyl chloride. 'H NMR (300 MHz, DMSO-d 6 ) 6 ppm 10.45 - 10.64 (s, 1 H), 7.91 (s, 1 H), 7.43 - 7.55 (m, 3 H), 7.31 - 7.43 (m, 2 H), 7.23 - 7.30 (in, 5 H), 6.97 (d, J=7.17, 2.39 Hz, 2 H), 5.48 (s, 2 H), 1.77 - 1.91 (m, 1 H), 137 WO 2008/154241 PCT/US2008/065727 0.69 - 0.87 (in, 4 H). MS (ESI+) m/z 435 (M+H)*. Example 204 N-[1-benzoyl-5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]benzamide 5 Example 89B (33mg, 0.1 mmol) was dissolved in tetrahydrofuran ( 0.6 mL) in a CEM microwave tube. Benzoyl chloride (28 mg, 0.2 mmol) was added and the mixture was heated at 120 C for 15 minutes in the CEM-Discover microwave. The reaction mixture was cooled to room temperature, and concentrated. The residue was purified by reverse phase HPLC (CH 3 CN/ H 2 0 /NH 4 0Ac) to afford the title compound. 1 H NMR (300 MHz, DMSO 10 d 6 ) 6 ppm 11.35 (s, 1 H), 8.55 (d, J=8.82 Hz, 1 H), 8.36 (s, 1 H), 8.17 (d, J=8.64, 1.65 Hz, 1 H), 8.06 (d, J=7.54, 2.39 Hz, 4 H), 7.51 - 7.72 (in, 6 H), 7.26 - 7.45 (in, 5 H), 5.71 (s, 2 H), 1.76 - 1.87 (in, 1 H), 1.11 (d, J=6.62 Hz, 2 H), 0.44 (d, J=4.41 Hz, 2 H). MS (ESI+) m/z 539 (M+H)y. 15 Example 205 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-3-fluorobenzamide Example 205A tert-Butyl 3-amino-5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazole-1 20 carboxylate The title compound was prepared according to the procedure outlined in Example 198A substituting Example 89B for Example 102A. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 8.26 (s, 1 H), 7.96 - 8.07 (in, 1 H), 7.86 - 7.95 (in, 1 H), 7.35 - 7.46 (in, 3 H), 7.28 - 7.35 (in, 2 H), 6.35 - 6.47 (m, 2 H), 5.70 (s, 2 H), 1.72 - 1.84 (in, 1 H), 1.60 (s, 9 H), 0.99 - 1.10 (d, 25 J=1.84 Hz, 2 H), 0.38 (d, J=3.68 Hz, 2 H). MS (ESI+) m/z 431 (M+H)+. Example 205B N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-3-fluorobenzamide Example 205A (25 mg, 0.058 mmol) and pyridine (9.2 mg, 0.116 mmol) were 30 dissolved in methylene chloride (1 mL). The mixture was allowed to stir at room temperature, and 3-fluorobenzoyl chloride (11.1 mg, 0.58 mmol) was added to the mixture. The reaction mixture was allowed to stir at room temperature overnight, and was concentrated and purified by reverse phase-HPLC (CH 3 CN/ H 2 0 /NH 4 0Ac) to afford the Boc-protected precursor. The 138 WO 2008/154241 PCT/US2008/065727 precursor was treated with 1:1 TFA / dichloromethane (2 ml) for 1 hour and concentrated under vacuum to afford the title compound as a TFA salt. 1 H NMR (300 MHz, DMSO d 6 ) 6 ppm 10.58 (s, 1 H), 7.75 (s, 1 H), 7.51 - 7.60 (in, 1 H), 7.46 (d, J=8.82, 1.47 Hz, 1 H), 7.15 - 7.28 (m, 2 H), 7.10 (d, J=2.21 Hz, 1 H), 6.88 - 7.05 (m, 6 H), 5.31 (s, 2 H), 1.35 - 1.47 5 (m, J=5.15 Hz, 1 H), 0.68 (d, J=8.27, 1.65 Hz, 2 H),0.03 (d, J=5.52 Hz, 2 H). MS (ESI+) m/z 453 (M+H). Example 206 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]benzamide 10 The title compound was prepared according to the procedure outlined in Example 205B substituting benzoyl chloride for 3-fluorobenzoyl chloride. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 12.89 (s, 1 H), 10.83 (s, 1 H), 8.02 - 8.15 (m, 3 H), 7.83 (d, J=8.82, 1.47 Hz, 1 H), 7.50 - 7.66 (m, 4 H), 7.24 - 7.43 (m, 5 H), 5.67 (s, 2 H), 1.77 (m, 1 H), 0.99 - 1.10 (m, 2 H), 0.39 (in, 2 H). MS (ESI+) m/z 435 (M+H)f. 15 Example 207 N-benzyl-5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-amine To a solution of Example 89B (18.3 mg, 0.05 mmol) in dimethylformamide (2 mL) was added acetic acid (15 mg, 0.25 mmol) and benzaldehyde (6.4 mg, 0.06 mmol). The 20 reaction mixture was stirred at room temperature overnight. Sodium triacetoxyborohydride (NaBH(OAc) 3 , 32 mg, 0.15 mmol) was added to the mixture. The reaction was stirred at room temperature for 3 hours, concentrated and purified by reverse phase-HPLC (CH 3 CN/

H

2 0 /NH 4 0Ac) to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) S ppm 13.09 (s, 1 H), 9.24 (s, 1 H), 8.02 - 8.10 (m, 3 H), 7.84 - 7.90 (m, 1 H), 7.49 - 7.67 (m, 4 H), 7.25 25 7.45 (m, 5 H), 5.70 (s, 2 H), 3.30 (s, 2 H), 1.88 - 1.95 (in, 1 H), 1.01 - 1.09 (m, 2 H), 0.43 (d, J=4.04 Hz, 2 H). MS (ESI+) m/z 421 (M+H). Example 208 30 N-[(1R)-1-benzyl-2-hydroxyethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81B substituting (R)-(+)-2-amino-3-phenyl-1-propanol (37 mg, 0.245 mmol) for piperidine. 1 H NMR (300 MHz, DMSO-d 6 ) S ppm 13.36 (s, 1 H) 8.46 (d, J=8.82 Hz, 1 H) 8.37 (s, 1 H) 8.22 139 WO 2008/154241 PCT/US2008/065727 (s, 1 H) 7.87 (dd, J=8.82, 1.36 Hz, 1 H) 7.69 (d, J=8.82 Hz, 1 H) 7.12 - 7.35 (in, 6 H) 4.89 (t, J=5.59 Hz, 1 H) 4.13 - 4.25 (in, 1 H) 3.40 - 3.58 (in, 2 H) 2.90 - 2.99 (m, 1 H) 2.74 - 2.87 (in, 1 H). MS (ESI+) m/z 363.0 (M+H)+. 5 Example 209 5-(1-benzyl-1H-pyrazol-4-yl)-1H-indazole Example 209A 1-(5-Bromo-1H-indazol-1-yl)ethanone 10 4-Bromo-2-methylaniline (25.0 g, 134 mmol) was dissolved in chloroform (250 mL), and the mixture was cooled to 5'C. Acetic anhydride (35 mL, 343 mmol) was added dropwise, and the mixture was allowed to warm to ambient temperature. Potassium acetate (3.97 g, 40.4 mmol) and isoamylnitrite (35 mL, 262 mmol) were added, and the mixture was heated at 70 C overnight. The mixture was neutralized with saturated sodium bicarbonate 15 and extracted with methylene chloride. The combined organic layers were concentrated under reduced pressure, and the resulting residue was triturated with methanol to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) S ppm 8.45 (s, 1 H) 8.26 (d, J=8.82 Hz, 1 H) 8.17 (d, J=1.70 Hz, 1 H) 7.77 (dd, J=8.82, 2.03 Hz, 1 H) 2.72 (s, 3 H). 20 Example 209B 5-(1-benzyl-1H-pyrazol-4-yl)-1H-indazole Example 209A (425 mg, 1.78 mmol), 1-benzyl-4-(4,4,5,5-tetramethyl-1,3,2 dioxaborolan-2-yl)-1H-pyrazole (508 mg, 1.79 mmol), dichlorobis(triphenylphosphine)palladium(II) (133 mg, 0.189 mmol), and potassium 25 carbonate (742 mg, 5.37 mmol) were combined in a sealed vial with dioxane (10 mL) and water (1 mL) under and inert atmosphere of nitrogen, and the mixture was heated to 110 0 C overnight. The mixture was diluted with methylene chloride and washed with water. The organic layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 45-90% ethyl acetate in hexanes to afford the title compound. 1H NMR 30 (300 MHz, DMSO-d 6 ) S ppm 13.00 (s, 1 H) 8.25 (s, 1 H) 8.02 (s, 1 H) 7.92 (s, 2 H) 7.55 7.61 (in, 1 H) 7.48 - 7.54 (in, 1 H) 7.25 - 7.40 (in, 5 H) 5.35 (s, 2 H). MS (ESI+) m/z 274.9 (M+H)+. 140 WO 2008/154241 PCT/US2008/065727 Example 210 N-[(1R)-3-hydroxy-1-phenylpropyl]-5-(3-methyl-iH-indazol-5-yl)isoxazole-3-carboxamide Example 210A 5 tert-Butyl 5-bromo-3-methyl-1H-indazole-1-carboxylate 5-Bromo-3-methyl-1H-indazole (5.11 g, 24.2 mmol) and catalytic dimethylaminopyridine (~30 mg) were dissolved in methylene chloride (100 mL). Di-tert butyl dicarbonate (5.9 g, 27.0 mmol) was added, and the mixture was stirred at ambient temperature for 3 hours. The solvent was removed under reduced pressure, and the resulting 10 residue was diluted with ethyl acetate and washed with 1 N sodium hydroxide (twice), 0.1 N hydrochloric acid, and brine. The organic layer was dried over sodium sulfate and filtered. The filtrate was concentrated under reduced pressure to afford the title compound. MS (ESI+) m/z 210.8 (M-Boc)+. 15 Example 210B tert-Butyl 3-methyl-5-((trimethylsilyl)ethynyl)-1H-indazole-1-carboxylate Example 210A (7.55 g, 24.3 mmol), dichlorobis(triphenylphosphine)palladium(II) (870 mg, 1.24 mmol), and copper(I) iodide (250 mg, 1.31 mmol) were combined in triethylamine (60 mL) under an inert atmosphere of nitrogen. Trimethylsilyl acetylene (4.0 20 mL, 28.9 mmol) was added, and the mixture was heated at 60'C overnight. The mixture was diluted with methylene chloride and washed with 0.1 M hydrochloric acid. The organic layer was absorbed onto silica gel and purified by silica gel chromatography eluting with a gradient of 10-40% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 228.9 (M Boc)+. 25 Example 210C 5-Ethynyl-3-methyl-i H-indazole Example 210B (7.26 g, 22.1 mmol) was dissolved in methanol (170 mL). A solution of 1 N potassium hydroxide (45 mL) was added, and the mixture was stirred at ambient 30 temperature overnight. The solvent was removed under reduced pressure, and the resulting residue was diluted with ethyl acetate and washed with water and brine. The organic layer was dried over sodium sulfate and concentrated under reduced pressure to afford the title compound. MS (ESI+) m/z 157.1 (M+H)+. 141 WO 2008/154241 PCT/US2008/065727 Example 210D ethyl 5-(3-methyl-iH-indazol-5-yl)isoxazole-3-carboxylate Example 210C (411 mg, 2.63 mmol) was dissolved in toluene (15 mL) and triethylamine (478 uL) and warmed to 90 C. Ethyl chlorooximidoacetate (480 mg, 3.17 5 mmol) dissolved in toluene (15 mL) was added slowly dropwise over 30 minutes. Following the addition, the mixture was diluted with ethyl acetate and washed with 1 N hydrochloric acid. The organic layer was concentrated under reduced pressure and the resulting residue was triturated with methanol to afford the title compound. MS (ESI+) m/z 271.9 (M+H)*. 10 Example 210E 5-(3-methyl-iH-indazol-5-yl)isoxazole-3-carboxylic acid Example 210D (325 mg, 1.20 mmol) was dissolved in tetrahydrofuran (10 mL), methanol (1 mL), and water (1 mL) and potassium hydroxide (150 mg, 2.67 mmol) was added. The mixture was stirred at ambient temperature for 3 hours. The mixture was diluted 15 with ethyl acetate and washed with 1 N hydrochloric acid. The product precipitated in the separatory funnel and was filtered to afford the title compound. MS (ESI+) m/z 243.9 (M+H)y. Example 210F 20 N-[(1R)-3-hydroxy-1 -phenylpropyl]-5-(3-methyl-iH-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81B substituting Example 210E for Example 81A and (R)-3-amino-3-phenylpropan-1-ol for piperidine. 1H NMR (300 MHz, DMSO-d 6 ) S ppm 12.93 (s, 1 H) 8.45 (d, J=8.82 Hz, 1 H) 8.33 (s, 1 H) 7.84 (d, J=8.82, 1.70 Hz, 1 H) 7.59 (d, J=9.16 Hz, 1 H) 7.21 - 7.29 (m, 5 H) 7.13 25 - 7.21 (in, 1 H) 4.89 (t, J=5.59 Hz, 1 H) 4.10 - 4.26 (m, 1 H) 3.42 - 3.56 (m, 2 H) 2.88 - 3.00 (in, 1 H) 2.75 - 2.87 (in, 1 H) 2.55 (s, 3 H). MS (ESI+) m/z 377.1 (M+H)+. Example 211 3 -[4-(3 -amino-i H-indazol-5 -yl)- 1 -benzyl- 1 H- 1,2,3 -triazol-5-yl]phenol 30 A vial under argon containing Example 125B (35 mg, 0.09 mmol), 3 hydroxyphenylboronic acid (12 mg, 0.09 mmol), PdCl 2 (dppf)-dichloromethane (7 mg, 0.009 mmol) and potassium carbonate (24 mg, 0.18 mmol) in DME (1 mL) and water (0.1 mL) was capped and heated at 80 0 C in a heater shaker for 3 days. The solvent was evaporated and the 142 WO 2008/154241 PCT/US2008/065727 product was purified by reverse-phase HPLC using an acetonitrile/water 0.1% TFA gradient elution method to afford the title compound. 1 H NMR (500 MHz, DMSO-d 6 ) 6 ppm 11.40 (s, 1 H) 9.68 (s, 1 H) 8.09 (s, 1 H) 7.24 - 7.35 (in, 5 H) 6.98 - 7.13 (in, 3 H) 6.88 (d, J=8.09, 1.98 Hz, 1 H) 6.73 (s, 1 H) 6.60 - 6.66 (in, 1 H) 5.47 (s, 2 H) 5.35 (s, 2 H). MS (ESI+) m/z 383.1 5 (M+H)+. Example 212 3 -[4-(3 -amino-i H-indazol-5 -yl)-1 -benzyl- 1 H- 1,2,3 -triazol-5-yl]benzamide The title compound was prepared according to the procedure outlined in Example 173 10 substituting 3-carbamoylphenylboronic acid for 4-methoxyphenylboronic acid. 1 H NMR (500 MHz, DMSO-d 6 ) 6 ppm 11.41 (s, 1 H) 8.07 (s, 1 H) 7.97 - 8.03 (m, 2 H) 7.83 - 7.87 (in, 1 H) 7.53 (t, J=7.78 Hz, 1 H) 7.45 (s, 1 H) 7.38 (d, J=7.63 Hz, 1 H) 7.23 - 7.30 (m, 3 H) 7.00 - 7.10 (in, 2 H) 6.96 (d, J=7.48, 1.98 Hz, 2 H) 5.51 (s, 2 H) 5.35 (s, 2 H). MS (ESI+) m/z 410.1 (M+H)'. 15 Example 213 5-{ 1-benzyl-5-[4-(methylsulfonyl)phenyl]-1H-1,2,3-triazol-4-yl}-1H-indazol-3-amine The title compound was prepared according to the procedure outlined in Example 173 substituting 4-(methylsulfonyl)phenylboronic acid for 4-methoxyphenylboronic acid. 1 H 20 NMR (500 MHz, DMSO-d 6 ) 6 ppm 11.44 (s, 1 H) 7.94 - 8.01 (m, 3 H) 7.58 (d, J=8.54 Hz, 2 H) 7.22 - 7.30 (in, 3 H) 7.04 - 7.13 (m, 2 H) 6.98 (d, J=7.48, 1.98 Hz, 2 H) 5.56 (s, 2 H) 5.37 (s, 2 H) 3.28 (s, 3 H). MS (ESI+) m/z 445.2 (M+H)*. Example 214 25 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-chlorobenzamide The title compound was prepared according to the procedure outlined in Example 205B substituting 2-chlorobenzoyl chloride for 3-fluorobenzoyl chloride. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 10.94 (s, 1 H), 8.24 (s, 1 H), 7.85 (d, J=8.82, 1.47 Hz, 1 H), 7.65 (d, J=6.99, 1.84 Hz, 1 H), 7.43 - 7.61 (in, 4 H), 7.26 - 7.42 (in, 5 H), 5.68 (s, 2 H), 1.71 - 1.83 30 (m, 1 H), 1.04 - 1.12 (m, 2 H), 0.37 - 0.45 (in, 2 H). MS (ESI+) m/z 469 (M+H)+. Example 215 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-4-chlorobenzamide 143 WO 2008/154241 PCT/US2008/065727 The title compound was prepared according to the procedure outlined in Example 205B substituting 4-chlorobenzoyl chloride for 3-fluorobenzoyl chloride. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 10.53 (s, 1 H), 7.65 - 7.71 (in, 3 H), 7.42 (d, J=8.82, 1.47 Hz, 1 H), 7.18 - 7.24 (in, 2 H), 7.12 - 7.18 (in, 1 H), 6.93 - 7.02 (in, 3 H), 6.83 - 6.92 (m, 3 H), 5.27 (s, 5 2 H), 1.30 - 1.44 (m, 1 H), 0.59 - 0.67 (in, 2 H), -0.07 - 0.04 (in, 2 H). MS (ESI+) m/z 469 (M+H)y. Example 216 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]ethanesulfonamide 10 The title compound was prepared according to the procedure outlined in Example 205B substituting ethanesulfonyl chloride for 3-fluorobenzoyl chloride. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 10.19 (s, 1 H), 8.15 (s, 1 H), 7.82 (d, J=8.64, 1.65 Hz, 1 H), 7.53 (d, J=8.82 Hz, 1 H), 7.35 - 7.45 (in, 3 H), 7.27 - 7.35 (in, 2 H), 5.69 (s, 2 H), 3.30 (q, J=7.35 Hz, 2 H), 1.74 - 1.87 (m,1 H), 1.27 - 1.36 (in, 3 H), 1.02 - 1.12 (m, 2 H), 0.34 - 0.44 (m, 2 H). MS 15 (ESI+) m/z 423 (M+H)+. Example 217 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]benzenesulfonamide The title compound was prepared according to the procedure outlined in Example 20 205B substituting benzenesulfonyl chloride for 3-fluorobenzoyl chloride. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 12.75 (s, 1 H), 10.69 (s, 1 H), 8.02 (s, 1 H), 7.71 - 7.83 (m, 3 H), 7.43 - 7.60 (in, 4 H), 7.34 - 7.43 (m, 3 H), 7.27 - 7.34 (m, 2 H), 5.69 (s, 2 H), 1.69 - 1.83 (in, 1 H), 0.99 - 1.11 (m, 2 H), 0.31 - 0.45 (in, 2 H). MS (ESI+) m/z 471 (M+H)*. 25 Example 218 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2 chlorobenzenesulfonamide The title compound was prepared according to the procedure outlined in Example 205B substituting 2-chlorobenzene-1-sulfonyl chloride for 3-fluorobenzoyl chloride. 1 H 30 NMR (300 MHz, DMSO-d 6 ) 6 ppm 12.36 (s, 1 H), 10.60 (s, 1 H), 7.67 (s, 1 H), 7.62 (d, J=7.91, 1.65 Hz, 1 H), 7.40 (d, J=8.82, 1.47 Hz, 1 H), 7.14 - 7.27 (in, 2 H), 7.00 - 7.12 (in, 4 H), 6.96 - 7.00 (in, 1 H), 6.90 - 6.95 (in, 2 H), 5.31 (s, 2 H), 1.29 - 1.44 (in, 1 H), 0.61 - 0.74 (in, 2 H), -0.05 - 0.05 (in, 2 H). MS (ESI+) m/z 505 (M+H)+. 144 WO 2008/154241 PCT/US2008/065727 Example 219 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-3 chlorobenzenesulfonamide The title compound was prepared as an HCI salt according to the procedure outlined 5 in Example 205B substituting 3-chlorobenzene-1-sulfonyl chloride for 3-fluorobenzoyl chloride. 'H NMR (300 MHz, DMSO-d 6 ) 6 ppm 12.84 (s, 1 H), 10.86 (s, 1 H), 8.00 (s, 1 H), 7.82 (s, 1 H), 7.72 (d, J=7.72 Hz, 1 H), 7.64 (d, J=1.84 Hz, 1 H), 7.57 (d, J=7.72 Hz, 1 H), 7.50 (d, J=8.82 Hz, 1 H), 7.34 - 7.45 (m, 3 H), 7.28 - 7.34 (m, 2 H), 5.69 (s, 2 H), 1.71 - 1.83 (m, 1 H), 1.06 (m, 2 H), 0.37 (m, 2 H). MS (ESI+) m/z 505 (M+H). 10 Example 220 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-4 chlorobenzenesulfonamide The title compound was prepared as an HCI salt according to the procedure outlined 15 in Example 205B substituting 4-chlorobenzene-1-sulfonyl chloride for 3-fluorobenzoyl chloride. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 12.80 (s, 1 H), 10.79 (s, 1 H), 8.00 (s, 1 H), 7.73 - 7.83 (in, 3 H), 7.56 - 7.64 (m, 2 H), 7.49 (d, J=8.82 Hz, 1 H), 7.34 - 7.45 (m, 3 H), 7.28 - 7.34 (in, 2 H), 5.69 (s, 2 H), 1.71 - 1.86 (m, 1 H), 0.99 - 1.12 (m, 2 H), 0.31 - 0.43 (m, 2 H). MS (ESI+) m/z 505 (M+H)+. 20 Example 221 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2,5-dimethylfuran-3 sulfonamide The title compound was prepared as an HCI salt according to the procedure outlined 25 in Example 205B substituting 2,5-dimethylfuran-3-sulfonyl chloride for 3-fluorobenzoyl chloride. 'H NMR (300 MHz, DMSO-d 6 ) a ppm 12.82 (s, 1 H), 10.48 (s, 1 H), 8.00 (s, 1 H), 7.78 (d, J=8.64, 1.65 Hz, 1 H), 7.50 (d, J=9.19 Hz, 1 H), 7.34 - 7.45 (in, 3 H), 7.28 - 7.33 (m, 2 H), 6.20 (s, 1 H), 5.69 (s, 2 H), 2.11 (s, 6 H), 1.71 - 1.84 (m, 1 H), 1.01 - 1.11 (m, 2 H), 0.32 - 0.41 (in, 2 H). MS (ESI+) m/z 489 (M+H). 30 Example 222 5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-N-(2-chlorobenzyl)-1H-indazol-3-amine The title compound was prepared according to the procedure outlined in Example 207 145 WO 2008/154241 PCT/US2008/065727 substituting 2-chlorobenzaldehyde for benzaldehyde. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 11.55 (s, 1 H), 8.20 (s, 1 H), 7.69 (d, J=8.46, 1.47 Hz, 1 H), 7.49 (d, J=8.82 Hz, 1 H), 7.34 7.46 (m, 4 H), 7.23 - 7.33 (in, 5 H), 5.69 (s, 2 H), 4.56 (s, 2 H), 1.72 - 1.83 (in, 1 H), 0.99 1.09 (m, 2 H), 0.35 - 0.42 (in, 2 H). MS (ESI+) m/z 455 (M+H)*. 5 Example 223 5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-N-(3-chlorobenzyl)-1H-indazol-3-amine The title compound was prepared according to the procedure outlined in Example 207 substituting 3-chlorobenzaldehyde for benzaldehyde. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 10 11.53 (s, 1 H), 8.15 (s, 1 H), 7.59 - 7.77 (in, 1 H), 7.25 - 7.48 (m, 10 H), 5.68 (s, 2 H), 4.49 (s, 2 H), 1.71 - 1.80 (in, 1 H), 1.04 (s, 2 H), 0.38 (s, 2 H). Example 224 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-3-chlorobenzamide 15 The title compound was prepared according to the procedure outlined in Example 205B substituting 3-chlorobenzoyl chloride for 3-fluorobenzoyl chloride. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 10.99 (s, 1 H), 8.12 (s, 2 H), 8.03 (d, J=7.72 Hz, 1 H), 7.83 (d, J=8.46 Hz, 1 H), 7.68 (s, 1 H), 7.58 (t, J=8.09 Hz, 2 H), 7.33 - 7.44 (m, 3 H), 7.25 - 7.33 (in, 2 H), 5.68 (s, 2 H), 1.72 - 1.86 (in, 1 H), 0.99 - 1.12 (in, 2 H), 0.34 - 0.45 (in, 2 H). MS 20 (ESI+) m/z 470 (M+H)+. Example 225 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-furamide The title compound was prepared according to the procedure outlined in Example 25 205B substituting furan-2-carbonyl chloride for 3-fluorobenzoyl chloride. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 10.36 (s, 1 H), 7.71 (s, 1 H), 7.42 (d, J=8.82, 1.47 Hz, 1 H), 7.15 (d, J=8.82 Hz, 1 H), 7.06 (d, J=3.31 Hz, 1 H), 6.93 - 7.03 (m, 3 H), 6.86 - 6.93 (m, 2 H), 6.31 (d, J=3.49, 1.65 Hz, 1 H), 5.28 (s, 1 H), 1.31 - 1.45 (m, 1 H), 0.59 - 0.71 (m, 2 H), -0.05 - 0.05 (m, 2 H). MS (ESI+) m/z 425 (M+H)+. 30 Example 226 5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-N-ethyl-1H-indazol-3-amine The title compound was prepared according to the procedure outlined in Example 207 146 WO 2008/154241 PCT/US2008/065727 substituting acetaldehyde for benzaldehyde. 'H NMR (300 MHz, DMSO-d 6 ) 6 ppm 8.56 (s, 1 H), 8.30 - 8.42 (m, 1 H), 7.90 - 8.17 (m, 2 H), 7.20 - 7.45 (m, 5 H), 5.70 (s, 2 H), 1.78 1.93 (m, 2 H), 1.67 (s, 1 H), 1.06 (m, 3 H), 0.95 (in, 2 H), 0.29 - 0.48 (m, 2 H). MS (ESI+) m/z 359 (M+H)*. 5 Example 227 5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-N-(4-chlorobenzyl)-1H-indazol-3-amine The title compound was prepared according to the procedure outlined in Example 207 substituting 4-chlorobenzaldehyde for benzaldehyde. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 10 10.01 (s, 1 H), 9.25 (s, 1 H), 8.25 - 8.33 (in, 1 H), 8.09 (d, J=8.46 Hz, 1 H), 7.84 - 7.97 (in, 2 H), 7.57 - 7.73 (in, 2 H), 7.26 - 7.51 (m, 6 H), 5.70 (s, 2 H), 1.71 - 1.84 (m, 1 H), 0.97 - 1.15 (m, 2 H), 0.36 - 0.47 (in, 2 H). MS (ESI+) m/z 455 (M+H)*. Example 228 15 5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-N-(3-furylmethyl)-1H-indazol-3-amine The title compound was prepared according to the procedure outlined in Example 207 substituting furan-3-carbaldehyde for benzaldehyde. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 8.21 (s, 1 H), 7.90 (s, 1 H), 7.71 - 7.82 (in, 1 H), 7.55 - 7.68 (in, 2 H), 7.24 - 7.51 (m, 6 H), 5.68 (s, 2 H), 4.33 (s, 2 H), 1.67 - 1.85 (in, 1 H), 0.95 - 1.13 (in, 2 H), 0.30 - 0.42 (in, 2 H). 20 MS (ESI+) m/z 411 (M+H)+. Example 229 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-[5-methyl-2 (trifluoromethyl)-3-furyl]urea 25 Example 205A (30 mg, 0.07 mmol) was dissolved in dioxane (2 mL) and 3 isocyanato-5-methyl-2-(trifluoromethyl)furan (40 mg, 0.21 mmol) was added to the solution. The reaction mixture was stirred at 80 C for 12 hours, concentrated and purified by reverse phase-HPLC (CH 3 CN/ H 2 0 /NH 4 0Ac) to afford the Boc-protected precursor. The precursor was dissolved in methanol and treated with excess HCl in dioxane (4 M, 0.5 mmol). The 30 reaction was allowed to stir for 5 hours and concentrated under vacuum to afford the title compound as an HCl salt. 'H NMR (300 MHz, DMSO-d 6 ) 6 ppm 12.73 (s, 1 H), 10.19 (s, 1 H), 8.40 (s, 1 H), 7.83 (d, J=8.82, 1.47 Hz, 1 H), 7.64 - 7.75 (in, 1 H), 7.49 (d, J=8.82 Hz, 1 H), 7.35 - 7.45 (in, 3 H), 7.27 - 7.35 (m, 2 H), 5.69 (s, 2 H), 2.33 (s, 3 H), 1.73 - 1.84 (m, 1 147 WO 2008/154241 PCT/US2008/065727 H), 1.02 - 1.11 (m, 2 H), 0.35 - 0.43 (m, 2 H). MS (ESI+) m/z 522 (M+H). Example 230 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-3-furamide 5 The title compound was prepared as an HCI salt according to the procedure outlined in Example 205B substituting furan-3-carbonyl chloride for 3-fluorobenzoyl chloride. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 10.64 (s, 1 H), 8.46 (s, 1 H), 8.13 (s, 1 H), 7.74 - 7.84 (m, 2 H), 7.52 - 7.58 (m, 1 H), 7.33 - 7.46 (m, 3 H), 7.24 - 7.33 (m, 3 H), 7.06 (s, 1 H), 5.68 (s, 2 H), 1.70 - 1.86 (m, 1 H), 0.99 - 1.09 (m, 2 H), 0.33 - 0.44 (m, 2 H). MS (ESI+) m/z 425 10 (M+H)y. Example 231 5-(1H-indazol-5-yl)-N-[(lS)-1-phenylpropyl]isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81B 15 substituting (S)-(-)-1-phenylpropyl amine for piperidine. 'H NMR (300 MHz, DMSO d 6 ) 6 ppm 13.37 (s, 1 H) 9.20 (d, J=8.48 Hz, 1 H) 8.39 (s, 1 H) 8.23 (s, 1 H) 7.88 (d, J=8.81, 1.70 Hz, 1 H) 7.69 (d, J=8.81 Hz, 1 H) 7.38 - 7.49 (m, 2 H) 7.18 - 7.38 (m, 4 H) 4.83 - 5.02 (m, 1 H) 1.73 - 1.97 (m, 2 H) 0.86 - 0.97 (m, 3 H). MS (ESI+) m/z 347.0 (M+H). 20 Example 232 5-(1H-indazol-5-yl)-N-[(1R)-1-phenylpropyl]isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81B substituting (R)-(-)-1-phenylpropyl amine for piperidine. 'H NMR (300 MHz, DMSO d 6 ) 6 ppm 13.37 (s, 1 H) 9.20 (d, J=8.48 Hz, 1 H) 8.39 (s, 1 H) 8.23 (s, 1 H) 7.88 (d, J=8.65, 25 1.53 Hz, 1 H) 7.69 (d, J=8.81 Hz, 1 H) 7.39 - 7.48 (in, 2 H) 7.18 - 7.38 (in, 4 H) 4.85 - 4.99 (m, 1 H) 1.74 - 1.97 (m, 2 H) 0.91 (t, J=7.29 Hz, 3 H). MS (ESI+) m/z 347.0 (M+H)*. Example 233 5-(1-benzyl-1H-pyrazol-4-yl)-1H-indazol-3-amine 30 Example 233A 5-(1-Benzyl-1H-pyrazol-4-yl)-2-fluorobenzonitrile 5-Bromo-2-fluorobenzonitrile (484 mg, 2.42 mmol), 1-benzyl-4-(4,4,5,5-tetramethyl 148 WO 2008/154241 PCT/US2008/065727 1,3,2-dioxaborolan-2-yl)-1H-pyrazole (736 mg, 2.59 mmol), dichlorobis(triphenylphosphine)palladium(II) (174 mg, 0.248 mmol), and potassium carbonate (1.36 g, 9.84 mmol) were combined in a sealed vial with dioxane (10 mL) and water (1 mL) under an inert atmosphere of nitrogen, and the mixture was heated to 110 C 5 overnight. The mixture was diluted with methylene chloride and washed with water. The organic layer was absorbed on silica gel and purified by silica gel chromatography eluting with a gradient of 10-50% ethyl acetate in hexanes to afford the title compound. MS (ESI+) m/z 290.0 (M+H). 10 Example 233B 5-(1-benzyl-1H-pyrazol-4-yl)-1H-indazol-3-amine Example 233A (591 mg, 2.13 mmol) was treated with hydrazine hydrate (4.0 mL) in ethanol (3.0 mL) and was stirred and heated to 70 0 C overnight. The mixture was diluted with methylene chloride and washed with water. The organic layer was concentrated under 15 reduced pressure, and the resulting residue was triturated with methanol to afford the title compound. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 11.32 (s, 1 H) 8.10 (s, 1 H) 7.85 (s, 1 H) 7.80 (s, 1 H) 7.44 (d, J=8.48, 1.70 Hz, 1 H) 7.25 - 7.41 (in, 5 H) 7.21 (d, J=8.82 Hz, 1 H) 5.35 (s, 2 H) 5.24 - 5.30 (m, 2 H). MS (ESI+) m/z 290.0 (M+H). 20 Example 234 1-benzyl-4-(1H-indazol-5-yl)-N-[(2S)-tetrahydrofuran-2-ylmethyl]-1H-1,2,3-triazole-5 carboxamide Into a 20 mL vial, a solution of Example 149C (51 mg, 0.16 mmol) dissolved in dimethylformamide (0.5 mL) was added, followed by the addition of (S)-(+) 25 tetrahydrofurfurylamine (18.2 mg, 0.18 mmol) dissolved in dimethylformamide (0.9 mL). A solution of HATU (68 mg, 0.1 8mmol) dissolved in dimethylformamide (0.5 mL) was added followed by a solution of diisopropylethylamine (0.087 mL, 0.5 mmol) dissolved in dimethylformamide (0.5 mL). The mixture was shaken at 50 C overnight. The reaction was filtered through a Si-Carbonate cartridge (6 mL-Ig) supplied by Silicycle Chemical Division, 30 and the filtrate was transferred to 20 mL vials. The reaction was checked by LC/MS and concentrated to dryness. The residue was dissolved in 1:1 DMSO/methanol and purified by reverse phase HPLC (Agilent, 5%-100% TFA/water gradient, 8 minute run). 1 H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 1.35 - 1.54 (m, 1 H) 1.64 - 1.96 (in, 3 H) 3.17 - 3.26 (m, 1 H) 149 WO 2008/154241 PCT/US2008/065727 3.32 - 3.38 (in, 1 H) 3.50 - 3.77 (m, 2 H) 3.81 - 4.00 (in, 1 H) 5.58 - 5.74 (m, 2 H) 7.21 - 7.41 (m, 5 H) 7.54 - 7.66 (in, 1 H) 7.68 - 7.84 (m, 1 H) 8.01 - 8.19 (m, 2 H). MS (ESI-) m/z 401 (M-H)-. 5 Example 235 1-benzyl-4-(1H-indazol-5-yl)-N-(2-isopropoxyethyl)-1H-1,2,3-triazole-5-carboxamide The title compound was prepared according to the procedure outlined in Example 234 substituting 2-aminoethylisopropyl ether for (S)-(+)-tetrahydrofurfurylamine. H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 0.98 (d, 6 H) 3.31 - 3.45 (in, 4 H) 3.45 - 3.57 (in, 1 H) 5.61 10 5.74 (m, 2 H) 7.25 - 7.46 (m, 5 H) 7.57 - 7.65 (m, 1 H) 7.68 - 7.80 (m, 1 H) 8.04 - 8.13 (in, 2 H). MS (ESI+) m/z 405 (M+H)+. Example 236 1-benzyl-4-(1H-indazol-5-yl)-N-[(2R)-tetrahydrofuran-2-ylmethyl]-1H-1,2,3-triazole-5 15 carboxamide The title compound was prepared according to the procedure outlined in Example 234 substituting (R)-(-)-tetrahydrofurfurylamine for (S)-(+)-tetrahydrofurfurylamine. 1H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 1.34 - 1.60 (in, 1 H) 1.65 - 1.94 (in, 3 H) 3.16 - 3.26 (in, 1 H) 3.33 - 3.39 (in, 1 H) 3.51 - 3.77 (m, 2 H) 3.78 - 4.00 (in, 1 H) 5.60 - 5.73 (in, 2 H) 7.26 20 7.45 (m, 5 H) 7.56 - 7.68 (in, 1 H) 7.71 - 7.79 (m, 1 H) 8.01 - 8.15 (in, 2 H). MS (ESI-) m/z 401 (M-H)-. Example 237 1-benzyl-4-(1H-indazol-5-yl)-N-(tetrahydrofuran-3-ylmethyl)-1H-1,2,3-triazole-5 25 carboxamide The title compound was prepared according to the procedure outlined in Example 234 substituting 3-aminomethyltetrahydrofuran for (S)-(+)-tetrahydrofurfurylamine. H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 1.36 - 1.59 (m, 1 H) 1.67 - 2.00 (m, 1 H) 2.19 - 2.45 (m, 1 H) 3.11 - 3.23 (in, 2 H) 3.45 - 3.77 (m, 2 H) 5.45 - 6.14 (in, 2 H) 7.16 - 7.44 (in, 5 H) 7.50 30 7.84 (m, 2 H) 7.96 - 8.25 (in, 2 H). MS (ESI+) m/z 403 (M+H)+. Example 238 1-benzyl-N-cyclopentyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazole-5-carboxamide 150 WO 2008/154241 PCT/US2008/065727 The title compound was prepared according to the procedure outlined in Example 234 substituting cyclopentylamine for (S)-(+)-tetrahydrofurfurylamine. 1H NMR (300 MHz, DMSO-d 6

/D

2 0) S ppm 1.19 - 1.63 (m, 6 H) 1.71 - 1.99 (in, 2 H) 3.99 - 4.37 (in, 1 H) 5.52 5.77 (m, 2 H) 7.22 - 7.45 (in, 5 H) 7.55 - 7.83 (m, 2 H) 7.95 - 8.20 (in, 2 H). MS (ESI-) m/z 5 385 (M-H)-. Example 239 1-benzyl-N-(cyclopentylmethyl)-4-(1H-indazol-5-yl)-1H-1,2,3-triazole-5-carboxamide The title compound was prepared according to the procedure outlined in Example 234 10 substituting aminomethylcyclopentane for (S)-(+)-tetrahydrofurfurylamine. H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 1.02 - 1.28 (m, 2 H) 1.34 - 1.73 (in, 6 H) 1.83 - 2.17 (in, 1 H) 3.03 - 3.17 (in, 2 H) 5.51 - 5.80 (m, 2 H) 7.20 - 7.42 (in, 5 H) 7.52 - 7.81 (m, 2 H) 7.93 - 8.19 (m, 2 H). MS (ESI+) m/z 401 (M+H)f. 15 Example 240 1-benzyl-N-ethyl-4-(1H-indazol-5-yl)-N-methyl-1H-1,2,3-triazole-5-carboxamide The title compound was prepared according to the procedure outlined in Example 234 substituting N-methylethylamine hydrochloride for (S)-(+)-tetrahydrofurfurylamine. 1H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 0.33 - 0.56 (m, 1 H) 0.90 - 1.14 (in, 2 H) 2.15 - 2.25 20 (m, 2 H) 2.58 - 2.69 (in, 1 H) 2.82 - 3.01 (m, 1 H) 3.35 - 3.52 (m, 1 H) 5.40 - 5.67 (in, 2 H) 7.14 - 7.48 (in, 5 H) 7.56 - 7.79 (m, 2 H) 7.90 - 8.24 (in, 2 H). MS (ESI+) m/z 361 (M+H)f. Example 241 1-benzyl-4-(1H-indazol-5-yl)-N-isopropyl-N-methyl-1H-1,2,3-triazole-5-carboxamide 25 The title compound was prepared according to the procedure outlined in Example 234 substituting methylisopropylamine for (S)-(+)-tetrahydrofurfurylamine. H NMR (300 MHz, DMSO-d 6

/D

2 0) S ppm 0.22 - 0.51 (m, 2 H) 0.84 - 1.09 (in, 4 H) 1.96 - 2.13 (m, 2 H) 2.74 2.87 (m, 1 H) 4.44 - 4.92 (m, 1 H) 5.43 - 5.67 (m, 2 H) 7.20 - 7.44 (m, 5 H) 7.51 - 7.73 (m, 2 H) 7.84 - 8.14 (in, 2 H). MS (ESI+) m/z 375 (M+H). 30 Example 242 1-benzyl-4-(1H-indazol-5-yl)-N-(2-methoxyethyl)-N-methyl-1H-1,2,3-triazole-5 carboxamide 151 WO 2008/154241 PCT/US2008/065727 The title compound was prepared according to the procedure outlined in Example 234 substituting N-(2-methoxyethyl)methylamine for (S)-(+)-tetrahydrofurfurylamine. 1H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 2.25 - 2.42 (in, 2 H) 2.74 - 3.06 (in, 4 H) 3.40 - 3.75 (in, 3 H) 5.38 - 5.73 (in, 2 H) 7.18 - 7.45 (m, 5 H) 7.53 - 7.74 (m, 2 H) 7.85 - 8.19 (in, 2 H). MS 5 (ESI+) m/z 391 (M+H)+. Example 243 1-benzyl-4-(1H-indazol-5-yl)-N-phenyl-1H-1,2,3-triazole-5-carboxamide The title compound was prepared according to the procedure outlined in Example 234 10 substituting aniline for (S)-(+)-tetrahydrofurfurylamine. H NMR (300 MHz, DMSO d 6

