US20040033559A1 - Secreted and transmembrane polypeptides and nucleic acids encoding the same - Google Patents
Secreted and transmembrane polypeptides and nucleic acids encoding the sameInfo
- Publication number
- US20040033559A1 US20040033559A1 US10/160,503 US16050302A US2004033559A1 US 20040033559 A1 US20040033559 A1 US 20040033559A1 US 16050302 A US16050302 A US 16050302A US 2004033559 A1 US2004033559 A1 US 2004033559A1
- Authority
- US
- United States
- Prior art keywords
- seq
- polypeptide
- acid sequence
- shows
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 452
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 441
- 229920001184 polypeptide Polymers 0.000 title claims abstract description 432
- 150000007523 nucleic acids Chemical class 0.000 title claims abstract description 210
- 102000039446 nucleic acids Human genes 0.000 title claims abstract description 65
- 108020004707 nucleic acids Proteins 0.000 title claims abstract description 65
- 238000000034 method Methods 0.000 claims abstract description 225
- 239000013598 vector Substances 0.000 claims abstract description 60
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 426
- 239000002773 nucleotide Substances 0.000 claims description 361
- 125000003729 nucleotide group Chemical group 0.000 claims description 361
- 108091026890 Coding region Proteins 0.000 claims description 295
- 210000004027 cell Anatomy 0.000 claims description 245
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 159
- 108020004414 DNA Proteins 0.000 claims description 100
- 239000000523 sample Substances 0.000 claims description 62
- 230000027455 binding Effects 0.000 claims description 59
- 241000282414 Homo sapiens Species 0.000 claims description 56
- 230000014509 gene expression Effects 0.000 claims description 48
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 44
- 108060003951 Immunoglobulin Proteins 0.000 claims description 32
- 102000018358 immunoglobulin Human genes 0.000 claims description 32
- 239000000203 mixture Substances 0.000 claims description 30
- 230000015572 biosynthetic process Effects 0.000 claims description 28
- 238000012360 testing method Methods 0.000 claims description 21
- 241000588724 Escherichia coli Species 0.000 claims description 20
- 101100149072 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) secA gene Proteins 0.000 claims description 19
- 230000004071 biological effect Effects 0.000 claims description 18
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 claims description 15
- 241000124008 Mammalia Species 0.000 claims description 14
- 239000002253 acid Substances 0.000 claims description 14
- 239000008103 glucose Substances 0.000 claims description 14
- 230000035755 proliferation Effects 0.000 claims description 14
- 238000004113 cell culture Methods 0.000 claims description 12
- 210000004978 chinese hamster ovary cell Anatomy 0.000 claims description 12
- 239000007787 solid Substances 0.000 claims description 12
- 230000004069 differentiation Effects 0.000 claims description 11
- 210000001612 chondrocyte Anatomy 0.000 claims description 9
- 230000008569 process Effects 0.000 claims description 9
- 230000004936 stimulating effect Effects 0.000 claims description 9
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 claims description 8
- 206010028980 Neoplasm Diseases 0.000 claims description 8
- 108060008682 Tumor Necrosis Factor Proteins 0.000 claims description 8
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 claims description 8
- 239000003053 toxin Substances 0.000 claims description 8
- 231100000765 toxin Toxicity 0.000 claims description 8
- 210000004369 blood Anatomy 0.000 claims description 6
- 239000008280 blood Substances 0.000 claims description 6
- 238000012258 culturing Methods 0.000 claims description 6
- 102000004127 Cytokines Human genes 0.000 claims description 5
- 108090000695 Cytokines Proteins 0.000 claims description 5
- 230000002401 inhibitory effect Effects 0.000 claims description 5
- 108020005187 Oligonucleotide Probes Proteins 0.000 claims description 4
- 101100515690 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) nadK2 gene Proteins 0.000 claims description 4
- 210000000845 cartilage Anatomy 0.000 claims description 4
- 239000002751 oligonucleotide probe Substances 0.000 claims description 4
- 206010006187 Breast cancer Diseases 0.000 claims description 3
- 210000002363 skeletal muscle cell Anatomy 0.000 claims description 3
- 210000005253 yeast cell Anatomy 0.000 claims description 3
- 208000026310 Breast neoplasm Diseases 0.000 claims description 2
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 2
- 230000000975 bioactive effect Effects 0.000 claims 20
- 229940012414 factor viia Drugs 0.000 claims 3
- 102000016611 Proteoglycans Human genes 0.000 claims 2
- 108010067787 Proteoglycans Proteins 0.000 claims 2
- 210000001789 adipocyte Anatomy 0.000 claims 2
- 239000013068 control sample Substances 0.000 claims 2
- 206010019695 Hepatic neoplasm Diseases 0.000 claims 1
- 208000015634 Rectal