/D

2 0) S ppm 5.65 - 5.79 (in, 2 H) 7.04 - 7.55 (m, 10 H) 7.54 - 7.84 (m, 2 H) 7.95 - 8.21 (m, 2 H). MS (ESI+) m/z 395 (M+H)*. Example 244 15 1-benzyl-N-(4-chlorophenyl)-4-(1H-indazol-5-yl)-1H-1,2,3-triazole-5-carboxamide The title compound was prepared according to the procedure outlined in Example 234 substituting 4-chloroaniline for (S)-(+)-tetrahydrofurfurylamine. 'H NMR (300 MHz, DMSO-d 6

/D

2 0) S ppm 5.70 - 5.74 (m, 2 H) 7.25 - 7.42 (in, 7 H) 7.43 - 7.52 (in, 2 H) 7.54 7.66 (in, 1 H) 7.68 - 7.77 (in, 1 H) 8.03 - 8.15 (in, 2 H). MS (ESI-) m/z 427 (M-H)-. 20 Example 245 1 -benzyl-4-(1 H-indazol-5-yl)-N-(2-morpholin-4-ylethyl)- 1 H- 1,2,3-triazole-5-carboxamide The title compound was prepared according to the procedure outlined in Example 234 substituting N-(3-aminopropyl)morpholine for (S)-(+)-tetrahydrofurfurylamine. 1H NMR 25 (300 MHz, DMSO-d 6

/D

2 0) S ppm 2.94 - 3.13 (in, 6 H) 3.46 - 3.61 (in, 2 H) 3.63 - 3.79 (in, 4 H) 5.61 - 5.88 (in, 2 H) 7.19 - 7.46 (m, 5 H) 7.56 - 7.88 (in, 2 H) 7.88 - 8.30 (in, 2 H). MS (ESI-) m/z 430 (M-H)-. Example 246 30 1-benzyl-N-[2-(dimethylamino)ethyl]-4-(1H-indazol-5-yl)-N-methyl-1H-1,2,3-triazole-5 carboxamide The title compound was prepared as a TFA salt according to the procedure outlined in Example 234 substituting N,N,N-trimethylethylenediamine for (S)-(+) 152 WO 2008/154241 PCT/US2008/065727 tetrahydrofurfurylamine. H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 2.28 - 2.42 (m, 3 H) 2.73 - 3.00 (m, 6 H) 3.07 - 3.19 (m, 2 H) 3.56 - 3.80 (m, 2 H) 5.55 - 5.68 (m, 2 H) 7.24 - 7.47 (m, 5 H) 7.56 - 7.78 (m, 2 H) 7.91 - 8.02 (m, 1 H) 8.10 - 8.17 (m, 1 H). MS (ESI+) m/z 404 (M+H)y. 5 Example 247 1-benzyl-N-(2-hydroxyethyl)-4-(1H-indazol-5-yl)-N-propyl-1H-1,2,3-triazole-5-carboxamide The title compound was prepared according to the procedure outlined in Example 234 substituting 2-(propylamino)ethanol for (S)-(+)-tetrahydrofurfurylamine. H NMR (300 10 MHz, DMSO-d 6

/D

2 0) 6 ppm 0.22 - 0.39 (m, 1 H) 0.80 - 1.06 (m, 3 H) 1.50 - 1.75 (m, 1 H) 2.65 - 2.78 (m, 1 H) 2.80 - 2.94 (m, 1 H) 2.97 - 3.09 (m, 1 H) 3.37 - 3.50 (m, 1 H) 3.51 - 3.63 (m, 1 H) 3.61 - 3.73 (m, 1 H) 5.39 - 5.74 (m, 2 H) 7.20 - 7.44 (m, 5 H) 7.50 - 7.85 (m, 2 H) 7.86 - 8.25 (m, 2 H). MS (ESI+) m/z 405 (M+H). 15 Example 248 1-benzyl-N-[3-(dimethylamino)propyl]-4-(1H-indazol-5-yl)-N-methyl-1H-1,2,3-triazole-5 carboxamide The title compound was prepared as a TFA salt according to the procedure outlined in Example 234 substituting N,N,N-trimethyl-1,3-propanediamine for (S)-(+) 20 tetrahydrofurfurylamine. H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.06 - 8.23 (m, 1 H) 7.85 - 8.05 (m, 1 H) 7.57 - 7.73 (m, 2 H) 7.19 - 7.48 (m, 5 H) 5.41 - 5.74 (m, 2 H) 3.36 - 3.45 (m, 2 H) 2.88 - 3.10 (m, 3 H) 2.60 - 2.86 (m, 5 H) 2.24 - 2.42 (m, 4 H) 1.73 - 1.91 (m, 1 H). MS (ESI+) m/z 418 (M+H)+. 25 Example 249 1-benzyl-N-[2-(diethylamino)ethyl]-4-(1H-indazol-5-yl)-N-methyl-1H-1,2,3-triazole-5 carboxamide The title compound was prepared as a TFA salt according to the procedure outlined in Example 234 substituting N,N-diethyl-N-methylethylenediamine for (S)-(+) 30 tetrahydrofurfurylamine. 1H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 7.82 - 8.24 (m, 2 H) 7.56 - 7.76 (m, 2 H) 7.15 - 7.49 (m, 5 H) 5.54 - 5.71 (m, 2 H) 3.60 - 3.77 (m, 2 H) 3.20 - 3.24 (m, 2 H) 3.13 - 3.18 (m, 2 H) 3.03 - 3.11 (m, 2 H) 2.32 - 2.44 (m, 3 H) 0.63 - 1.41 (m, 6 H). MS (ESI+) m/z 432 (M+H)+. 153 WO 2008/154241 PCT/US2008/065727 Example 250 N,1-dibenzyl-N-ethyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazole-5-carboxamide The title compound was prepared according to the procedure outlined in Example 234 5 substituting N-ethylbenzylamine for (S)-(+)-tetrahydrofurfurylamine. 1 H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 7.81 - 8.20 (m, 2 H) 7.49 - 7.71 (in, 2 H) 7.24 - 7.51 (in, 9 H) 6.39 7.18 (m, 2 H) 5.41 - 5.74 (in, 2 H) 4.53 - 4.84 (m, 1 H) 3.82 - 4.00 (in, 1 H) 3.37 - 3.54 (in, 1 H) 2.61 - 2.78 (in, 1 H) 0.91 - 1.08 (in, 1 H) 0.27 - 0.45 (in, 2 H). MS (ESI+) m/z 437 (M+H)y. 10 Example 251 N,1-dibenzyl-N-(2-hydroxyethyl)-4-(1H-indazol-5-yl)-1H-1,2,3-triazole-5-carboxamide The title compound was prepared according to the procedure outlined in Example 234 substituting N-benzylethanolamine for (S)-(+)-tetrahydrofurfurylamine. MS (ESI+) m/z 453 15 (M+H)y. Example 252 (3R)-1-{[1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazol-5-yl]carbonyl}piperidin-3-ol The title compound was prepared according to the procedure outlined in Example 234 20 substituting (R)-(+)-3-hydroxypiperidine hydrochloride for (S)-(+)-tetrahydrofurfurylamine. H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 7.83 - 8.22 (m, 2 H) 7.51 - 7.78 (in, 2 H) 7.23 7.45 (m, 5 H) 5.46 - 5.75 (in, 2 H) 3.80 - 4.31 (m, 1 H) 3.40 - 3.68 (in, 1 H) 2.58 - 3.15 (in, 2 H) 2.19 - 2.49 (in, 1 H) 0.31 - 2.14 (in, 4 H). MS (ESI+) m/z 403 (M+H)+. 25 Example 253 1-{[1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazol-5-yl]carbonyl}piperidine-4-carboxamide The title compound was prepared according to the procedure outlined in Example 234 substituting isonipecotamide for (S)-(+)-tetrahydrofurfurylamine. 1H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 7.86 - 8.24 (m, 2 H) 7.53 - 7.70 (in, 2 H) 7.22 - 7.46 (in, 5 H) 5.42 30 5.77 (m, 2 H) 4.19 - 4.48 (m, 1 H) 2.65 - 3.10 (m, 2 H) 2.27 - 2.47 (m, 1 H) 2.05 - 2.24 (m, 1 H) 1.65 - 1.89 (m,1 H) 1.29 - 1.55 (m, 1 H) 0.98 - 1.27 (m, 1 H) 0.52 - 0.87 (m,1 H). MS (ESI+) m/z 430 (M+H)*. 154 WO 2008/154241 PCT/US2008/065727 Example 254 5- { 1-benzyl-5-[(2,6-dimethylmorpholin-4-yl)carbonyl]-1H-1,2,3-triazol-4-yl}-1H-indazole The title compound was prepared according to the procedure outlined in Example 234 substituting 2,6-dimethylmorpholine for (S)-(+)-tetrahydrofurfurylamine. 1H NMR (300 5 MHz, DMSO-d 6

/D

2 0) 6 ppm 7.87 - 8.27 (m, 2 H) 7.50 - 7.76 (m, 2 H) 7.12 - 7.45 (m, 5 H) 5.46 - 5.68 (m, 2 H) 4.16 - 4.43 (m, 1 H) 2.61 - 2.98 (m, 1 H) 2.16 - 2.41 (m, 2 H) 1.77 - 2.13 (m, 1 H) 0.86 - 1.39 (m, 3 H) 0.38 - 0.83 (m, 3 H). MS (ESI+) m/z 417 (M+H)*. Example 255 10 5-{5-[(4-acetylpiperazin-1-yl)carbonyl]-1-benzyl-1H-1,2,3-triazol-4-yl}-1H-indazole The title compound was prepared according to the procedure outlined in Example 234 substituting 1-acetylpiperazine for (S)-(+)-tetrahydrofurfurylamine. 1 H NMR (300 MHz, DMSO-d 6

/D

2 0) S ppm 7.89 - 8.41 (m, 2 H) 7.55 - 7.86 (m, 2 H) 7.07 - 7.51 (m, 5 H) 5.44 5.82 (m, 2 H) 3.46 - 3.70 (m, 3 H) 3.35 - 3.49 (m, 2 H) 2.57 - 2.93 (m, 3 H) 1.61 - 2.03 (m, 3 15 H). MS (ESI+) m/z 430 (M+H)*. Example 256 5-{1-benzyl-5-[(4-phenylpiperazin-1-yl)carbonyl]-1H-1,2,3-triazol-4-yl}-1H-indazole The title compound was prepared according to the procedure outlined in Example 234 20 substituting 1-phenylpiperazine for (S)-(+)-tetrahydrofurfurylamine. 1 H NMR (300 MHz, DMSO-d 6

/D

2 0) S ppm 7.79 - 8.38 (m, 2 H) 7.53 - 7.73 (m, 2 H) 7.22 - 7.46 (m, 5 H) 7.05 7.19 (m, 2 H) 6.64 - 6.79 (m, 3 H) 5.54 - 5.68 (m, 2 H) 3.50 - 3.90 (m, 2 H) 2.93 - 3.15 (m, 2 H) 2.62 - 2.89 (m, 2 H) 2.19 - 2.43 (m, 2 H). MS (ESI-) m/z 462 (M-H)-. 25 Example 257 1-benzyl-N-[(1R)-1-(hydroxymethyl)-2-methylpropyl]-4-(1H-indazol-5-yl)-1H-1,2,3 triazole-5-carboxamide The title compound was prepared according to the procedure outlined in Example 234 substituting (R)-(+)-2-amino-3-methyl-1-butanol for (S)-(+)-tetrahydrofurfurylamine. 1H 30 NMR (300 MHz, DMSO-d 6

/D

2 0) S ppm 7.95 - 8.31 (m, 2 H) 7.52 - 7.96 (m, 2 H) 7.18 - 7.46 (m, 5 H) 5.42 - 5.86 (m, 2 H) 3.68 - 3.94 (m, 1 H) 3.38 - 3.59 (m, 2 H) 1.49 - 2.08 (m, 1 H) 0.50 - 1.20 (m, 6 H). MS (ESI+) m/z 405 (M+H)*. 155 WO 2008/154241 PCT/US2008/065727 Example 258 1-benzyl-N-[(1S)-1-(hydroxymethyl)-2-methylpropyl]-4-(1H-indazol-5-yl)-1H-1,2,3-triazole 5-carboxamide The title compound was prepared according to the procedure outlined in Example 234 5 substituting (S)-(-)-2-amino-3-methyl-1-butanol for (S)-(+)-tetrahydrofurfurylamine. 1H NMR (300 MHz, DMSO-d 6

/D

2 0) 6 ppm 7.94 - 8.36 (m, 2 H) 7.52 - 7.84 (in, 2 H) 7.18 - 7.51 (m, 5 H) 5.57 - 5.76 (in, 2 H) 3.75 - 3.94 (m, 1 H) 3.35 - 3.54 (in, 2 H) 1.70 - 1.94 (in, 1 H) 0.54 - 1.09 (in, 6 H). MS (ESI+) m/z 405 (M+H). 10 Example 259 1-benzyl-N-[3-(1H-imidazol-1-yl)propyl]-4-(1H-indazol-5-yl)-1H-1,2,3-triazole-5 carboxamide The title compound was prepared according to the procedure outlined in Example 234 substituting 1-(3-aminopropyl)imidazole for (S)-(+)-tetrahydrofurfurylamine. 1H NMR (300 15 MHz, DMSO-d 6

/D

2 0) 6 ppm 8.57 - 8.85 (in, 1 H) 7.92 - 8.16 (m, 2 H) 7.60 - 7.80 (in, 2 H) 7.47 - 7.55 (in, 2 H) 7.19 - 7.40 (m, 5 H) 5.54 - 5.75 (in, 2 H) 3.83 - 4.21 (m, 2 H) 3.19 - 3.26 (m, 2 H) 1.79 - 2.06 (in, 2 H). MS (ESI+) m/z 427 (M+H){. Example 260 20 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-ethylurea The title compound was prepared as a hydrochloric acid salt according to the procedure outlined in Example 229 substituting isocyanatoethane for 3-isocyanato-5-methyl 2-(trifluoromethyl)furan. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 12.38 (s, 1 H), 9.47 (s, 1 H), 8.38 (s, 1 H), 7.85 - 7.97 (m, 1 H), 7.78 (d, J=8.82, 1.47 Hz, 1 H), 7.34 - 7.50 (in, 4 H), 25 7.24 - 7.33 (in, 2 H), 5.69 (s, 2 H), 3.17 - 3.29 (in, 2 H), 1.70 - 1.83 (in, 1 H), 1.12 (t, J=7.17 Hz, 3 H), 1.00 - 1.08 (in, 2 H), 0.37 (d, J=3.68 Hz, 2 H). MS (ESI+) m/z 402 (M+H)*. Example 261 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-phenylurea 30 The title compound was prepared as a hydrochloric acid salt according to the procedure outlined in Example 229 substituting isocyanatobenzene for 3-isocyanato-5 methyl-2-(trifluoromethyl)furan. H NMR (300 MHz, DMSO-d 6 ) 6 ppm 12.47 - 12.78 (in, 1 H), 9.64 (s, 1 H), 8.39 (s, 1 H), 7.70 - 7.95 (m, 1 H), 7.45 - 7.60 (m, 3 H), 7.27 - 7.45 (in, 7 156 WO 2008/154241 PCT/US2008/065727 H), 7.02 (in, 1 H), 5.69 (s, 2 H), 1.79 (m, 1 H), 1.07 (m, 2 H), 0.40 (m, 2 H). MS (ESI+) m/z 450 (M+H)+. Example 262 5 N-benzyl-N'-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]urea The title compound was prepared as a hydrochloric acid salt according to the procedure outlined in Example 229 substituting (isocyanatomethyl)benzene for 3-isocyanato 5-methyl-2-(trifluoromethyl)furan. 1 H NMR (300 MHz, DMSO-d 6 ) S ppm 12.42 (s, 1 H), 9.61 (s, 1 H), 8.37 (s, 1 H), 8.23 - 8.33 (m, 1 H), 7.79 (d, J=8.82, 1.47 Hz, 1 H), 7.36 - 7.50 10 (m, 4 H), 7.28 - 7.36 (m, 6 H), 7.21 - 7.27 (m, 1 H), 5.69 (s, 2 H), 4.45 (d, J=5.88 Hz, 2 H), 1.65 - 1.79 (t, J=8.27, 8.27 Hz, 1 H), 0.99 - 1.08 (m, 2 H), 0.30 - 0.43 (in, 2 H). MS (ESI+) m/z 464 (M+H)*. Example 263 15 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-(2 chlorophenyl)urea The title compound was prepared as a hydrochloric acid salt according to the procedure outlined in Example 229 substituting 1 -chloro-2-isocyanatobenzene for 3 isocyanato-5-methyl-2-(trifluoromethyl)furan. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 12.74 20 (s, 1 H), 10.23 (s, 1 H), 8.44 (s, 1 H), 8.34 (d, J=8.09 Hz, 1 H), 7.83 (d, J=8.82, 1.47 Hz, 1 H), 7.46 - 7.55 (m, 2 H), 7.35 - 7.45 (m, 3 H), 7.28 - 7.35 (m, 3 H), 7.03 - 7.12 (m, 1 H), 5.70 (s, 2 H), 1.70 - 1.86 (m, 1 H), 1.00 - 1.12 (m, 2 H), 0.33 - 0.45 (m, 2 H). MS (ESI+) m/z 484 (M+H)+. 25 Example 264 N-[5-(1 -benzyl-5-cyclopropyl- 1 H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-(3 chlorophenyl)urea The title compound was prepared as a hydrochloric acid salt according to the procedure outlined in Example 229 substituting 1-chloro-3-isocyanatobenzene for 3 30 isocyanato-5-methyl-2-(trifluoromethyl)furan. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 12.66 (s, 1 H), 10.02 (s, 1 H), 9.71 (s, 1 H), 8.22 - 8.48 (m, 1 H), 7.71 - 7.91 (m, 2 H), 7.51 (d, J=8.46 Hz, 1 H), 7.37 - 7.46 (in, 2 H), 7.26 - 7.37 (m, 5 H), 7.02 - 7.11 (m, 1 H), 5.69 (s, 2 H), 1.73 - 1.89 (m, 1 H), 0.99 - 1.11 (m, 2 H), 0.33 - 0.48 (m, 2 H). MS (ESI+) m/z 484 157 WO 2008/154241 PCT/US2008/065727 (M+H)y. Example 265 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-(4 5 chlorophenyl)urea The title compound was prepared as a hydrochloric acid salt according to the procedure outlined in Example 229 substituting 1 -chloro-4-isocyanatobenzene for 3 isocyanato-5-methyl-2-(trifluoromethyl)furan. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 12.65 (s, 1 H), 9.96 (s, 1 H), 9.68 (s, 1 H), 8.37 (s, 1 H), 7.81 (d, J=8.82, 1.47 Hz, 1 H), 7.53 - 7.60 10 (m, 2 H), 7.50 (d, J=8.82 Hz, 1 H), 7.39 - 7.44 (in, 1 H), 7.33 - 7.40 (m, 4 H), 7.27 - 7.32 (m, 2 H), 5.69 (s, 2 H), 1.71 - 1.87 (m, 1 H), 1.00 - 1.12 (m, 2 H), 0.34 - 0.44 (m, 2 H). MS (ESI+) m/z 484 (M+H)*. Example 266 15 N-[5-(1-benzyl-5-iodo-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]benzamide Example 266A tert-butyl 3-amino-5-(1-benzyl-5-iodo-1H-1,2,3-triazol-4-yl)-1H-indazole-1-carboxylate The title compound was prepared according to the procedure outlined in Example 20 198A substituting Example 125B for Example 102B. The product was used directly in subsequent reactions without characterization. Example 266B N-[5-(1-benzyl-5-iodo-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]benzamide 25 The title compound was prepared as a TFA salt according to the procedure outlined in Example 205B substituting Example 266A for Example 205A. 1H NMR (300 MHz, DMSO d 6 ) 6 ppm 12.97 (s, 1 H), 10.89 (s, 1 H), 8.28 (s, 1 H), 8.05 - 8.14 (in, 2 H), 7.88 (d, J=8.82, 1.47 Hz, 1 H), 7.58 - 7.67 (m, 2 H), 7.54 (t, J=7.35 Hz, 2 H), 7.29 - 7.45 (m, 3 H), 7.23 (d, J=6.99 Hz, 2 H), 5.73 (s, 2 H). MS (ESI+) m/z 521 (M+H)+. 30 Example 267 3 -[4-(3-amino- 1 H-indazol-5 -yl)- 1 H-pyrazol- 1 -yl]propanenitrile 158 WO 2008/154241 PCT/US2008/065727 Example 267A 3-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazol-1-yl)propanenitrile To a solution of 4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole (5.00 g, 25.8 mmol) in acetonitrile (50 mL) was added acrylonitrile (3.4 mL, 52 mmol) followed by 5 1,8-diazabicyclo[5.4.0]undec-7-ene (1.94 mL, 12.9 mmol). After about 2 hours, the reaction mixture was concentrated under reduced pressure. The crude material was then dissolved in a minimal amount of dichloromethane and purified via silica gel chromatography eluting with a gradient of 10-50% ethyl acetate in heptane to afford the title compound. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 8.03 (s, 1H), 7.64 (s, 1H), 4.40 (t, J = 6.4 Hz, 2H), 3.06 (t, J = 6.4 10 Hz, 2H), 1.26 (s, 12H). MS (ESI+) m/z 247.3 (M+H)*. Example 267B 3 -[4-(3-amino- 1 H-indazol-5 -yl)- 1 H-pyrazol- 1 -yl]propanenitrile To a microwave vial was added 5-bromo-1H-indazol-3-amine (0.14 g, 0.66 mmol), 15 tetrakis(triphenylphosphine)palladium(0) (0.076 g, 0.066 mmol), and sodium carbonate (0.147 g, 1.39 mmol) followed by a solution of Example 267A (0.212 g, 0.858 mmol) in 1,2 dimethoxyethane (2.50 mL) and then water (1.25 mL). The mixture was heated in a CEM microwave at about 150 'C for about 20 minutes (275 psi maximum pressure, about 2 minutes ramp, 200 maximum watts) and then the mixture was concentrated under reduced 20 pressure. Methanol (20 mL) was added and the resulting mixture was stirred for about 1 hour. The insoluble material was removed by filtration. The filtrate was concentrated under reduced pressure onto silica get and purified via silica gel chromatography eluting with a stepwise gradient of dichloromethane/methanol/ ammonium hydroxide (990:9:1 to 985:13.5:1.5 to 980:18:2) to afford a solid. This solid was dissolved in a minimum amount of 25 hot acetonitrile (~2 mL), filtered to remove minor amount of insolubles, while washing with methanol (<0.5 mL), and left to sit at ambient temperature. The resulting solid that formed overnight was collected by filtration, while washing with additional acetonitrile, and dried in a vacuum oven at about 60 'C for about 2 hours to afford the title compound. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 11.35 (s, 1H), 8.10 (s, 1H), 7.86 (s, 1H), 7.84 (s, 1H), 7.44 (dd, J = 30 8.54, 1.26 Hz, 1H), 7.23 (d, J = 8.62 Hz, 1H), 5.32 (s, 2H), 4.42 (t, J = 6.36 Hz, 2H), 3.10 (t, J = 6.43 Hz, 2H). MS (ESI+) m/z 253.2 (M+H)+. 159 WO 2008/154241 PCT/US2008/065727 Example 268 2-[4-(3-amino- 1 H-indazol-5 -yl)-1 H-pyrazol- 1 -yl]acetamide 5 Example 268A 2-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazol-1-yl)acetamide A suspension of 4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole (2.00 g, 10.3 mmol), 2-bromoacetamide (2.14 g, 15.5 mmol), and potassium carbonate (2.14 g, 15.5 mmol) in acetone (60 mL) was heated at about 50 'C for about 3.5 days. The reaction 10 mixture was then cooled to ambient temperature, filtered through diatomaceous earth, while washing with additional acetone, and then concentrated under reduced pressure. The crude material was then dissolved in a minimal amount of dichloromethane and purified via silica gel chromatography eluting with a gradient of 80-100% ethyl acetate in heptane to afford the title compound. 1 H NMR (400 MHz, DMSO-d 6 ) S ppm 7.88 (s, 1H), 7.57 (s, 1H), 7.46 (s, 15 1H), 7.24 (s, 1H), 4.77 (s, 2H), 1.26 (s, 12H). MS (ESI+) m/z 252.2 (M+H)*. Example 268B 2-[4-(3-amino- 1 H-indazol-5 -yl)- 1 H-pyrazol- 1 -yl]acetamide The title compound was prepared according to the procedure outlined in Example 20 267B substituting Example 268A for Example 267A and heating at about 120 'C for about 10 minutes. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 11.32 (s, 1H), 7.98 (s, 1H), 7.87 (s, 1H), 7.77 (s, 1H), 7.48 (s, 1H), 7.45 (d, J = 8.6 Hz, 1H), 7.26 (s, 1H), 7.22 (d, J = 8.7 Hz, 1H), 5.28 (s, 2H), 4.78 (s, 2H). MS (ESI+) m/z 257.2 (M+H)+. 25 Example 269 methyl 3- [4-(3 -amino-i H-indazol-5 -yl)- 1 H-pyrazol- 1 -yl]propanoate Example 269A 30 methyl 3-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazol-1-yl)propanoate The title compound was prepared according to the procedure outlined in Example 267A substituting methyl acrylate for acrylonitrile. H NMR (400 MHz, DMSO-d 6 ) 6 ppm 7.91 (s, 1H), 7.57 (s, 1H), 4.35 (t, J = 6.73 Hz, 2H), 2.87 (t, J = 6.75 Hz, 2H), 3.59 (s, 3H), 160 WO 2008/154241 PCT/US2008/065727 1.24 (s, 12H). MS (ESI+) m/z 281.2 (M+H). Example 269B methyl 3- [4-(3 -amino-i H-indazol-5 -yl)-1 H-pyrazol- 1 -yl]propanoate 5 The title compound was prepared according to the procedure outlined in Example 267B substituting Example 269A for Example 267A and heating at about 120 'C for about 20 minutes. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 11.32 (s, 1H), 8.00 (s, 1H), 7.85 (s, 1H), 7.76 (s, 1H), 7.42 (d, J = 8.50 Hz, 1H), 7.21 (d, J = 8.61 Hz, 1H), 5.28 (s, 2H), 4.37 (t, J= 6.71 Hz, 2H), 3.61 (s, 3H), 2.92 (t, J = 6.69 Hz, 2H). MS (ESI+) m/z 286.2 (M+H). 10 Example 270 3- [4-(3 -amino-i H-indazol-5-yl)- 1 H-pyrazol- 1 -yl]propanamide 15 Example 270A 3-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazol-1-yl)propanamide The title compound was prepared according to the procedure outlined in Example 267A substituting acrylamide for acrylonitrile (0.72 g, 53%). 1 H NMR (400 MHz, DMSO 20 d 6 ) 6 ppm 7.84 (s, 1H), 7.56 (s, 1H), 7.37 (s, 1H), 6.88 (s, 1H), 4.30 (t, J = 6.80 Hz, 2H), 2.60 (t, J = 6.79 Hz, 2H), 1.24 (s, 12H). MS (ESI+) m/z 266.2 (M+H)*. Example 270B 3- [4-(3 -amino-i H-indazol-5-yl)- 1 H-pyrazol- 1 -yl]propanamide 25 The title compound was prepared according to the procedure outlined in Example 267B substituting Example 270A for Example 267A and heating at about 120 'C for about 15 minutes (0.056 g, 22%). 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 11.32 (s, 1H), 7.94 (d, J= 0.53 Hz, 1H), 7.84 (s, 1H), 7.75 (d, J = 0.54 Hz, 1H), 7.42 (m, 2H), 7.20 (d, J = 8.26 Hz, 1H), 6.89 (s, 1H), 5.27 (s, 2H), 4.32 (t, J = 6.89 Hz, 2H), 2.65 (t, J = 6.89 Hz, 2H). MS 30 (ESI+) m/z 271.0 (M+H)+. Example 271 161 WO 2008/154241 PCT/US2008/065727 [4-(3-amino-i H-indazol-5-yl)-1 H-pyrazol- 1 -yl]acetonitrile Example 271A 5 2-(4-(4,4,5,5-tetramethyl- 1,3,2-dioxaborolan-2-yl)- 1 H-pyrazol- 1 -yl)acetonitrile The title compound was prepared according to the procedure outlined in Example 268A substituting 2-bromoacetonitrile for 2-bromoacetamide. H NMR (400 MHz, DMSO d 6 ) 6 ppm 7.99 (s, 1H), 7.66 (s, 1H), 5.45 (s, 2H), 1.25 (s, 12H). 10 Example 271B tert-butyl 3-(bis(tert-butoxycarbonyl)amino)-5-bromo-1H-indazole-1-carboxylate To 5-bromo-1H-indazol-3-amine (2.00 g, 9.43 mmol) in tetrahydrofuran (20 mL) was added 4-(dimethylamino)pyridine (0.230 g, 1.886 mmol) and di-tert-butyl dicarbonate (6.18 15 g, 28.3 mmol). The reaction was heated at 50 'C for about 2 hours, cooled to ambient temperature, and concentrated under reduced pressure. The residue was dissolved in diethyl ether (100 mL) and then washed sequentially with 1 N hydrochloric acid (2 x 25 mL), 1 N sodium hydroxide (2 x 25 mL) and brine (25 mL). The organic layer was then dried over sodium sulfate, filtered, concentrated under reduced pressure, and dried in a vacuum oven at 20 about 60 'C to afford the title compound. 1 H NMR (400 MHz, DMSO-d6) 8.05 (d, J = 8.95 Hz, 1H), 7.99 (d, J = 1.90 Hz, 1H), 7.81 (dd, J = 8.94, 1.89 Hz, 1H), 1.65 (s, 9H), 1.40 (s, 18H). MS (ESI+) m/z 512.2 (M+H)*. 25 Example 271C tert-butyl 3-(bis(tert-butoxycarbonyl)amino)-5-(1-(cyanomethyl)-1H-pyrazol-4-yl)-1H indazole- 1 -carboxylate A vial was charged with Example 271A (0.682 g, 2.93 mmol), Example 271B (1.25 g, 2.44 mmol), cesium carbonate (1.99 g, 6.10 mmol), 1,4-dioxane (12.5 mL) and water (2.50 30 mL). After a vacuum/nitrogen purge through a septa, tris(dibenzylideneacetone)dipalladium(0) (0.112 g, 0.122 mmol) and tri-t-butylphosphonium tetrafluoroborate (0.085 g, 0.29 mmol) were added and a cap was put on the vial after flushing with nitrogen. After about 6 hours at ambient temperature, the reaction was 162 WO 2008/154241 PCT/US2008/065727 partitioned between saturated aqueous sodium bicarbonate and dichloromethane (50 mL each). The layers were separated and the aqueous layer was extracted with additional dichloromethane (2 x 50 mL). The combined organic layers were washed with brine, dried over magnesium sulfate, filtered, and concentrated under reduced pressure. The crude oil 5 was dissolved in a minimal amount of dichloromethane and purified via silica gel chromatography eluting with a gradient of 20-60% ethyl acetate in heptane to afford the title compound. 1H NMR (400 MHz, DMSO-d 6 ) 6 ppm 8.43 (s, 1H), 8.19 (s, 1H), 8.08 (d, J = 9.22 Hz, 1H), 7.93 (in, 2H), 5.53 (s, 2H), 1.67 (s, 9H), 1.39 (s, 18H). MS (ESI+) m/z 539.3 (M+H)y. 10 Example 271D [4-(3 -amino-i H-indazol-5 -yl)- 1 H-pyrazol- 1 -yl]acetonitrile To a solution of tert-butyl 3-(bis(tert-butoxycarbonyl)amino)-5-(1-(cyanomethyl)-1H pyrazol-4-yl)-1H-indazole-1-carboxylate (0.30 g, 0.557 mmol) in dichloromethane (4.0 mL) 15 was added trifluoroacetic acid (2.0 mL). After about 45 minutes, the reaction was slowly quenched with saturated aqueous sodium bicarbonate. The resulting mixture was extracted with dichloromethane (3 x 25 mL). The combined organic layers were washed with brine, dried over magnesium sulfate, filtered, and concentrated under reduced pressure to give a crude solid. A white precipitate that was suspended in both the initial aqueous layer and the 20 brine layer was filtered and added to the crude solid. The resulting solid was triturated with dichloromethane/methanol (19:1). The remaining solid was collected by vacuum filtration and dried in a vacuum oven at about 70 'C to afford the title compound. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 11.37 (s, 1H), 8.12 (s, 1H), 7.92 (s, 1H), 7.89 (s, 1H) 7.49-7.41 (m, 1H), 7.24 (d, J = 8.71 Hz, 1H), 5.52 (s, 2H), 5.31 (s, 2H). MS (ESI+) m/z 239.1 (M+H). 25 Example 272 4-(3 -amino-i H-indazol-5 -yl)-N,N-dimethyl- 1 H-imidazole- 1-sulfonamide 3-Cyano-4-fluorophenylboronic acid (0.083 g, 0.503 mmol), 4-iodo-N,N-dimethyl 1H-imidazole-1-sulfonamide (0.167 g, 0.554 mmol), sodium carbonate (0.128 g, 1.208 30 mmol) and tetrakis(triphenylphosphine)palladium(0) (0.035 g, 0.030 mmol) were combined in dimethoxyethane (4 mL) and water (1.5 mL). The reaction mixture was heated in a microwave (CEM-Discover) at about 150 'C for about 25 minutes. The organic layer was separated and the solvent was removed under reduced pressure. To the residue was added 163 WO 2008/154241 PCT/US2008/065727 ethanol (0.7 mL) and hydrazine monohydrate (1 mL). The reaction mixture was heated at about 80 'C for about 20 hours. The reaction mixture was partitioned between water (5 mL) and dichloromethane (100 mL). The organic layer was separated and concentrated under reduced pressure. The residue was purified by reverse phase HPLC using acetonitrile/water 5 (0.05 M ammonium acetate) gradient elution method to afford the title compound. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 11.42 (s, 1H), 8.25 (s, 1H), 8.21 (d, J = 1.36 Hz, 1H), 7.92 (d, J = 1.37 Hz, 1H), 7.74 (dd, J= 8.66, 1.58 Hz, 1H), 7.23 (d, J= 8.68 Hz, 1H), 5.35 (s, 2H), 2.87 (s, 6H). MS (ESI+) m/z 307.2 (M+H)*. 10 Example 273 5-pyrazin-2-yl-1H-indazol-3-amine The title compound was prepared according to the procedure outlined in Example 272 substituting 2-iodopyrazine for 4-iodo-N,N-dimethyl-1H-imidazole-1-sulfonamide. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 11.61 (s, 1H), 9.18 (d, 1H, J= 1.6), 8.66 (dd, 1H, J = 1.7, 2.4), 15 8.59 (d, 1H, J = 1.0), 8.51 (d, 1H, J = 2.5), 8.04 (dd, 1H, J= 1.8, 8.8), 7.35 (d, 1H, J = 9.2), 5.54 (s, 2H). MS (ESI+) m/z 212.2 (M+H)+. Example 274 5-thien-2-yl-1H-indazol-3-amine 20 The title compound was prepared according to the procedure outlined in Example 272 substituting 2-iodothiophene for 4-iodo-N,N-dimethyl-1H-imidazole-1-sulfonamide. 1 H NMR (400 MHz,DMSO-d 6 ) 6 ppm 11.47 (s, 1H), 7.99 (d, 1H, J = 1.4), 7.55 (dd, 1H, J = 1.8, 8.8), 7.43 (dd, 1H, J = 1.0, 5.1), 7.35 (dd, 1H, J = 1.1, 3.6), 7.26 (d, 1H, J = 8.6), 7.10 (dd, 1H, J = 3.5, 5.1), 5.42 (d, 2H, J = 8.8). MS (ESI+) m/z 216.1 (M+H)*. 25 Example 275 5-(2-aminopyrimidin-4-yl)-1H-indazol-3-amine The title compound was prepared according to the procedure outlined in Example 272 substituting 5 -iodopyrimidin-2-amine for 4-iodo-N,N-dimethyl- 1 H-imidazole- 1-sulfonamide. 30 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 11.40 (s, 1H), 8.53 (s, 2H), 7.91 (dd, 1H, J = 0.7, 1.5), 7.47 (dd, 1H, J = 1.8, 8.6), 7.28 (dd, 1H, J = 0.7, 8.7), 6.64 (s, 2H), 5.36 (s, 2H). 1H NMR (400 MHz, DMSO-d 6 ) 6 ppm 11.41 (s, 1H), 8.53 (s, 2H), 7.92 (in, 1H), 7.47 (dd, J = 8.66, 1.74 Hz, 1H), 7.28 (dd, J = 8.63, 0.65 Hz, 1H), 6.64 (s, 2H), 5.36 (s, 2H). MS (ESI+) m/z 164 WO 2008/154241 PCT/US2008/065727 227.2 (M+H)j. Example 276 5-(2-methoxypyridin-3-yl)-1H-indazol-3-amine 5 The title compound was prepared according to the procedure outlined in Example 272 substituting 3-iodo-2-methoxypyridine for 4-iodo-N,N-dimethyl-1H-imidazole-1 sulfonamide. H NMR (400 MHz, DMSO-d 6 ) 6 ppm 11.43 (s, 1H), 8.14 (dd, 1H, J = 1.9, 5.0), 7.86 (s, 1H), 7.71 (dd, 1H, J = 2.0, 7.2), 7.42 (dd, 1H, J = 1.7, 8.7), 7.26 (d, 1H, J = 8.6), 7.09 (dd, 1H, J = 5.0, 7.3), 5.38 (s, 2H), 3.89 (s, 3H). MS (ESI+) m/z 241.2 (M+H). 10 Example 277 5-imidazo[1,2-a]pyridin-3-yl-1H-indazol-3-amine The title compound was prepared according to the procedure outlined in Example 272 substituting 3-bromoimidazo[1,2-a]pyridine for 4-iodo-N,N-dimethyl-1H-imidazole-1 15 sulfonamide. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 8.52 (dt, 1H, J = 1.2, 7.0), 7.99 (dd, 1H, J = 0.7, 1.7), 7.68 (s, 1H), 7.65 (dt, 2H, J = 1.2, 9.0), 7.46 (dd, 1H, J = 1.8, 8.6), 7.39 (dd, 1H, J = 0.8, 8.6), 7.28 (ddd, 1H, J = 1.2, 6.6, 9.2), 6.96 (td, 1H, J = 1.3, 6.7), 5.47 (s, 2H). MS (ESI+) m/z 250.2 (M+H)+. 20 Example 278

N

2

,N

2 -dimethyl-N-[5-(1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]glycinamide Example 65 (257 mg, 0.685 mmol) was dissolved in ethanol (15 mL). The reaction mixture was hydrogenated in an H-Cube apparatus with palladium hydroxide (20%) on carbon at about 80 'C and about 60 psi for about 8 hours. The solvent was removed under 25 reduced pressure and the residue was purified by reverse phase HPLC using acetonitrile/water (0.05 M ammonium acetate) gradient elution method to afford the title compound. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 8.16-8.37 (m, 1H), 7.10-7.46 (bs, 2H), 7.00-7.34 (bs, 2H), 6.87-7.24 (bs, 2H), 3.33-3.34 (m, 2H). MS (ESI+) m/z 286.2 (M+H)f. 30 Example 279 5-(1H-pyrazol-5-yl)-1H-indazol-3-amine The title compound was prepared according to the procedure outlined in Example 272 substituting 5-iodo-1H-pyrazole for 4-iodo-N,N-dimethyl-1H-imidazole-1-sulfonamide. 1H 165 WO 2008/154241 PCT/US2008/065727 NMR (400 MHz, DMSO-d 6 ) 6 ppm 7.87-7.94 (in, 3H), 7.60-7.63 (m, 1H), 7.48 (dd, J = 8.55, 1.62 Hz, 1H), 7.19-7.32 (in, 2H), 5.25-5.28 (in, 2H). MS (ESI+) m/z 200.1 (M+H). Example 280 5 5-(4-methyl-1H-imidazol-5-yl)-1H-indazol-3-amine The title compound was prepared according to the procedure outlined in Example 272 substituting 5-iodo-4-methyl-1H-imidazole for 4-iodo-N,N-dimethyl-1H-imidazole-1 sulfonamide. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 7.85 (s, 1H), 7.52 (d, 2H, J = 6.6), 7.22 (m, 1H), 5.3 2 (bs, 2H). 2.37 (s, 3H). MS (ESI+) m/z 214.1 (M+H). 10 Example 281 5-(1H-imidazol-4-yl)-1H-indazol-3-amine The title compound was prepared according to the procedure outlined in Example 272 substituting 4-iodo-1H-imidazole for 4-iodo-N,N-dimethyl-1H-imidazole-1-sulfonamide. 1 H 15 NMR (400 MHz, DMSO-d 6 ) 6 ppm 8.07 (s, IH), 7.66 (s, 1H), 7.63 (d, 1H, J = 8.6), 7.37 (s, 1H), 7.20 (d, 1H, J = 8.8), 5.28 (s, 2H). MS (ESI+) m/z 200.1 (M+H)*. Example 282

N

2

,N

2 -dimethyl-N -{5-[1-(3-methylbenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazol-3 20 yl} glycinamide Example 282A 5-bromo-1H-indazol-3-amine 25 The title compound was prepared according to the procedure outlined in Example 62D substituting 5-bromo-2-fluorobenzonitrile for Example 62C. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 11.55 (s, 1H), 7.92 (d, J = 1.87 Hz, 1H), 7.30 (dd, J = 8.79, 1.89 Hz, 1H), 7.19 (d, J = 8.78 Hz, 1H), 5.41 (s, 2H). 30 Example 282B tert-butyl 3-amino-5-bromo-1H-indazole-1-carboxylate The title compound was prepared according to the procedure outlined in Example 166 WO 2008/154241 PCT/US2008/065727 64A substituting Example 282A for Example 62D. H NMR (400 MHz, DMSO-d 6 ) 6 ppm 8.12 (d, J = 1.93 Hz, 1H), 7.95-7.81 (m, 1H), 7.65 (dd, J = 8.85, 1.96 Hz, 1H), 6.39 (d, J = 4.44 Hz, 1H), 1.58 (m, 9H) 5 Example 282C tert-butyl 5-bromo-3-(2-(dimethylamino)acetamido)-1H-indazole-1-carboxylate To a mixture of Example 282B (24.43 g, 78 mmol), potassium carbonate (81 g, 587 mmol) and 2-(dimethylamino)acetyl chloride hydrochloride (43.3 g, 274 mmol) was added 10 tetrahydrofuran (200 mL). The reaction mixture was stirred at room temperature for about 2 hours. The reaction mixture was filtered and the filtrate was washed with water (50 mL). The organic layer was separated and the aqueous layer was extracted with dichloromethane (3 x 100 mL). The combined organic extracts were dried over magnesium sulfate, filtered and concentrated under reduced pressure. The residue was purified by silica gel 15 chromatography eluting with methanol in dichloromethane (5%) to afford the title compound. H NMR (400 MHz, DMSO-d 6 ) 6 ppm 10.72 (s, 1H), 8.19 (d, 1H, J = 1.6), 8.03 (d, 1H, J = 9.0), 7.76 (dd, 1H, J = 2.0, 9.0), 3.22 (s, 2H), 2.32 (s, 6H), 1.63 (s, 9H). 20 Example 282 D tert-butyl 3-(2-(dimethylamino)acetamido)-5-((trimethylsilyl)ethynyl)-1H-indazole-1 carboxylate To a mixture of Example 282C (2.56 g, 6.44 mmol), bis(triphenylphosphine)palladium(II) chloride (0.225 g, 0.321 mmol), and copper(I) iodide 25 (0.073 g, 0.383 mmol) was added triethylamine (20 mL, 144 mmol) followed by ethynyltrimethylsilane (0.760 g, 7.73 mmol). The reaction mixture was heated at about 60 'C for about 3 hours. The reaction mixture was diluted with dichloromethane (100 mL), washed with water (20 mL) and brine (20 mL), dried over magnesium sulfate, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography 30 eluting with ethyl acetate in dichloromethane (10%) to give the title compound. 1H NMR (400 MHz, DMSO-d 6 ) 6 ppm 10.69 (s, 1H), 8.08 (s, 1H), 8.04 (d, 1H, J = 9.0), 7.62 (d, 1H, J = 8.8), 3.21 (s, 2H), 2.30 (s, 6H), 1.61 (s, 9H), 0.23 (s, 9H). 167 WO 2008/154241 PCT/US2008/065727 Example 282E 2-(dimethylamino)-N-(5-ethynyl-1H-indazol-3-yl)acetamide To Example 282D (0.303 g, 0.731 mmol) in methanol (5 mL) was added aqueous 5 potassium hydroxide (1.46 mL, 1.46 mmol, 1.ON solution). The reaction mixture was stirred at room temperature for about 1 hour. The solvent was removed under reduced pressure and the residue was dissolved in ethyl acetate (80 mL). The organic layer was separated and washed with water (10 mL) and brine (10 mL), dried over magnesium sulfate, filtered and concentrated under reduced pressure to afford the title compound. 1 H NMR (400 MHz, 10 DMSO-d 6 ) 6 ppm 12.89 (s, 1H), 10.14 (s, 1H), 8.00 (d, 1H, J = 12.1), 7.44 (s, 2H), 7.38 (d, 1H, J = 8.6), 4.02 (s, 1H), 3.17 (s, 2H), 2.33 (s, 6H). Example 282F

N

2

,N

2 -dimethyl-N- {5-[1-(3-methylbenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazol-3 15 yl} glycinamide To a suspension of Example 282E (0.16 g, 0.660 mmol) in tert-butanol (1.2 mL) was added 1-(azidomethyl)-3-methylbenzene (0.098 g, 0.667 mmol), then water (1.2 mL). A solution of sodium (R)-2-((S)-1,2-dihydroxyethyl)-4-hydroxy-5-oxo-2,5-dihydrofuran-3-olate (0.057 mL, 0.066 mmol, 1.6 M in water) and an aqueous solution of copper (II) sulfate 20 pentahydrate (0.019 ml, 6.6 pmol, 0.34M) was added. The reaction mixture was heated at about 60 'C for about 2 hours. The solvent was removed under reduced pressure and the residue was purified by reverse phase HPLC using acetonitrile/water (0.05 M ammonium acetate) gradient elution method to afford the title compound. 1 H NMR (400 MHz, DMSO d 6 ) 6 ppm 12.77 (s, 1H), 10.05 (s, 1H), 8.56 (s, 1H), 8.24 (s, 1H), 7.82 (d, 1H, J = 8.6), 7.50 25 (d, 1H, J = 8.8), 7.28 (t, 1H, J = 7.6), 7.16 (in, 4H), 5.59 (s, 2H), 3.18 (s, 2H), 2.34 (s, 6H), 2.30 (s, 3H). MS (ESI+) m/z 390.3 (M+H)+. Example 283 5-(1-benzyl-1H-imidazol-4-yl)-1H-indazol-3-amine 30 The title compound was prepared according to the procedure outlined in Example 272 substituting 1 -benzyl-4-iodo- 1 H-imidazole for 4-iodo-N,N-dimethyl- 1 H-imidazole- 1 sulfonamide. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 11.29 (s, 1H), 8.07 (s, 1H), 7.79 (s, 1H), 7.61 (d, JH, J = 8.6), 7.46 (s, 1H), 7.36 (m, 5H), 7.17 (d, 1H, J = 8.8), 5.28 (s, 2H), 5.22 168 WO 2008/154241 PCT/US2008/065727 (s, 2H). MS (ESI+) m/z 290.2 (M+H)*. Example 284

N

1 -{5-[1-(4-tert-butylbenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazol-3-yl} 2

,N

2 _ 5 dimethylglycinamide The title compound was prepared according to the procedure outlined in Example 282F substituting 1-(azidomethyl)-4-tert-butylbenzene for 1-(azidomethyl)-3-methylbenzene. H NMR (400 MHz, DMSO-d 6 ) 6 ppm 12.88 (s, 1H), 10.05 (s, 1H), 8.57 (s, 1H), 8.23 (s, 1H), 7.81 (d, 1H, J = 8.8), 7.50 (d, 1H, J = 8.8), 7.41 (d, 2H, J = 8.2), 7.30 (d, 2H, J = 8.2), 3.18 (s, 10 2H), 2.34 (s, 6H), 1.26 (s, 9H). MS (ESI+) m/z 432.2 (M+H). Example 285

N

2

,N

2 -dimethyl-N- {5-[1-(2-piperidin-1-ylethyl)-1H-1,2,3-triazol-4-yl]-1H-indazol-3 yl}glycinamide 15 The title compound was prepared according to the procedure outlined in Example 282F substituting 1-(2-azidoethyl)piperidine for 1-(azidomethyl)-3-methylbenzene. H NMR (400 MHz, DMSO-d 6 ) 6 ppm 12.91 (s, 1H), 10.07 (s, 1H), 8.47 (s, 1H), 8.22 (s, 1H), 7.80 (dd, 1H, J = 1.2, 8.7), 7.52 (d, 1H, J = 8.8), 4.49 (t, 2H, J = 6.4), 3.19 (s, 2H), 2.76 (t, 2H, J= 6.4), 2.41 (s, 4H), 2.35 (s, 6H), 1.69 (s, 3H), 1.47 (m, 4H), 1.37 (dd, 2H, J = 5.2, 10.2). MS 20 (ESI-) m/z 395.3 (M-H)-. Example 286 N 2,N 2 -dimethyl-N- {5-[1-(2-morpholin-4-ylethyl)-1H-1,2,3-triazol-4-yl]-1H-indazol-3 yl} glycinamide 25 The title compound was prepared according to the procedure outlined in Example 282F substituting 4-(2-azidoethyl)morpholine for 1-(azidomethyl)-3-methylbenzene. 1H NMR (400 MHz, DMSO-d 6 ) 6 ppm 12.83 (s, 1H), 10.07 (s, 1H), 8.49 (s, 1H), 8.23 (s, 1H), 7.81 (dd, 1H, J = 1.3, 8.7), 7.52 (d, 1H, J = 8.8), 4.53 (t, 2H, J = 6.3), 3.55 (m, 4H), 3.19 (s, 2H), 2.80 (t, 2H, J = 6.3), 2.45 (m, 4H), 2.35 (s, 6H). MS (ESI-) m/z 397.3 (M-H)-. 30 Example 287 N -(5- { 1-[2-(3,5-dimethylisoxazol-4-yl)ethyl]-1H-1,2,3-triazol-4-yl}-1H-indazol-3-yl) N 2,N 2-dimethylglycinamide The title compound was prepared according to the procedure outlined in Example 169 WO 2008/154241 PCT/US2008/065727 282F substituting 4-(2-azidoethyl)-3,5-dimethylisoxazole for 1-(azidomethyl)-3 methylbenzene. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 12.90 (s, 1H), 10.07 (s, 1H), 8.44 (s, 1H), 8.21 (s, 1H), 7.78 (dd, 1H, J = 1.3, 8.7), 7.52 (d, 1H, J = 8.8), 4.51 (t, 2H, J = 6.7), 3.19 (s, 2H), 2.93 (t, 2H, J = 6.7), 2.35 (s, 6H), 2.08 (d, 6H, J = 4.3). MS (ESI-) m/z 407.2 (M-H)-. 5 Example 288 N -(5-{ 1-[2-(3,5-dimethyl-1H-pyrazol-4-yl)ethyl]-1H-1,2,3-triazol-4-yl}-1H-indazol-3-yl) N 2,N 2-dimethylglycinamide The title compound was prepared according to the procedure outlined in Example 10 282F substituting 4-(2-azidoethyl)-3,5-dimethyl-1H-pyrazole for 1-(azidomethyl)-3 methylbenzene. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 12.85 (s, 1H), 10.06 (s, 1H), 8.37 (s, 1H), 8.21 (s, 1H), 7.78 (d, 1H, J = 8.8), 7.51 (d, 1H, J = 8.8), 4.42 (t, 2H, J = 6.9), 3.19 (s, 2H), 2.89 (t, 2H, J = 7.0), 2.35 (s, 6H), 1.97 (s, 6H). MS (ESI-) m/z 406.2 (M-H)-. 15 Example 289 2-(4-{3-[(N,N-dimethylglycyl)amino]-1H-indazol-5-yl}-1H-1,2,3-triazol-1-yl)- 2 methylpropanoic acid The title compound was prepared according to the procedure outlined in Example 282F substituting 2-azido-2-methylpropanoic acid for 1-(azidomethyl)-3-methylbenzene. 'H 20 NMR (400 MHz, DMSO-d 6 ) 6 ppm 12.77 (s, 1H), 10.03 (s, 1H), 8.47 (s, 1H), 8.22 (s, 1H), 7.85 (dd, 1H, J = 0.9, 8.7), 7.49 (d, 1H, J = 8.6), 3.21 (s, 2H), 2.36 (s, 6H), 1.77 (s, 6H). MS (ESI-) m/z 370.2 (M-H)-. Example 290 25 ethyl (4-{3-[(N,N-dimethylglycyl)amino]-1H-indazol-5-yl}-1H-1,2,3-triazol-1-yl)acetate The title compound was prepared according to the procedure outlined in Example 282F substituting ethyl 2-azidoacetate for 1-(azidomethyl)-3-methylbenzene. 1H NMR (400 MHz, DMSO-d 6 ) 6 ppm 12.87 (s, 1H), 10.08 (s, 1H), 8.51 (s, 1H), 8.26 (s, 1H), 7.82 (dd, 1H, J = 1.4, 8.7), 7.53 (d, 1H, J = 8.8), 5.44 (s, 2H), 4.21 (q, 2H, J = 7.0), 3.19 (s, 2H), 2.35 (s, 30 6H), 1.24 (t, 3H, J = 7.1). MS (ESI+) m/z 372.2 (M+H). Example 291 N 2,N 2 -dimethyl-N'-(5-{ 1-[(trimethylsilyl)methyl]-1H-1,2,3-triazol-4-yl}-1H-indazol-3 yl)glycinamide 170 WO 2008/154241 PCT/US2008/065727 The title compound was prepared according to the procedure outlined in Example 282F substituting (azidomethyl)trimethylsilane for 1-(azidomethyl)-3-methylbenzene. 1H NMR (400 MHz, DMSO-d 6 ) 6 ppm 13.04 (s, 1H), 10.20 (s, 1H), 8.46 (s, 1H), 8.36 (s, 1H), 7.94 (dd, 1H, J = 1.3, 8.7), 7.65 (d, 1H, J = 8.8), 4.18 (s, 2H), 3.33 (s, 2H), 2.49 (s, 6H), 0.25 5 (in, 9H). MS (ESI+) m/z 372.2 (M+H). Example 292 Nl-[5-(3-furyl)-1H-indazol-3-yl]-N 2

,N

2 -dimethylglycinamide The title compound was prepared according to the procedure outlined in Example 10 233A substituting Example 282C for 5-bromo-2-fluorobenzonitrile and furan-3-ylboronic acid for 1-benzyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole. H NMR (600 MHz, DMSO-d 6 ) 6 ppm 12.70 (s, 1H), 9.98 (s, 1H), 8.08 (s, 1H), 7.90 (s, 1H), 7.72 (t, 1H, J = 1.6), 7.59 (dd, 1H, J = 1.4, 8.7), 7.45 (d, 1H, J = 8.8), 6.87 (s, 1H), 3.17 (s, 2H), 2.33 (s, 6H). MS (ESI+) m/z 285.2 (M+H)y. 15 Example 293

N

2

,N

2 -dimethyl-N -[5-(1H-pyrazol-5-yl)-1H-indazol-3-yl]glycinamide The title compound was prepared according to the procedure outlined in Example 233A substituting Example 282C for 5-bromo-2-fluorobenzonitrile and 1H-pyrazol-5 20 ylboronic acid for 1-benzyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 12.68 (s, 1H), 10.01 (s, 1H), 8.12 (s, 1H), 7.80 (d, 1H, J = 9.0), 7.69 (s, 1H), 7.46 (d, 1H, J = 8.6), 6.60 (d, 1H, J = 2.0), 3.17 (d, 2H, J = 6.4), 2.34 (s, 6H). MS (ESI+) m/z 285.2 (M+H)*. 25 Example 294 N 2,N 2 -dimethyl-N-(5-pyrimidin-5-yl-1H-indazol-3-yl)glycinamide The title compound was prepared according to the procedure outlined in Example 233A substituting Example 282C for 5-bromo-2-fluorobenzonitrile and pyrimidin-5 ylboronic acid for 1-benzyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole. 1 H 30 NMR (600 MHz, DMSO-d 6 ) 6 ppm 12.87 (s, 1H), 10.11 (s, 1H), 9.16 (s, 1H), 9.09 (s, 2H), 8.16 (s, 1H), 7.75 (dd, 1H, J= 1.5, 8.8), 7.60 (d, 1H, J= 8.8), 3.18 (s, 2H), 2.33 (s, 6H). MS (ESI+) m/z 297.2 (M+H)*. 171 WO 2008/154241 PCT/US2008/065727 Example 295 N-[5-(2,1,3-benzoxadiazol-5-yl)-1H-indazol-3-yl]-N 2

,N

2 -dimethylglycinamide The title compound was prepared according to the procedure outlined in Example 233A substituting Example 282C for 5-bromo-2-fluorobenzonitrile and 5 benzo[c][1,2,5]oxadiazol-5-ylboronic acid for 1-benzyl-4-(4,4,5,5-tetramethyl-1,3,2 dioxaborolan-2-yl)-1H-pyrazole. 1 H NMR (600 MHz, DMSO-d 6 ) 6 ppm 12.87 (s, 1H), 10.15 (s, 1H), 8.29 (s, 1H), 8.21 (s, 1H), 8.16 (d, 1H, J = 9.4), 7.99 (dd, 1H, J = 1.1, 9.4), 7.85 (m, 1H), 7.59 (d, 1H, J = 8.8), 3.19 (s, 2H), 2.34 (s, 6H). MS (ESI+) m/z 337.2 (M+H)*. 10 Example 296

N

2

,N

2 -dimethyl-N -[5-(1H-pyrazol-4-yl)-1H-indazol-3-yl]glycinamide The title compound was prepared according to the procedure outlined in Example 233A substituting Example 282C for 5-bromo-2-fluorobenzonitrile and 4-(4,4,5,5 tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole for 1-benzyl-4-(4,4,5,5-tetramethyl-1,3,2 15 dioxaborolan-2-yl)-1H-pyrazole. 1 H NMR (600 MHz, DMSO-d 6 ) 6 ppm 12.62 (s, 1H), 9.94 (s, 1H), 7.95 (s, 2H), 7.87 (s, IH), 7.58 (d, 1H, J = 8.8), 7.42 (d, 1H, J= 8.8), 3.16 (s, 2H), 2.34 (s, 6H). MS (ESI+) m/z 285.2 (M+H)*. Example 297 20 N 2

,N

2 -dimethyl-N -[5-(1-methyl-iH-pyrazol-4-yl)-1H-indazol-3-yl]glycinamide The title compound was prepared according to the procedure outlined in Example 233A substituting Example 282C for 5-bromo-2-fluorobenzonitrile and 1-methyl-4-(4,4,5,5 tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole or 1-benzyl-4-(4,4,5,5-tetramethyl-1,3,2 dioxaborolan-2-yl)-1H-pyrazole. 1 H NMR (600 MHz, DMSO-d 6 ) 6 ppm 12.64 (s, 1H), 9.98 25 (s, 1H), 8.04 (s, 1H), 7.86 (s, IH), 7.76 (s, 1H), 7.55 (dd, 1H, J = 1.6, 8.6), 7.43 (d, 1H, J = 8.8), 3.87 (s, 3H), 3.17 (s, 2H), 2.35 (s, 6H). MS (ESI+) m/z 299.2 (M+H)*. Example 298 N -[5-(3,5-dimethyl-1H-pyrazol-4-yl)-1H-indazol-3-yl] -N 2

,N

2 -dimethylglycinamide 30 The title compound was prepared according to the procedure outlined in Example 233A substituting Example 282C for 5-bromo-2-fluorobenzonitrile and 3,5-dimethyl-4 (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole for 1-benzyl-4-(4,4,5,5 tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole. 1H NMR (600 MHz, DMSO-d 6 ) 6 ppm 12.63 (s, 1H), 10.02 (s, 1H), 7.63 (s, 1H), 7.46 (in, 1H), 7.27 (dd, 1H, J = 1.6, 8.6), 3.16 (s, 172 WO 2008/154241 PCT/US2008/065727 2H), 2.32 (s, 6H), 2.18 (s, 6H). MS (ESI+) m/z 323.2 (M+H). Example 299

N

1 -{5-[2-(dimethylamino)pyrimidin-5-yl]-1H-indazol-3-yl}-N 2

,N

2 -dimethylglycinamide 5 The title compound was prepared according to the procedure outlined in Example 233A substituting Example 282C for 5-bromo-2-fluorobenzonitrile and N,N-dimethyl-5 (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-amine for 1-benzyl-4-(4,4,5,5 tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole. H NMR (600 MHz, DMSO-d 6 ) 6 ppm 12.72 (s, 1H), 10.03 (s, 1H), 8.62 (s, 2H), 7.91 (s, 1H), 7.58 (dd, 1H, J = 1.6, 8.6), 7.51 (d, 10 1H, J = 8.5), 3.16 (s, 8H), 2.33 (s, 6H). MS (ESI+) m/z 340.2 (M+H). Example 300 N 2,N 2 -dimethyl-N-[5-(2-morpholin-4-ylpyrimidin-5-yl)-1H-indazol-3-yl]glycinamide The title compound was prepared according to the procedure outlined in Example 15 233A substituting Example 282C for 5-bromo-2-fluorobenzonitrile and 4-(5-(4,4,5,5 tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)morpholine for 1-benzyl-4-(4,4,5,5 tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole. H NMR (600 MHz, DMSO-d 6 ) 6 ppm 12.74 (s, 1H), 10.03 (s, 1H), 8.67 (s, 2H), 7.94 (s, 1H), 7.60 (dd, 1H, J = 1.8, 8.8), 7.52 (d, 1H, J = 8.5), 3.74 (m, 4H), 3.67 (m, 4H), 3.17 (s, 2H), 2.33 (s, 6H). MS (ESI+) m/z 382.2 20 (M+H)y. Example 301

N

2

,N

2 -dimethyl-Nl - {5-[1-(2-morpholin-4-ylethyl)-1H-pyrazol-4-yl]-1H-indazol-3 yl} glycinamide 25 The title compound was prepared according to the procedure outlined in Example 233A substituting Example 282C for 5-bromo-2-fluorobenzonitrile and 4-(2-(4-(4,4,5,5 tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazol-1-yl)ethyl)morpholine for 1-benzyl-4 (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole. HNMR (600 MHz, DMSO-d 6 ) 6 ppm 12.63 (s, 1H), 9.96 (s, 1H), 8.09 (s, 1H), 7.85 (s, 1H), 7.77 (s, 1H), 7.54 (dd, 1H, J = 30 1.5, 8.8), 7.43 (d, 1H, J = 8.5), 4.24 (t, 2H, J = 6.6), 3.54 (m, 4H), 3.16 (s, 2H), 2.73 (t, 2H, J = 6.6), 2.41 (s, 4H), 2.34 (s, 6H). MS (ESI+) m/z 398.3 (M+H). Example 302 Nl-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N 2

,N

2 _ 173 WO 2008/154241 PCT/US2008/065727 dimethylglycinamide Example 302A 5 1-benzyl-5-cyclopropyl-4-(tributylstannyl)-1H-1,2,3-triazole The title compound was prepared according to the procedure outlined in Example 142A substituting toluene for hexane and (azidomethyl)benzene for Example 80A. The crude product was used in the next step without purification. 10 Example 302B 5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-2-fluorobenzonitrile The title compound was prepared according to the procedure outlined in Example 142B substituting Example302A for Example 142A and 2-fluoro-5-iodobenzonitrile for 87A. 15 MS (ESI+) m/z 319.2 (M+H). Example 302C 5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-amine 20 The title compound was prepared according to the procedure outlined in Example 62D substituting Example 302B for Example 62C. MS (ESI-) m/z 299.2 (M-H)-. Example 302D 25 tert-butyl 3-amino-5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazole-1 carboxylate The title compound was prepared according to the procedure outlined in Example 64A substituting Example 302C for Example 62D. 30 Example 302E

N

1 -[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N 2

,N

2 _ dimethylglycinamide The title compound was prepared according to the procedure outlined in Example 64B substituting Example 302D for Example 64A and dimethylaminoacetylchloride 174 WO 2008/154241 PCT/US2008/065727 hydrochloride for methoxy acetyl chloride. H NMR (400 MHz, DMSO-d 6 ) 6 ppm 12.76 (s, 1H), 10.06 (s, 1H), 8.18 (s, 1H), 7.79 (d, 1H, J = 8.8), 7.50 (d, 1H, J= 8.8), 7.34 (in, 5H), 5.68 (s, 2H), 3.16 (s, 2H), 2.32 (s, 6H), 1.76 (m, 1H), 1.05 (q, 2H, J= 6.1), 0.39 (q, 2H, J= 5.4). MS (ESI+) m/z 416.3 (M+H). MS (ESI+) m/z 416.3 (M+H)*. 5 Example 303 N -[5-(1-benzyl-1H-pyrazol-4-yl)-1H-indazol-3-yl]-N2,N2 -dimethylglycinamide 10 Example 303A 3-amino-5 -(1 -benzyl- 1 H-pyrazol-4-yl)-indazole- 1 -carboxylic acid tert-butyl ester The title compound was prepared according to the procedure outlined in Example 64A substituting Example 233B for Example 62D (0.925 g, 100%). 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 8.19 (s, 1H), 8.04 (s, 1H), 7.90-7.95 (m, 1H), 7.87 (s, 1H), 7.74 (d, J = 1.6 15 Hz, 1H), 7.28-7.36 (m, 5 H), 6.27 (s, 2H), 5.37 (s, 2H), 1.58 (s, 9H). MS (ESI+) m/z 390 (M+H)y. Example 303B N-[5-(1-benzyl-1H-pyrazol-4-yl)-1H-indazol-3-yl]-N 2

,N

2 -dimethylglycinamide A suspension of 2-(dimethylamino)acetic acid (32 mg, 0.308 mmol) and oxalyl 20 chloride (0.31 mL, 0.61 mmol) in dichloromethane (5 mL) and dimethylformamide (2 drops) was stirred at ambient temperature for about 1 hour then concentrated under reduced pressure. The residue was suspended in tetrahydrofuran (3 mL) and added to a suspension of Example 303A (40 mg, 0.103 mmol) and potassium carbonate (43 mg, 0.308 mmol) in tetrahydrofuran (5 mL). The reaction mixture was stirred at ambient temperature for about 25 30 minutes then trifluoroacetic acid (4 mL) was added and the reaction mixture was heated at about 60 'C for about 20 hours. The reaction mixture was cooled to ambient temperature and concentrated under reduced pressure, diluted with dichloromethane (20 mL) and washed with 15% aqueous sodium hydroxide solution (20 mL). The organic extract was separated, dried over magnesium sulfate, filtered and concentrated under reduced pressure. The crude 30 material was purified by reverse-phase HPLC using acetonitrile/water (0.05 M ammonium acetate) gradient elution method to afford the title compound as the acetate salt. H NMR (400 MHz, DMSO-d 6 ) 6 ppm 9.97 (s, 1H), 8.21 (s, 1H), 7.83 (s, 1H), 7.82 (s, 1H), 7.56 (d, J = 8.7 Hz, 1H), 7.43 (d, J = 8.6 Hz, 1H), 7.32-7.40 (m, 2H), 7.25-7.32 (m, 3H), 5.35 (s, 2H), 175 WO 2008/154241 PCT/US2008/065727 3.16 (s, 2H), 2.33 (s, 6H), 1.91 (s, 3H). MS (ESI+) m/z 375 (M+H)f. Example 304 N -[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3 -yl]-N 2 -methylglycinamide 5 The title compound was prepared according to the procedure outlined in Example 303B substituting 2-(tert-butoxycarbonyl(methyl)amino)acetic acid for 2 (dimethylamino)acetic acid and Example 64A for Example 303A. 1 H NMR (400 MHz, DMSO-d 6 ) S ppm 8.56 (s, 1H), 8.28 (s, 1H), 7.78-7.88 (m, iH), 7.45-7.56 (m, 1H), 7.28-7.45 (5H, m), 5.64 (2H, s), 2.37 (s, 2H), 1.89 (s, 3H). MS (ESI+) m/z 362 (M+H)f. 10 Example 305 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-pyrrolidin-1-ylacetamide 15 Example 305A tert-butyl 5-(1-benzyl-1H-1,2,3-triazol-4-yl)-3-(2-bromoacetamido)-1H-indazole-1 carboxylate To a suspension of Example 64A (500 mg, 1.28 mmol) in tetrahydrofuran (12 mL) was added diisopropylethylamine (0.22 mL, 1.28 mmol). The reaction mixture was stirred at 20 ambient temperature for about 15 minutes then 2-bromoacetyl chloride (0.11 mL, 1.2 mmol) was added. The reaction mixture was stirred at ambient temperature for about 16 hours then additional 2-bromoacetyl chloride (0.11 mL, 1.2 mmol) was added. The reaction mixture was stirred for an additional 15 minutes then concentrated under reduced pressure to provide the title compound as a brown solid. This material was used without further purification. 25 Example 305B N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-pyrrolidin-1-ylacetamide To a solution of Example 305A (44 mg, 0.086 mmol) and diisopropylethylamine (0.015 mL, 0.086 mmol) in acetonitrile (1 mL) was added pyrrolidine (0.021 mL, 0.25 mmol) 30 and the reaction mixture was heated at about 60 'C for about 15 minutes. The reaction mixture was cooled to ambient temperature and trifluoroacetic acid (1 mL) was added. The reaction mixture was heated at about 60 'C for about 48 hours. The reaction mixture was concentrated under reduced pressure, diluted with dichloromethane (20 mL) and washed with 176 WO 2008/154241 PCT/US2008/065727 15% aqueous sodium hydroxide solution (20 mL). The organic layer was separated, dried over magnesium sulfate, filtered and concentrated under reduced pressure. The crude material was purified by reverse-phase HPLC using acetonitrile/water (0.05 M ammonium acetate) gradient elution method to afford the title compound. 1 H NMR (400 MHz, DMSO 5 d 6 ) 6 ppm 8.58 (s, 1H), 8.24 (s, 1H), 7.81 (d, J = 8.7 Hz, 1H), 7.50 (d, J = 8.7 Hz, 1H), 7.27 7.45 (m, 5H), 5.64 (s, 2H), 3.35 (s, 2H), 2.65 (s, 4H), 1.76 (s, 4H). MS (ESI+) m/z 402 (M+H)y. Example 306 10 Nl-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N 2 -cyclopentylglycinamide The title compound was prepared according to the procedure outlined in Example 305B substituting cyclopentanamine for pyrrolidine (0.004 g, 12%). 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 8.56 (s, 1H), 8.31 (s, 1H), 7.73-7.86 (d, J = 8.8 Hz, 1H), 7.49 (d, J = 8.7 Hz, 1H), 7.29-7.45 (m, 5H), 5.64 (s, 2H), 3.37 (s, 2H), 2.99-3.14 (m, 1H), 1.60-1.80 (m, 4H), 15 1.30-1.50 (m, 4H). MS (ESI+) m/z 416 (M+H)+. Example 307 Nl-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N 2 -cyclopropylglycinamide To a solution of Example 305A (100 mg, 0.196 mmol) and diisopropylethylamine 20 (0.034 mL, 0.19 mmol) in acetonitrile (1 mL) was added cyclopropanamine (11 mg, 0.19 mmol) and the reaction mixture was heated at about 60 'C for about 1 hour. The reaction mixture was cooled to ambient temperature and hydrochloric acid (4 N in dioxane, 1 mL) was added. The reaction mixture was stirred at ambient temperature for about 16 hours. The reaction mixture was concentrated under reduced pressure and the crude material was 25 purified by reverse-phase HPLC using acetonitrile/water (0.05 M ammonium acetate) gradient elution method to afford the title compound as the acetate salt. 'H NMR (400 MHz, DMSO-d 6 ) 6 ppm 10.18 (s, 1H), 8.28 (s, 1H), 8.56 (s, 1H), 7.81 (d, J = 8.6 Hz, 1H), 7.49 (d, J = 8.7 Hz, 1H), 7.30-7.45 (m, 5H), 5.64 (s, 2H), 3.45 (s, 2H), 2.18-2.26 (m, 1H), 1.89 (s, 3H), 0.37-0.45 (m, 2H), 0.29-0.37 (m, 2H). MS (ESI+) m/z 388 (M+H). 30 Example 308

N

1 -[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N 2 -tetrahydro-2H-pyran-4 ylglycinamide 177 WO 2008/154241 PCT/US2008/065727 The title compound was prepared as the acetate salt according to the procedure outlined in Example 307 substituting tetrahydro-2H-pyran-4-amine for cyclopropanamine. H NMR (400 MHz, DMSO-d 6 ) 6 ppm 8.56 (s, 1H), 8.31 (s, 1H), 7.81 (d, J = 8.7 Hz, 1H), 7.50 (d, J= 8.7 Hz, 1H), 7.31-7.45 (m, 5H), 5.64 (s, 2H), 3.84 (d, J = 11.2 Hz, 2H), 3.43 (s, 5 2H), 3.30 (t, J = 10.8 Hz, 2H), 2.62-2.74 (in, 1H), 1.88 (s, 3H), 1.75-1.85 (in, 2H), 1.24-1.39 (in, 2H). MS (ESI+) m/z 432 (M+H)'. Example 309 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-(3-hydroxypyrrolidin-1 10 yl)acetamide The title compound was prepared as the diacetate salt according to the procedure outlined in Example 307 substituting pyrrolidin-3-ol for cyclopropanamine. H NMR (400 MHz, DMSO-d 6 ) 6 ppm 10.09 (s, 1H), 8.22 (s, 1H), 8.58 (s, 1H), 7.82 (d, J = 8.7 Hz, 1H), 7.50 (d, J = 8.7 Hz, 1H), 7.28-7.45 (m, 5H), 5.64 (s, 2H), 4.16-4.26 (in, 1H), 3.34 (s, 2H), 15 2.77-2.93 (m, 2H), 2.52-2.65 (in, 2H), 1.98-2.13 (in, 1H), 1.87 (s, 6H), 1.56-1.69 (in, 1H). MS (ESI+) m/z 418 (M+H)+. Example 310 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-(3-hydroxypiperidin-1 20 yl)acetamide The title compound was prepared as the acetate salt according to the procedure outlined in Example 307 substituting piperidin-3-ol for cyclopropanamine. 1H NMR (400 MHz, DMSO-d 6 ) 6 ppm 10.05 (s, 1H), 8.56 (s, 1H), 8.23 (s, 1H), 7.82 (d, J = 8.7 Hz, 1H), 7.50 (d, J = 8.7 Hz, 1H), 7.29-7.44 (m, 5H), 5.64 (s, 2H), 3.55-3.67 (in, 1H), 3.20 (s, 2H), 25 2.77-2.88 (m, 1H), 2.60-2.70 (in, 1H), 2.22-2.35 (in, 1H), 2.12-2.23 (m, 1H), 1.88 (s, 3H), 1.66-1.78 (m, 2H), 1.43-1.59 (in, 1H), 1.13-1.27 (in, 1H). MS (ESI+) m/z 432 (M+H). Example 311 N -[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N 3

,N

3 -dimethyl-beta-alaninamide 30 The title compound was prepared as the acetate salt according to the procedure outlined in Example 307 substituting dimethylamine for cyclopropanamine. 1H NMR (400 MHz, DMSO-d 6 ) 6 ppm 10.48 (s, 1H), 8.54 (s, 1H), 8.26 (s, 1H), 7.80 (d, J = 8.7 Hz, 1H), 7.48 (d, J = 8.7 Hz, 1H), 7.30-7.44 (m, 5H), 5.64 (s, 2H), 2.60 (d, J = 6.1 Hz, 2H), 2.54 (d, J= 178 WO 2008/154241 PCT/US2008/065727 6.3 Hz, 2H), 2.21 (s, 6H), 1.90 (s, 3H). MS (ESI+) m/z 390 (M+H). Example 312 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-morpholin-4-ylacetamide 5 The title compound was prepared according to the procedure outlined in Example 307 substituting morpholine for cyclopropanamine. 'H NMR (400 MHz, DMSO-d 6 ) 6 ppm 10.10 (s, 1H), 8.57 (s, 1H), 8.23 (s, 1H), 7.81 (d, J = 8.7 Hz, 1H), 7.50 (d, J = 8.7 Hz, 1H), 7.29 7.46 (m, 5H), 5.64 (s, 2H), 3.59-3.71 (m, 4H), 3.22-3.28 (in, 2H), 2.54 -2.64 (m, 4H). MS (ESI+) m/z 418 (M+H)*. 10 Example 313 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-(4-methylpiperazin-1 yl)acetamide The title compound was prepared as the diacetate salt according to the procedure 15 outlined in Example 307 substituting 1-methylpiperazine for cyclopropanamine. 'H NMR (400 MHz, DMSO-d 6 ) 6 ppm 8.57 (s, 1H), 8.25 (s, 1H), 7.81 (d, J = 8.7 Hz, 1H), 7.50 (d, J= 8.7 Hz, 1H), 7.32-7.43 (m, 5H), 5.64 (s, 2H), 3.22 (s, 2H), 2.53-2.65 (m, 4H), 2.31-2.45 (m, 4H), 2.17 (s, 3H), 1.85 (s, 6 H). MS (ESI+) m/z 431 (M+H)*. 20 Example 314 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-(3-oxopiperazin-1 yl)acetamide The title compound was prepared according to the procedure outlined in Example 307 substituting piperazine-2-one for cyclopropanamine. H NMR (400 MHz, DMSO-d 6 ) 6 ppm 25 10.21 (s, 1H), 8.57 (s, 1H), 8.22 (s, 1H), 7.81 (d, J = 8.7 Hz, 1H), 7.50 (d, J = 8.7 Hz, 1H), 7.31 - 7.46 (in, 5H), 5.64 (s, 2H), 3.36 (s, 2H), 3.24 (s, 2H), 3.17 (s, 2H), 2.78 (s, 2H). MS (ESI+) m/z 431 (M+H)+. Example 315 30 N'-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N 2 -isopropylglycinamide The title compound was prepared as the acetate salt according to the procedure outlined in Example 307 substituting propan-2-amine for cyclopropanamine. 'H NMR (400 MHz, DMSO-d 6 ) 6 ppm 8.56 (s 1H), 8.31 (s, 1H), 7.81 (d, J = 8.7 Hz, 1H), 7.49 (d, J = 8.7 179 WO 2008/154241 PCT/US2008/065727 Hz, 1H), 7.31-7.44 (in, 5H), 5.64 (s, 2H), 3.39 (s, 2H), 2.73-2.86 (in, lH), 1.90 (s, 3H), 1.04 (d, J = 6.1 Hz, 6H). MS (ESI+) m/z 390 (M+H). Example 316 5 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N 2 -cyclohexylglycinamide The title compound was prepared as the acetate salt according to the procedure outlined in Example 307 substituting cyclohexanamine for cyclopropanamine. H NMR (400 MHz, DMSO-d 6 ) 6 ppm 8.55 (s, 1H), 8.31 (s, 1H), 7.81 (d, J = 8.7 Hz, 1H), 7.49 (d, J = 8.7 Hz, 1H), 7.30-7.44 (in, 5H), 5.64 (s, 2H), 3.40 (s, 2H), 1.90 (s, 3H), 1.80-1.88 (in, 2H), 1.63 10 1.73 (in, 2H), 1.50-1.60 (in, 1H), 1.02-1.29 (in, 5H). MS (ESI+) m/z 430 (M+H). Example 317 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]acetamide To a mixture of Example 64A (20 mg, 0.051 mmol) and diisopropylethylamine (0.063 15 mL, 0.35 mmol) in tetrahydrofuran (1.5 mL) was added acetyl chloride (0.013 mL, 0.17 mmol) and the reaction mixture was stirred at ambient temperature for about 1.5 hours. Hydrochloric acid (4 N in dioxane, 1.5 mL) was added and the mixture stirred at ambient temperature for about 16 hours. The solvent was removed under reduced pressure and the crude material was purified by reverse-phase HPLC using acetonitrile/water (0.05 M 20 ammonium acetate) gradient elution method to afford the title compound as the acetate salt. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 10.35 (s, 1H), 8.57 (s, 1H), 8.22 (s, 1H), 7.81 (d, J= 8.7 Hz, 1H), 7.48 (d, J = 8.7 Hz, 1H), 7.33-7.42 (in, 5H), 5.64 (s, 2H), 2.13 (s, 3H). MS (ESI-) m/z 331 (M-H)-. 25 Example 318

N

1 -[5-(1 -benzyl- 1 H-1,2,3-triazol-4-yl)- 1 H-indazol-3-yl]-N 2 -cyclobutylglycinamide The title compound was prepared according to the procedure outlined in Example 307 substituting cyclobutanamine for cyclopropanamine. 1H NMR (400 MHz, DMSO-d 6 ) 6 ppm 8.56 (s, 1H), 8.29 (s, 1H), 7.81 (d, J = 8.7 Hz, 1H), 7.49 (d, J = 8.7 Hz, 1H), 7.31-7.45 (in, 30 5H), 5.64 (s, 2H), 3.31 (s, 2H), 2.01-2.20 (in, 2H), 1.48-1.83 (in, 5H). MS (ESI+) m/z 402 (M+H)f. 180 WO 2008/154241 PCT/US2008/065727 Example 319 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-propylurea To a solution of Example 64A (75 mg, 0.19 mmol) in pyridine (2 mL) was added 1 isocyanatopropane (16 mg, 0.19 mmol) and the reaction mixture was stirred at ambient 5 temperature for about 3 hours. Additional isocyanate (0.1 mL) was added and the mixture was heated at about 80 'C for about 16 hours. The reaction mixture was cooled to ambient temperature and water (5 mL) was added. The resulting precipitate was collected by filtration then treated with hydrochloric acid (4 N solution in dioxane, 3 mL) and stirred at room temperature for about 4.5 hours. Diethyl ether (5 mL) was added and the precipitate 10 collected by filtration. The crude material was purified by reverse-phase HPLC using acetonitrile/water (0.05 M ammonium acetate) gradient elution method to afford the title compound as the acetate salt. 1H NMR (400 MHz, DMSO-d 6 ) 6 ppm 9.34 (s, 1H), 8.50 (s, TH), 8.42 (s, TH), 7.80 (d, J = 8.7 Hz, TH), 7.38 (d, J = 8.7 Hz, 1H), 7.31-7.48 (m, 5H), 5.65 (s, 2H), 3.18 (dd, J = 6.6, 12.7 Hz, 2H), 1.51 (dd, J = 7.1, 14.3 Hz, 2H), 0.91 (t, J = 7.3 Hz, 15 3H). MS (ESI+) m/z 376 (M+H)f. Example 320 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]ethanesulfonamide To a solution of Example 64A (75 mg, 0.19 mmol) in pyridine (2 mL) was added 20 ethanesulfonyl chloride (25 mg, 0.19 mmol) and the reaction mixture was stirred at room temperature for about 3 hours. Additional sulfonyl chloride (25 mg, 0.19 mmol) was added and the reaction mixture was stirred for about 48 hours. The reaction mixture was concentrated under reduced pressure and the residue dissolved in dichloromethane (10 mL) and washed with 1 N aqueous hydrochloric acid (10 mL). The organic portion was separated, 25 dried under reduced pressure, and treated with hydrochloric acid (4 N in dioxane, 5 mL) and stirred at room temperature for about 12 hours. The reaction mixture was concentrated under reduced pressure and the crude material was purified by reverse-phase HPLC using acetonitrile/water (0.05 M ammonium acetate) gradient elution method to afford the title compound as the acetate salt. 1H NMR (400 MHz, DMSO-d) 6 ppm 10.12 (s, 1H), 8.61 (s, 30 1H), 8.24 (s, 1H), 7.83 (d, J = 8.7 Hz, 1H), 7.52 (d, J = 8.7 Hz, 1H), 7.29-7.48 (m, 5H), 5.64 (s, 2H), 3.29 (d, J = 9.2 Hz, 2H), 1.31 (t, J = 7.3 Hz, 3H). MS (ESI+) m/z 383 (M+H)f. 181 WO 2008/154241 PCT/US2008/065727 Example 321 5-(1-benzyl-1H-1,2,3-triazol-4-yl)-N-(cyclopropylmethyl)-1H-indazol-3-amine A mixture of Example 64A (100 mg, 0.256 mmol), cyclopropanecarbaldehyde (0.057 mL, 0.76 mmol), sodium triacetoxyborohydride (163 mg, 0.76 mmol) and acetic acid (0.044 5 mL, 0.76 mmol) in 1,2-dichloroethane (5 mL) was stirred at ambient temperature for about 2.5 hours. Hydrochloric acid (4 N in dioxane, 4 mL) was added and the reaction mixture was stirred for about 16 hours. The precipitate was collected by filtration, rinsing with ether (10 mL). The solid was dissolved in dichloromethane (10 mL) and treated with trifluoroacetic acid (0.1 mL) and the reaction mixture was stirred at room temperature for about 2 hours. 10 The reaction mixture was neutralized by the addition of 15% aqueous sodium hydroxide solution (about 15 mL) and the organic layer was separated, dried over magnesium sulfate, filtered and concentrated under reduced pressure. The crude material was purified by reverse-phase HPLC using acetonitrile/water (0.05 M ammonium acetate) gradient elution method to afford the title compound as the acetate salt. 1 H NMR (400 MHz, DMSO-d 6 ) 6 15 ppm 11.43 (s, 1H), 8.41 (s, 1H), 8.28 (s, 1H), 7.68 (d, J = 8.7 Hz, 1H), 7.32-7.45 (in, 5H), 7.26 (d, J = 8.6 Hz, 1H), 6.08 (t, J = 5.7 Hz, 1H), 5.64 (s, 2H), 3.12 (t, J = 6.2 Hz, 2 H), 1.04 1.22 (in, 1H), 0.35-0.53 (m, 2H), 0.17-0.32 (in, 2H). MS (ESI+) m/z 345 (M+H). Example 322 20 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-ethylurea The title compound was prepared according to the procedure outlined in Example 319 substituting isocyanatoethane for 1-isocyanatopropane. 1 H NMR (400 MHz, DMSO-d 6 ) 6 ppm 9.32 (s, 1H), 8.49 (s, 1H), 8.42 (s, 1H), 7.81 (d, J = 8.7 Hz, 1H), 7.70 (d, J = 8.7 Hz, 1H), 7.31-7.49 (m, 5H), 5.65 (s, 2H), 3.23 (d, J = 6.9 Hz, 2H), 1.12 (t, J = 7.1 Hz, 3 H). MS 25 (ESI+) m/z 362 (M+H)+. Example 323 1-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]pyrrolidin-2-one A suspension of Example 64A (200 mg, 0.51 mmol) and diisopropylethylamine 30 (0.089 mL, 0.51 mmol) in tetrahydrofuran (5 mL) was stirred for about 15 minutes at ambient temperature then 4-bromobutanoyl chloride (0.059 mL, 0.51 mmol) was added. The reaction mixture was stirred for about 16 hours. The precipitate was removed by filtration and the filtrate concentrated under reduced pressure. The residue was taken up in acetonitrile (5 mL) 182 WO 2008/154241 PCT/US2008/065727 and treated with diisopropylethylamine (0.089 mL, 0.51 mmol) and heated at about 60 0 C for about 16 hours. The reaction mixture was cooled to room temperature and concentrated under reduced pressure. The residue was treated with hydrochloric acid (4 N in dioxane, 5 mL) and the reaction mixture stirred at room temperature for about 2 hours. The reaction 5 mixture was concentrated under reduced pressure and the crude material was purified by reverse-phase HPLC using acetonitrile/water (0.05 M ammonium acetate) gradient elution method to afford the title compound as the acetate salt. H NMR (400 MHz, DMSO-d 6 ) 6 ppm 12.84 (s, 1H), 8.56 (s, 1H), 8.49 (s, 1H), 7.84 (d, J = 8.6 Hz, 1H), 7.51 (d, J = 8.7 Hz, 1H), 7.29-7.46 (m, 5H), 5.64 (s, 2H), 3.96 (t, J = 6.9 Hz, 2H), 2.56 (t, J = 7.9 Hz, 2H), 2.25 10 2.12 (in, 2H). MS (ESI+) m/z 359 (M+H)+. Example 324 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-4-(dimethylamino)butanamide The title compound was prepared as the diacetate salt according to the procedure 15 outlined in Example 303B substituting 4-(dimethylamino)butanoic acid for 2 (dimethylamino)acetic acid and substituting Example 64A for Example 303A. 1H NMR (400 MHz, DMSO-d 6 ) 6 ppm 10.34 (s, 1H), 8.53 (s, 1H), 8.22 (s, 1H), 7.78 (d, J = 8.7 Hz, 1H), 7.47 (d, J = 8.7 Hz, 1H), 7.30-7.41 (m, 5H), 5.62 (s, 2H), 2.41 (t, J = 7.2 Hz, 2H), 2.28 (t, J= 6.8 Hz, 2H), 2.14 (s, 6H), 1.84 (s, 6H), 1.74-1.77 (in, 2H). MS (ESI-) m/z 462 (M-H)-. 20 Example 325 N-3,4-dihydro-1H-isochromen-4-yl-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81B substituting 3,4-dihydro-1H-isochromen-4-amine for piperidine. 1 H NMR (300 MHz, 25 DMSO-d 6 ) 6 ppm 13.4 (br s, 1 H), 9.02 (d, 1 H), 8.4 (in, 1 H), 8.22 (in, 1 H), 7.75 (m, 2 H), 7.2-7.4 (in, 5 H), 5.24 (m, 1 H), 4.75 (m, 2 H), 4.02 (in, 1 H), 3.8 (m, 1 H). MS m/z (ESI+) 361 (M+H)+. Example 326 30 N-(cyclohexylmethyl)-5-(1H-indazol-5-yl)isoxazole-3-carboxamide 5-(1H-Indazol-5-yl)isoxazole-3-carboxylic acid (35 mg, 0.15 mmol, Example 71A), was dissolved in NN-dimethylformamide (0.8 mL) followed by the addition of HATU (60 mg, 0.15 mmol) dissolved in NN-dimethylformamide (0.8 mL). Then a solution of 1 183 WO 2008/154241 PCT/US2008/065727 cyclohexylmethanamine (17 mg, 0.17 mmol), dissolved in NN-dimethylformamide (0.8mL) was added, followed by diisopropylethylamine (56 gL,0..31 mmol) dissolved in NN dimethylformamide (0.8 mL). The resulting mixture was shaken for 3 hours at 40 C. The reaction was filtered, checked by LC/MS and concentrated to dryness. The residues were 5 dissolved in 1:1 dimethyl sulfoxide/methanol and purified by reverse phase HPLC (Phenomenex@ Luna@ C8(2) 5 pim 1oA AXIATM column (30 mm x 75 mm), 50 mL/min, 10-100% acetonitrile/0.1% trifluoroacetic acid in water) to provide the title product. 'H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 0.91 - 0.97 (in, 2 H), 1.12 - 1.27 (m, 4 H), 1.61 1.75 (in, 5 H), 3.08 - 3.16 (m, 2 H), 7.22 - 7.24 (in, 1 H), 7.71 - 7.75 (in, 1 H), 7.87 - 7.92 (in, 10 1 H), 8.23 - 8.27 (m, 1 H), 8.38 - 8.41 (in, 1 H). MS (ESI+) m/z 325 (M+H); (ESI-) m/z 323 (M-H)-. Example 327 N-(3-chlorobenzyl)-5-(1H-indazol-5-yl)isoxazole-3-carboxamide 15 The title compound was prepared using the procedure described in Exampe 326 except 1-(3-chlorophenyl)methanamine was substituted for 1-cyclohexylmethanamine. 1H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 4.47 - 4.52 (in, 2 H), 7.27 - 7.29 (m, 1 H), 7.30 7.42 (in, 4 H), 7.72 - 7.75 (m, 1 H), 7.89 - 7.93 (in, 1 H), 8.25 - 8.28 (in, 1 H), 8.41 - 8.42 (in, 1 H). MS (ESI+) m/z 353 (M+H)*; (ESI-) m/z 351 (M-H)-. 20 Example 328 5-(1H-indazol-5-yl)-N-(2-methoxybenzyl)isoxazole-3-carboxamide The title compound was prepared using the procedure described in Exampe 326 except 1-(2-methoxyphenyl)methanamine was substituted for 1-cyclohexylmethanamine. 1H 25 NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 3.82 - 3.86 (in, 3 H), 4.45 - 4.50 (m, 2 H), 6.92 6.97 (in, 1 H), 7.01 - 7.04 (m, 1 H), 7.19 - 7.24 (in, 1 H), 7.26 - 7.31 (in, 2 H), 7.69 - 7.77 (in, 1 H), 7.88 - 7.93 (m, 1 H), 8.24 - 8.28 (in, 1 H), 8.38 - 8.44 (in, 1 H). MS (ESI+) m/z 349 (M+H); (ESI-) m/z 347 (M-H)-. 30 Example 329 5-(1H-indazol-5-yl)-N-[2-(trifluoromethyl)benzyl]isoxazole-3-carboxamide The title compound was prepared using the procedure described in Exampe 326 except 1-[2-(trifluoromethyl)phenyl]methanamine was substituted for 1 184 WO 2008/154241 PCT/US2008/065727 cyclohexylmethanamine. H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 4.66 - 4.73 (m, 2 H), 7.29 - 7.33 (in, 1 H), 7.49 - 7.60 (in, 2 H), 7.67 - 7.79 (in, 3 H), 7.91 - 7.94 (m, 1 H), 8.26 8.28 (m, 1 H), 8.41 - 8.45 (m, 1 H). MS (ESI+) m/z 387 (M+H)f; (ESI-) m/z 385 (M-H)-. 5 Example 330 5-(1H-indazol-5-yl)-N-[3-(trifluoromethyl)benzyl]isoxazole-3-carboxamide The title compound was prepared using the procedure described in Exampe 326 except 1-[3-(trifluoromethyl)phenyl]methanamine was substituted for 1 cyclohexylmethanamine. H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 4.57 - 4.61 (m, 2 H), 10 7.28 - 7.31 (m, 1 H), 7.59 - 7.77 (m, 5 H), 7.90 - 7.94 (m, 1 H), 8.27 - 8.28 (m, 1 H), 8.40 8.43 (m, 1 H). MS (ESI-) m/z 385 (M-H)-. Example 331 5-(1H-indazol-5-yl)-N-[4-(trifluoromethyl)benzyl]isoxazole-3-carboxamide 15 The title compound was prepared using the procedure described in Exampe 326 except 1-[4-(trifluoromethyl)phenyl]methanamine was substituted for 1 cyclohexylmethanamine. H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 4.55 - 4.60 (s, 2 H), 7.27 - 7.30 (m, 1 H), 7.54 - 7.59 (m, 2 H), 7.70 - 7.76 (m, 3 H), 7.88 - 7.94 (m, 1 H), 8.24 8.28 (m, 1 H), 8.40 - 8.44 (m, 1 H). MS (ESI+) m/z 387 (M+H)f; (ESI-) m/z 385 (M-H)-. 20 Example 332 5-(1H-indazol-5-yl)-N-(pyridin-2-ylmethyl)isoxazole-3-carboxamide The title compound was prepared using the procedure described in Exampe 326 except 1 -pyridin-2-ylmethanamine was substituted for 1 -cyclohexylmethanamine. 1H NMR 25 (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 4.74 - 4.84 (s, 2 H), 7.30 - 7.34 (m, 1 H), 7.68 - 7.81 (m, 3 H), 7.89 - 7.97 (m, 1 H), 8.22 - 8.33 (m, 2 H), 8.40 - 8.45 (in, 1 H), 8.67 - 8.76 (m, 1 H). MS (ESI+) m/z 320 (M+H); (ESI-) m/z 318 (M-H)-. Example 333 30 5-(1H-indazol-5-yl)-N-(pyridin-3-ylmethyl)isoxazole-3-carboxamide The title compound was prepared using the procedure described in Exampe 326 except 1-pyridin-3-ylmethanamine was substituted for 1-cyclohexylmethanamine. H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 4.61 - 4.68 (s, 2 H), 7.27 - 7.31 (m, 1 H), 7.70 - 7.75 (m, 1 185 WO 2008/154241 PCT/US2008/065727 H), 7.83 - 7.94 (m, 2 H), 8.24 - 8.28 (m, 1 H), 8.31 - 8.37 (m, 1 H), 8.40 - 8.44 (m, 1 H), 8.69 - 8.74 (m, 1 H), 8.77 - 8.82 (m, 1 H). MS (ESI+) m/z 320 (M+H)+; (ESI-) m/z 318 (M-H)-. 5 Example 334 5-(1H-indazol-5-yl)-N-(pyridin-4-ylmethyl)isoxazole-3-carboxamide The title compound was prepared using the procedure described in Exampe 326 except 1-pyridin-4-ylmethanamine was substituted for 1-cyclohexylmethanamine. H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 4.73 - 4.80 (s, 2 H), 7.30 - 7.33 (m, 1 H), 7.73 - 7.78 (m, 1 10 H), 7.89 - 7.97 (m, 3 H), 8.25 - 8.30 (m, 1 H), 8.40 - 8.46 (m, 1 H), 8.76 - 8.83 (m, 2 H). MS (ESI-) m/z 318 (M-H)-. Example 335 N-(2-chlorobenzyl)-5-(1H-indazol-5-yl)isoxazole-3-carboxamide 15 The title compound was prepared using the procedure described in Exampe 326 except 1-(2-chlorophenyl)methanamine was substituted for 1-cyclohexylmethanamine. 1H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 4.54 - 4.58 (s, 2 H), 7.27 - 7.32 (m, 1 H), 7.33 - 7.42 (m, 3 H), 7.47 - 7.49 (m, 1 H), 7.71 - 7.77 (m, 1 H), 7.88 - 7.98 (m, 1 H), 8.24 - 8.27 (m, 1 H), 8.41 - 8.44 (m, 1 H). MS (ESI+) m/z 353 (M+H)+; (ESI-) m/z 351(M-H)-. 20 Example 336 N-(4-chlorobenzyl)-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared using the procedure described in Exampe 326 except 1-(4-chlorophenyl)methanamine was substituted for 1-cyclohexylmethanamine. 1 H 25 NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 4.42 - 4.49 (m, 2 H), 7.22 - 7.31 (m, 1 H), 7.34 7.49 (m, 4 H), 7.70 - 7.76 (m, 1 H), 7.84 - 7.92 (m, 1 H), 8.17 - 8.30 (m, 1 H), 8.35 - 8.47 (m, 1 H). MS (ESI-) m/z 351 (M-H)-. Example 337 30 5 -(1 H-indazol-5 -yl)-N-(1 -phenyl-2-pipendin- 1 -ylethyl)isoxazole-3 -carboxamide The title compound was prepared according to the procedure outlined in Example 81 B substituting 1-phenyl-2-piperidin-1-ylethanamine for piperidine. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.4 (br s, 1 H), 9.12 (d, 1 H), 8.4 (s, 1 H), 8.22 (s, 1 H), 7.9 (d, 1 H), 7.7 186 WO 2008/154241 PCT/US2008/065727 (d, 1 H), 7.2-7.4 (in, 6 H), 5.2 (m, 1 H), 3.2 (in, 2 H), 2.3 (m, 4 H), 1.2-1.4 (in, 6 H). MS (ESI+) m/z 416 (M+H). Example 338 5 N-[2-(1H-imidazol-1-yl)-l-phenylethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81 B substituting 2-(1H-imidazol- l-yl)-l -phenylethanamine for piperidine. 'H NMR (300 MHz, DMSO-d 6 ) a ppm 13.4 (br s, 1 H), 9.5 (d, 1 H), 8.4 (s, 1 H), 8.22 (s, 1 H), 7.78 (m, 1 H), 7.52 (d, 2 H), 7.72 (d, 2 H), 7.2-7.4 (in, 5 H), 6.85 (s, 1 H), 5.44 (m, 1 H), 4.44 (m, 2 H). MS 10 (ESI+) m/z 399 (M+H)+. Example 339 5-(1H-indazol-5-yl)-N-(2-morpholin-4-yl-1-phenylethyl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81 B 15 substituting 2-morpholin-4-yl-1-phenylethanamine for piperidine. 'H NMR (300 MHz, DMSO-d 6 ) a ppm 13.4 (br s, 1 H), 9.2 (d, 1 H), 8.4 (s, 1 H), 8.22 (s, 1 H), 7.9 (d, 1 H), 7.7 (d, 1 H), 7.2-7.4 (m, 6 H), 5.2 (m, 1 H), 3.6 (m, 4 H), 3.4 (m, 2 H), 2.4 (m, 4 H). MS (ESI+) m/z 418 (M+H)f. 20 Example 340 5-(1H-indazol-5-yl)-N-[2-(4-methylpiperazin-1-yl)-l-phenylethyl]isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81 B substituting 2-(4-methylpiperazin-1-yl)-l-phenylethanamine for piperidine. 'H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.6 (br s, 1 H), 9.14 (d, 1 H), 8.4 (s, 1 H), 8.22 (s, 1 H), 7.9 (d, 1 25 H), 7.7 (d, 1 H), 7.2-7.4 (in, 6 H), 5.2 (in, 1 H), 3.2 (in, 2 H), 2.4 (in, 4 H), 2.2 (in, 4 H), 2.1 (m, 3 H). MS (ESI+) m/z 432 (M+H)f. Example 341 5-(1H-indazol-5-yl)-N-(1-phenyl-2-pyrrolidin-1-ylethyl)isoxazole-3-carboxamide 30 The title compound was prepared according to the procedure outlined in Example 81B substituting 1-phenyl-2-pyrrolidin-1-ylethanamine for piperidine. 'H NMR (300 MHz, DMSO-d) 6 ppm 13.4 (br s, 1 H), 9.14 (d, 1 H), 8.4 (s, 1 H), 8.22 (s, 1 H), 7.9 (d, 1 H), 7.7 (d, 1 H), 7.2-7.4 (in, 6 H), 5.18 (m, 1 H), 3.2 (m, 2 H), 2.4 (m, 4 H), 1.8 (m, 3 H). MS (ESI+) 187 WO 2008/154241 PCT/US2008/065727 m/z 402.5 (M+H)f. Example 342 tert-butyl 2-( { [5 -(1 H-indazol-5 -yl)isoxazol-3 -yl] carbonyl} amino)-2-phenylethylcarbamate 5 The title compound was prepared according to the procedure outlined in Example 81 B substituting tert-butyl 2-amino-2-phenylethylcarbamate for piperidine. 1H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.4 (br s, 1 H), 9.14 (d, 1 H), 8.4 (s, 1 H), 8.22 (s, 1 H), 7.9 (d, 1 H), 7.7 (d, 1 H), 7.2-7.4 (in, 6 H), 7.00 (t, 1 H), 5.18 (m, 1 H), 3.2 (m, 2 H), 1.4 (s, 9 H). MS (ESI+) m/z 449 (M+H)*. 10 Example 343 5-(1H-indazol-5-yl)-N-(1-naphthylmethyl)isoxazole-3-carboxamide The title compound was prepared using the procedure described in Exampe 326 except 1 -(1 -naphthyl)methanamine was substituted for 1 -cyclohexylmethanamine. 1H NMR 15 (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 4.93 - 4.99 (m, 2 H), 7.28 - 7.32 (m, 1 H), 7.48 - 7.66 (m, 4 H), 7.70 - 7.76 (m, 1 H), 7.86 - 7.92 (m, 2 H), 7.96 - 8.00 (m, 1 H), 8.18 - 8.23 (m, 1 H), 8.24 - 8.27 (m, 1 H), 8.38 - 8.44 (m, 1 H); ). MS (ESI-) m/z 367 (M-H)-. Example 344 20 5-(1H-indazol-5-yl)-N-(2-phenylethyl)isoxazole-3-carboxamide The title compound was prepared using the procedure described in Exampe 326 except 2-phenylethanamine was substituted for 1-cyclohexylmethanamine. 1H NMR (500 MHz, DMSO-d 6

/D

2 0) S ppm 2.84 - 2.92 (t, 2 H), 3.47 - 3.57 (t, 2 H), 7.18 - 7.35 (m, 6 H), 7.69 - 7.77 (m, 1 H), 7.86 - 7.91 (m, 1 H), 8.22 - 8.29 (m, 1 H), 8.37 - 8.44 (m, 1 H). MS 25 (ESI+) m/z 333 (M+H)+; (ESI-) m/z 331 (M-H)-. Example 345 5-(1H-indazol-5-yl)-N-(2-pyridin-2-ylethyl)isoxazole-3-carboxamide 30 The title compound was prepared using the procedure described in Exampe 326 except 2-pyridin-2-ylethanamine was substituted for 1-cyclohexylmethanamine. 1H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 3.22 - 3.29 (t, 2 H), 3.71 - 3.75 (t, 2 H), 7.14 - 7.26 (m, 1 H), 7.70 - 7.75 (m, 1 H), 7.81 - 7.94 (m, 3 H), 8.23 - 8.29 (in, 1 H), 8.35 - 8.44 (m, 2 H), 8.71 188 WO 2008/154241 PCT/US2008/065727 - 8.83 (m, 1 H). MS (ESI+) m/z 334 (M+H); (ESI-) m/z 332 (M-H)-. Example 346 5-(1H-indazol-5-yl)-N-(2-pyridin-3-ylethyl)isoxazole-3-carboxamide 5 The title compound was prepared using the procedure described in Exampe 326 except 2-pyridin-3-ylethanamine was substituted for 1-cyclohexylmethanamine. 1H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 3.01 - 3.13 (t, 2 H), 3.55 - 3.70 (t, 2 H), 7.14 - 7.26 (m, 1 H), 7.70 - 7.77 (m, 1 H), 7.84 - 7.95 (m, 2 H), 8.25 - 8.29 (in, 1 H), 8.36 - 8.45 (m, 2 H), 8.69 - 8.75 (m, 1 H), 8.77 - 8.84 (m, 1 H). MS (ESI+) m/z 334 (M+H)f; (ESI-) m/z 332 (M-H)-. 10 Example 347 5-(1H-indazol-5-yl)-N-(2-pyridin-4-ylethyl)isoxazole-3-carboxamide The title compound was prepared using the procedure described in Exampe 326 except 2-pyridin-4-ylethanamine was substituted for 1-cyclohexylmethanamine. 1H NMR 15 (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 3.12 - 3.23 (t, 2 H), 3.67 - 3.71 (t, 2 H), 7.20 - 7.21 (m, 1 H), 7.69 - 7.76 (m, 1 H), 7.86 - 7.91 (m, 3 H), 8.25 - 8.27 (in, 1 H), 8.38 - 8.41 (m, 1 H), 8.70 - 8.77 (m, 2 H). MS (ESI+) m/z 334 (M+H); (ESI-) m/z 332 (M-H)-. Example 348 20 N-[2-(2-chlorophenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared using the procedure described in Exampe 326 except 2-(2-chlorophenyl)ethanamine was substituted for 1-cyclohexylmethanamine. 1 H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 2.99 - 3.05 (t, 2 H), 3.54 - 3.61 (t, 2 H), 7.21 - 7.23 (m, 1 H), 7.26 - 7.33 (m, 2 H), 7.35 - 7.40 (m, 1 H), 7.41 - 7.47 (in, 1 H), 7.70 - 7.75 (m, 1 25 H), 7.87 - 7.93 (in, 1 H), 8.23 - 8.31 (in, 1 H), 8.37 - 8.44 (in, 1 H). MS (ESI+) m/z 367 (M+H); (ESI-) m/z 365 (M-H)-. Example 349 N-[2-(3-chlorophenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide 30 The title compound was prepared using the procedure described in Exampe 326 except 2-(3-chlorophenyl)ethanamine was substituted for 1-cyclohexylmethanamine. 1H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 2.89 (t, 2 H), 3.54 (t, 2 H), 7.19 - 7.42 (m, 5 H), 7.69 - 7.77 (m, 1 H), 7.86 - 7.94 (m, 1 H), 8.22 - 8.29 (in, 1 H), 8.38 - 8.42 (m, 1 H). MS 189 WO 2008/154241 PCT/US2008/065727 (ESI-) m/z 365 (M-H)-. Example 350 N-[2-(4-chlorophenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide 5 The title compound was prepared using the procedure described in Exampe 326 except 2-(4-chlorophenyl)ethanamine was substituted for 1-cyclohexylmethanamine. 1H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 2.86 (t, 2 H), 3.50 (t, 2 H), 7.17 - 7.24 (m, 1 H), 7.27 - 7.41 (m, 4 H), 7.71 - 7.76 (m, 1 H), 7.85 - 7.91 (in, 1 H), 8.21 - 8.29 (m, 1 H), 8.34 8.44 (m, 1 H). MS (ESI-) m/z 365 (M-H)-. 10 Example 351 N-benzyl-N-ethyl-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared using the procedure described in Exampe 326 except N-benzyl-N-ethylamine was substituted for 1-cyclohexylmethanamine. HNMR (500 15 MHz, DMSO-d 6

/D

2 0) 6 ppm 1.06 - 1.19 (m, 3 H), 3.37 - 3.49 (m, 2 H), 4.69 - 4.76 (m, 2 H), 7.21 - 7.28 (m, 1 H), 7.28 - 7.49 (m, 5 H), 7.69 - 7.78 (m, 1 H), 7.83 - 7.97 (m, 1 H), 8.24 8.32 (m, 1 H), 8.36 - 8.46 (m, 1 H). MS (ESI+) m/z 347 (M+H)*; (ESI-) m/z 345 (M-H)-. Example 352 20 5-(1H-indazol-5-yl)-N-methyl-N-(1-naphthylmethyl)isoxazole-3-carboxamide The title compound was prepared using the procedure described in Exampe 326 except N-methyl-N-(1 -naphthylmethyl)amine was substituted for 1 -cyclohexylmethanamine. 1 H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 3.04 - 3.11 (m, 3 H), 5.20 - 5.35 (m, 2 H), 7.20 7.31 (m, 1 H), 7.33 - 7.66 (m, 4 H), 7.66 - 7.77 (m, 1 H), 7.81 - 8.18 (in, 4 H), 8.20 - 8.28 (m, 25 1 H), 8.31 - 8.45 (m, 1 H). MS (ESI+) m/z 383 (M+H)+; (ESI-) m/z 381 (M-H)-. Example 353 5-(1H-indazol-5-yl)-N-methyl-N-(2-phenylethyl)isoxazole-3-carboxamide The title compound was prepared using the procedure described in Exampe 326 30 except N-methyl-N-(2-phenylethyl)amine was substituted for 1-cyclohexylmethanamine. 1H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 2.86 - 2.97 (m, 2 H), 3.06 - 3.13 (m, 3 H), 3.70 3.74 (m, 2 H), 6.64 - 7.39 (m, 6 H), 7.69 - 7.92 (m, 2 H), 8.24 - 8.44 (in, 2 H). MS (ESI+) m/z 347 (M+H)+; (ESI-) m/z 345 (M-H)-. 190 WO 2008/154241 PCT/US2008/065727 Example 354 5-(1H-indazol-5-yl)-N-methyl-N-(2-pyridin-2-ylethyl)isoxazole-3-carboxamide The title compound was prepared using the procedure described in Exampe 326 5 except N-methyl-N-(2-pyridin-2-ylethyl)amine was substituted for 1 cyclohexylmethanamine. 'H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 3.07 - 3.22 (in, 3 H), 3.26 - 3.39 (in, 2 H), 3.92 - 4.04 (in, 2 H), 6.85 - 7.14 (in, 1 H), 7.65 - 8.05 (m, 4 H), 8.23 8.56 (in, 3 H), 8.65 - 8.86 (m, 1 H). MS (ESI+) m/z 348 (M+H)+; (ESI-) m/z 346 (M-H)-. 10 Example 355 5-(1H-indazol-5-yl)-N-[(1R)-1-phenylethyl]isoxazole-3-carboxamide The title compound was prepared using the procedure described in Exampe 326 except (IR)-1-phenylethanamine was substituted for 1-cyclohexylmethanamine. HNMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 1.49 - 1.54 (m, 3 H), 5.12 - 5.20 (m, 1 H), 7.23 - 7.29 (m, 15 2 H), 7.33 - 7.46 (m, 4 H), 7.71 - 7.75 (in, 1 H), 7.87 - 7.91 (in, 1 H), 8.22 - 8.28 (in, 1 H), 8.37 - 8.42 (in, 1 H). MS (ESI+) m/z 333 (M+H); (ESI-) m/z 331 (M-H)-. Example 356 5-(1H-indazol-5-yl)-N-1,2,3,4-tetrahydronaphthalen-1-ylisoxazole-3-carboxamide 20 The title compound was prepared using the procedure described in Exampe 326 except 1,2,3,4-tetrahydronaphthalen- 1-amine was substituted for 1-cyclohexylmethanamine. H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 1.72 - 2.09 (m, 4 H), 2.68 - 2.85 (in, 2 H), 5.19 5.26 (in, 1 H), 7.12 - 7.24 (m, 4 H), 7.29 - 7.35 (in, 1 H), 7.69 - 7.77 (in, 1 H), 7.86 - 7.93 (in, 1 H), 8.25 - 8.30 (m, 1 H), 8.38 - 8.43 (in, 1 H). MS (ESI-) m/z 357 (M-H)-. 25 Example 357 5-(1H-indazol-5-yl)-N-[(IS)-1-(1-naphthyl)ethyl]isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81 B substituting (1S)-1-(1-naphthyl)ethanamine for piperidine. H NMR (300 MHz, DMSO-d 6 ) 6 30 ppm 13.4 (br s, 1 H), 9.4 (d, 1 H), 8.4 (s, 1 H), 8.25 (s, 1 H), 8.22 (br s, 1 H), 7.95 (d, 1 H), 7.85 (in, 2 H), 7.65 (in, 2 H), 7.5 (m, 3 H), 7.3 (s, 1 H), 5.9 (in, 1 H), 1.65 (d, 3 H). MS (ESI+) m/z 382.9 (M+H)*. 191 WO 2008/154241 PCT/US2008/065727 Example 358 5-(1H-indazol-5-yl)-N-[(1R)-1-(1-naphthyl)ethyl]isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81 B substituting (1R)-1-(1-naphthyl)ethanamine for piperidine. H NMR (300 MHz, DMSO-de) 6 5 ppm 13.4 (br s, 1 H), 9.4 (d, 1 H), 8.4 (s, 1 H), 8.25 (s, 1 H), 8.22 (br s, 1 H), 7.95 (d, 1 H), 7.85 (m, 2 H), 7.65 (m, 2 H), 7.5 (m, 3 H), 7.3 (s, 1 H), 5.9 (m, 1 H), 1.65 (d, 3 H). MS (ESI+) m/z 382.9 (M+H)+. Example 359 10 N-[3-(dimethylamino)-1-phenylpropyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81 B substituting N 3

,N

3 -dimethyl-1-phenylpropane-1,3-diamine for piperidine. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.4 (br s, 1 H), 9.4 (d, 1 H), 8.4 (s, 1 H), 8.25 (s, 1 H), 7.92 (m, 1 H), 7.7 (m, 1 H), 7.3-7.5 (m, 6 H), 5.15 (m, 1 H), 3.2 (m, 2 H), 7.75 (s, 6 H), 2.35 (m, 1 H), 15 2.15 (m, 1 H). MS (ESI+) m/z 390 (M+H)+. Example 360 N-(2,3-dihydro-1,4-benzodioxin-5-ylmethyl)-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81 B 20 substituting 1-(2,3-dihydro-1,4-benzodioxin-5-yl)methanamine for piperidine. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.4 (br s, 1 H), 9.24 (t, 1 H), 8.4 (s, 1 H), 8.25 (s, 1 H), 7.92 (d, 1 H), 7.7 (d, 1 H), 7.24 (s, 1 H), 6.9 (m, 3 H), 4.4 (d, 2 H), 4.3 (d, 2 H), 4.25 (d, 2 H). MS (ESI+) m/z 377 (M+H)+. 25 Example 361 N-(3,4-dihydro-2H-1,5-benzodioxepin-6-ylmethyl)-5-(1H-indazol-5-yl)isoxazole-3 carboxamide The title compound was prepared according to the procedure outlined in Example 81 B substituting 1-(3,4-dihydro-2H-1,5-benzodioxepin-6-yl)methanamine for piperidine. H 30 NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.4 (br s, 1 H), 9.2 (t, 1 H), 8.4 (s, 1 H), 8.25 (s, 1 H), 7.92 (d, 1 H), 7.7 (d, 1 H), 7.24 (s, 1 H), 6.9 (m, 3 H), 4.42 (d, 2 H), 4.15 (m, 4 H), 2.2 (m, 2 H). MS (ESI+) m/z 391 (M+H)+. 192 WO 2008/154241 PCT/US2008/065727 Example 362 5-(1H-indazol-5-yl)-N-[(1-methyl-iH-indol-4-yl)methyl]isoxazole-3-carboxamide The title compound was prepared according to the procedure outlined in Example 81 B substituting (1-methyl-1H-indol-4-yl)methylamine for piperidine. H NMR (300 MHz, 5 DMSO-d 6 ) 6 ppm 13.4 (br s, 1 H), 9.24 (t, 1 H), 8.4 (s, 1 H), 8.25 (s, 1 H), 7.92 (d, 1 H), 7.7 (d, 1 H), 7.38 (in, 3 H), 7.18 (in, 1 H), 7.0 (d, 1 H), 6.6 (s, 1 H), 4.7 (d, 2 H), 3.8 (s, 3 H). MS (ESI+) m/z 372 (M+H)+. Example 363 10 5-{3-[(3-phenylpyrrolidin-1-yl)carbonyl]isoxazol-5-yl}-1H-indazole The title compound was prepared according to the procedure outlined in Example 81 B substituting 3-phenylpyrrolidine for piperidine. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.4 (br s, 1 H), 8.4 (in, 1 H), 8.25 (s, 1 H), 7.92 (d, 1 H), 7.8 (d, 1 H), 7.24 (in, 6 H), 4.4 (in, 1 H), 3.4 (in, 2 H), 2.4 (in, 2 H), 2.0 (in, 2 H). MS (ESI+) m/z 359 (M+H)*. 15 Example 364 5-{3-[(2-phenylpyrrolidin-1-yl)carbonyl]isoxazol-5-yl}-1H-indazole The title compound was prepared according to the procedure outlined in Example 81 B substituting 2-phenylpyrrolidine for piperidine. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.4 20 (br s, 1 H), 8.4 (in, 1 H), 8.25 (s, 1 H), 7.92 (d, 1 H), 7.8 (d, 1 H), 7.24 (in, 6 H), 5.6 (in, 0.3 H), 5.2 (in, 0.7 H), 4.0 (in, 2 H), 1.8-2.0 (in, 4 H). MS (ESI+) m/z 390 (M+H)+. Example 365 5- {3-[(2-phenylpiperidin-1-yl)carbonyl]isoxazol-5-yl} -1H-indazole 25 The title compound was prepared according to the procedure outlined in Example 81B substituting 2-phenylpiperidine for piperidine. 1 H NMR (300 MHz, DMSO-d 6 ) 6 ppm 13.4 (br s, 1 H), 8.4 (m, 1 H), 8.25 (s, 1 H), 7.92 (d, 1 H), 7.8 (d, 1 H), 7.24 (in, 6 H), 5.6 (in, 0.3 H), 5.2 (m, 0.7 H), 4.0 (m, 2 H), 1.8-2.0 (m, 6 H). MS (ESI+) m/z 373 (M+H)*. 30 Example 366 5-(1H-indazol-5-yl)-N-[(1S)-1-phenylethyl]isoxazole-3-carboxamide 5-(1H-Indazol-5-yl)isoxazole-3-carboxylic acid (36 mg, 0.16 mmol, Example 71A), was dissolved in NN-dimethylformamide (1.0 mL) followed by the addition of HATU (60 193 WO 2008/154241 PCT/US2008/065727 mg, 0.16 mmol) dissolved in N,N-dimethylformamide (0.5 mL). Then a solution of (S)-1 phenylethanamine (22 mg, 0.18 mmol), dissolved in NN-dimethylformamide (0.6 mL) was added, followed by diisopropylethylamine (56 pL,0.3 2 mmol) dissolved in NN dimethylformamide (0.2 mL). The resulting mixture was shaken for 3 hours at 40 C. The 5 reaction was filtered, checked by LC/MS and concentrated to dryness. The residues were dissolved in 1:1 dimethyl sulfoxide/methanol and purified by reverse phase HPLC (Phenomenex@ Luna@ C8(2) 5 gm 1OA AXIATM column (30 mm x 75 mm), 50 mL/min, 10-100% acetonitrile/0.1% trifluoroacetic acid in water) to provide the title product. 'H NMR (500 MHz, DMSO-d 6

/D

2 0) 6 ppm 1.50 (d, 3 H), 5.06 - 5.22 (m, 1 H), 7.23 - 7.29 (in, 2 10 H), 7.34 - 7.38 (in, 2 H), 7.40 - 7.45 (in, 2 H), 7.70 - 7.75 (in, 1 H), 7.87 - 7.92 (m, 1 H), 8.25 - 8.27 (in, 1 H), 8.39 - 8.41 (in, 1 H), 9.28 (d, 1 H). MS (ESI+) m/z 333 (M+H); (ESI-) m/z 331 (M-H)-. Example 367 15 5-(1H-indazol-5-yl)-N-[(1R)-1-(4-methylphenyl)ethyl]isoxazole-3-carboxamide The title compound was prepared using the procedure descriped in Example 366 except (IR)-1-(4-methylphenyl)ethanamine was substituted for (S)-1-phenylethanamine. 1H NMR (500 MHz, DMSO-d 6 /D20) 6 ppm 1.49 (d, 3 H), 2.25 - 2.31 (in, 3 H), 5.09 - 5.18 (in, 1 H), 7.14 - 7.18 (m, 2 H), 7.23 - 7.24 (in, 1 H), 7.28 - 7.32 (in, 2 H), 7.70 - 7.75 (in, 1 H), 20 7.86 - 7.92 (in, 1 H), 8.22 - 8.29 (in, 1 H), 8.37 - 8.42 (in, 1 H), 9.19 (d, 1 H). MS (ESI+) m/z 347 (M+H); (ESI-) 345 (M-H)-. Example 368 5-(1H-indazol-5-yl)-N-[(1S)-i-(4-methylphenyl)ethyl]isoxazole-3-carboxamide 25 The title compound was prepared using the procedure descriped in Example 366 except (iS)-1-(4-methylphenyl)ethanamine was substituted for (S)-1-phenylethanamine. 'H NMR (500 MHz, DMSO-d 6 /D20) 6 ppm 1.48 (d, 3 H), 2.26 - 2.30 (in, 3 H), 5.05 - 5.23 (in, 1 H), 7.15 - 7.17 (m, 2 H), 7.22 - 7.25 (in, 1 H), 7.28 - 7.32 (in, 2 H), 7.67 - 7.79 (in, 1 H), 7.86 - 7.93 (in, 1 H), 8.22 - 8.30 (in, 1 H), 8.38 - 8.41 (in, 1 H), 9.21 (d, 1 H). MS (ESI-) m/z 30 345(M-H)-. Example 369 N-[(1R,2S)-2-hydroxy-2,3-dihydro-1H-inden-1-yl]-5-(1H-indazol-5-yl)isoxazole-3 194 WO 2008/154241 PCT/US2008/065727 carboxamide The title compound was prepared using the procedure described in Example 366 except (1R,2S)-1-aminoindan-2-ol was substituted for (S)-1-phenylethanamine. HNMR (500 MHz, DMSO-d 6 /D20) 6 ppm 2.89 - 2.96 (m, 1 H), 3.13 - 3.21 (m, 1 H), 4.55 - 4.61 (m, 5 1 H), 5.40 - 5.47 (m, 1 H), 7.21 - 7.34 (m, 4 H), 7.39 - 7.42 (m, 1 H), 7.72 - 7.77 (in, 1 H), 7.91 - 7.95 (m, 1 H), 8.25 - 8.29 (m, 1 H), 8.42 - 8.45 (m, 1 H). MS (ESI-) m/z 359 (M-H)-. Example 370 N-[(1R,2R)-2-hydroxy-2,3-dihydro-1H-inden-1-yl]-5-(1H-indazol-5-yl)isoxazole-3 10 carboxamide The title compound was prepared using the procedure descriped in Example 366 except (1R,2R)-1-aminoindan-2-ol was substituted for (S)-1-phenylethanamine. H NMR (500 MHz, DMSO-d 6 /D20) S ppm 2.72 - 2.83 (m, 1 H), 3.13 - 3.30 (m, 1 H), 4.44 - 4.53 (m, 1 H), 5.24 - 5.32 (m, 1 H), 7.10 - 7.18 (m, 1 H), 7.20 - 7.27 (m, 3 H), 7.30 - 7.33 (m, 1 H), 15 7.72 - 7.78 (m, 1 H), 7.91 - 7.93 (m, 1 H), 8.24 - 8.29 (m, 1 H), 8.41 - 8.45 (m, 1 H), 9.17 (d, 1 H). MS (ESI-) m/z 359 (M-H)-. Example 371 N-[(1R)-1-(4-bromophenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide 20 The title compound was prepared using the procedure descriped in Example 366 except (1R)-1-(4-bromophenyl)ethanamine was substituted for (S)-1-phenylethanamine. 1H NMR (500 MHz, DMSO-d 6 /D20) S ppm 1.50 (d, 3 H), 5.08 - 5.18 (m, 1 H), 7.21 - 7.27 (in, 1 H), 7.36 - 7.41 (m, 2 H), 7.50 - 7.59 (m, 2 H), 7.70 - 7.76 (m, 1 H), 7.86 - 7.93 (m, 1 H), 8.23 - 8.29 (m, 1 H), 8.38 - 8.41 (m, 1 H), 9.32 (d, 1 H). MS (ESI+) m/z 411 (M+H)+. 25 Example 372 N-[(IS)-1-(4-bromophenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared using the procedure descriped in Example 366 except (iS)-1-(4-bromophenyl)ethanamine was substituted for (S)-1-phenylethanamine. 1H 30 NMR (500 MHz, DMSO-d 6 /D20) 6 ppm 1.49 (d, 3 H), 5.09 - 5.19 (m, 1 H), 7.23 - 7.25 (in, 1 H), 7.37 - 7.40 (m, 2 H), 7.53 - 7.57 (m, 2 H), 7.71 - 7.75 (m, 1 H), 7.87 - 7.92 (m, 1 H), 8.25 - 8.27 (m, 1 H), 8.38 - 8.41 (m, 1 H), 9.32 (d, 1 H). MS (ESI) negative ion 409 (M-H)-. 195 WO 2008/154241 PCT/US2008/065727 Example 373 N-[(1R)-1-(4-chlorophenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared using the procedure descriped in Example 366 except (IR)-1-(4-chlorophenyl)ethanamine was substituted for (S)-1-phenylethanamine. 1H 5 NMR (500 MHz, DMSO-d 6 /D20) 6 ppm 1.50 (d, 3 H), 5.10 - 5.21 (m, 1 H), 7.22 - 7.26 (in, 1 H), 7.38 - 7.47 (m, 4 H), 7.70 - 7.75 (m, 1 H), 7.87 - 7.92 (m, 1 H), 8.20 - 8.28 (m, 1 H), 8.38 - 8.41 (m, 1 H), 9.33 (d, 1 H). MS (ESI-) m/z 365 (M-H)-. Example 374 10 N-[(lS)-i-(4-chlorophenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared using the procedure descriped in Example 366 except (iS)-1-(4-chlorophenyl)ethanamine was substituted for (S)-1-phenylethanamine. 1H NMR (500 MHz, DMSO-d 6 /D20) 6 ppm 1.49 (d, 3 H), 5.12 - 5.19 (m, 1 H), 7.23 - 7.25 (in, 1 H), 7.39 - 7.47 (m, 4 H), 7.71 - 7.74 (m, 1 H), 7.87 - 7.91 (m, 1 H), 8.25 - 8.27 (m, 1 H), 15 8.37 - 8.43 (m, 1 H), 9.32 (d, 1 H). MS (ESI-) m/z 365 (M-H)-. Example 375 5-(1H-indazol-5-yl)-N-[(lS)-i-(2-naphthyl)ethyl]isoxazole-3-carboxamide The title compound was prepared using the procedure descriped in Example 366 20 except (IS)- 1 -(2-naphthyl)ethanamine was substituted for (S)-1 -phenylethanamine. I H NMR (500 MHz, DMSO-d 6 /D20) 6 ppm 1.61 (d, 3 H), 5.30 - 5.38 (m, 1 H), 7.25 - 7.26 (m, 1 H), 7.48 - 7.55 (m, 2 H), 7.60 - 7.63 (m, 1 H), 7.72 - 7.75 (m, 1 H), 7.88 - 7.95 (m, 5 H), 8.25 8.28 (m, 1 H), 8.39 - 8.43 (m, 1 H), 9.39 (d, 1 H). MS (ESI-) m/z 381 (M-H)-. 25 Example 376 N-[l-(4-ethoxyphenyl)-2-hydroxyethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared using the procedure described in Example 366 except 2-amino-2-(4-ethoxyphenyl)ethanol was substituted for (S)-1-phenylethanamine. 1H NMR (500 MHz, DMSO-d 6 /D20) 6 ppm 1.32 (t, 3 H), 3.62 - 3.67 (m, 1 H), 3.70 - 3.73 (m, 1 30 H), 3.96 - 4.06 (m, 2 H), 4.98 - 5.06 (m, 1 H), 6.87 - 6.91 (in, 2 H), 7.23 - 7.36 (m, 3 H), 7.70 - 7.75 (m, 1 H), 7.88 - 7.91 (m, 1 H), 8.25 - 8.27 (m, 1 H), 8.39 - 8.42 (m, 1 H). MS (ESI-) m/z 391 (M-H)-. 196 WO 2008/154241 PCT/US2008/065727 Example 377 N-[2-hydroxy-1-(4-isopropylphenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared using the procedure descriped in Example 366 except 2-amino-2-(4-isopropylphenyl)ethanol was substituted for (S)-1-phenylethanamine. 5 1 H NMR (500 MHz, DMSO-d 6 /D20) 6 ppm 1.18 (d, 6 H), 2.81 - 2.91 (in, 1 H), 3.65 - 3.70 (in, 1 H), 3.72 - 3.74 (in, 1 H), 5.01 - 5.09 (in, 1 H), 7.20 - 7.28 (in, 3 H), 7.29 - 7.35 (in, 2 H), 7.72 - 7.80 (in, 1 H), 7.87 - 7.95 (in, 1 H), 8.24 - 8.29 (in, 1 H), 8.38 - 8.44 (in, 1 H). MS (ESI-) m/z 389 (M-H)-. 10 Example 378 N-[1-(3,4-dimethylphenyl)-2-hydroxyethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared using the procedure descriped in Example 366 except 2-amino-2-(3,4-dimethylphenyl)ethanol was substituted for (S)-1 -phenylethanamine. 1 H NMR (500 MHz, DMSO-d 6 /D20) 6 ppm 2.30 (d, 6 H), 3.56 - 3.63 (in, 1 H), 3.65 - 3.73 15 (in, 1 H), 5.32 - 5.42 (in, 1 H), 7.06 - 7.08 (in, 2 H), 7.23 - 7.28 (in, 2 H), 7.69 - 7.76 (in, 1 H), 7.87 - 7.95 (in, 1 H), 8.25 - 8.28 (in, 1 H), 8.39 - 8.43 (in, 1 H). MS (ESI-) m/z 375 (M H)-. Example 379 20 N-[2-hydroxy-1-(2-methoxyphenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared using the procedure descriped in Example 366 except 2-amino-2-(2-methoxyphenyl)ethanol was substituted for (S)-1-phenylethanamine. 1H NMR (500 MHz, DMSO-d 6 /D20) 6 ppm 3.60 - 3.66 (in, 2 H), 3.84 - 3.88 (in, 3 H), 5.37 5.48 (in, 1 H), 6.95 (t, 1 H), 7.00 - 7.06 (in, 1 H), 7.24 - 7.31 (in, 2 H), 7.32 - 7.36 (in, 1 H), 25 7.71 - 7.77 (in, 1 H), 7.85 - 7.97 (in, 1 H), 8.24 - 8.28 (in, 1 H), 8.40 - 8.45 (in, 1 H). MS (ESI+) m/z 379 (M+H)j; negative ion 377 (M-H)-. Example 380 N-[2-hydroxy-1-(4-methylphenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide 30 The title compound was prepared using the procedure described in Example 366 except 2-amino-2-(4-methylphenyl)ethanol was substituted for (S)-i -phenylethanamine. 1 H NMR (500 MHz, DMSO-d 6 /D20) 6 ppm 2.26 - 2.32 (in, 3 H), 3.65 - 3.70 (in, 1 H), 3.72 3.75 (in, 1 H), 5.01 - 5.08 (m, 1 H), 7.10 - 7.21 (in, 2 H), 7.25 - 7.35 (in, 3 H), 7.70 - 7.77 (in, 197 WO 2008/154241 PCT/US2008/065727 1 H), 7.86 - 7.95 (m, 1 H), 8.26 - 8.28 (m, 1 H), 8.39 - 8.46 (m, 1 H). MS (ESI+) m/z 363 (M+H); (ESI-) m/z 361 (M-H)-. Example 381 5 5-(1H-indazol-5-yl)-N-[(1R)-1-(2-methoxyphenyl)ethyl]isoxazole-3-carboxamide The title compound was prepared using the procedure descriped in Example 366 except (IR)- 1 -(2-methoxyphenyl)ethanamine was substituted for (S)-1 -phenylethanamine. 1 H NMR (500 MHz, DMSO-d 6 /D20) 6 ppm 1.43 (d, 3 H), 3.82 - 3.86 (in, 3 H), 5.41 - 5.50 (m, 1 H), 6.95 (t, 1 H), 7.00 - 7.05 (in, 1 H), 7.23 - 7.29 (m, 2 H), 7.35 - 7.39 (m, 1 H), 7.71 10 7.76 (m, 1 H), 7.88 - 7.92 (m, 1 H), 8.25 - 8.27 (m, 1 H), 8.37 - 8.43 (in, 1 H). MS (ESI+) m/z 363 (M+H)+; (ESI-) m/z 361 (M-H)-. Example 382 N-[(1S)-i-(3,4-difluorophenyl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide 15 The title compound was prepared using the procedure descriped in Example 366 except (IS)- 1 -(3,4-difluorophenyl)ethanamine was substituted for (S)-1 -phenylethanamine. 1 H NMR (500 MHz, DMSO-d 6 /D20) 6 ppm 1.50 (d, 3 H), 5.09 - 5.24 (m, 1 H), 7.21 - 7.30 (m, 2 H), 7.35 - 7.44 (m, 1 H), 7.44 - 7.53 (m, 1 H), 7.68 - 7.82 (in, 1 H), 7.86 - 7.94 (m, 1 H), 8.26 - 8.27 (m, 1 H), 8.39 - 8.42 (m, 1 H). MS (ESI-) m/z 367 (M-H)-. 20 Example 383 5-(1H-indazol-5-yl)-N-[(1R)-1-(3-methoxyphenyl)ethyl]isoxazole-3-carboxamide The title compound was prepared using the procedure descriped in Example 366 except (IR)- 1 -(3 -methoxyphenyl)ethanamine was substituted for (S)-i -phenylethanamine. 25 1 H NMR (500 MHz, DMSO-d 6 /D20) 6 ppm 1.50 (d, 3 H), 3.75 - 3.77 (in, 3 H), 5.01 - 5.19 (m, 1 H), 6.80 - 6.87 (m, 1 H), 6.97 - 7.02 (m, 2 H), 7.21 - 7.32 (in, 2 H), 7.70 - 7.75 (m, 1 H), 7.87 - 7.95 (m, 1 H), 8.22 - 8.31 (m, 1 H), 8.37 - 8.43 (in, 1 H). MS (ESI-) m/z 361 (M H)-. 30 Example 384 5 -(1 H-indazol-5 -yl)-N- {(1 R)- 1 -[3 -(trifluoromethyl)phenyl]ethyl} isoxazole-3 -carboxamide The title compound was prepared using the procedure descriped in Example 366 except (1R)-1-[3-(trifluoromethyl)phenyl]ethanamine was substituted for (S)-i 198 WO 2008/154241 PCT/US2008/065727 phenylethanamine. H NMR (500 MHz, DMSO-d 6 /D20) 6 ppm 1.54 (d, 3 H), 5.22 - 5.29 (in, 1 H), 7.23 - 7.27 (in, 1 H), 7.58 - 7.69 (in, 2 H), 7.71 - 7.75 (in, 2 H), 7.77 - 7.83 (in, 1 H), 7.87 - 7.92 (in, 1 H), 8.24 - 8.29 (in, 1 H), 8.38 - 8.42 (in, 1 H). MS (ESI-) m/z 399 (M H)-. 5 Example 385 N-[1-(2,3-dihydro-1,4-benzodioxin-6-yl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared using the procedure descriped in Example 366 except 1-(2,3-dihydro- 1,4-benzodioxin-6-yl)ethanamine was substituted for (S)-1 10 phenylethanamine. 1 H NMR (500 MHz, DMSO-d 6 /D20) 6 ppm 1.46 (d, 3 H), 4.18 - 4.25 (in, 4 H), 5.01 - 5.10 (m, 1 H), 6.80 - 6.95 (in, 3 H), 7.22 - 7.24 (in, 1 H), 7.70 - 7.74 (in, 1 H), 7.87 - 7.91 (in, 1 H), 8.26 - 8.27 (in, 1 H), 8.39 - 8.41 (in, 1 H). MS (ESI-) m/z 389 (M H)-. 15 Example 386 N-[I1-(3,5-dichlorophenyl)-2-hydroxyethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide The title compound was prepared using the procedure descriped in Example 366 except 2-amino-2-(3,5 -dichlorophenyl)ethanol was substituted for (S)-1 -phenylethanamine. 1 H NMR (500 MHz, DMSO-d 6 /D20) 6 ppm 3.68 - 3.72 (in, 1 H), 3.76 - 3.78 (in, 1 H), 5.02 20 5.10 (in, 1 H), 7.26 - 7.29 (m, 1 H), 7.47 - 7.52 (in, 3 H), 7.72 - 7.75 (in, 1 H), 7.89 - 7.93 (in, 1 H), 8.25 - 8.28 (m, 1 H), 8.39 - 8.44 (in, 1 H). MS (ESI-) m/z 415 (M-H)-. Example 387 25 tert-butyl 5-(1-benzyl-1H-1,2,3-triazol-4-yl)-3-[({[6-(trifluoromethyl)pyridin-2 yl]amino}carbonyl)amino]- 1H-indazole- 1 -carboxylate A solution of triphosgene in dichloromethane was cooled to 0 'C under nitrogen. Then a mixture of triethylamine (0.426 mL, 3.07 mmol) and Example 64A (150 mg, 0.384 mmol) in dichloromethane (2 mL) was slowly added dropwise. The resultant mixture was 30 stirred at room temperature for 1 hour. Then 6-(trifluoromethyl)pyridin-2-amine (62.3 mg, 0.384 mmol) was added followed by stirring overnight at room temperature. The precipitate was filtered off and washed with dichloromethane and water. The product was dried under vacuum to provide the title compound. MS m/z 579.3 (M+H)*. 199 WO 2008/154241 PCT/US2008/065727 Example 388 5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1-[(1-methylpiperidin-2-yl)carbonyl]-1H-indazol-3-amine 1 -Methylpiperidine-3-carboxylic acid hydrochloride was combined with a mixture of 5 dimethylformamide and dichloromethane under nitrogen and stirred for 15 minutes. Then carbonyldiimidazole was added portionwise. The resultant solution was stirred at room temperature for 1 hour. Then Example 62 was added followed by stirring at 60 'C for 2 hours and then at room temperature overnight. The reaction mixture was poured into ice water and brine was added. The cold solution was decanted, and the residue was taken into 10 dichloromethane and washed with water (2X). The organic layer was dried with magnesium sulfate, and the volatiles were removed under reduced pressure. The decanted solution was extracted with ethyl acetate (3X). The combined organic layers were washed with brine (2X), dried with magnesium sulfate, and concentrated. The residue was taken into a small amount of acetone and then dropped into distilled water. A precipitate was collected by 15 filtration, washed with water, and dried to provide the title compound. MS m/z 579.3 (M+H)f. Example 389 20 5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1-[(dimethylamino)acetyl]-1H-indazol-3-amine 2-(Dimethylamino)acetic acid was dissolved in dimethylformamide and pyridine under nitrogen at room temperature over 15 minutes. Carbonyldiimidazole was added portionwise. The resultant mixture was stirred at room temperature for 1 hour. Then Example 62 was added, and the mixture was stirred overnight at room temperature. The 25 volatile material was removed under reduced pressure, and the remainder was added to ice water. Sodium chloride was added and thick oil came out of the cool solution. The solution was decanted. The residue was washed with water (3X) and then dried. From the decanted solution, a precipitate came out overnight of the water/dimethylformamide mixture. This proved to be starting material which was filtered off and discarded. The product residue was 30 crystallized in dichloromethane, collected by filtration, rinsed with a small quantity of dichloromethane and ether. The product was dried to provide the title compound. MS m/z 376.3 (M+H)f. 200 WO 2008/154241 PCT/US2008/065727 Example 390 tert-butyl 3-amino-5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazole-1-carboxylate Example 62 was suspended in dichloromethane along with a catalytic amount of dimethylaminopyridine. A solution of di-tert-butyl dicarbonate in dichloromethane (160 mL) 5 was added over 1 hour. The reaction mixture was stirred for approximately 40 hours. Silica gel was added, and the mixture was concentrated. This silica mixture was added to a silica gel column and the material was eluted first with dichloromethane and then with 10% methanol/dichloromethane and lastly with 2% methanol/dichloromethane. The fractions containing the desired product were combined and concentrated to provide the title 10 compound. MS m/z 391.3 (M+H)f. Example 391 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-piperidin-1-ylacetamide 15 2-(Piperidin- 1 -yl)acetic acid was combined with dimethylformamide and pyridine. The mixture was stirred for 15 minutes at room temperature, and then carbonyldiimidazole was added portionwise. Stirring was continued at room temperature for 1 hour, and then Example 64A was added followed by continued stirring for 24 hours. The reaction mixture was warmed to 60 'C for 14 hours. A small amount of the title compound was obtained. MS 20 m/z 416.3 (M+H). Example 392 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-morpholin-4-ylacetamide 2-Morpholinoacetic acid was combined with dimethylformamide and pyridine. The 25 mixture was stirred for 15 minutes at room temperature, and then carbonyldiimidazole was added portionwise. Stirring was continued at room temperature for 1 hour, and then Example 64A was added followed by continued stirring for 28 hours. The reaction mixture was warmed to 60 'C for 4 hours and then stirring was continued overnight at room temperature. The reaction mixture was warmed again to 60 'C for 7 hours. A small amount of the title 30 compound was obtained. MS m/z 418.3 (M+H)+. Example 393 N-[5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-1-methylpiperidine-2-carboxamide 1 -Methylpiperidine-3-carboxylic acid hydrochloride was combined with 201 WO 2008/154241 PCT/US2008/065727 dimethylformamide and pyridine. The mixture was stirred for 15 minutes at room temperature, and then carbonyldiimidazole was added portionwise. Stirring was continued at room temperature for 1 hour, and then Example 64A was added followed by continued stirring for 28 hours. The reaction mixture was warmed to 60 'C for 4.25 hours and then 5 stirring was continued overnight at room temperature. The reaction mixture was warmed again to 60 'C for 7 hours. A small amount of the title compound was obtained. MS m/z 416.3 (M+H)*. Biological Data 10 ROCK-2 Inhibitory Assay The compounds of formula (I) were tested for their ability to inhibit N-terminal His6 tagged recombinant human ROCK-2 residues 11-552 expressed by baculovirus in Sf21 cells (Upstate). In 384-well v-bottom polypropylene plates (Axygen), 1 nM (final concentration) in 10 ul recombinant N-terminal His6-tagged recombinant human ROCK-2 residues 11-552 15 expressed by baculovirus in Sf21 cells (Upstate) was mixed with 2 uM (final concentration) in 10 ul biotinylated peptide substrate (biotin-Aha-KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK (SEQ ID NO: 1)) (Genemed), and various concentration of inhibitor (2% DMSO final) in reaction buffer (25 mM HEPES, pH 7.5, 0.5 mM DTT, 10 mM MgCl 2 , 100 uM Na 3

VO

4 , 0.075 mg/ml Triton X 20 100), and the reaction was initiated by addition of 5 uM unlabelled ATP containing 0.01 uCi ["P]-ATP (Perkin Elmer). The reaction was quenched after 1 hour by the addition of 50 ul stop buffer (50 mM EDTA, 2M NaCl final concentration). 80 uL of the stopped reactions were transferred to 384-well streptavidin-coated FlashPlates (Perkin Elmer), incubated 10 minutes at room temperature, washed 3 times with 0.05% Tween-20/PBS using an ELX-405 25 automated plate washer (BioTek), and counted on a TopCount Scintillation Plate Reader (Packard). ROCK-I Inhibitory Assay The compounds of formula (I) were tested for their ability to inhibit N-terminal His6 30 tagged, recombinant, human ROCK-1 amino acids 17-535 expressed by baculovirus in Sf21 cells (Upstate). In 384-well v-bottom polypropylene plates (Axygen), 2 nM (final concentration) in 10 ul recombinant N-terminal His6-tagged, recombinant, human ROCK-I amino acids 17-535 expressed by baculovirus in Sf21 cells (Upstate) in reaction buffer was mixed with 2 uM (final concentration) biotinylated peptide substrate 202 WO 2008/154241 PCT/US2008/065727 (biotin-Aha-VRRLRRLTAREAA (SEQ ID NO: 2)) (Genemed), and various concentration of inhibitor (2% DMSO final) in 10 ul reaction buffer (25 mM HEPES, pH 7.5, 0.5 mM DTT, 10 mM MgCl 2 , 100 uM Na 3

VO

4 , 0.075 mg/ml Triton X-100), and the reaction was initiated by addition of 5 uM unlabelled ATP containing 0.01 uCi [ 3 3 P]-ATP (Perkin Elmer). The 5 reaction was quenched after 1 hour by the addition of 50 ul stop buffer (50 mM EDTA, 2M NaCl final concentration). 80 uL of the stopped reactions were transferred to 384-well streptavidin-coated FlashPlates (Perkin Elmer), incubated 10 minutes at room temperature, washed 3 times with 0.05% Tween-20/PBS using an ELX-405 automated plate washer (BioTek), and counted on a TopCount Scintillation Plate Reader (Packard). 10 GSK inhibitory Assay The compounds of formula (I) were tested for their ability to inhibit N-terminal His6 tagged GSK-3 expressed by baculovirus in Sf21 cells (Upstate). In 384-well v-bottom polypropylene plates (Axygen), 10 ul recombinant N-terminal His-tagged GSK3 expressed 15 by baculovirus in Sf21 cells (Upstate) was mixed with 10 pl biotinylated peptide substrate (biotin-ahx-YRRAAVPPSPSLSRHSSPHQS(p)EDEEE (SEQ ID NO: 3)), 2 pM final concentration (Genemed), and various concentration of inhibitor (2% DMSO final) in reaction buffer (20 mM HEPES, pH 7.5, 1 mM DTT, 10 mM MgCl 2 100 uM Na 3

VO

4 , 0.075 mg/ml Triton X-100), and the reaction was initiated by addition of 20 il [ 3 3 P]-ATP, 5 pM 20 final concentration, 2 mCi/umol (Perkin Elmer). The reaction was quenched after 1 hour by the addition of 50 ul stop buffer (50 mM EDTA, 2M NaCl final concentration). 80 pL of the stopped reactions were transferred to 384-well streptavidin-coated FlashPlates (Perkin Elmer), incubated 10 minutes at room temperature, washed 3 times with 0.050% Tween 20/PBS using an ELX-405 automated plate washer (BioTek), and counted on a TopCount 25 Scintillation Plate Reader (Packard). Human GSK-3p Inhibitory Assay Compounds were tested for their ability to inhibit human Glycogen Synthase kinase-3 beta (hGSK-3p) to phosphorylate biotin-YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE. 30 Compounds were incubated with 0.5 pCi 3 3 P-ATP, 10 ptM ATP, 0.0125U hGSK-3 P (Upstate cell signaling solutions) and 1p M substrate (biotin-YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE (SEQ ID NO: 3)) in 50 mM HEPES, 10 mM MgCl 2 , 100 uM Na 3

VO

4 , 1 mM DTT, 0.0075% Triton, 2% DMSO (total volume 50 pL) 203 WO 2008/154241 PCT/US2008/065727 for 30 minutes at room temperature. The incubation was stopped by addition of an equal volume of 100 mM EDTA, 4 M NaCl 2 . 80 gL of this mixture was added to streptavidin coated Flashplates (PerkinElmer). Following a wash step, 33 P incorporation was quantified on a MicroBeta microplate liquid scintillation counter (PerkinElmer). IC50s were determined by 5 fitting a sigmoidal dose-response curve to the counts obtained at the different concentrations in GraphPad Prism. Human GSK-3a Inhibitory Assay Compounds were tested for their ability to inhibit human Glycogen Synthase kinase-3 10 alpha (hGSK-3a) 0.5 nM final concentration of to phosphorylate biotin-YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE (SEQ ID NO: 3). Compounds were incubated with 0.5 Ci 33 P-ATP, 10 M ATP, 0.0125U hGSK-3 (Upstate cell signaling solutions) and 2 pM substrate (biotin-YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE) in 50 mM HEPES, 10 mM MgCl 2 , 100 uM Na 3

VO

4 , 1 mM DTT, 0.0075% Triton, 2% DMSO (total 15 volume 50 pL) for 30 minutes at room temperature. The incubation was stopped by addition of an equal volume of 100 mM EDTA, 4M NaCl 2 . 80 pL of this mixture was added to streptavidin-coated Flashplates (PerkinElmer). Following a wash step, 33 P incorporation was quantified on a MicroBeta microplate liquid scintillation counter (PerkinElmer). IC50s were determined by fitting a sigmoidal dose-response curve to the counts obtained at the different 20 concentrations in GraphPad Prism. JAK2 Inhibition Assay Jak2 kinase activity was assayed by a homogenous time-resolved fluorescence (HTRF) in vitro kinase assay (Mathis, G., HTRF(R) Technology. J Biomol Screen, 1999. 25 4(6): p. 309-314). Specifically, 10 pL C-terminal His6-tagged, recombinant, human JAK2, amino acids 808-end, expressed by baculovirus in Sf21 cells (Upstate) was mixed with 10 ul inhibitor (various concentrations, 2% final DMSO) and 10 ul of ATP (5 pM final concentration) in reaction buffer (50 mM HEPES, pH 7.5, 10 mM MgCl 2 , 2 mM MnCl 2 , 0.1% BSA and 1 mM DTT, 40 ptL final volume). The reaction was initiated by addition of 30 10 ul of Bio-PDK peptide (Biotin-Ahx[protein fragment, 39 aa] (SEQ ID NO: 4), 0.5 ptM final concentration) in a black 384-well plate (Packard). After 60 minutes incubation at room temperature, the reaction was quenched by addition 60 pL stop/revelation buffer to 204 WO 2008/154241 PCT/US2008/065727 give 30 mM EDTA, 1 pg/ml streptavidin-APC (Prozyme), 50 ng/ml anti-phosphotyrosine mAb PT66-K Europium Cryptate, 30 mM HEPES, pH 7.5, 120 mM KF, 0.005% Tween-20, 0.05% BSA). The quenched reaction was allowed to stand at room temperature for 1 hour and then read in a time-resolved fluorescence detector (Envision, Perkin Elmer) at 615 nm 5 and 665 nm simultaneously. The ratio between the signal of 615 nm and 665 nm was used in the calculation of the IC 50 . Methods - p-catenin reporter-gene assay Compounds were tested for their ability to modulate -catenin-modulated gene 10 transcription in a LEF/TCF(T-cell factor) reporter gene assay. SY-SY5Y human neuroblastoma cells were transiently transfected with 80 ng/well TOPFLASH plasmid (Upstate cell signaling solutions) containing two sets of three copies of the TCF binding site upstream of the Thymidine kinase minimal promoter and firefly Luciferase open reading frame or with 80 ng/well FOPFLASH plasmid (Upstate cell signaling solutions) containing 15 three copies of a mutated TCF binding site upstream of the Thymidine kinase minimal promoter and firefly Luciferase open reading frame. In addition, all cells were transiently transfected with the 20 ng/well pRL-TK plasmid (Promega) containing the herpes simplex virus thymidine kinase promoter to provide low to moderate levels of Renilla Luciferase expression. Transfection medium was exchanged for serum-free medium containing the test 20 substance and incubated for 24 hours at 37 C. The incubation was stopped and quantified using the Dual Glo Luciferase Assay (Promega) as indicated and quantified on a Pherastar reader (BMG). Firefly Luciferase activity was normalized for Renilla Luciferase activity per well. Subsequently, the normalised TOPFLASH response was compared to the normalised 25 FOPFLASH response, thus giving the LEF/TCF specific signal. The maximal response is the maximal ratio between the normalised TOPFLASH and FOPFLASH signals. Sigmoidal dose-response curves were fitted using Graphpad Prism. Murine Asthma Model of acute asthma 30 Female Balb/c mice were purchased from Taconic and housed at Abbott Bioresearch Center. Animals were utilized at 8-12 weeks of age. All protocols were approved by the Institutional Animal Care and Use Committee (IACUC). Dexamethasone (Dex), and ovalbumin (OVA) were purchased from Sigma. Endotoxin was removed from ovalbumin 205 WO 2008/154241 PCT/US2008/065727 using DetoxiGel (Pierce) according to manufacturer's protocol and the final material contained less than 0.1 EU/mg protein. Alum Imject was purchased from Pierce. Animals were sensitized to OVA on day 0 and 7 with an i.p. injection of 8 ug OVA in 2 mg alum. On days 14 and 16, animals received intra-nasal challenge of 0.3 pg OVA in 50 5 pl sterile PBS. Animals were dosed i.p. with a representative compound of formula (I) (dissolved with 0.5% HMPC, 0.02% Tween 80 in water) twice per day at doses of 3, 10, and 30 mg/kg/dose beginning the afternoon of day 13. The final dose of compound was administered 30 minutes prior to measurement of airway hyperresponsiveness (AHR). Dexamethasone was administered orally once a day on days 13-17 at a dose of 3 mg/kg. All 10 endpoints were analyzed on day 17, 24 hours after the second OVA challenge. AHR was assessed using unconscious restrained whole body plethysmography. Briefly, a surgical plane of anesthesia was induced with an i.p. injection of ketamine and xylazine. A tracheal canula was surgically inserted between the third and fourth tracheal rings. Spontaneous breathing was prevented by an intravenous (i.v.) jugular vein injection of pancuronium 15 bromide. Animals were placed in a whole body plethysmograph (Buxco) and mechanically ventilated with 0.2 ml room air at 150 breaths per minute with a volume-controlled ventilator (Harvard Apparatus). Pressure in the lung and flow within the plethysmograph were measured using transducers, and lung resistance was calculated as pressure/flow using Biosystem Xa software. Baseline resistance as well as resistance following challenge with 20 methacholine (3, 10 or 30 mg/ml) that was delivered with an inline ultrasonic-nebulizer were measured. Upon completion of pulmonary function testing, the lungs were lavaged 4 times with 0.5 ml sterile PBS. Lavage fluid was analyzed for IL-13, AMCase, Muc5ac and cellular infiltrates. The efficacy of the test compound was tested at doses of 3, 10 and 30 mg/kg b.i.d (6, 20, 60 mg/kg/day). Challenge with OVA caused an increase in lung resistance to 6.90 cm 25 H 2 0/ml/sec vs. 4.65 cm H 2 0/ml/sec in animals challenged with PBS. Treatment of mice with the test compound significantly inhibited (p<0.00 1) methacholine-induced airways resistance down to 4.55 cm H 2 0/ml/sec and 4.77 cm H 2 0/ml/sec at doses ranging between 1 and 100 mg/kg. The preferred compounds require a dose of less than 50 mg/kg to exhibit said response. The most preferred compounds require a dose of less than 30 mg/kg to exhibit 30 said response. This inhibition was equivalent to measurements taken in the PBS challenged group (4.65 cm H 2 0/ml/sec) and to treatment of 3 mg/kg dexamethasone (4.76 cm

H

2 0/ml/sec). IL- 13 measurement: IL- 13 concentrations in the bronchoalveolar lavage fluid (BAL) 206 WO 2008/154241 PCT/US2008/065727 were measured by ELISA (R & D Systems) according to manufacturer's instructions. IL-13 concentrations in the BAL fluid were significantly induced to 102.5 pg/mi in OVA challenged mice as compared to levels below detection in the PBS challenged group. This induction was significantly inhibited (p<0.05) by 60% after administration of the test 5 compounds administration at the 30 mg/kg dose. There was no significant inhibition at the 3 mg/kg or 10 mg/kg dose groups. AMCase measurement: Acidic mammalian chitinase (AMCase) activity was determined in a 1:10 dilution of BAL fluid with 0.01% BSA, 30 mM sodium citrate, 60 mM sodium phosphate, pH 5.2 in the presence of 80 uM 4-methylumbelliferyl P-D-N,N' 10 diacetylchitobioside. Reactions were incubated for 15 minutes at room temperature and quenched by addition of 100 uL of 1 M glycine/NaOH pH 10.6. Product formation was determined by fluorescence emission at 460 nm using excitation at 385 nm on a Fluoroskan Ascent fluorometer. AMCase activity was induced to 28.5U in OVA challenged animals compared to 2.17U in the PBS challenged animals. This induction was significantly inhibited 15 (p<O.01) in the 30 mg/kg group by 35% after test compounds were administered. MUC5AC measurement: Concentrations of the mucin gene MUC5AC were quantitated by ELISA format. Briefly, BAL samples are diluted 1:2 in buffer (2% BSA in PBS) and plated onto high protein binding 96-well plates (Costar) and dried. After a series of washes, a 1:100 dilution of biotinylated MUC5AC antibody (Clone 45M, LabVision) was 20 added for 1 hour. Plates are washed and a 1:3000 dilution of streptavidin-HRP (Southern Biotech) was added to the plate for 15 minutes. Plates were then developed using a TMB substrate (Sigma) for 30 minutes. The reaction was stopped using IM H 2

SO

4 and then read in a spectrophotometer at OD 450nm. Levels of MUC5AC were reduced by greater than 50% after administration of test compounds. 25 Determination of Antinociceptive Effect: Models for Neuropathic Pain Spinal Nerve (L5/L6) Ligation Model of Neuropathic Pain. As previously described in detail by Kim and Chung (Kim S. H.; Chung J.M. An experimental model for peripheral neuropathy produced by segmental spinal nerve ligation in the rat. Pain 1992, 50, 355-363), 30 a 1.5 cm incision was made dorsal to the lumbosacral plexus. In anesthetized rats, the paraspinal muscles (left side) were separated from the spinous processes, the L5 and L6 spinal nerves isolated, and tightly ligated with 3-0 silk threads. Following hemostasis, the wound was sutured and coated with antibiotic ointment. The rats were allowed to recover and then placed in a cage with soft bedding for 14 days before behavioral testing for 207 WO 2008/154241 PCT/US2008/065727 mechanical allodynia. Sciatic Nerve Ligation Model of Neuropathic Pain. As previously described in detail by Bennett and Xie (Bennett G. J.; Xie Y-K. A peripheral mononeuropathy in rat that produces disorders of pain sensation like those seen in man. Pain 1988, 33, 87-107), in 5 anesthetized rats, a 1.5 cm incision was made 0.5cm below the pelvis and the biceps femoris and the gluteous superficialis (right side) were separated. The sciatic nerve was exposed, isolated, and four loose ligatures (5-0 chromic catgut) with 1 mm spacing were placed around it. The rats were allowed to recover and then placed in a cage with soft bedding for 14 days before behavioral testing for mechanical allodynia as described above. In addition, animals 10 were also tested for cold allodynia by dipping their hind paw in a cold-water bath (4.5 0 C) and determining the paw withdrawal latency. Selected analogs of compounds of formula (I), dosed either i.p. or p.o. demonstrated greater than 30% inhibition of tactile allodynia in the Chung and Bennett models of neuropathic pain described herein at doses ranging from 1-150 mg/kg. 15 In summary, a representative compound of formula (I) in a mouse model of acute asthma was effective in inhibiting airway resistance in a dose range between 1 and 100 mg/kg. High dose (30 mg/kg) treatment also inhibited IL-13 induction as well as AMCase activity and MUC5AC levels in the BAL fluid. 20 Representative compounds of formula (I) in rat models of neuopathic pain were effective as demonstrated by a greater than 30% inhibition of tactile allodynia at doses ranging from 1-150 mg/kg. The compounds of formula (I) were found to inhibit human ROCK-2, N-terminal His tagged GSK-3 P, human GSK-3P, His6-tagged, recombinant, human JAK2 and Firefly 25 Luciferase exhibiting an IC 50 of about 1.0 gM to about 10 pM, preferably about 100 nM to about 1.0 pxM. More preferably, compounds of formula (I) were found to inhibit human ROCK-2, N-terminal His-tagged GSK-3p, human GSK-3p, His6-tagged, recombinant, human JAK2 and Firefly Luciferase exhibiting an ICso of about 10 nM to about 100 nM, and most preferably less than 10 nM. 30 In addition, certain compounds of formula (I) exhibited inhibition of human ROCK-2 with a selectivity of greater than 10 fold against a panel of 50 kinase targets. Certain compounds of formula (I) exhibited inhibition of human GSK-3p with a selectivity of greater than 10 fold against a panel of 50 kinase targets. Certain compounds of formula (I) exhibited 208 WO 2008/154241 PCT/US2008/065727 inhibition of His6-tagged, recombinant, human JAK2 with a selectivity of greater than 10 fold against a panel of 50 kinase targets. Methods of Administration 5 The present invention also provides pharmaceutical compositions that comprise compounds of the present invention. The pharmaceutical compositions comprise compounds of the present invention formulated together with one or more non-toxic pharmaceutically acceptable carriers. The pharmaceutical compositions of this invention can be administered to humans 10 and other mammals orally, rectally, parenterally, intracisternally, intravaginally, topically (as by powders, ointments or drops), bucally or as an oral or nasal spray. The term "parenterally," as used herein, refers to modes of administration that include intravenous, intramuscular, intraperitoneal, intrastemal, subcutaneous and intraarticular injection and infusion. 15 The term "pharmaceutically acceptable carrier," as used herein, means a non-toxic, inert solid, semi-solid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type. Some examples of materials which can serve as pharmaceutically acceptable carriers are sugars such as, but not limited to, lactose, glucose and sucrose; starches such as, but not limited to, corn starch and potato starch; cellulose and its derivatives such as, but not 20 limited to, sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients such as, but not limited to, cocoa butter and suppository waxes; oils such as, but not limited to, peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols; such as propylene glycol; esters such as, but not limited to, ethyl oleate and ethyl laurate; agar; buffering agents such as, but not 25 limited to, magnesium hydroxide and aluminum hydroxide; alginic acid; pyrogen-free water; isotonic saline; Ringer's solution; ethyl alcohol, and phosphate buffer solutions, as well as other non-toxic compatible lubricants such as, but not limited to, sodium lauryl sulfate and magnesium stearate, as well as coloring agents, releasing agents, coating agents, sweetening, flavoring and perfuming agents, preservatives and antioxidants can also be present in the 30 composition, according to the judgment of the formulator. Pharmaceutical compositions of this invention for parenteral injection comprise pharmaceutically acceptable sterile aqueous or nonaqueous solutions, dispersions, suspensions or emulsions as well as sterile powders for reconstitution into sterile injectable solutions or dispersions just prior to use. Examples of suitable aqueous and nonaqueous 209 WO 2008/154241 PCT/US2008/065727 carriers, diluents, solvents or vehicles include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol and the like), vegetable oils (such as olive oil), injectable organic esters (such as ethyl oleate) and suitable mixtures thereof Proper fluidity can be maintained, for example, by the use of coating materials such as lecithin, by the 5 maintenance of the required particle size in the case of dispersions and by the use of surfactants. These compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of the action of microorganisms can be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, 10 chlorobutanol, phenol sorbic acid and the like. It may also be desirable to include isotonic agents such as sugars, sodium chloride and the like. Prolonged absorption of the injectable pharmaceutical form can be brought about by the inclusion of agents, which delay absorption such as aluminum monostearate and gelatin. In some cases, in order to prolong the effect of the drug, it is desirable to slow the 15 absorption of the drug from subcutaneous or intramuscular injection. This can be accomplished by the use of a liquid suspension of crystalline or amorphous material with poor water solubility. The rate of absorption of the drug then depends upon its rate of dissolution that, in turn, may depend upon crystal size and crystalline form. Alternatively, delayed absorption of a parenterally administered drug form is accomplished by dissolving or 20 suspending the drug in an oil vehicle. Injectable depot forms are made by forming microencapsule matrices of the drug in biodegradable polymers such as polylactide-polyglycolide. Depending upon the ratio of drug to polymer and the nature of the particular polymer employed, the rate of drug release can be controlled. Examples of other biodegradable polymers include poly(orthoesters) and 25 poly(anhydrides). Depot injectable formulations are also prepared by entrapping the drug in liposomes or microemulsions, which are compatible with body tissues. The injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable 30 medium just prior to use. Solid dosage forms for oral administration include capsules, tablets, pills, powders and granules. In such solid dosage forms, the active compound may be mixed with at least one inert, pharmaceutically acceptable carrier or excipient, such as sodium citrate or dicalcium phosphate and/or a) fillers or extenders such as starches, lactose, sucrose, glucose, 210 WO 2008/154241 PCT/US2008/065727 mannitol and silicic acid; b) binders such as carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidone, sucrose and acacia; c) humectants such as glycerol; d) disintegrating agents such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates and sodium carbonate; e) solution retarding agents such as paraffin; f) absorption 5 accelerators such as quaternary ammonium compounds; g) wetting agents such as cetyl alcohol and glycerol monostearate; h) absorbents such as kaolin and bentonite clay and i) lubricants such as talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate and mixtures thereof. In the case of capsules, tablets and pills, the dosage form may also comprise buffering agents. 10 Solid compositions of a similar type may also be employed as fillers in soft and hard filled gelatin capsules using such carriers as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like. The solid dosage forms of tablets, dragees, capsules, pills and granules can be prepared with coatings and shells such as enteric coatings and other coatings well-known in 15 the pharmaceutical formulating art. They may optionally contain opacifying agents and may also be of a composition such that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of embedding compositions that can be used include polymeric substances and waxes. The active compounds can also be in micro-encapsulated form, if appropriate, with 20 one or more of the above-mentioned carriers. Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, solutions, suspensions, syrups and elixirs. In addition to the active compounds, the liquid dosage forms may contain inert diluents commonly used in the art such as, for example, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, 25 isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethyl formamide, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan and mixtures thereof. Besides inert diluents, the oral compositions may also include adjuvants such as 30 wetting agents, emulsifying and suspending agents, sweetening, flavoring and perfuming agents. Suspensions, in addition to the active compounds, may contain suspending agents as, for example, ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar, tragacanth and 211 WO 2008/154241 PCT/US2008/065727 mixtures thereof. Compositions for rectal or vaginal administration are preferably suppositories which can be prepared by mixing the compounds of this invention with suitable non-irritating carriers or carriers such as cocoa butter, polyethylene glycol or a suppository wax which are 5 solid at room temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active compound. Compounds of the present invention can also be administered in the form of liposomes. As is known in the art, liposomes are generally derived from phospholipids or other lipid substances. Liposomes are formed by mono- or multi-lamellar hydrated liquid 10 crystals that are dispersed in an aqueous medium. Any non-toxic, physiologically acceptable and metabolizable lipid capable of forming liposomes can be used. The present compositions in liposome form can contain, in addition to a compound of the present invention, stabilizers, preservatives, excipients and the like. The preferred lipids are natural and synthetic phospholipids and phosphatidyl cholines (lecithins) used separately or together. 15 Methods to form liposomes are known in the art. See, for example, Prescott, Ed., Methods in Cell Biology, Volume XIV, Academic Press, New York, N.Y. (1976), p. 33 et seq. Dosage forms for topical administration of a compound of this invention include powders, sprays, ointments and inhalants. The active compound may be mixed under sterile 20 conditions with a pharmaceutically acceptable carrier and any needed preservatives, buffers or propellants, which may be required. Ophthalmic formulations, eye ointments, powders and solutions are also contemplated as being within the scope of this invention. Actual dosage levels of active ingredients in the pharmaceutical compositions of this invention can be varied so as to obtain an amount of the active compound(s) that is effective 25 to achieve the desired therapeutic response for a particular patient, compositions and mode of administration. The selected dosage level will depend upon the activity of the particular compound, the route of administration, the severity of the condition being treated and the condition and prior medical history of the patient being treated. When used in the above or other treatments, a therapeutically effective amount of one 30 of the compounds of the present invention can be employed in pure form or, where such forms exist, in pharmaceutically acceptable salt, ester or prodrug form. The phrase "therapeutically effective amount" of the compound of the invention means a sufficient amount of the compound to treat disorders, at a reasonable benefit/risk ratio applicable to any medical treatment. It will be understood, however, that the total daily usage of the 212 WO 2008/154241 PCT/US2008/065727 compounds and compositions of the present invention will be decided by the attending physician within the scope of sound medical judgment. The specific therapeutically effective dose level for any particular patient will depend upon a variety of factors including the disorder being treated and the severity of the disorder; activity of the specific compound 5 employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the specific compound employed; the duration of the treatment; drugs used in combination or coincidental with the specific compound employed; and like factors well known in the medical arts. 10 The term "pharmaceutically acceptable salt," as used herein, means salts derived from inorganic or organic acids. The salts can be prepared in situ during the final isolation and purification of compounds of Formula (I) or separately by reacting the free base of a compound of Formula (I) with an inorganic or organic acid. Representative acid addition salts include, but are not limited to, acetate, adipate, alginate, citrate, aspartate, benzoate, 15 benzenesulfonate, bisulfate, butyrate, camphorate, camphorsulfonate, digluconate, glycerophosphate, hemisulfate, heptanoate, hexanoate, fumarate, hydrochloride, hydrobromide, hydroiodide, 2-hydroxyethansulfonate (isethionate), lactate, maleate, fumarate, methanesulfonate, nicotinate, 2-naphthalenesulfonate, oxalate, pamoate, pectinate, persulfate, 3-phenylpropionate, picrate, pivalate, propionate, succinate, sulfate, (L) tartrate, 20 (D) tartrate, (DL) tartrate, thiocyanate, phosphate, glutamate, bicarbonate, p-toluenesulfonate, and undecanoate. The term "pharmaceutically acceptable prodrug" or "prodrug,"as used herein, represents those prodrugs of the compounds of the present invention which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and 25 lower animals without undue toxicity, irritation, allergic response, and the like. Prodrugs of the present invention may be rapidly transformed in vivo to compounds of Formula (I), for example, by hydrolysis in blood. The present invention contemplates compounds of Formula (I) formed by synthetic means or formed by in vivo biotransformation. 30 The compounds of the invention can exist in unsolvated as well as solvated forms, including hydrated forms, such as hemi-hydrates. In general, the solvated forms, with pharmaceutically acceptable solvents such as water and ethanol among others, are equivalent to the unsolvated forms for the purposes of the invention. The total daily dose of the compounds of this invention administered to a human or 213 WO 2008/154241 PCT/US2008/065727 lower animal may range from about 0.003 to about 30 mg/kg/day. For purposes of oral administration, more preferable doses can be in the range of from about 0.01 to about 10 mg/kg/day. If desired, the effective daily dose can be divided into multiple doses for purposes of administration; consequently, single dose compositions may contain such 5 amounts or submultiples thereof to make up the daily dose. Protein kinases can be classified into broad groups based upon the identity of the amino acid(s) that they target (serine/threonine, tyrosine, lysine, and histidine). For example, tyrosine kinases include receptor tyrosine kinases (RTKs), such as growth factors and non receptor tyrosine kinases, such as the src kinase family. There are also dual-specific protein 10 kinases that target both tyrosine and serine/threonine, such as cyclin dependent kinases (CDKs) and mitogen-activated protein kinases (MAPKs). The protein tyrosine kinases (PTKs) compose a large family of kinases that regulate cell to cell signals involved in growth, differentiation, adhesion, motility, and death (Pearson, M. et al., In Protein Tyrosine Kinases; Fabbro, D., McCormick, F., Eds.; Humana Press Inc., 15 2006; pp 1-29.). Members of the tyrosine kinase include, but are not limited to, Yes, BMX, Syk, EphAl, FGFR3, RYK, MUSK, JAKI and EGFR. Tyrosine kinases are distinguished into two classes, i.e., the receptor type and non-receptor type tyrosine kinases. Interestingly, the entire family of tyrosine kinases consists of at least 90 characterized kinases with at least 58 receptor type and at least 32 nonreceptor type kinases comprising at least 30 total 20 subfamilies. Tyrosine kinases have been implicated in a number of diseases in humans, including diabetes and cancer (Pearson, M. et al., In Protein Tyrosine Kinases; Fabbro, D., McCormick, F., Eds.; Humana Press Inc., 2006; pp 1-29.). Tyrosine kinases are often involved in most forms of human malignancies and have been linked to a wide variety of congenital syndromes (Robertson et al., Trends Genet. 16:265-271, 2000). 25 The non-receptor tyrosine kinases represent a group of intracellular enzymes that lack extracellular and transmembrane sequences. Currently, over 32 families of non-receptor tyrosine kinases have been identified (Robinson et al., Oncogene 19, 5548-5557, 2000). Representative examples include Src, Btk, Csk, ZAP70 and Kak families. In particular, the Src family of non-receptor tyrosine kinase family is the largest, consisting of Src, Yes, Fyn, 30 Lyn, Lck, Blk, Hck, Fgr and Yrk protein tyrosine kinases. The Src family of kinases have been linked to oncogenesis, cell proliferation and tumor progression. Many of the protein tyrosine kinases have been found to be involved in cellular signaling pathways involved in various pathological conditions including but not limited to cancer and hyperproliferative disorders and immune disorders. 214 WO 2008/154241 PCT/US2008/065727 The cyclin dependent kinases CDKs represent a group of intracellular enzymes that control progression through the cell cycle and have essential roles in cell proliferation (Cohen, P. Nature Reviews Drug Discovery 1, 309-315, 2002). Representative examples of CDKs include, but are not limited to, cyclin dependent kinase 2 (CDK2), cyclin dependent 5 kinase 7 (CDK7), cyclin dependent kinase 6 (CDK6) and cell division control 2 protein (CDC2). CDKs have been implicated in the regulation of transitions between different phases of the cell cycle, such as the progression from a quiescent stage in GI (the gap between mitosis and the onset of DNA replication for a new round of cell division) to S (the period of active DNA synthesis), or the progression from G2 to M phase, in which active 10 mitosis and cell division occur (Rowell et al. Critical Reviews in Immunology 26(3), 189 212, 2006). CDK complexes are formed through association of a regulatory cyclin subunit (e.g., cyclin A, B1,B2, D1, D2, D3, and E) and a catalytic kinase subunit (e.g., cdc2 (CDK1), CDK2, CDK4, CDK5, and CDK6). CDKs display an absolute dependence on the cyclin subunit in order to phosphorylate their target substrates, and different kinase/cyclin pairs 15 function to regulate progression through specific portions of the cell cycle. Furthermore, CDKs have been implicated in various disease states, including but not limited to, those displaying the cancer phenotype, various neoplastic disorders and in neurological disorders (Pallas et al. Current Medicinal Chemistry: Central Nervous System Agents 5(2), 101-109, 2005). 20 The mitogen activated protein (MAP) kinases participate in the transduction of signals to the nucleus of the cell in response to extracellular stimuli. Representative examples of MAP kinases include, but are not limited to, mitogen activated protein kinase 3 (MAPK3), mitogen-activated protein kinase 1 (ERK2), mitogen-activated protein kinase 7 (MAPK7), mitogen-activated protein kinase 8 (JNKI), mitogen-activated protein kinase 14 (p38 alpha), 25 mitogen-activated protein kinase 10 (MAPK 10), JNK3 alpha protein kinase, stress-activated protein kinase JNK2 and mitogen-activated protein kinase 14 (MAPK14). MAP kinases are a family of proline-directed serine/threonine kinases that mediate signal transduction from extracellular receptors or heath shock, or UV radiation (Barr et al., Trends in Pharmacological Sciences 27(10), 525-530, 2006). MAP kinases activate through the 30 phosphorylation of threonine and tyrosine by dual-specificity protein kinases, including tyrosine kinases such as growth factors. Cell proliferation and differentiation have been shown to be under the regulatory control of multiple MAP kinase cascades (Sridhar et al., Pharmaceutical Research, 17:11 1345-1353, 2000). As such, the MAP kinase pathway plays critical roles in a number of disease states, for example, defects in activities of MAP kinases 215 WO 2008/154241 PCT/US2008/065727 have been shown to lead to aberrant cell proliferation and carcinogenesis (Qi et al., Journal of Cell Science 118(16), 3569-3572, 2005). Moreover, MAP kinase activity has also been implicated in insulin resistance associated with type-2 diabetes (Fujishiro et al. Recent Research Developments in Physiology 1(Pt. 2), 801-812, 2003). 5 The p90 ribosomal S6 kinases (Rsk) are serine/threonine kinases which function in mitogen-activated cell growth and proliferation, differentiation, and cell survival. Examples of members of the Rsk family of kinases include, but are not limited to, ribosomal protein S6 kinase, 90 kDa, polypeptide 2 (Rsk3), ribosomal protein S6 kinase, 90 kDa, polypeptide 6 (Rsk4), ribosomal protein S6 kinase, 90 kDa, polypeptide 3 (Rsk2) and ribosomal protein S6 10 kinase, 90 kDa, polypeptide 1 (Rsk1/p90Rsk). The Rsk family members are activated by extracellular signal-related kinases and phosphoinositide-dependent protein kinase 1 (Frodin and Gammeltoft, Mol. Cell. Endocrinol. 151, 65-77, 1999). Under basal conditions, RSK kinases are localized in the cytoplasm of cells and upon stimulation by mitogens, the activated (phosphorylated by extracellular-related kinase) RSK transiently translocates to the 15 plasma membrane where they become fully activated. The fully activated RSK phosphorylates substrates that are involved in cell growth, proliferation, differentiation, and cell survival (Clark et al. Cancer Research 65, 3108-3116, 2005). RSK signaling pathways have also been associated with the modulation of the cell cycle (Gross et al., J. Biol. Chem. 276, 46099-46103, 2001). Current data suggests that small molecules that inhibit Rsk may be 20 useful therapeutic agents for the prevention and treatment of cancer and inflammatory diseases. Members of the checkpoint protein kinase family (CHK) are serine/threonine kinases that play an important role in cell cycle progression. Examples of members of the checkpoint family include, but are not limited to, CHK1 and CHK2. Checkpoints kinases are control 25 systems that coordinate cell cycle progression by influencing the formation, activation and subsequent inactivation of the cyclin-dependent kinases. Checkpoints kinases prevent cell cycle progression at inappropriate times, maintain the metabolic balance of cells while the cell is arrested, and in some instances can induce apoptosis (programmed cell death) when the requirements of the checkpoint have not been met (Nurse, Cell, 91, 865-867, 1997; 30 Hartwell et al., Science, 266, 1821-1828, 1994). Members of the checkpoint family of kinases have been implicated in cell proliferative disorders, cancer phenotypes and other diseases related to DNA damage and repair (Kumagai and Dunphy Cell Cycle, 5, 1265-1268 (2006); Xiao et al., Molecular Cancer Therapeutics 5, 1935-1943, 2006). Aurora kinases are a family of multigene mitotic serine-threonine kinases that 216 WO 2008/154241 PCT/US2008/065727 functions as a class of novel oncogenes. These kinases comprise aurora-A and aurora-B members. Aurora kinases are hyperactivated and/or over-expressed in several solid tumors including but not limited to, breast, ovary, prostate, pancreas, and colorectal cancers. In particular aurora-A is a centrosome kinase that plays an important role cell cycle progression 5 and cell proliferation. Aurora-A is located in the 20ql3 chromosome region that is frequently amplified in several different types of malignant tumors such as colorectal, breast and bladder cancers. There is also a high correlation between aurora-A and high histo-prognostic grade aneuploidy, making the kinase a potential prognostic vehicle. Inhibition of aurora kinase activity may reduce cell proliferation, tumor growth and potentially tumorigenesis. A 10 detailed description of aurora kinase function is reviewed in Journal of Cell Science, 119, 3664-3675, 2006. The Rho-associated coiled-coil-containing protein serine/threonine kinases ROCK-I and ROCK-2 are thought to play a major role in cytoskeletal dynamics by serving as downstream effectors of the Rho/Rac family of cytokine-and growth factor-activated small 15 GTPases. ROCKs phosphorylate various substrates, including, but not limited to, myosin light chain phosphatase, myosin light chain, ezrin-radixin-moesin proteins and LIM (for Lin 1, IslI and Mec3) kinases. ROCKs also mediate the formation of actin stress fibers and focal adhesions in various cell types. ROCKs have an important role in cell migration by enhancing cell contractility and are required for tail retraction of monocytes and cancer cells. 20 ROCK inhibitors have also been shown to reduce tumor-cell dissemination in vivo. Recent experiments have defined new functions of ROCKs in cells, including centrosome positioning and cell-size regulation, which might contribute to various physiological and pathological states (Mueller et al, Nature Reviews Drug Discovery 4, 387-398, 2005). The ROCK family members are attractive intervention targets for a variety of pathologies 25 including cancer and cardiovascular disease. ROCK inhibitors can be useful therapeutic agents for hypertension, angina pectoris, and asthma. Furthermore, Rho is expected to play a role in peripheral circulation disorders, arteriosclerosis, inflammation, and autoimmune disease and as such, is a useful target for therapy (Shimokawa et al, Arteriosclerosis, Thrombosis, and Vascular Biology, 25, 1767-1775, 2005). 30 The limited success of pharmacotherapeutic approaches in spinal-cord injury is based to a large extent on the inability of injured nerve fibers in the white matter of the human spinal cord to regrow and re-establish synaptic contacts with their disconnected partner neurons. A hostile micro-environment, characterized by the presence of a large variety of molecular neurite-growth inhibitors at the lesion site, in the scar tissue and on CNS myelin, 217 WO 2008/154241 PCT/US2008/065727 accounts for this irreversible arrest of neurite-growth. In tissue culture, these inhibitors of neurite growth often induce very dramatic responses, including the collapse of the formation and withdrawal of the neurite. Scar tissue in the human brain and spinal cord is a strong and persistent barrier for any regenerative neurite growth and ROCK inhibitors might help injured 5 fibers to grow or sprout beyond this regeneration-inhibiting tissue. A variety of evidence indicates that injury to brain and spinal cord results in a strongly activated RhoA-ROCK pathway. Due to the persistent presence of the neurite growth inhibitors at or around the lesion site and in CNS myelin, such activation could potentially persist for a long time, making ROCK inhibition an attractive goal not only for acute and sub-acute treatment, but 10 also for chronic treatment of spinal-cord injury. Inhibition of ROCK by two different small molecule ROCK inhibitors (Y-27632 and fasudil) stimulated or accelerated functional recovery in different mouse and rat spinal-cord-injury models when given locally or systemically immediately after injury as a single dose or over several weeks (Dergham, P. et al. Rho signaling pathway targeted to promote spinal cord repair. J. Neurosci. 22, 6570-6577, 15 2002; Hara, M. et al. Protein kinase inhibition by fasudil hydrochloride promotes neurological recovery after spinal cord injury in rats. J. Neurosurg. Spine 93, 94-101, 2000.; Fournier, A. E. et al. ROCK inhibition enhances axonal regeneration in the injured CNS. J. Neurosci. 23, 1416-1423, 2003; Sung, J. K. et al. A possible role of RhoA/Rho-kinase in experimental spinal cord injury in rat. Brain Res. 959, 29-38, 2003; Tanaka, H. et al. 20 Cytoplasmic p21 (Cip 1 /WAF 1) enhances axonal regeneration and functional recovery after spinal cord injury in rats. Neuroscience 127, 155-164, 2004). In these studies, ROCK inhibition not only enhanced nerve-fiber growth beyond the lesion site, but was also neuroprotective and decreased tissue damage and cavity formation. On the basis of these rodent studies, ROCK inhibitors, which possess neuroprotective and neuroregeneration 25 stimulating activities, could offer significant benefit for spinally injured patients. In addition, they could normalize spinal blood flow due to their vasodilatory effects, thereby further enhancing tissue preservation. Pathologically, Alzheimer's disease is characterized at the microscopic level by intracellular neurofibrillary tangles and extracellular amyloid aggregates. Neurofibrillary 30 tangles contain aberrantly phosphorylated tau protein, a microtubule-associated protein and substrate for ROCK, whereas the amyloid aggregates are formed primarily by toxic 42 amino-acid long amyloid-p (AP) peptides. It was recently shown (Zhou, Y. et al. Nonsteroidal anti-inflammatory drugs can lower amyloidogenic A342 by inhibiting Rho. Science 302, 1215-1217, 2003) that in cells secreting Ap42 and in transgenic PDAPP MICE 218 WO 2008/154241 PCT/US2008/065727 producing large amounts of Ap42, some NSAIDs lowered A342 by inhibiting the RhoA ROCK pathway. The ROCK inhibitor Y-27632 was effective in lowering A342 levels both in cell culture and in PDAPP transgenic mice after intra-cerebroventricular injection. Activation of Rho by geranylgeranylpyrophosphate, a lipid required for the membrane 5 attachment of Rho, increased Ap42 levels; this increase was completely prevented by Y 27632. The ROCK inhibitor Y-27632 used in animal Alzheimer's disease models was efficient in lowering the amount of the toxic Ap42 levels, but had no effect on total AP levels and this effect of Rho or ROCK inhibitors is at least one mechanism by which NSAIDs reduce Ap42 levels. In addition to many other therapeutic interventions, these inhibitors have 10 the well-documented advantage of stimulating regenerative growth of neuritis and it is therefore possible that the inhibition of this pathway could result in repair of the amyloid damaged neural circuitry. Most important in disease pathogenesis is the migration of leukocytes beyond the brain endothelium into the CNS and the inflammatory cascade stimulated by these cells, 15 which finally results in demyclination of CNS fiber tracts and in neurite damage and loss. Leukocytes require active RhoA and ROCK for their journey beyond brain endothelium, because their trans-endothelial migration was prevented by the ROCK inhibitor Y-2763294. Neuroprotective activities of the ROCK inhibitors fasudil and hydroxy-fasudil are not restricted to spinal-cord injury models, but have also been reported in cerebral multi-infarct 20 models in gerbils and rats (Toshima Y, Satoh S, Ikegaki I, Asano T. A new model of cerebral microthrombosis in rats and the neuroprotective effect of a Rho-kinase inhibitor. Stroke 31, 2245-2250, 2000; Satoh, S. et al. Pharmacological profile of hydroxy fasudil as a selective ROCK inhibitor on ischemic brain damage. Life Sci. 69, 1441-1453, 2001; Kitaoka, Y. et al. Involvement of RhoA and possible neuroprotective effect of fasudil, a 25 ROCK inhibitor, in NMDA-induced neurotoxicity in the rat retina. Brain Res.10 18, 111-118, 2004). In rodent stroke models, several regeneration inhibitors, such as the ROCK-activating NgR1 complex and one of its ligands, NOGO-A, have been neutralized 24 hours or even 1 week after induction of a cerebral stroke and improved functional recovery has been observed (Lee, J. K., Kim, J. E., Sivula, M. & Strittmatter, S. M. Nogo receptor antagonism promotes 30 stroke recovery by enhancing axonal plasticity. J. Neurosci. 24, 6209-6217, 2004; Wiessner, C. et al. Anti-Nogo-A antibody infusion 24 hours after experimental stroke improved behavioral outcome and corticospinal plasticity in normotensive and spontaneously hypertensive rats. J. Cereb. Blood FlowMetab. 23, 154-165, 2003). Blocking ROCK is therefore a feasible neuroregenerative strategy; furthermore, such a strategy has the 219 WO 2008/154241 PCT/US2008/065727 advantage that the therapeutic treatment window for the use of these inhibitors might be larger than for thrombolytic or neuroprotective stroke treatment options. Neuronal injuries in the peripheral nervous system or in the CNS of humans can lead to a chronic pain state known as neuropathic pain. Inflammatory mediators such as 5 lysophosphatidic acid (LPA) which is produced in response to injury has recently been shown to be involved in initiation of neuropathic pain in a mouse model of peripheral nerve injury (Inoue, M. et al. Initiation of neuropathic pain requires lysophosphatidic acid receptor signaling. Nature Med. 10, 712-718, 2004). LPA is present at lesion sites in the PNS and CNS, and exerts its function by binding to G-protein-coupled LPA receptors which results in 10 activation of the RhoA-ROCK pathway. The ROCK inhibitor Y-27632 prevented the initiation of neuropathic pain after nerve injury or LPA injection, whereas another ROCK inhibitor, H- 1152, relieved neuropathic pain in an L5 spinal-nerve-transection model (Tatsumi, S. et al. Involvement of Rho-kinase in inflammatory and neuropathic pain through phosphorylation of myristoylated alanine-rich C-kinase substrate (MARCKS). Neuroscience 15 131, 491-498, 2005). The results of these studies indicate that ROCK is a potential drug target responsible for the induction and also maintenance of persistent pain states. Moreover, Schueller et al. (Abstract 1216, 8th World Congress on Inflammation, Copenhagen, Denmark, June 16-20, 2007) have demonstrated that SLx-2119, an orally bioavailable, potent and highly selective inhibitor of ROCK 2 reduces atherogenesis in the 20 presence of dramatically elevated lipid levels in groups of 8 ApoE knockout mice, indicaticating that selective inhibition of ROCK 2 has the potential to limit atherosclerosis. The 70 kDa ribosomal S6 kinase (p70S6K) is activated by numerous mitogens, growth factors and hormones. Activation of p70S6K occurs through phosphorylation at a number of sites and the primary target of the activated kinase is the 40S ribosomal protein S6, 25 a major component of the machinery involved in protein synthesis in mammalian cells. In addition, p70S6K activation has been implicated in cell cycle control, neuronal cell differentiation, regulation of cell motility and a cellular response that is important in tumor metastases, immunity and tissue repair. Modulation of p70S6 kinase activity may also have therapeutic implications in disorders such as cancer, inflammation, and various neuropathies. 30 A detailed discussion of p70S6K kinases can be found in Prog. Cell Cycle Res., 1, 21-32, 1995, and Immunol. Cell Biol. 78, 447-5 1, 2000. Glycogen synthase kinase 3 (GSK-3) is a ubiquitously expressed constitutively active serine/threonine kinase that phosphorylates cellular substrates and thereby regulates a wide variety of cellular functions, including development, metabolism, gene transcription, protein 220 WO 2008/154241 PCT/US2008/065727 translation, cytoskeletal organization, cell cycle regulation, and apoptosis. GSK-3 was initially described as a key enzyme involved in glycogen metabolism, but is now known to regulate a diverse array of cell functions. Two forms of the enzyme, GSK-3+f and GSK 3+f, have been previously identified. The activity of GSK-3+f is negatively regulated by 5 protein kinase B/Akt and by the Wnt signaling pathway. Small molecules inhibitors of GSK 3 may, therefore, have several therapeutic uses, including the treatment and prevention of neurodegenerative diseases and stimulation of neurogeneration in various neurological disorders (Gartner et al. J. Cell Science, 2006, 119, 3927-3934. Zhou et al. Neuron, 2004, 42, 897-912), type II diabetes, bipolar disorders, stroke, cancer, osteoarthritis, osteoporosis, 10 rheumatoid arthritis (Cuzzocrea et al. Clinical Immunology, 2006, 120, 57-67) and chronic inflammatory disease. General review: Kockeritz et al., Current Drug Targets, 7, 1377 1388, 2006. Review of neurological applications: Current Drug Targets, 7(11), 1389-1397 and 1399-1409, 2006. Protein kinases have become attractive targets for the treatment of cancers (Fabbro et 15 al., Pharmacology & Therapeutics 93:79-98, 2002). It has been proposed that the involvement of protein kinases in the development of human malignancies may occur by: (1) genomic rearrangements (e.g., BCR-ABL in chronic myelogenous leukemia), (2) mutations leading to constitutively active kinase activity, such as acute myelogenous leukemia and gastrointestinal tumors, (3) deregulation of kinase activity by activation of oncogenes or loss 20 of tumor suppressor functions, such as in cancers with oncogenic RAS, (4) deregulation of kinase activity by over-expression, as in the case of EGFR and (5) ectopic expression of growth factors that can contribute to the development and maintenance of the neoplastic phenotype (Fabbro et al., Pharmacology & Therapeutics 93:79-98, 2002). Certain cancers are associated with angiogenesis. Angiogenesis is the growth of new 25 capillary blood vessels from pre-existing vasculature (Risau, W., Nature 386:671-674, 1997). It has been shown that protein kinases can contribute to the development and maintenance of the neoplastic phenotype (Fabbro et al., Pharmacology & Therapeutics 93:79-98, 2002). For example, VEGF A-D and their four receptors have been implicated in phenotypes that involve neovascualrization and enhanced vascular permeability, such as tumor angiogenesis 30 and lymphangiogenesis (Matter, A., Drug Discov. Today 6:1005-1023, 2001). It has been recognized that a single agent approach that specifically targets one kinase or one kinase pathway may be inadequate to treat diseases and disorders, in particular cancer, for several reasons. Models have suggested that 5 to 7 mutations are necessary for the 221 WO 2008/154241 PCT/US2008/065727 progression of a normal cell to a malignant one. Furthermore, it is widely recognized that cancer is the result of alterations in multiple pathways, in particular protein kinase pathways that are associated with processes such as cell growth, proliferation, apoptosis, motility, or invasion. In a majority of cancers, a common feature is the simultaneous overexpression 5 and/or hyper-activation of a variety of protein kinases, such as receptor and non-receptor kinases, serine/threonine kinases, P13 kinases and cell cycle associated kinases. In fact, several of these kinases, either alone or in conjunction with other kinases, have been implicated in a number of processes important for cell survival, proliferation, growth and malignant transformation, motility and invasion leading to metastasis and angiogenesis or 10 inflammation, and diseases, disorders, and conditions associated therewith. Accordingly, blocking one target kinase may not be clinically sufficient because there are multiple target kinases that affect the progression of a condition, disease, or disorder. In addition, blocking one target kinase may not be clinically sufficient because redundant kinase-mediated pathways and alternative oncogenic or inflammatory mechanisms may 15 compensate for the blocked target kinase. Moreover, the use of a single agent can also increase the chances that resistance to that agent will develop. Cardiovascular disease accounts for nearly one quarter of total annual deaths worldwide. Vascular disorders such as atherosclerosis and restenosis result from dysregulated growth of the vessel walls and the restriction of blood flow to vital organs. 20 Various kinase pathways, e.g. JNK, are activated by atherogenic stimuli and regulated through local cytokine and growth factor production in vascular cells (Yang et al., Immunity 9:575, 1998). Ischemia and ischemia coupled with reperfusion in the heart, kidney or brain result in cell death and scar formation, which can ultimately lead to congestive heart failure, renal failure or cerebral dysfumction. In organ transplantation, reperfusion of previously 25 ischemic donor organs results in acute leukocyte-mediated tissue injury and delay of graft function. Ischemia and reperfusion pathways are mediated by various kinases. For example, the JNK pathway has been linked to leukocyte-mediated tissue damage (Li et al., Mol. Cell. Biol. 16:5947-5954, 1996). Finally, enhanced apoptosis in cardiac tissues has also been linked to kinase activity (Pombo et al., J. Biol. Chem. 269:26546-26551, 1994). 30 222

Claims (156)

1. A compound of formula (I) AR, AIN (R 3 )m 5 (I), or a pharmaceutically acceptable salt thereof, wherein A is N- rIr' I-N ~ NI+-N (i, (RiiN s (Ric( ,N(R) N NN 0, 0l , 04 N 0 (i) (ii) (iii) (iv) (V) (Rvi)b (Rvi)b (Rjlii)a (Ri.)a (vi) (vii) (viii) (ix) (Rx)b (Rxi)b (Rxii)a (Rxiii)a N-j'-\ I'WN N-H S , S , S (x) (xi) (xii) (xiii) (Rxiv)c (Rxv)d (R.,i)d (R ,i)d S N ~ - ~ , N',,~ N N N N N (xiv) (xv) (xvi) (xvii) (Rxylii)c R) (Rxix)c (R i),a , \' N(Rxxi)d NN N NN , N , N (xviii) (xix) (xx) (xxi) (Rx i)c (Rx i)c or (xxii) (xxiii) R 1 is hydrogen, alkyl, aryl, heterocycle, heteroaryl, RaRbN-, RcRdN-C(O)- or 223 WO 2008/154241 PCT/US2008/065727 RcRdN-S(O) 2 -; R 2 is hydrogen, alkyl, alkoxycarbonyl, alkylcarbonyl, arylcarbonyl, heterocyclecarbonyl or RRfN-alkyl-C(O)-; R 3 is alkyl, alkoxy, aryl, cyano, cycloalkyl, halogen, haloalkyl, heteroaryl, nitro, or 5 RgRhN-; R 4 is alkyl, alkoxyalkyl, aryl, cycloalkyl, heteroaryl, heterocycle, heterocyclealkyl, RjRkN- or RjRkN-alkyl-; R 5 is alkyl, aryl, or heteroaryl; Re is alkyl, alkoxyalkyl, RjRkN-alkyl-, aryl, cycloalkyl or heteroaryl; 10 R 7 is alkyl, aryl or heteroaryl; Ra and Rb are each independently hydrogen, alkyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroarylalkyl, R4-C(O)-, or RS-S(0) 2 -; Re and Rd are each independently hydrogen, alkyl or heteroaryl; Re and Rf are each independently hydrogen, alkyl, arylalkyl, heteroarylalkyl, 15 R 6 -C(O)-, or R 7 -S(0) 2 -; Rg and Rh are each independently hydrogen, alkyl, or alkylcarbonyl; Rj and Rk are each independently hydrogen, alkyl, aryl, arylalkyl, cycloalkyl, heteroaryl, or heterocycle; Ri, Rii, Riii, Rij, R., Rji, Rjii, Riii, Rix, Rx, Rxi, Rxii, Rxiii, Rxij, Rx,, Rx, Rxvii, Rxviii, Rxix, 20 Rxx, Rxxi, Rxxii, and Rxxiii are each independently alkyl, alkoxy, alkoxyalkyl, alkoxycarbonyl, alkoxycarbonylalkyl, aryl, arylalkyl, aryl(hydroxy)alkyl, aryloxyalkyl, arylcarbonyl, arylthioalkyl, carboxy, carboxyalkyl, cyanoalkyl, cycloalkyl, cycloalkylalkyl, cycloalkylcarbonyl, halogen, heteroaryl, heteroarylalkyl, heterocycle, heterocyclealkyl, heterocyclecarbonyl, hydroxyalkyl, trialkylsilylalkyl, H 2 NC(O)-alkyl, ZaZbN-, ZaZbNalkyl, 25 ZeZdNC(O)- or ZeZdNS(O) 2 - wherein Rxi, R, Rxi, and Rxvii may occur at any open valence on compounds (xiv), (xv), (xvi) or (xvii); Za and Zb are each independently hydrogen, alkyl, alkoxycarbonylalkyl, aryl, arylalkyl, cycloalkyl, H 2 NC(O)-, H 2 NalkylC(O)-, H 2 NC(O)-alkyl, dialkylNC(O)- or dialkylNC(O)-alkyl-; 30 Ze and Zd are each independently hydrogen, alkyl, alkoxyalkyl, aryl, arylalkyl, aryl(hydroxy)alkyl, cycloalkyl, cycloalkylalkyl, heteroarylalkyl, heterocycle, heterocyclealkyl, hydroxyalkyl, H 2 NC(O)-alkyl-, dialkylNC(O)-alkyl-, dialkylN-alkyl-, or CHZeZf; Ze is aryl or heteroaryl; 224 WO 2008/154241 PCT/US2008/065727 Zf is heteroarylalkyl, heterocyclealkyl, or Z1Z 2 N-alkyl-; m is 0, 1 or 2; a is 0 or 1; b is 0, 1, or 2; 5 cis0, 1,2or3; and d is 0, 1, 2, 3 or 4.

2. The compound according to claim 1, wherein A is (ii), (iii), (iv), (vii), (x), (xiv), (xv), (xvi), (xvii), (xviii), (xix), (xx), (xxi), (xxii), 10 or (xxiii).

3. The compound according to claim 2, wherein A is (ii) (Rii)b NN 15 (ii); R 1 is hydrogen, aryl, heteroaryl, heterocycle, RaRbN-, or RcRdN-C(O)-; R 2 is hydrogen, alkoxycarbonyl, heterocyclecarbonyl, alkylcarbonyl, or ReRfN-alkyl-C(O)-; R 4 is alkyl, alkoxyalkyl, aryl, cycloalkyl, heterocycle, heterocyclealkyl, RjRkN- or 20 RjRkN-alkyl-; R 5 is alkyl, aryl or heteroaryl; Ra and Rb are each independently hydrogen, arylalkyl, cycloalkylalkyl, R 4 -C(O)- or RS-S(O) 2 -; Re and Rd are each independently hydrogen or heteroaryl; 25 Re and Rf are each independently hydrogen or alkyl; Rj and Rk are each independently hydrogen, alkyl, aryl, cycloalkyl, or heterocycle; Rii is alkyl, alkoxyalkyl, alkoxycarbonyl, aryl, arylalkyl, aryl(hydroxy)alkyl, aryloxyalkyl, arylcarbonyl, alkoxycarbonylalkyl, arylthioalkyl, carboxy, carboxyalkyl, cycloalkyl, cycloalkylalkyl, cycloalkylcarbonyl, halogen, heteroaryl, heteroarylalkyl, 30 heterocycle, heterocyclealkyl, heterocyclecarbonyl, hydroxyalkyl, trialkylsilylalkyl, ZaZbN-, ZaZbNalkyl- or ZcZdNC(O)-; Za and Zb are each independently hydrogen, alkyl or H 2 NalkylC(O)-; 225 WO 2008/154241 PCT/US2008/065727 Z, and Zd are each independently hydrogen, alkyl, alkoxyalkyl, aryl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroarylalkyl, heterocyclealkyl, hydroxyalkyl or dialkylN alkyl-; m is 0; and 5 bis0,1,or2.

4. The compound according to claim 3, wherein R 1 is hydrogen, heterocycle, RaRbN-, or RcRdN-C(O)-; R 2 is hydrogen, alkoxycarbonyl or ReRfN-alkyl-C(O)-; 10 R 4 is alkyl, alkoxyalkyl, aryl, cycloalkyl, heterocycle, heterocyclealkyl, RjRkN- or RjRkN-alkyl-; R 5 is alkyl, aryl or heteroaryl; Ra and Rb are each independently hydrogen, arylalkyl, cycloalkylalkyl, R 4 -C(O)- or R 5 -S(O) 2 -; 15 Rj and Rk are each independently hydrogen, alkyl, aryl cycloalkyl or heterocycle; Rii is alkyl, alkoxyalkyl, alkoxycarbonylalkyl, aryl, arylalkyl, aryloxyalkyl, arylcarbonyl, arylthioatkyl, carboxy, carboxyalkyl, cycloalkyl, cycloalkylalkyl, cycloalkylcarbonyl, halogen, heteroaryl, heteroarylalkyl, heterocyclealkyl, heterocyclecarbonyl, hydroxyalkyl, trialkylsilylalkyl, ZaZbNalkyl-, or ZeZdNC(O)-; 20 Za and Z are each independently hydrogen or alkyl; Ze and Zd are each independently hydrogen, alkyl, alkoxyalkyl, aryl, arylalkyl, cycloalkylalkyl or heterocyclealkyl; m is 0; and b is 0, 1 or 2. 25

5. The method according to claim 3, wherein R 1 is hydrogen or RaRbN-; R 2 is hydrogen; R 4 is alkyl, alkoxyalkyl or aryl; 30 Rs is alkyl or aryl; Ra and Rb are each independently hydrogen, arylalkyl, R 4 -C(O)- or R 5 -S(O) 2 -; Rii is alkyl, aryl, arylalkyl, cycloalkyl, cycloalkylalkyl or halogen; b is 1 or 2; and m is 0. 226 WO 2008/154241 PCT/US2008/065727

6. The method according to claim 3, wherein R 1 is hydrogen, aryl, heteroaryl or RaRbN-, wherein the heteroaryl is triazole substituted with arylalkyl; R 4 is alkoxyalkyl, alkyl, aryl, or RjRkN-; 5 R 5 is alkyl, aryl, or heteroaryl; Ra and Rb are each independently hydrogen, arylalkyl, R 4 -C(O)-, or R5-S(O)2-; Rj and Rk are alkyl; Rii is alkyl, alkoxyalkyl, aryl, arylalkyl, aryl(hydroxy)alkyl, aryloxyalkyl, arylcarbonyl, arylthioalkyl, carboxy, cycloalkyl, cycloalkylalkyl, cycloalkylcarbonyl, 10 halogen, heteroaryl, heteroarylalkyl, heterocyclealkyl, heterocyclecarbonyl, hydroxyalkyl, ZaZbNalkyl or ZeZdNC(O)-; Za and Zb are each independently hydrogen or H 2 Nalkyl-C(O)-; Z, and Zd are each independently hydrogen, alkoxyalkyl, alkyl, arylalkyl, cycloalkyl, cycloalkylalkyl, or heterocyclealkyl; 15 b is 1 or 2; and m is 0.

7. The compound according to claim 2, wherein A is (iii) (Riii)c 20 N (iii); R 1 is hydrogen or RaRbN-; R 2 is hydrogen; Ra and Rb are each hydrogen; 25 Riii is arylalkyl; m is 0; and c is 1.

8. The compound according to claim 2, wherein A is (iii) 30 (Riii)c I -\ N 227 WO 2008/154241 PCT/US2008/065727 (iii); R 1 is hydrogen or RaRbN-; R 2 is hydrogen; R 4 is RjRkN-alkyl-; 5 Ra and Rb are each independently hydrogen, or R4-C(0)-; Rj and Rk are alkyl; Riii is alkoxycarbonylalkyl, alkyl, arylalkyl, cyanoalkyl, heterocyclealkyl, or H 2 NC(O)-alkyl-; c is 0, 1 or 2; and 10 m is 0.

9. The compound according to claim 2, wherein A is (iv) (Riv)c N 15 (iv); R 1 is hydrogen or RaRbN-; R 2 is hydrogen; Ra and Rb are each hydrogen; Ri, is alkyl, aryl, arylalkyl, heterocycle, heterocyclealkyl or ZaZbNalkyl or 20 ZeZdNS(O) 2 -; Za and Zb are each independently hydrogen or alkyl; Ze and Zd are each alkyl; c is 0, or 1; and m is 0. 25

10. The compound according to claim 2, wherein A is (vii) (Rvii)b (vii); 30 R 1 is hydrogen,-NRaRb, or alkyl; R 2 is hydrogen; 228 WO 2008/154241 PCT/US2008/065727 Ra and Rb are each hydrogen; Rjii is alkyl, alkoxycarbonyl, aryl, arylalkyl, cycloalkyl, heterocyclealkyl, heterocyclecarbonyl, hydroxyalkyl or ZcZdNC(O)-; Z, and Zd are each independently hydrogen, alkyl, alkoxyalkyl, aryl, arylalkyl, 5 aryl(hydroxy)alkyl, cycloalkyl, cycloalkylalkyl, heteroarylalkyl, heterocycle, heterocyclealkyl, hydroxyalkyl, or CHZeZf; Ze is aryl or heteroaryl; Zf is heteroarylalkyl, heterocyclealkyl, or ZIZ 2 N-alkyl-; b is 1; and 10 m is 0.

11. The compound according to claim 2, wherein A is (vii) (Rvii)b 15 (vii) R 1 is hydrogen, alkyl, or RaRbN-; R 2 is hydrogen; Ra and Rb are each hydrogen; Rvii is alkyl, alkoxycarbonyl, arylalkyl, cycloalkyl, heterocyclealkyl, 20 heterocyclecarbonyl, hydroxyalkyl or ZcZdNC(O)-; Ze and Zd are each independently hydrogen, alkyl, alkoxyalkyl, aryl, arylalkyl, aryl(hydroxy)alkyl, cycloalkyl, heteroarylalkyl, heterocyclealkyl or hydroxyalkyl; b is 1; and m is 0. 25

12. The method according to claim 2, wherein A is (vii) (Rvii)b (vii); 30 R 1 is hydrogen or RaRbN-; R 2 is hydrogen; 229 WO 2008/154241 PCT/US2008/065727 Ra and Rb are hydrogen; Rjii is alkyl or arylalkyl; b is 1; and m is 0. 5

13. The compound according to claim 2, wherein A is (x) (RX)b S (x); R 1 is hydrogen; 10 R 2 is hydrogen; Rx is alkyl, aryl or ZaZbN-; Za and Zb are each independently hydrogen, alkyl, aryl or arylalkyl; b is 1 or 2; and m is 0. 15

14. The compound according to claim 2, wherein A is (xiv) (R xiv)cN N S -jN (xiv); 20 R 1 is hydrogen; R 2 is hydrogen; Rxi, is ZaZbN-; Za and Zb are each independently hydrogen or cycloalkyl; c is 1; and 25 m is 0.

15. The compound according to claim 2, wherein A is (xv) (Rxv)d N 30 (xv); 230 WO 2008/154241 PCT/US2008/065727 R 1 is hydrogen or RaRbN-; R 2 is hydrogen; Ra and Rb are hydrogen; R,, is ZaZbN-; 5 Za and Zb are each independently hydrogen, alkoxycarbonylalkyl, aryl, arylalkyl or cycloalkyl; d is 0 or 1; and m is 0. 10

16. The compound according to claim 2, wherein A is (xvi) (Rxvi)d AN r N (xvi); R 1 is hydrogen; R 2 is hydrogen; 15 Rxvi is ZaZbN-; Za and Zb are each independently hydrogen or cycloalkyl; d is 1; and m is 0. 20

17. The compound according to claim 2, wherein A is (xvii) (Rxii)d N (xvii); R 1 is hydrogen; R 2 is hydrogen; 25 Rxvii is ZaZbN- or aryl; Za and Zb are each independently hydrogen, alkyl, alkoxycarbonylalkyl, aryl, arylalkyl, cycloalkyl, or H 2 NC(O)-alkyl; d is 0 or 1; and m is 0. 30 231 WO 2008/154241 PCT/US2008/065727

18. The compound according to claim 2, wherein A is (xviii) (R.ylii)c :N (xviii); R 1 is RaRbN-; 5 R 2 is hydrogen; Ra and Rb are each hydrogen; c is 0; and m is 0. 10

19. The compound according to claim 2, wherein A is (xix) (R.Ji \c N (xix); R 1 is RaRbN-; R 2 is hydrogen; 15 Ra and Rb are each hydrogen; c is 0; and m is 0.

20. The compound according to claim 2, wherein A is (xx) (R.x). N 20 N (xx); R 1 is RaRbN-; R 2 is hydrogen; R 4 is RjRkN-alkyl-; 25 Ra and Rb are each independently hydrogen or R4-C(O)-; Rj and Rk are independently alkyl; Rxx is ZaZbN- or heterocycle; Za and Zb are each independently hydrogen or alkyl; 232 WO 2008/154241 PCT/US2008/065727 c is 0 or 1; and m is 0.

21. The compound according to claim 2, wherein A is (xxi) (Rxxi)d 5 N (xxi); R 1 is RaRbN-; R 2 is hydrogen; R, and Rb are each hydrogen; 10 Rxxi is alkoxy; d is 1; and m is 0.

22. The compound according to claim 2, wherein A is (xxii) 15 0 (xxii); R 1 is RaRbN-; R 2 is hydrogen; R 4 is RjRkN-alkyl-; 20 Ra and Rb are each independently hydrogen or R4-C(O)-; Rj and Rk are each independently alkyl; c is 0; and m is 0. 25

23. The compound according to claim 2, wherein A is (xxiii) (Rxxiii)c (xxiii); R 1 is RaRbN-; R 2 is hydrogen; 233 WO 2008/154241 PCT/US2008/065727 R, and Rb are each hydrogen; c is 0; and m is 0. 5

24. The compound of claim 1, that is 5-(1-benzyl-1H-1,2,3-triazol-5-yl)-1H-indazole compound with 5-(1-benzyl-1H 1,2,3-triazol-4-yl)-1H-indazole; 5-(1H-1,2,3-triazol-5-yl)-1H-indazole; 5-(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazole; 10 5-[1-(2-methylbenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; 5-[1-(3-methylbenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; 5-[1-(4-methylbenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; 5-[1-(3-methoxybenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; 5-[1-(2-fluorobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; 15 5-[1-(3-fluorobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; 5-[1-(4-fluorobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; 5-[1-(2-chlorobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; 5-[1-(3-chlorobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; 5-[1-(4-chlorobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; 20 5-[1-(2-bromobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; 5-[1-(2-nitrobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; 5-[1-(3-nitrobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; 5-[1-(4-nitrobenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; 2- { [4-(1H-indazol-5-yl)-1H-1,2,3-triazol-1-yl]methyl}benzonitrile; 25 3- { [4-(1H-indazol-5-yl)-1H-1,2,3-triazol-1-yl]methyl}benzonitrile; 4- { [4-(1H-indazol-5-yl)-1H-1,2,3-triazol-1-yl]methyl}benzonitrile; 5- { 1-[2-(trifluoromethyl)benzyl]-1H-1,2,3-triazol-4-yl}-1H-indazole; 5- { 1-[3-(trifluoromethyl)benzyl]-1H-1,2,3-triazol-4-yl}-1H-indazole; 5- { 1-[4-(trifluoromethyl)benzyl]-1H-1,2,3-triazol-4-yl}-1H-indazole; 30 5- { 1-[3-(trifluoromethoxy)benzyl]-1H-1,2,3-triazol-4-yl}-1H-indazole; 5- { 1-[4-(trifluoromethoxy)benzyl]-1H-1,2,3-triazol-4-yl}-1H-indazole; 5-[1-(4-tert-butylbenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazole; methyl 3- { [4-(1 H-indazol-5 -yl)-l H- 1,2,3 -triazol- 1 -yl]methyl} benzoate; methyl 4- { [4-(1 H-indazol-5 -yl)-l H- 1,2,3 -triazol- 1 -yl]methyl} benzoate; 234 WO 2008/154241 PCT/US2008/065727 5-[1-(2,4-dimethylbenzyl)- 1 H- 1,2,3-triazol-4-yl]- 1 H-indazole; 5-[1-(3,5-dimethylbenzyl)- 1 H- 1,2,3-triazol-4-yl]- 1 H-indazole; 5-[1-(2,3-dichlorobenzyl)- 1H- 1,2,3-triazol-4-yl]- 1 H-indazole; 5-[1-(2,4-dichlorobenzyl)- 1H- 1,2,3-triazol-4-yl]- 1 H-indazole; 5 5-[1-(2,5-dichlorobenzyl)- 1H- 1,2,3-triazol-4-yl]- 1 H-indazole; 5-[1-(3,5-dichlorobenzyl)- 1H- 1,2,3-triazol-4-yl]- 1 H-indazole; 5- { 1-[2,4-bis(trifluoromethyl)benzyl]-1H-1,2,3-triazol-4-yl}-1H-indazole; N-cyclohexyl-6-(1H-indazol-5-yl)imidazo[2, 1-b] [1,3]thiazol-5-amine; N-cyclohexyl-2-(1H-indazol-5-yl)imidazo[1,2-a]pyridin-3-amine; 10 N-cyclohexyl-2-(1H-indazol-5-yl)imidazo[1,2-a]pyrazin-3-amine; 5-[1 -benzyl-4-(4-fluorophenyl)- 1 H-imidazol-5-yl]-l H-indazole; N- {3-[4-(4-fluorophenyl)-5-(1H-indazol-5-yl)- 1 H-imidazol- 1 -yl]propyl} -N,N dimethylamine; N-cyclohexyl-2-(1H-indazol-5-yl)imidazo[1,2-a]pyrimidin-3-amine; 15 5-[4-(4-fluorophenyl)- 1 -(1 -phenylethyl)- 1 H-imidazol-5-yl]- 1 H-indazole; 2-(1 H-indazol-5-yl)-N-isopropylimidazo[1,2-a]pyrimidin-3-amine; 4-(1 H-indazol-5 -yl)-N-phenyl- 1,3 -thiazol-2-amine; 5 -(2-methyl- 1,3 -thiazol-4-yl)- 1 H-indazole; N-ethyl-4-(1 H-indazol-5 -yl)-1,3 -thiazol-2-amine; 20 N-benzyl-4-(1 H-indazol-5-yl)- 1,3-thiazol-2-amine; 4-(1 H-indazol-5-yl)-1,3-thiazol-2-amine; 4-(1 H-indazol-5-yl)-N-(2-phenylethyl)- 1,3-thiazol-2-amine; N-benzyl-2-(1 H-indazol-5-yl)imidazo[ 1,2-a]pyrimidin-3-amine; N-butyl-2-(1H-indazol-5-yl)imidazo[1,2-a]pyrimidin-3-amine; 25 N-(4-chlorophenyl)-2-(1H-indazol-5-yl)imidazo[ 1,2-a]pyrimidin-3-amine; 2-(1H-indazol-5-yl)-N-(4-methoxyphenyl)imidazo[1,2-a]pyrimidin-3-amine; 2-(1 H-indazol-5-yl)imidazo[1,2-a]pyrimidine; methyl N-[2-(1H-indazol-5-yl)imidazo[1,2-a]pyridin-3-yl]glycinate; N-benzyl-2-(1H-indazol-5-yl)imidazo[1,2-a]pyridin-3-amine; 30 N-(4-chlorophenyl)-2-(1H-indazol-5-yl)imidazo[1,2-a]pyridin-3-amine; 2-(1H-indazol-5-yl)-N-(4-methoxyphenyl)imidazo[1,2-a]pyridin-3-amine; tert-butyl 4-[4-(4-fluorophenyl)-5-(1H-indazol-5-yl)-1H-imidazol-1-yl]piperidine-1 carboxylate; 3,5-bis(1-benzyl-1H-1,2,3-triazol-4-yl)-1H-indazole; 235 WO 2008/154241 PCT/US2008/065727 5 -(1 -benzyl- 1 H-i ,2,3-triazol-4-yl)-3-phenyl- 1 H-indlazole; 5 -(1 -benzyl- 1 H-i ,2,3-triazol-4-yl)- 1 H-indazol-3-amine; 5 -(1 -benzyl- 1 H-i ,2,3-triazol-4-yl)- 1- [(1 -methylpiperidin-4-yl)carbonyl] -1 H-indlazol 3-amine; 5 N- [5 -(1 -benzyl- 1 H-i ,2,3 -triazol-4-yl)- 1 H-indazol-3 -yl]-2-methoxyacetamide; N 1 -[5-( 1 -benzyl- 1 H-i ,2,3-triazol-4-yl)- IH-indazol-3-yl]-N 2 ,N 2 -dimethylglycinamide; N-[5 -(1 -benzyl- 1 H-i ,2,3 -triazol-4-yl)- 1 H-indazol-3 -yl]butanamide; 5- [4-(4-fluorophenyl)-l1-piperidin-4-yl- 1H-imidazol-5 -yl]-i H-indazole; 5- f{4-(4-fluorophenyl)- 1- [2-( 1 -methylpyrrolidin-2-yl)ethyl] -1 H-imidlazol-5 -yl} -1 H 10 indazole; 5- f{4-(4-fiuorophenyl)- 1 -[3 -(4-methylpiperazin- 1 -yl)propyl] -1 H-imidazol-5-yl} -1 H indazole; ethyl 5-(1 H-indazol-5-yl)isoxazole-3-earboxylate; 5-(i H-indazol-5-yl)-N-methylisoxazole-3-carboxamide; i5 5 -(3 -benzylisoxazol-5 -yl)-l H-indazole; N- [5 -(1-benzyl- 1H-i ,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]benzamide; 5 -(3 -propylisoxazol-5 -yl)-i H-indazole; N-benzyl-4-( 1H-indazol-5-yl)-5 -phenyl- 1,3-thiazol-2-amine; 4-( 1H-indazol-5 -yl)-N,5-diphenyl- 1,3 -thiazol-2-amine; 20 5 -(1 -benzyl-5 -cyclopropyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazole; S -(1 -benzyl-4-cyclopropyl- 1H- 1,2,3 -triazol-5-yl)- 1H-indazole; 2-( 1H-indazol-5 -yl)-1 -phenylimidazo [1 ,2-a]pyrimidine; 5-fl -(tetrahydro-2H-pyran-4-ylmethyl)- 1H- 1,2,3 -triazol-4-yll -1H-indazole; 5- [3-(piperidin- 1-ylcarbonyl)isoxazol-5 -yl] -1H-indazole; 25 5 -(1 H-indazol-5 -yl)-N-phenylisoxazole-3-carboxamide; N-cyelohexyl-5 -(1 H-indazol-5 -yl)isoxazole-3 -carboxamide; 5- [3-(piperidin- 1-ylmethyl)isoxazol-5 -yl]-l H-indazole; [5 -(1H-indazol-5 -yl)isoxazol-3 -yl]methanol; S -(1 H-indazol-5 -yl)-N-(2-methoxyethyl)isoxazole-3 -earboxamide; 30 5 -(1 -benzyl-5 -phenyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazole; S -(4-benzyl- 1H- 1,2,3 -triazol- i-yl)-l H-indazole; S -(1 -benzyl-5 -cyclopropyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -amine; 5 -(1 -benzyl-4-cyelopropyl- 1H- 1,2,3 -triazol-5-yl)- 1H-indazol-3 -amine; 5 -(3 -isobutylisoxazol-5-yl)- 1H-indazol-3 -amine; 236 WO 2008/154241 PCT/US2008/065727 5 -(3 -benzylisoxazol-5 -yl)-l H-indazol-3 -amine; N- {2-[4-(4-fluorophenyl)-5-(1H-indazol-5-yl)- 1 H-imidazol-l-yl]ethyl} -N,N dimethylamine; 5-[4-(4-fluorophenyl)-1 -(3-morpholin-4-ylpropyl)- 1 H-imidazol-5-yl] -1 H-indazole; 5 5- [4-(4-fluorophenyl)- 1 -(3-pyrrolidin- 1 -ylpropyl)- 1 H-imidazol-5 -yl] -1 H-indazole; 5- {4-(4-fluorophenyl)- 1-[2-(4-methylpiperidin- 1 -yl)ethyl] -1 H-imidazol-5-yl} -1 H indazole; 5-[1 -(1 -benzylpiperidin-4-yl)-4-(4-fluorophenyl)- 1 H-imidazol-5-yl] -1 H-indazole; 5-[4-(4-fluorophenyl)- 1 -(2-morpholin-4-ylethyl)- 1H-imidazol-5-yl]-l H-indazole; 10 5-[1-(1 -benzylpyrrolidin-3-yl)-4-(4-fluoropheny)- 1 H-imidazol-5-yl]- 1 H-indazole; 2- {4-[4-(4-fluorophenyl)-5-(1H-indazol-5-yl)-1H-imidazol- 1 -yl]piperidin-1 -yl} -2 oxoethanol; 5-(1 -benzyl-5-phenyl- 1H- 1,2,3-triazol-4-yl)- 1 H-indazol-3-amine; 2-[1 -(1 H-indazol-5-yl)-1 H-1,2,3-triazol-4-yl]propan-2-ol; 15 5-[4-(methoxymethyl)- 1H- 1,2,3-triazol- 1-yl] -1 H-indazole; 1-[l -(1 H-indazol-5-yl)-l H-1,2,3-triazol-4-yl]- 1 -phenylethanol; 5-(4-propyl- 1H- 1,2,3-triazol- 1-yl)-l H-indazole; 1-[l -(1 H-indazol-5-yl)-l H-1,2,3-triazol-4-yl]propan-2-ol; 3-[1 -(1 H-indazol-5-yl)-l H-1,2,3-triazol-4-yl]propan- 1 -ol; 20 1- { [1-(1H-indazol-5-yl)-1H-1,2,3-triazol-4-yl]methyl}-1H-1,2,3-benzotriazole; 5- {4-[(phenylthio)methyl]-1H- 1,2,3-triazol-1 -yl} -1 H-indazole; 5-(4-cyclopropyl- 1 H-1,2,3-triazol- l-yl)-1H-indazole; 5-[4-(2-phenylethyl)- 1H-1,2,3-triazol- l-yl] -1 H-indazole; 5-[4-(cyclohexylmethyl)- 1H- 1,2,3-triazol- l-yl] -1 H-indazole; 25 5-(4-cyclopentyl- 1H-1,2,3-triazol- l-yl)-l H-indazole; 1-[1 -(1 H-indazol-5-yl)-l H-1,2,3-triazol-4-yl]cyclohexanol; 5-[4-(phenoxymethyl)- 1 H- 1,2,3-triazol- l-yl]-l H-indazole; 5- {4-[(1,1 -dioxidothiomorpholin-4-yl)methyl]-1H-1,2,3-triazol-1-yl} -1H-indazole; 5-[4-(3-phenylpropyl)- 1 H- 1,2,3-triazol- l-yl]-l H-indazole; 30 [1 -benzyl-4-(iH-indazol-5-yl)- 1 H- 1,2,3-triazol-5-yl](phenyl)methanone; N,N-diethyl-N- { [1 -(1H-indazol-5-yl)-i H- 1,2,3-triazol-4-yl]methyl} amine; ethyl N-[2-(1H-indazol-5-yl)imidazo[1,2-a]pyrimidin-3-yl]-beta-alaninate; 5-(1-benzyl-5-methyl-iH-1,2,3-triazol-4-yl)-1H-indazole; 5-(1-benzyl-5-methyl-iH-1,2,3-triazol-4-yl)-1H-indazol-3-amine; 237 WO 2008/154241 PCT/US2008/065727 N3-[2-(1H-indazol-5-yl)imidazo[ 1,2-a]pyrimidin-3-yl]-j-alaninamide; 5-(1 -benzyl-5-iodo- 1 H- 1,2,3-triazol-4-yl)- 1H-indazol-3-amine; N- {3-[4-(3-amino-i H-indazol-5-yl)-l -benzyl-1H-1,2,3-triazol-5-yl]phenyl} -N'-(3 methylphenyl)urea; 5 5 -(1 H-indazol-5 -yl)-N-(2-isopropoxyethyl)isoxazole-3 -carboxamide; 5- [3 -(morpholin-4-ylcarbonyl)isoxazol-5 -yl] -1 H-indazole; 5 -(1 H-indazol-5 -yl)-N-(3-morpholin-4-ylpropyl)isoxazole-3-carboxamide; N-[2-(1H-imidazol-4-yl)ethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide; (3R)-1- { [5-(1H-indazol-5-yl)isoxazol-3-yl]carbonyl} piperidin-3-ol; 10 1- [5-(1H-indazol-5-yl)isoxazol-3-yl]carbonyl} piperidine-3-carboxamide; 2-[2-(4- { [5-(1 H-indazol-5-yl)isoxazol-3-yl]carbonyl}piperazin- 1 -yl)ethoxy]ethanol; 5- {3-[(4-methyl- 1,4-diazepan- 1 -yl)carbonyl]isoxazol-5-yl} -1H-indazole; N-(3 -hydroxypropyl)-5 -(1 H-indazol-5 -yl)isoxazole-3-carboxamide; N-[(I1R)-2-hydroxy- 1 -phenylethyl]-5-(1 H-indazol-5-yl)isoxazole-3-carboxamide; 15 N-[3-(1H-imidazol- 1 -yl)propyl]-5-(1 H-indazol-5-yl)isoxazole-3-carboxamide; 5-(1 H-indazol-5-yl)-N-[3-(2-oxopyrrolidin- 1 -yl)propyl]isoxazole-3-carboxamide; N- {2-[4-(aminosulfonyl)phenyl]ethyl} -5-(1 H-indazol-5-yl)isoxazole-3-carboxamide; [1 -benzyl-4-(1H-indazol-5-yl)- 1 H- 1,2,3-triazol-5-yl](3-chlorophenyl)methanone; [1 -benzyl-4-(1H-indazol-5-yl)- 1 H- 1,2,3-triazol-5-yl](cyclopropyl)methanone; 20 5-[5-cyclopropyl- 1 -(tetrahydro-2H-pyran-4-ylmethyl)- 1 H- 1,2,3-triazol-4-yl]-1H indazole; N 1 - { [1 -benzyl-4-(1H-indazol-5-yl)- 1H-1,2,3-triazol-5-yl]methyl} glycinamide; (4-fluorophenyl)[4-(1H-indazol-5-yl)-l -(tetrahydro-2H-pyran-4-ylmethyl)-1H- 1,2,3 triazol-5-yl]methanone; 25 (4-chlorophenyl) [4-(1 H-indazol-5 -yl)-l -(tetrahydro-2H-pyran-4-ylmethyl)- 1 H- 1,2,3 triazol-5-yl]methanone; (3 -chlorophenyl) [4-(1 H-indazol-5 -yl)-l -(tetrahydro-2H-pyran-4-ylmethyl)- 1 H- 1,2,3 triazol-5-yl]methanone; (2-chlorophenyl) [4-(1 H-indazol-5 -yl)-l -(tetrahydro-2H-pyran-4-ylmethyl)- 1 H- 1,2,3 30 triazol-5-yl]methanone; cyclopentyl[4-(1H-indazol-5-yl)-l -(tetrahydro-2H-pyran-4-ylmethyl)- 1H- 1,2,3 triazol-5-yl]methanone; 1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazole-5-carboxylic acid; 238 WO 2008/154241 PCT/US2008/065727 5- {5-(4-fluorophenyl)- 1-[4-(trifluoromethyl)benzyl] -1 H-1,2,3-triazol-4-yl} -1 H indazol-3-amine; 5-[1 -benzyl-5-(4-fluorophenyl)- 1 H- 1,2,3-triazol-4-yl] -1 H-indazol-3-amine; [4-(1 H-indazol-5-yl)-l -(tetrahydro-2H-pyran-4-ylmethyl)- 1 H-1,2,3-triazol-5 5 yl](tetrahydro-2H-pyran-4-yl)methanone; 5-[1 -benzyl-5-(2-methylphenyl)- 1 H- 1,2,3-triazol-4-yl]- 1 H-indazole; 5- { 1-benzyl-5-[(4-methylpiperazin-1-yl)carbonyl] -1 H-1,2,3-triazol-4-yl} -1 H indazole; 1- { [1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazol-5-yl]carbonyl)piperidin-4-ol; 10 1 -acetyl-5-[5-(4-fluorophenyl)- 1 -(tetrahydro-2H-pyran-4-ylmethyl)-1H- 1,2,3-triazol 4-yl]-1H-indazole; 1 -benzyl-4-(1H-indazol-5-yl)-N,N-dimethyl- 1 H- 1,2,3-triazole-5-carboxamide; N, 1 -dibenzyl-4-(1 H-indazol-5-yl)-1 H- 1,2,3-triazole-5-carboxamide; N-(2-hydroxy-2-phenylethyl)-5-(1H-indazol-5-yl)-N-methylisoxazole-3-carboxamide; 15 N- [(1S)-2-hydroxy- 1 -phenylethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide; N-benzyl-N-(2-hydroxyethyl)-5 -(1 H-indazol-5 -yl)isoxazole-3 -carboxamide; 5-[1 -benzyl-5-(2-methylphenyl)- 1 H- 1,2,3-triazol-4-yl]-3-methyl-i H-indazole; 5-[l -benzyl-5-(2-methylphenyl)- 1 H- 1,2,3-triazol-4-yl]- 1 H-indazol-3-amine; 2- {2-[1 -(1 H-indazol-5-yl)- 1 H-1,2,3 -triazol-4-yl] ethyl} -1 H-isoindole- 1,3(2H)-dione; 20 5- {4-[(2,4-dichlorophenoxy)methyl]-1H-1,2,3-triazol-1-yl} -1H-indazole; 5- {4-[(2,6-dichlorophenoxy)methyl]-1H-1,2,3-triazol-1-yl} -1H-indazole; 5- [5 -(4-fluorophenyl)- 1 -(tetrahydro-2H-pyran-4-ylmethyl)- 1 H-1,2,3-triazol-4-yl]- 1 H indazole; 1- { [1 -(1 H-indazol-5-yl)-1 H-1,2,3-triazol-4-yl]methyl} -1 H-indazole; 25 5-[1 -benzyl-5-(piperidin-1 -ylcarbonyl)- 1 H-1,2,3-triazol-4-yl]- 1H-indazole; 5- [5 -(2-methylphenyl)- 1 -(tetrahydro-2H-pyran-4-ylmethyl)- 1 H- 1,2,3 -triazol-4-yl] 1H-indazole; 5- [5 -(2-methylphenyl)- 1 -(tetrahydro-2H-pyran-4-ylmethyl)- 1 H- 1,2,3 -triazol-4-yl] 1H-indazol-3-amine; 30 5-[l -benzyl-5-(morpholin-4-ylcarbonyl)- 1 H-1,2,3-triazol-4-yl] -1 H-indazole; 5-[1 -benzyl-5-(4-methoxyphenyl)- 1 H-1,2,3-triazol-4-yl]- 1H-indazol-3-amine; N-[(iS)- 1 -benzyl-2-hydroxyethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide; N-[(iS,2R)-2-hydroxy-2,3-dihydro- 1 H-inden-1 -yl]-5-(l H-indazol-5-yl)isoxazole-3 carboxamide; 239 WO 2008/154241 PCT/US2008/065727 5- {3-[(3-phenylmorpholin-4-yl)carbonyl]isoxazol-5-yl} -1 H-indazole; N-benzyl-5-(l H-indazol-5-yl)isoxazole-3-carboxamide; ((1 S)-2- { [5-(1H-indazol-5-yl)isoxazol-3-yl]carbonyl}-6,7-dimethoxy-1,2,3,4 tetrahydroisoquinolin- 1 -yl)methanol; 5 N- [(I 1R)-3 -hydroxy- 1 -phenylpropyl]-5-(l H-indazol-5-yl)isoxazole-3-carboxamide; N- [(I 1S)-3 -hydroxy- 1 -phenylpropyl]-5 -(1 H-indazol-5 -yl)isoxazole-3 -carboxamide; N-2,3 -dihydro- 1 H-inden- 1-yl-5-(l H-indazol-5-yl)isoxazole-3 -carboxamide; N-2,3 -dihydro- 1 H-inden-2-yl-5-(1 H-indazol-5-yl)isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-(1 -phenylpropyl)isoxazole-3 -carboxamide; 10 5- { 1 -benzyl-5 -[3 -(dimethylamino)phenyl] -1 H- 1,2,3 -triazol-4-yl} -1 H-indazol-3 amine; 5- { 1 -benzyl-5 - [4-(dimethylamino)phenyl] -1 H- 1,2,3 -triazol-4-yl} -1 H-indazol-3 amine; N- {3-[4-(3-amino- 1 H-indazol-5-yl)- 1 -benzyl- 1H- 1,2,3-triazol-5 15 yl]phenyl} acetamide; N- {4-[4-(3-amino- 1 H-indazol-5-yl)- 1 -benzyl- 1H- 1,2,3-triazol-5 yl]phenyl} acetamide; 5- {1 -benzyl-5 -[3 -(1 H-pyrazol- 1 -yl)phenyl]- 1 H- 1,2,3 -triazol-4-yl} -1 H-indazol-3 amine; 20 5-[1 -benzyl-5 -(1-methyl-i H-pyrazol-4-yl)- 1 H- 1,2,3 -triazol-4-yl]- 1 H-indazol-3 amine; 3- [4-(3 -amino-i H-indazol-5 -yl)-l -benzyl- 1 H- 1,2,3 -triazol-5-yl]-N-phenylbenzamide; 3- [4-(3 -amino-i H-indazol-5 -yl)-1 -benzyl- 1 H- 1,2,3 -triazol-5-yl]-N-benzylbenzamide; 5-[1 -benzyl-5 -(1-methyl-i H-indol-5-yl)- 1 H- 1,2,3 -triazol-4-yl]- 1 H-indazol-3 -amine; 25 5-[1 -benzyl-5 -(3-methoxyphenyl)- 1 H-1,2,3-triazol-4-yl]- 1 H-indazol-3 -amine; 5-[1 -benzyl-5 -(3-morpholin-4-ylphenyl)- 1 H- 1,2,3 -triazol-4-yl] -1 H-indazol-3 -amine; 5- [3 -(1,3 -dihydro-2H-isoindol-2-ylcarbonyl)isoxazol-5 -yl]-l H-indazole; 5- {3-[(4-methyl-2-phenylpiperazin- 1 -yl)carbonyl]isoxazol-5 -yl} -1 H-indazole; 1- { [1 -benzyl-4-(1 H-indazol-5 -yl)-l H- 1,2,3 -triazol-5-yl] carbonyl} piperidin-4-amine; 30 N-[5 -(1 -benzyl-5 -phenyl- 1 H-1,2,3-triazol-4-yl)- 1 H-indazol-3-yl]benzamide; N- [5 -(1 -benzyl-5 -phenyl- 1 H-1,2,3-triazol-4-yl)- 1 H-indazol-3-yl]benzenesulfonamide; N- [5 -(1 -benzyl-5 -phenyl- 1 H-1,2,3-triazol-4-yl)- 1 H-indazol-3-yl] -N'-(4 methoxyphenyl)urea; N- [5 -(1 -benzyl-5 -phenyl- 1 H-1,2,3-triazol-4-yl)- 1 H-indazol-3-yl]butanamide; 240 WO 2008/154241 PCT/US2008/065727 N-[5-(1-benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2 methylpropanamide; N-[5-(1-benzyl-5-phenyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3 yl]cyclopropanecarboxamide; 5 N-[1-benzoyl-5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3 yl]benzamide; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-3 fluorobenzamide; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]benzamide; 10 N-benzyl-5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-amine; N-[(1R)-1-benzyl-2-hydroxyethyl]-5-(1H-indazol-5-yl)isoxazole-3-carboxamide; 5-(1-benzyl-1H-pyrazol-4-yl)-1H-indazole; N-[(1R)-3-hydroxy-1-phenylpropyl]-5-(3-methyl-1H-indazol-5-yl)isoxazole-3 carboxamide; 15 3- [4-(3 -amino-i H-indazol-5 -yl)-l -benzyl- 1 H- 1,2,3 -triazol-5-yl]phenol; 3- [4-(3 -amino-i H-indazol-5 -yl)-l -benzyl- 1 H- 1,2,3 -triazol-5-yl]benzamide; 5-{ 1-benzyl-5-[4-(methylsulfonyl)phenyl]-1H-1,2,3-triazol-4-yl} -1H-indazol-3 amine; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]- 2 20 chlorobenzamide; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]- 4 chlorobenzamide; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3 yl]ethanesulfonamide; 25 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3 yl]benzenesulfonamide; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]- 2 chlorobenzenesulfonamide; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-3 30 chlorobenzenesulfonamide; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]- 4 chlorobenzenesulfonamide; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]- 2 ,5 dimethylfuran-3-sulfonamide; 241 WO 2008/154241 PCT/US2008/065727 5-(1 -benzyl-5-cyclopropyl- 1H- 1,2,3-triazol-4-yl)-N-(2-chlorobenzyl)- 1H-indazol-3 amine; 5-(1 -benzyl-5-cyclopropyl- 1H- 1,2,3-triazol-4-yl)-N-(3-chlorobenzyl)- 1H-indazol-3 amine; 5 N-[5-(1 -benzyl-5-cyclopropyl- 1 H- 1,2,3-triazol-4-yl)-1H-indazol-3-yl]-3 chlorobenzamide; N-[5-(1 -benzyl-5-cyclopropyl- 1 H- 1,2,3-triazol-4-yl)-1H-indazol-3-yl]-2-furamide; 5-(1 -benzyl-5-cyclopropyl- 1H- 1,2,3-triazol-4-yl)-N-ethyl- 1H-indazol-3-amine; 5-(1 -benzyl-5-cyclopropyl- 1H- 1,2,3-triazol-4-yl)-N-(4-chlorobenzyl)- 1H-indazol-3 10 amine; 5-(1 -benzyl-5-cyclopropyl- 1H- 1,2,3-triazol-4-yl)-N-(3-furylmethyl)- 1 H-indazol-3 amine; N-[5-(1 -benzyl-5-cyclopropyl- 1 H- 1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-[5-methyl 2-(trifluoromethyl)-3-furyl]urea; 15 N-[5-(1 -benzyl-5-cyclopropyl- 1 H- 1,2,3-triazol-4-yl)-1H-indazol-3-yl]-3-furamide; 5-(1 H-indazol-5-yl)-N-[(1 S)- 1 -phenylpropyl]isoxazole-3-carboxamide; 5-(1 H-indazol-5-yl)-N-[(1 R)- 1 -phenylpropyl]isoxazole-3-carboxamide; 5-(1 -benzyl- 1H-pyrazol-4-yl)- 1H-indazol-3-amine; 1 -benzyl-4-(1H-indazol-5-yl)-N-[(2S)-tetrahydrofuran-2-ylmethyl] -1 H- 1,2,3-triazole 20 5-carboxamide; 1 -benzyl-4-(1H-indazol-5-yl)-N-(2-isopropoxyethyl)- 1 H-1,2,3-triazole-5 carboxamide; 1 -benzyl-4-(1H-indazol-5-yl)-N-[(2R)-tetrahydrofuran-2-ylmethyl]- 1 H- 1,2,3-triazole 5-carboxamide; 25 1 -benzyl-4-(1H-indazol-5-yl)-N-(tetrahydrofuran-3-ylmethyl)- 1 H-1,2,3-triazole-5 carboxamide; 1 -benzyl-N-cyclopentyl-4-(1 H-indazol-5-yl)-l H- 1,2,3-triazole-5-carboxamide; 1 -benzyl-N-(cyclopentylmethyl)-4-(1H-indazol-5-yl)- 1 H- 1,2,3-triazole-5 carboxamide; 30 1 -benzyl-N-ethyl-4-(l H-indazol-5-yl)-N-methyl- 1 H- 1,2,3-triazole-5-carboxamide; 1 -benzyl-4-(1H-indazol-5-yl)-N-isopropyl-N-methyl- 1 H-1,2,3-triazole-5 carboxamide; 1 -benzyl-4-(1H-indazol-5-yl)-N-(2-methoxyethyl)-N-methyl- 1 H-1,2,3-triazole-5 carboxamide; 242 WO 2008/154241 PCT/US2008/065727 1 -benzyl-4-(1H-indazol-5-yl)-N-phenyl- 1 H-1,2,3-triazole-5-carboxamide; 1 -benzyl-N-(4-chlorophenyl)-4-(1 H-indazol-5-yl)-1 H-1,2,3-triazole-5-carboxamide; 1 -benzyl-4-(1H-indazol-5-yl)-N-(2-morpholin-4-ylethyl)- 1 H-1,2,3-triazole-5 carboxamide; 5 1 -benzyl-N-[2-(dimethylamino)ethyl]-4-(1H-indazol-5-yl)-N-methyl- 1 H- 1,2,3 triazole-5-carboxamide; 1 -benzyl-N-(2-hydroxyethyl)-4-(l H-indazol-5-yl)-N-propyl- 1 H- 1,2,3-triazole-5 carboxamide; 1 -benzyl-N-[3-(dimethylamino)propyl]-4-(l H-indazol-5-yl)-N-methyl-1H- 1,2,3 10 triazole-5-carboxamide; 1 -benzyl-N-[2-(diethylamino)ethyl]-4-(1 H-indazol-5-yl)-N-methyl- 1 H-1,2,3-triazole 5-carboxamide; N, 1 -dibenzyl-N-ethyl-4-(1H-indazol-5-yl)- 1 H- 1,2,3-triazole-5-carboxamide; N, 1 -dibenzyl-N-(2-hydroxyethyl)-4-(1H-indazol-5-yl)-1 H- 1,2,3-triazole-5 15 carboxamide; (3R)- 1- { [1 -benzyl-4-(l H-indazol-5-yl)-1 H- 1,2,3-triazol-5-yl]carbonyl}piperidin-3-ol; 1- { [1-benzyl-4-(1H-indazol-5-yl)-1H-1,2,3-triazol-5-yl]carbonyl} piperidine-4 carboxamide; 5- { 1-benzyl-5-[(2,6-dimethylmorpholin-4-yl)carbonyl] -1 H-1,2,3-triazol-4-yl} -1 H 20 indazole; 5- {5-[(4-acetylpiperazin-1-yl)carbonyl]- 1 -benzyl- 1 H- 1,2,3-triazol-4-yl} -1 H-indazole; 5-{ 1-benzyl-5-[(4-phenylpiperazin-1-yl)carbonyl]- 1 H-1,2,3-triazol-4-yl} -1 H indazole; 1 -benzyl-N-[(1 R)- 1 -(hydroxymethyl)-2-methylpropyl]-4-(1H-indazol-5-yl)-1H- 1,2,3 25 triazole-5-carboxamide; 1 -benzyl-N-[(1 S)- 1 -(hydroxymethyl)-2-methylpropyl]-4-(1H-indazol-5-yl)- 1 H- 1,2,3 triazole-5-carboxamide; 1 -benzyl-N-[3-(l H-imidazol-1 -yl)propyl]-4-(1H-indazol-5-yl)-1 H- 1,2,3-triazole-5 carboxamide; 30 N-[5-(1 -benzyl-5-cyclopropyl- 1 H- 1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-ethylurea; N-[5-(1 -benzyl-5-cyclopropyl- 1 H- 1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-phenylurea; N-benzyl-N'-[5-(1 -benzyl-5-cyclopropyl-1H- 1,2,3-triazol-4-yl)- 1 H-indazol-3-yl]urea; N-[5-(1 -benzyl-5-cyclopropyl- 1 H- 1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-(2 chlorophenyl)urea; 243 WO 2008/154241 PCT/US2008/065727 N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-(3 chlorophenyl)urea; N-[5-(1-benzyl-5-cyclopropyl-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]-N'-(4 chlorophenyl)urea; 5 N-[5-(1-benzyl-5-iodo-1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]benzamide; 3- [4-(3 -amino-i H-indazol-5 -yl)-i H-pyrazol- 1 -yl]propanenitrile; 2- [4-(3 -amino-i H-indazol-5 -yl)-i H-pyrazol- 1-yl] acetamide; methyl 3- [4-(3-amino- 1 H-indazol-5 -yl)-l H-pyrazol- 1 -yl]propanoate; 3- [4-(3 -amino-i H-indazol-5 -yl)-l H-pyrazol- 1 -yl]propanamide; 10 [4-(3 -amino-i H-indazol-5 -yl)-1 H-pyrazol- l-yl] acetonitrile; 4-(3 -amino-i H-indazol-5-yl)-N,N-dimethyl- 1 H-imidazole- 1-sulfonamide; 5-pyrazin-2-yl-1H-indazol-3-amine; 5-thien-2-yl-1H-indazol-3-amine; 5-(2-aminopyrimidin-4-yl)-1H-indazol-3-amine; 15 5-(2-methoxypyridin-3-yl)-1H-indazol-3-amine; 5-imidazo[1,2-a]pyridin-3-yl-1H-indazol-3-amine; N 2 ,N 2 -dimethyl-N-[5-(1H-1,2,3-triazol-4-yl)-1H-indazol-3-yl]glycinamide; 5-(1H-pyrazol-5-yl)-1H-indazol-3-amine; 5-(4-methyl-iH-imidazol-5-yl)-1H-indazol-3-amine; 20 5-(1H-imidazol-4-yl)-1H-indazol-3-amine; N 2 ,N 2 -dimethyl-N-{5-[1-(3-methylbenzyl)-1H-1,2,3-triazol-4-yl]-1H-indazol-3 yl} glycinamide; 5 -(1 -benzyl- 1 H-imidazol-4-yl)- 1 H-indazol-3 -amine; N 1 - {5 -[1-(4-tert-butylbenzyl)- 1 H- 1,2,3 -triazol-4-yl] - I H-indazol-3 -yl} -N 2 ,N 2 _ 25 dimethylglycinamide; N 2 ,N 2 -dimethyl-N -{5-[1-(2-piperidin- I -ylethyl)- 1 H-1,2,3-triazol-4-yl]- 1 H-indazol-3 yl} glycinamide; N 2 ,N 2 -dimethyl-N - {5-[ 1-(2-morpholin-4-ylethyl)- 1 H-1,2,3 -triazol-4-yl] -1 H-indazol 3-yl}glycinamide; 30 N -(5- { 1- [2-(3,5-dimethylisoxazol-4-yl)ethyl] -1 H-1,2,3 -triazol-4-yl} -1 H-indazol-3 yl)-N 2 ,N 2 -dimethylglycinamide; N -(5-{1- [2-(3,5-dimethyl- 1 H-pyrazol-4-yl)ethyl]- I H-1,2,3 -triazol-4-yl} - H-indazol 3-yl)-N 2 ,N 2 -dimethylglycinamide; 2-(4- {3-[(N,N-dimethylglycyl)amino] - I H-indazol-5 -yl} -1 H- 1,2,3 -triazol- 1 -yl)- 2 244 WO 2008/154241 PCT/US2008/065727 methyipropanoic acid; ethyl (4- {3 -[N,N-dimethylglycyl)amino]- 1H-indazol-5 -yl} -1H-i ,2,3-triazol- 1 yl)acetate; N 2 ,N 2 -dimethyl-N 1 -(5- {1- [(trimethylsilyl)methyl] -1H-i ,2,3-triazol-4-yl} -1H-indazol 5 3-yl)glycinamide; Nl-15-(3-furyl)- 1H-indazol-3 -yl]-N 2N 2 -dimethylglycinamide; N 2 ,N 2 -dimethyl-N 1 -[5 -(1 H-pyrazol-5 -yl)-l H-indazol-3 -yl]glycinamide; N 2 ,N 2 -dimethyl-N 1 -(5 -pyrimidin-5 -yl-l H-indazol-3 -yl)glycinamide; Nl-115-(2, 1,3 -benzoxadiazol-5-yl)- 1H-indazol-3 -yl] -N 2N 2 -dimethylglycinamide; 10 N 2 ,N 2 -dimethyl-N 1 -[5 -(1 H-pyrazol-4-yl)- 1H-indazol-3 -yl]glycinamide; N 2 ,N 2 -dimethyl-N 1 -[5 -(1-methyl-i H-pyrazol-4-yl)- 1H-indazol-3 -yl]glycinamide; Nl-115-(3 ,5 -dimethyl- 1H-pyrazol-4-yl)- 1H-indazol-3 -yl] -N 2N 2 -dimethylglycinamide; N 1 - {5 -[2-(dimethylamino)pyrimidin-5-yl] -1H-indazol-3 -yl}_N ,N 2 _ dimethyiglycinamide; 15 N 2 ,N 2 -dimethyl-N 1 -[5 -(2-morpholin-4-ylpyrimidin-5 -yl)- 1H-indazol-3 yl] glycinamide; N 2 ,N 2 -dimethyl-N - {5- [1-(2-morpholin-4-ylethyl)- 1H-pyrazol-4-yl]- 1H-indazol-3 yl} glycinamide; N-15-(1 -benzyl-5 -cyclopropyl- 1H-i ,2,3-triazol-4-yl)- 1H-indazol-3-yl] -N 2 ,N 20 dimethyiglycinamide; Nl-115-(1 -benzyl- 1H-pyrazol-4-yl)- 1H-indazol-3 -yl]-N 2N 2 -dimethylglycinamide; N-15-(1 -benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-N 2 -methylglycinamide; N-[rs-(1 -benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-2-pyrrolidin- 1-ylacetamide; Nl-115-(1 -benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-N 2 -cyclopentylglycinamide; 25 Nl-[5-(1 -benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-N 2 -cyclopropylglycinamide; Nl-r5-(1 -benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-N 2 -tetrahydro-2H-pyran-4 ylglycinamide; N- [5 -(1-benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-2-(3-hydroxypyrrolidin- 1 yl)acetamide; 30 N- [5 -(1-benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-2-(3-hydroxypiperidin- 1 yl)acetamide; Nl-115-(1 -benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-N 3 ,N 3 -dimethyl-beta alaninamide; N- [5 -(1-benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-2-morpholin-4-ylacetamide; 245 WO 2008/154241 PCT/US2008/065727 N- [5 -(1-benzyl- 1H-i ,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-2-(4-methylpiperazin- 1 yl)acetamide; N- [5 -(1-benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-2-(3-oxopiperazin- 1 yl)acetamide; 5 N 1 -[5-(1 -benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-N 2 -isopropylglycinamide; N 1 -[5-(1 -benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-N 2 -cyclohexylglycinamide; N- [5 -(1-benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]acetamide; N 1 -115-(1 -benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-N 2 -cyclobutylglycinamide; N- [5-(1 -benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-N'-propylurea; 10 N-[5 -(1 -benzyl- 1H-i ,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]ethanesulfonamide; 5 -(1 -benzyl- 1H-i ,2,3-triazol-4-yl)-N-(cyclopropylmethyl)- 1H-indazol-3-amine; N- [5 -(1-benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-N'-ethylurea; 1- [5 -(1-benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3-yl]pyrrolidin-2-one; N- [5 -(1-benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-4 15 (dimethylamino)butanamide; N-3 ,4-dihydro- 1H-isochromen-4-yl-5 -(1 H-indazol-5 -yl)isoxazole-3 -carboxamide; N-(cyclohexylmethyl)-5 -(1 H-indazol-5 -yl)isoxazole-3-carboxamide; N-(3 -chlorobenzyl)-5-( 1H-indazol-5-yl)isoxazole-3-carboxamide; 5 -(1 H-indazol-5 -yl)-N-(2-methoxybenzyl)isoxazole-3 -carboxamide; 20 5 -(1 H-indazol-5 -yl)-N-[2-(trifluoromethyl)benzyllsoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-[3-(trifluoromethyl)benzyl]isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-[4-(trifluoromethyl)benzyl]isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-(pyridin-2-ylmethyl)isoxazole-3-carboxamide; 5 -(1 H-indazol-5 -yl)-N-(pyridin-3-ylmethyl)isoxazole-3-carboxamide; 25 5 -(1 H-indazol-5 -yl)-N-(pyridin-4-ylmethyl)isoxazole-3-carboxamide; N-(2-chlorobenzyl)-5-( 1H-indazol-5-yl)isoxazole-3-carboxamide; N-(4-chlorobenzyl)-5-( 1H-indazol-5-yl)isoxazole-3-carboxamide; 5 -(1 H-indazol-5 -yl)-N-( 1-phenyl-2-piperidin- 1-ylethyl)isoxazole-3 -carboxamide; N- [2-( 1H-imidazol- l-yl)-l -phenylethyl]-5 -(1 H-indazol-5 -yl)isoxazole-3 30 carboxamide; 5 -(1 H-indazol-5 -yl)-N-(2-morpholin-4-yl-l1-phenylethyl)isoxazole-3-carboxamide; 5 -(1 H-indazol-5 -yl)-N-[2-(4-methylpiperazin- l-yl)-l -phenylethyl]isoxazole-3 carboxamide; 5 -(1 H-indazol-5 -yl)-N-( 1-phenyl-2-pyrrolidin- 1-ylethyl)isoxazole-3 -carboxamide; 246 WO 2008/154241 PCT/US2008/065727 tert-butyl 2-( {[5 -(1H-indazol-5 -yl)isoxazol-3 -yl]carbonyl} amino)-2 phenylethylcarbamate; 5 -(1 H-indazol-5 -yl)-N-( 1-naphthylmethyl)isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-(2-phenylethyl)isoxazole-3-carboxamide; 5 5 -(1 H-indazol-5 -yl)-N-(2-pyridin-2-ylethyl)isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-(2-pyridin-3-ylethyl)isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-(2-pyridin-4-ylethyl)isoxazole-3 -carboxamide; N- [2-(2-chlorophenyl)ethyl] -5-( 1H-indazol-5-yl)isoxazole-3-carboxamide; N- [2-(3-chlorophenyl)ethyl] -5-( 1H-indazol-5-yl)isoxazole-3-carboxamide; 10 N- [2-(4-chlorophenyl)ethyl] -5-( 1H-indazol-5-yl)isoxazole-3-carboxamide; N-benzyl-N-ethyl-5 -(1 H-indazol-5 -yl)isoxazole-3 -earboxamide; 5 -(1 H-indazol-5 -yl)-N-methyl-N-( 1-naphthylmethyl)isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-methyl-N-(2-phenylethyl)isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-methyl-N-(2-pyridin-2-ylethyl)isoxazole-3 -earboxamide; 15 5 -(1 H-indazol-5 -yl)-N-[( 1R)- 1-phenylethyl]isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N- 1,2,3 ,4-tetrahydronaphthalen- 1-ylisoxazole-3-carboxamide; 5 -(1 H-indazol-5 -yl)-N-[( 1S)- 1-(1 -naphthyl)ethyl]isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-[( 1R)- 1-(1 -naphthyl)ethyl]isoxazole-3-carboxamide; N- [3-(dimethylamino)-l1-phenylpropyl]-5-( 1H-indazol-5-yl)isoxazole-3-carboxamide; 20 N-(2,3-dihydro- 1,4-benzodioxin-5-ylmethyl)-5 -(1 H-indazol-5 -yl)isoxazole-3 carboxamide; N-(3 ,4-dihydro-2H- 1,5 -benzodioxepin-6-ylmethyl)-5 -(1 H-indazol-5 -yl)isoxazole-3 carboxamide; 5 -(1 H-indazol-5 -yl)-N-[( 1-methyl-i H-indol-4-yl)methyl]isoxazole-3 -carboxamide; 25 5- {3-[(3 -phenylpyrrolidin- 1-yl)carbonyl]isoxazol-5-yl} -1H-indazole; 5- {3-[(2-phenylpyrrolidin- 1-yl)carbonyl]isoxazol-5-yl} -1H-indazole; 5- {3-[(2-phenylpiperidin- 1-yl)carbonyl]isoxazol-5-yl} -1H-indazole; 5 -(1 H-indazol-5 -yl)-N-[( 1S)-l1-phenylethyl]isoxazole-3-carboxamide; 5 -(1 H-indazol-5 -yl)-N-[( 1R)- 1-(4-methylphenyl)ethyl]isoxazole-3-carboxamide; 30 5 -(1 H-indazol-5 -yl)-N-[( 1S)- 1-(4-methylphenyl)ethyl]isoxazole-3 -carboxamide; N- [(1R,2S)-2-hydroxy-2 ,3-dihydro- 1H-inden- l-yl]-S -(1 H-indazol-5 -yl)isoxazole-3 carboxamide; N- [(1R,2R)-2-hydroxy-2,3 -dihydro- 1H-inden- l-yl]-5-(l H-indazol-5-yl)isoxazole-3 carboxamide; 247 WO 2008/154241 PCT/US2008/065727 N- [(1R)- 1-(4-bromophenyl)ethyl] -5 -(1H-indazol-5 -yl)isoxazole-3 -carboxamide; N- [(1S)- 1-(4-bromophenyl)ethyl]-5 -(1 H-indazol-5 -yl)isoxazole-3 -carboxamide; N- [(1R)- 1-(4-chlorophenyl)ethyl] -5 -(1H-indazol-5 -yl)isoxazole-3 -carboxamide; N- [(1S)- 1-(4-chlorophenyl)ethyl]-5-( 1H-indazol-5-yl)isoxazole-3-carboxamide; 5 5 -(1 H-indazol-5 -yl)-N-[( 1 S)- 1-(2-naphthyl)ethyl]isoxazole-3 -carboxamide; N-[1 -(4-ethoxyphenyl)-2-hydroxyethyl] -5 -(1H-indazol-5 -yl)isoxazole-3 carboxamide; N- [2-hydroxy-l1-(4-isopropylphenyl)ethyl]-5 -(1 H-indazol-5 -yl)isoxazole-3 carboxamide; 10 N-[l -(3 ,4-dimethylphenyl)-2-hydroxyethyl]-5 -(1 H-indazol-5 -yl)isoxazole-3 carboxamide; N- [2-hydroxy- 1-(2-methoxyphenyl)ethyl] -5-( 1H-indazol-5 -yl)isoxazole-3 carboxamide; N- [2-hydroxy-l1-(4-methylphenyl)ethyl]-5 -(1 H-indazol-5 -yl)isoxazole-3 15 carboxamide; 5 -(1 H-indazol-5 -yl)-N-[( 1R)- 1-(2-methoxyphenyl)ethyl]isoxazole-3 -carboxamide; N- [(1S)- 1-(3 ,4-difluorophenyl)ethyl]-5 -(1 H-indazol-5 -yl)isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N-[( 1R)- 1-(3 -methoxyphenyl)ethyl]isoxazole-3 -carboxamide; 5 -(1 H-indazol-5 -yl)-N- {(I1R)- 1-[3 -(trifluoromethyl)phenyl]ethyl} isoxazole-3 20 carboxamide; N-[l -(2 ,3-dihydro- 1,4-benzodioxin-6-yl)ethyl] -5 -(1H-indazol-5 -yl)isoxazole-3 carboxamide; N-ri -(3 ,5-dichlorophenyl)-2-hydroxyethyl]-5-( 1H-indazol-5-yl)isoxazole-3 carboxamide; 25 tert-butyl 5 -(1 -benzyl- 1H- 1 ,2,3-triazol-4-yl)-3-[( { [6-(trifluoromethyl)pyridin-2 yl] amino} carbonyl)amino]- TH-indazole- 1 -carboxylate; 5 -(1 -benzyl- 1H- 1,2,3 -triazol-4-yl)- 1 - [(1 -methylpiperidin-2-yl)carbonyl] - 1H-indazol 3-amine; 5 -(1 -benzyl- 1H- 1 ,2,3-triazol-4-yl)- 1 -[(dimethylamino)acetyl]- 1H-indazol-3 -amine; 30 tert-butyl 3 -amino-5-( 1-benzyl- 1H- 1,2,3-triazol-4-yl)- 1H-indazole- 1-carboxylate; N- [5 -(1-benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-2-piperidin- 1-ylacetamide; N-[5-( 1-benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-2-morpholin-4-ylacetamide; or N-[5-( 1-benzyl- 1H- 1,2,3 -triazol-4-yl)- 1H-indazol-3 -yl]-l -methylpiperidine-2 248 WO 2008/154241 PCT/US2008/065727 carboxamide.

25. A pharmaceutical composition comprising a therapeutically effective amount of a compound of formula (I) according to claim 1, in combination with a pharmaceutically 5 suitable carrier.

26. A method of inhibiting Glycogen Synthase kinase 3 (GSK-3), Rho kinase (ROCK), Janus Kinases (JAK), AKT, PAK4, PLK, CK2, KDR, MK2, JNK1, aurora, pim 1 and nek 2 comprising administering a therapeutically effective amount of a compound of Formula (I) 10 according to claim 1.

27. A method of inhibiting GSK-3 kinase comprising administering a therapeutically effective amount of a compound of Formula (I), according to claim 4, wherein the the inhibition of GSK-3 kinase is useful for the treatment or prevention of diseases or disorders 15 regulated by GSK-3 kinase in a human in need thereof.

28. The method according to Claim 27, wherein the inhibition of GSK-3 kinase is useful for stimulation of neuroregeneration and the treatment and prevention of neurodegenerative diseases, inflammatory and demyelinating diseases, Alzheimer's disease, stroke, multiple 20 sclerosis, cognitive and attention deficits associated with Alzheimer's disease, acute and chronic neurodegenerative diseases, dementia, acute stroke and other traumatic injuries, cerebrovascular accidents, brain and spinal cord trauma, peripheral neuropathies, retinopathies and glaucoma. 25

29. The method accord to Claim 28, wherein the acute and chronic neurodegenerative diseases are Parkinson's disease and tauopathies.

30. The method according to Claim 29, wherein the tautopathies are frontotemporoparietal dementia, corticobasal degeneration, Pick's disease, and progressive supranuclear palsy. 30

31. The method according to Claim 28, wherein the dementia is vascular dementia.

32. The method according to Claim 28, wherein the cerebrovascular accident is age related macular degeneration. 249 WO 2008/154241 PCT/US2008/065727

33. The method according to Claim 27, wherein the inhibition of GSK-3 kinase is useful for the treatment non-insulin dependent diabetes and obesity, manic depressive illness, schizophrenia, alopecia, cancer, osteoarthritis, rheumatoid arthritis, and osteoporosis. 5

34. The method according to Claim 33, wherein the cancer is breast cancer, non-small cell lung carcinoma, thyroid cancer, T or B-cell leukemia, and virus-induced tumors.

35. A method of inhibiting GSK-3 kinase comprising administering a therapeutically 10 effective amount of a compound of Formula (I), according to claim 8, wherein the inhibition of GSK-3 kinase is useful for the treatment or prevention of diseases or disorders regulated by GSK-3 kinase in a human in need thereof

36. The method according to Claim 35, wherein the inhibition of GSK-3 kinase is useful for 15 stimulation of neuroregeneration and the treatment and prevention of neurodegenerative diseases, inflammatory and demyelinating diseases, Alzheimer's disease, stroke, multiple sclerosis, cognitive and attention deficits associated with Alzheimer's disease, acute and chronic neurodegenerative diseases, dementia, acute stroke and other traumatic injuries, cerebrovascular accidents, brain and spinal cord trauma, peripheral neuropathies, 20 retinopathies and glaucoma.

37. The method accord to Claim 36, wherein the acute and chronic neurodegenerative diseases are Parkinson's disease and tauopathies. 25

38. The method according to Claim 37, wherein the tautopathies are frontotemporoparietal dementia, corticobasal degeneration, Pick's disease, and progressive supranuclear palsy.

39. The method according to Claim 36, wherein the dementia is vascular dementia. 30

40. The method according to Claim 36, wherein the cerebrovascular accident is age related macular degeneration.

41. The method according to Claim 35, wherein the inhibition of GSK-3 kinase is useful for the treatment non-insulin dependent diabetes and obesity, manic depressive illness, 250 WO 2008/154241 PCT/US2008/065727 schizophrenia, alopecia, cancer, osteoarthritis, rheumatoid arthritis, and osteoporosis.

42. The method according to Claim 41, wherein the cancer is breast cancer, non-small cell lung carcinoma, thyroid cancer, T or B-cell leukemia, and virus-induced tumors. 5

43. A method of inhibiting GSK-3 kinase comprising administering a therapeutically effective amount of a compound of Formula (I), according to claim 9, wherein the the inhibition of GSK-3 kinase is useful for the treatment or prevention of diseases or disorders regulated by GSK-3 kinase in a human in need thereof. 10

44. The method according to Claim 43, wherein the inhibition of GSK-3 kinase is useful for stimulation of neuroregeneration and the treatment and prevention of neurodegenerative diseases, inflammatory and demyelinating diseases, Alzheimer's disease, stroke, multiple sclerosis, cognitive and attention deficits associated with Alzheimer's disease, acute and 15 chronic neurodegenerative diseases, dementia, acute stroke and other traumatic injuries, cerebrovascular accidents, brain and spinal cord trauma, peripheral neuropathies, retinopathies and glaucoma.

45. The method accord to Claim 44, wherein the acute and chronic neurodegenerative 20 diseases are Parkinson's disease and tauopathies.

46. The method according to Claim 45, wherein the tautopathies are frontotemporoparietal dementia, corticobasal degeneration, Pick's disease, and progressive supranuclear palsy. 25

47. The method according to Claim 44, wherein the dementia is vascular dementia.

48. The method according to Claim 44, wherein the cerebrovascular accident is age related macular degeneration. 30

49. The method according to Claim 43, wherein the inhibition of GSK-3 kinase is useful for the treatment non-insulin dependent diabetes and obesity, manic depressive illness, schizophrenia, alopecia, cancer, osteoarthritis, rheumatoid arthritis, and osteoporosis.

50. The method according to Claim 49, wherein the cancer is breast cancer, non-small cell 251 WO 2008/154241 PCT/US2008/065727 lung carcinoma, thyroid cancer, T or B-cell leukemia, and virus-induced tumors.

51. A method of inhibiting GSK-3 kinase comprising administering a therapeutically effective amount of a compound of Formula (I), according to claim 11, wherein the the 5 inhibition of GSK-3 kinase is useful for the treatment or prevention of diseases or disorders regulated by GSK-3 kinase in a human in need thereof.

52. The method according to Claim 51, wherein the inhibition of GSK-3 kinase is useful for stimulation of neuroregeneration and the treatment and prevention of neurodegenerative 10 diseases, inflammatory and demyelinating diseases, Alzheimer's disease, stroke, multiple sclerosis, cognitive and attention deficits associated with Alzheimer's disease, acute and chronic neurodegenerative diseases, dementia, acute stroke and other traumatic injuries, cerebrovascular accidents, brain and spinal cord trauma, peripheral neuropathies, retinopathies and glaucoma. 15

53. The method accord to Claim 52, wherein the acute and chronic neurodegenerative diseases are Parkinson's disease and tauopathies.

54. The method according to Claim 53, wherein the tautopathies are frontotemporoparietal 20 dementia, corticobasal degeneration, Pick's disease, and progressive supranuclear palsy.

55. The method according to Claim 52, wherein the dementia is vascular dementia.

56. The method according to Claim 52, wherein the cerebrovascular accident is age related 25 macular degeneration.

57. The method according to Claim 51, wherein the inhibition of GSK-3 kinase is useful for the treatment non-insulin dependent diabetes and obesity, manic depressive illness, schizophrenia, alopecia, cancer, osteoarthritis, rheumatoid arthritis, and osteoporosis. 30

58. The method according to Claim 57, wherein the cancer is breast cancer, non-small cell lung carcinoma, thyroid cancer, T or B-cell leukemia, and virus-induced tumors.

59. A method of inhibiting GSK-3 kinase comprising administering a therapeutically 252 WO 2008/154241 PCT/US2008/065727 effective amount of a compound of Formula (I), according to claim 14, wherein the the inhibition of GSK-3 kinase is useful for the treatment or prevention of diseases or disorders regulated by GSK-3 kinase in a human in need thereof. 5

60. The method according to Claim 59, wherein the inhibition of GSK-3 kinase is useful for stimulation of neuroregeneration and the treatment and prevention of neurodegenerative diseases, inflammatory and demyelinating diseases, Alzheimer's disease, stroke, multiple sclerosis, cognitive and attention deficits associated with Alzheimer's disease, acute and chronic neurodegenerative diseases, dementia, acute stroke and other traumatic injuries, 10 cerebrovascular accidents, brain and spinal cord trauma, peripheral neuropathies, retinopathies and glaucoma.

61. The method accord to Claim 60, wherein the acute and chronic neurodegenerative diseases are Parkinson's disease and tauopathies. 15

62. The method according to Claim 61, wherein the tautopathies are frontotemporoparietal dementia, corticobasal degeneration, Pick's disease, and progressive supranuclear palsy.

63. The method according to Claim 60, wherein the dementia is vascular dementia. 20

64. The method according to Claim 60, wherein the cerebrovascular accident is age related macular degeneration.

65. The method according to Claim 59, wherein the inhibition of GSK-3 kinase is useful for 25 the treatment non-insulin dependent diabetes and obesity, manic depressive illness, schizophrenia, alopecia, cancer, osteoarthritis, rheumatoid arthritis, and osteoporosis.

66. The method according to Claim 65, wherein the cancer is breast cancer, non-small cell lung carcinoma, thyroid cancer, T or B-cell leukemia, and virus-induced tumors. 30

67. A method of inhibiting GSK-3 kinase comprising administering a therapeutically effective amount of a compound of Formula (I), according to claim 15, wherein the the inhibition of GSK-3 kinase is useful for the treatment or prevention of diseases or disorders regulated by GSK-3 kinase in a human in need thereof. 253 WO 2008/154241 PCT/US2008/065727

68. The method according to Claim 67, wherein the inhibition of GSK-3 kinase is useful for stimulation of neuroregeneration and the treatment and prevention of neurodegenerative diseases, inflammatory and demyelinating diseases, Alzheimer's disease, stroke, multiple 5 sclerosis, cognitive and attention deficits associated with Alzheimer's disease, acute and chronic neurodegenerative diseases, dementia, acute stroke and other traumatic injuries, cerebrovascular accidents, brain and spinal cord trauma, peripheral neuropathies, retinopathies and glaucoma. 10

69. The method accord to Claim 68, wherein the acute and chronic neurodegenerative diseases are Parkinson's disease and tauopathies.

70. The method according to Claim 69, wherein the tautopathies are frontotemporoparietal dementia, corticobasal degeneration, Pick's disease, and progressive supranuclear palsy. 15

71. The method according to Claim 68, wherein the dementia is vascular dementia.

72. The method according to Claim 68, wherein the cerebrovascular accident is age related macular degeneration. 20

73. The method according to Claim 67, wherein the inhibition of GSK-3 kinase is useful for the treatment non-insulin dependent diabetes and obesity, manic depressive illness, schizophrenia, alopecia, cancer, osteoarthritis, rheumatoid arthritis, and osteoporosis. 25

74. The method according to Claim 73, wherein the cancer is breast cancer, non-small cell lung carcinoma, thyroid cancer, T or B-cell leukemia, and virus-induced tumors.

75. A method of inhibiting GSK-3 kinase comprising administering a therapeutically effective amount of a compound of Formula (I), according to claim 16, wherein the the 30 inhibition of GSK-3 kinase is useful for the treatment or prevention of diseases or disorders regulated by GSK-3 kinase in a human in need thereof.

76. The method according to Claim 75, wherein the inhibition of GSK-3 kinase is useful for stimulation of neuroregeneration and the treatment and prevention of neurodegenerative 254 WO 2008/154241 PCT/US2008/065727 diseases, inflammatory and demyelinating diseases, Alzheimer's disease, stroke, multiple sclerosis, cognitive and attention deficits associated with Alzheimer's disease, acute and chronic neurodegenerative diseases, dementia, acute stroke and other traumatic injuries, cerebrovascular accidents, brain and spinal cord trauma, peripheral neuropathies, 5 retinopathies and glaucoma.

77. The method accord to Claim 76, wherein the acute and chronic neurodegenerative diseases are Parkinson's disease and tauopathies. 10

78. The method according to Claim 77, wherein the tautopathies are frontotemporoparietal dementia, corticobasal degeneration, Pick's disease, and progressive supranuclear palsy.

79. The method according to Claim 76, wherein the dementia is vascular dementia. 15

80. The method according to Claim 76, wherein the cerebrovascular accident is age related macular degeneration.

81. The method according to Claim 75, wherein the inhibition of GSK-3 kinase is useful for the treatment non-insulin dependent diabetes and obesity, manic depressive illness, 20 schizophrenia, alopecia, cancer, osteoarthritis, rheumatoid arthritis, and osteoporosis.

82. The method according to Claim 81, wherein the cancer is breast cancer, non-small cell lung carcinoma, thyroid cancer, T or B-cell leukemia, and virus-induced tumors. 25

83. A method of inhibiting GSK-3 kinase comprising administering a therapeutically effective amount of a compound of Formula (I), according to claim 17, wherein the the inhibition of GSK-3 kinase is useful for the treatment or prevention of diseases or disorders regulated by GSK-3 kinase in a human in need thereof. 30

84. The method according to Claim 83, wherein the inhibition of GSK-3 kinase is useful for stimulation of neuroregeneration and the treatment and prevention of neurodegenerative diseases, inflammatory and demyelinating diseases, Alzheimer's disease, stroke, multiple sclerosis, cognitive and attention deficits associated with Alzheimer's disease, acute and chronic neurodegenerative diseases, dementia, acute stroke and other traumatic injuries, 255 WO 2008/154241 PCT/US2008/065727 cerebrovascular accidents, brain and spinal cord trauma, peripheral neuropathies, retinopathies and glaucoma.

85. The method accord to Claim 84, wherein the acute and chronic neurodegenerative 5 diseases are Parkinson's disease and tauopathies.

86. The method according to Claim 85, wherein the tautopathies are frontotemporoparietal dementia, corticobasal degeneration, Pick's disease, and progressive supranuclear palsy. 10

87. The method according to Claim 84, wherein the dementia is vascular dementia.

88. The method according to Claim 84, wherein the cerebrovascular accident is age related macular degeneration. 15

89. The method according to Claim 83, wherein the inhibition of GSK-3 kinase is useful for the treatment non-insulin dependent diabetes and obesity, manic depressive illness, schizophrenia, alopecia, cancer, osteoarthritis, rheumatoid arthritis, and osteoporosis.

90. The method according to Claim 89, wherein the cancer is breast cancer, non-small cell 20 lung carcinoma, thyroid cancer, T or B-cell leukemia, and virus-induced tumors.

91. A method of inhibiting GSK-3 kinase comprising administering a therapeutically effective amount of a compound of Formula (I), according to claim 18, wherein the the inhibition of GSK-3 kinase is useful for the treatment or prevention of diseases or disorders 25 regulated by GSK-3 kinase in a human in need thereof.

92. The method according to Claim 91, wherein the inhibition of GSK-3 kinase is useful for stimulation of neuroregeneration and the treatment and prevention of neurodegenerative diseases, inflammatory and demyelinating diseases, Alzheimer's disease, stroke, multiple 30 sclerosis, cognitive and attention deficits associated with Alzheimer's disease, acute and chronic neurodegenerative diseases, dementia, acute stroke and other traumatic injuries, cerebrovascular accidents, brain and spinal cord trauma, peripheral neuropathies, retinopathies and glaucoma. 256 WO 2008/154241 PCT/US2008/065727

93. The method accord to Claim 92, wherein the acute and chronic neurodegenerative diseases are Parkinson's disease and tauopathies.

94. The method according to Claim 93, wherein the tautopathies are frontotemporoparietal 5 dementia, corticobasal degeneration, Pick's disease, and progressive supranuclear palsy.

95. The method according to Claim 92, wherein the dementia is vascular dementia.

96. The method according to Claim 92, wherein the cerebrovascular accident is age related 10 macular degeneration.

97. The method according to Claim 91, wherein the inhibition of GSK-3 kinase is useful for the treatment non-insulin dependent diabetes and obesity, manic depressive illness, schizophrenia, alopecia, cancer, osteoarthritis, rheumatoid arthritis, and osteoporosis. 15

98. The method according to Claim 97, wherein the cancer is breast cancer, non-small cell lung carcinoma, thyroid cancer, T or B-cell leukemia, and virus-induced tumors.

99. A method of inhibiting GSK-3 kinase comprising administering a therapeutically 20 effective amount of a compound of Formula (I), according to claim 19, wherein the the inhibition of GSK-3 kinase is useful for the treatment or prevention of diseases or disorders regulated by GSK-3 kinase in a human in need thereof.

100. The method according to Claim 99, wherein the inhibition of GSK-3 kinase is useful for 25 stimulation of neuroregeneration and the treatment and prevention of neurodegenerative diseases, inflammatory and demyelinating diseases, Alzheimer's disease, stroke, multiple sclerosis, cognitive and attention deficits associated with Alzheimer's disease, acute and chronic neurodegenerative diseases, dementia, acute stroke and other traumatic injuries, cerebrovascular accidents, brain and spinal cord trauma, peripheral neuropathies, 30 retinopathies and glaucoma.

101. The method accord to Claim 100, wherein the acute and chronic neurodegenerative diseases are Parkinson's disease and tauopathies. 257 WO 2008/154241 PCT/US2008/065727

102. The method according to Claim 101, wherein the tautopathies are frontotemporoparietal dementia, corticobasal degeneration, Pick's disease, and progressive supranuclear palsy.

103. The method according to Claim 100, wherein the dementia is vascular dementia. 5

104. The method according to Claim 100, wherein the cerebrovascular accident is age related macular degeneration.

105. The method according to Claim 99, wherein the inhibition of GSK-3 kinase is useful for 10 the treatment non-insulin dependent diabetes and obesity, manic depressive illness, schizophrenia, alopecia, cancer, osteoarthritis, rheumatoid arthritis, and osteoporosis.

106. The method according to Claim 105, wherein the cancer is breast cancer, non-small cell lung carcinoma, thyroid cancer, T or B-cell leukemia, and virus-induced tumors. 15

107. A method of inhibiting GSK-3 kinase comprising administering a therapeutically effective amount of a compound of Formula (I), according to claim 20, wherein the the inhibition of GSK-3 kinase is useful for the treatment or prevention of diseases or disorders regulated by GSK-3 kinase in a human in need thereof. 20

108. The method according to Claim 107, wherein the inhibition of GSK-3 kinase is useful for stimulation of neuroregeneration and the treatment and prevention of neurodegenerative diseases, inflammatory and demyelinating diseases, Alzheimer's disease, stroke, multiple sclerosis, cognitive and attention deficits associated with Alzheimer's disease, acute and 25 chronic neurodegenerative diseases, dementia, acute stroke and other traumatic injuries, cerebrovascular accidents, brain and spinal cord trauma, peripheral neuropathies, retinopathies and glaucoma.

109. The method accord to Claim 108, wherein the acute and chronic neurodegenerative 30 diseases are Parkinson's disease and tauopathies.

110. The method according to Claim 109, wherein the tautopathies are frontotemporoparietal dementia, corticobasal degeneration, Pick's disease, and progressive supranuclear palsy. 258 WO 2008/154241 PCT/US2008/065727

111. The method according to Claim 108, wherein the dementia is vascular dementia.

112. The method according to Claim 108, wherein the cerebrovascular accident is age related macular degeneration. 5

113. The method according to Claim 107, wherein the inhibition of GSK-3 kinase is useful for the treatment non-insulin dependent diabetes and obesity, manic depressive illness, schizophrenia, alopecia, cancer, osteoarthritis, rheumatoid arthritis, and osteoporosis. 10

114. The method according to Claim 113, wherein the cancer is breast cancer, non-small cell lung carcinoma, thyroid cancer, T or B-cell leukemia, and virus-induced tumors.

115. A method of inhibiting GSK-3 kinase comprising administering a therapeutically effective amount of a compound of Formula (I), according to claim 21, wherein the the 15 inhibition of GSK-3 kinase is useful for the treatment or prevention of diseases or disorders regulated by GSK-3 kinase in a human in need thereof.

116. The method according to Claim 115, wherein the inhibition of GSK-3 kinase is useful for stimulation of neuroregeneration and the treatment and prevention of neurodegenerative 20 diseases, inflammatory and demyelinating diseases, Alzheimer's disease, stroke, multiple sclerosis, cognitive and attention deficits associated with Alzheimer's disease, acute and chronic neurodegenerative diseases, dementia, acute stroke and other traumatic injuries, cerebrovascular accidents, brain and spinal cord trauma, peripheral neuropathies, retinopathies and glaucoma. 25

117. The method accord to Claim 116, wherein the acute and chronic neurodegenerative diseases are Parkinson's disease and tauopathies.

118. The method according to Claim 117, wherein the tautopathies are frontotemporoparietal 30 dementia, corticobasal degeneration, Pick's disease, and progressive supranuclear palsy.

119. The method according to Claim 116, wherein the dementia is vascular dementia.

120. The method according to Claim 116, wherein the cerebrovascular accident is age related 259 WO 2008/154241 PCT/US2008/065727 macular degeneration.

121. The method according to Claim 115, wherein the inhibition of GSK-3 kinase is useful for the treatment non-insulin dependent diabetes and obesity, manic depressive illness, 5 schizophrenia, alopecia, cancer, osteoarthritis, rheumatoid arthritis, and osteoporosis.

122. The method according to Claim 121, wherein the cancer is breast cancer, non-small cell lung carcinoma, thyroid cancer, T or B-cell leukemia, and virus-induced tumors. 10

123. A method of inhibiting GSK-3 kinase comprising administering a therapeutically effective amount of a compound of Formula (I), according to claim 22, wherein the the inhibition of GSK-3 kinase is useful for the treatment or prevention of diseases or disorders regulated by GSK-3 kinase in a human in need thereof. 15

124. The method according to Claim 123, wherein the inhibition of GSK-3 kinase is useful for stimulation of neuroregeneration and the treatment and prevention of neurodegenerative diseases, inflammatory and demyelinating diseases, Alzheimer's disease, stroke, multiple sclerosis, cognitive and attention deficits associated with Alzheimer's disease, acute and chronic neurodegenerative diseases, dementia, acute stroke and other traumatic injuries, 20 cerebrovascular accidents, brain and spinal cord trauma, peripheral neuropathies, retinopathies and glaucoma.

125. The method accord to Claim 124, wherein the acute and chronic neurodegenerative diseases are Parkinson's disease and tauopathies. 25

126. The method according to Claim 125, wherein the tautopathies are frontotemporoparietal dementia, corticobasal degeneration, Pick's disease, and progressive supranuclear palsy.

127. The method according to Claim 124, wherein the dementia is vascular dementia. 30

128. The method according to Claim 124, wherein the cerebrovascular accident is age related macular degeneration.

129. The method according to Claim 123, wherein the inhibition of GSK-3 kinase is useful 260 WO 2008/154241 PCT/US2008/065727 for the treatment non-insulin dependent diabetes and obesity, manic depressive illness, schizophrenia, alopecia, cancer, osteoarthritis, rheumatoid arthritis, and osteoporosis.

130. The method according to Claim 129, wherein the cancer is breast cancer, non-small cell 5 lung carcinoma, thyroid cancer, T or B-cell leukemia, and virus-induced tumors.

131. A method of inhibiting GSK-3 kinase comprising administering a therapeutically effective amount of a compound of Formula (I), according to claim 23, wherein the the inhibition of GSK-3 kinase is useful for the treatment or prevention of diseases or disorders 10 regulated by GSK-3 kinase in a human in need thereof.

132. The method according to Claim 131, wherein the inhibition of GSK-3 kinase is useful for stimulation of neuroregeneration and the treatment and prevention of neurodegenerative diseases, inflammatory and demyelinating diseases, Alzheimer's disease, stroke, multiple 15 sclerosis, cognitive and attention deficits associated with Alzheimer's disease, acute and chronic neurodegenerative diseases, dementia, acute stroke and other traumatic injuries, cerebrovascular accidents, brain and spinal cord trauma, peripheral neuropathies, retinopathies and glaucoma. 20

133. The method accord to Claim 132, wherein the acute and chronic neurodegenerative diseases are Parkinson's disease and tauopathies.

134. The method according to Claim 133, wherein the tautopathies are frontotemporoparietal dementia, corticobasal degeneration, Pick's disease, and progressive supranuclear palsy. 25

135. The method according to Claim 132, wherein the dementia is vascular dementia.

136. The method according to Claim 132, wherein the cerebrovascular accident is age related macular degeneration. 30

137. The method according to Claim 131, wherein the inhibition of GSK-3 kinase is useful for the treatment non-insulin dependent diabetes and obesity, manic depressive illness, schizophrenia, alopecia, cancer, osteoarthritis, rheumatoid arthritis, and osteoporosis. 261 WO 2008/154241 PCT/US2008/065727

138. The method according to Claim 137, wherein the cancer is breast cancer, non-small cell lung carcinoma, thyroid cancer, T or B-cell leukemia, and virus-induced tumors.

139. A method of inhibiting JAK kinase comprising administering a therapeutically effective 5 amount of a compound of Formula (I), according to claim 1 wherein the inhibition of JAK kinase is useful for the treatment or prevention of diseases or disorders regulated by JAK kinases in a human in need thereof.

140. The method according to Claim 139, wherein the inhibition of JAK kinase is useful for 10 the treatment of autoimmune diseases, myeloproliferative syndromes and cardiovascular diseases associated with abnormal activity of JAK kinases comprises administering to a mammalian organism in need thereof an effective amount of a compound according to claim 5. 15

141. The method according to Claim 140, wherein the myeloproliferative syndromes are leukemias, lymphomas or cancer.

142. The method according to Claim 141, wherein the cancer is hematologic cancer. 20

143. The method according to Claim 140, wherein the autoimmune diseases are rheumatoid arthritis and psoriasis.

144. The method according to Claim 139, wherein the inhibition of JAK kinase is useful for the treatment of autoimmune diseases, myeloproliferative syndromes and cardiovascular 25 diseases associated with abnormal activity of JAK kinases comprises administering to a mammalian organism in need thereof an effective amount of a compound according to claim 8.

145. The method according to Claim 144, wherein the myeloproliferative syndromes are 30 leukemias, lymphomas or cancer.

146. The method according to Claim 145, wherein the cancer is hematologic cancer.

147. The method according to Claim 144, wherein the autoimmune diseases are rheumatoid 262 WO 2008/154241 PCT/US2008/065727 arthritis and psoriasis.

148. The method according to Claim 139, wherein the inhibition of JAK kinase is useful for the treatment of autoimmune diseases, myeloproliferative syndromes and cardiovascular 5 diseases associated with abnormal activity of JAK kinases comprises administering to a mammalian organism in need thereof an effective amount of a compound according to claim 12.

149. The method according to Claim 148, wherein the myeloproliferative syndromes are 10 leukemias, lymphomas or cancer.

150. The method according to Claim 149, wherein the cancer is hematologic cancer.

151. The method according to Claim 148, wherein the autoimmune diseases are rheumatoid 15 arthritis and psoriasis.

152. A method of inhibiting ROCK kinase comprising administering a therapeutically effective amount of a compound of Formula (I), according to claim 3, wherein the inhibition of ROCK kinase is useful for the treatment of neurodegeneration, inflammatory and 20 demyelinating diseases, Alzheimer's disease, stroke, pulmonary inflammation associated with asthma, asthma, for accelerated regeneration and enhanced functional recovery after spinal-cord injury, for multiple sclerosis, pain, hypertension, chronic and congestive heart failure, cardiac hypertrophy, restenosis, chronic renal failure, cerebral vasospasm after subarachnoid bleeding, pulmonary hypertension, atherosclerosis, male erectile dysfunctions, 25 female sexual dysfunction, over-active bladder syndrome, induction of new axonal growth, axonal rewiring across lesions within the CNS, amyotrophic lateral sclerosis, Huntington's disease, Parkinson's disease, rheumatoid arthritis, osteoarthritis, irritable bowel syndrome, Crohn's disease, psoriasis, ulcerative colitis, Lupus, cancer and tumor metastasis, anti-viral and anti-bacterial applications, insulin resistance, diabetes, cystic fibrosis, angina pectoris, 30 and arteriosclerosis.

153. A method of inhibiting ROCK kinase comprising administering a therapeutically effective amount of a compound of Formula (I), according to claim 6, wherein the inhibition of ROCK kinase is useful for the treatment of neurodegeneration, inflammatory and 263 WO 2008/154241 PCT/US2008/065727 demyelinating diseases, Alzheimer's disease, stroke, pulmonary inflammation associated with asthma, asthma, for accelerated regeneration and enhanced functional recovery after spinal-cord injury, for multiple sclerosis, pain, hypertension, chronic and congestive heart failure, cardiac hypertrophy, restenosis, chronic renal failure, cerebral vasospasm after 5 subarachnoid bleeding, pulmonary hypertension, atherosclerosis, male erectile dysfunctions, female sexual dysfunction, over-active bladder syndrome, induction of new axonal growth, axonal rewiring across lesions within the CNS, amyotrophic lateral sclerosis, Huntington's disease, Parkinson's disease, rheumatoid arthritis, osteoarthritis, irritable bowel syndrome, Crohn's disease, psoriasis, ulcerative colitis, Lupus, cancer and tumor metastasis, anti-viral 10 and anti-bacterial applications, insulin resistance, diabetes, cystic fibrosis, angina pectoris, and arteriosclerosis.

154. A method of inhibiting ROCK kinase comprising administering a therapeutically effective amount of a compound of Formula (I), according to claim 7, wherein the inhibition 15 of ROCK kinase is useful for the treatment of neurodegeneration, inflammatory and demyelinating diseases, Alzheimer's disease, stroke, pulmonary inflammation associated with asthma, asthma, for accelerated regeneration and enhanced functional recovery after spinal-cord injury, for multiple sclerosis, pain, hypertension, chronic and congestive heart failure, cardiac hypertrophy, restenosis, chronic renal failure, cerebral vasospasm after 20 subarachnoid bleeding, pulmonary hypertension, atherosclerosis, male erectile dysfunctions, female sexual dysfunction, over-active bladder syndrome, induction of new axonal growth, axonal rewiring across lesions within the CNS, amyotrophic lateral sclerosis, Huntington's disease, Parkinson's disease, rheumatoid arthritis, osteoarthritis, irritable bowel syndrome, Crohn's disease, psoriasis, ulcerative colitis, Lupus, cancer and tumor metastasis, anti-viral 25 and anti-bacterial applications, insulin resistance, diabetes, cystic fibrosis, angina pectoris, and arteriosclerosis.

155. A method of inhibiting ROCK kinase comprising administering a therapeutically effective amount of a compound of Formula (I), according to claim 10, wherein the inhibition 30 of ROCK kinase is useful for the treatment of neurodegeneration, inflammatory and demyelinating diseases, Alzheimer's disease, stroke, pulmonary inflammation associated with asthma, asthma, for accelerated regeneration and enhanced functional recovery after spinal-cord injury, for multiple sclerosis, pain, hypertension, chronic and congestive heart failure, cardiac hypertrophy, restenosis, chronic renal failure, cerebral vasospasm after 264 WO 2008/154241 PCT/US2008/065727 subarachnoid bleeding, pulmonary hypertension, atherosclerosis, male erectile dysfunctions, female sexual dysfunction, over-active bladder syndrome, induction of new axonal growth, axonal rewiring across lesions within the CNS, amyotrophic lateral sclerosis, Huntington's disease, Parkinson's disease, rheumatoid arthritis, osteoarthritis, irritable bowel syndrome, 5 Crohn's disease, psoriasis, ulcerative colitis, Lupus, cancer and tumor metastasis, anti-viral and anti-bacterial applications, insulin resistance, diabetes, cystic fibrosis, angina pectoris, and arteriosclerosis.

156. A method of inhibiting ROCK kinase comprising administering a therapeutically 10 effective amount of a compound of Formula (I), according to claim 13, wherein the inhibition of ROCK kinase is useful for the treatment of neurodegeneration, inflammatory and demyelinating diseases, Alzheimer's disease, stroke, pulmonary inflammation associated with asthma, asthma, for accelerated regeneration and enhanced functional recovery after spinal-cord injury, for multiple sclerosis, pain, hypertension, chronic and congestive heart 15 failure, cardiac hypertrophy, restenosis, chronic renal failure, cerebral vasospasm after subarachnoid bleeding, pulmonary hypertension, atherosclerosis, male erectile dysfunctions, female sexual dysfunction, over-active bladder syndrome, induction of new axonal growth, axonal rewiring across lesions within the CNS, amyotrophic lateral sclerosis, Huntington's disease, Parkinson's disease, rheumatoid arthritis, osteoarthritis, irritable bowel syndrome, 20 Crohn's disease, psoriasis, ulcerative colitis, Lupus, cancer and tumor metastasis, anti-viral and anti-bacterial applications, insulin resistance, diabetes, cystic fibrosis, angina pectoris, and arteriosclerosis. 265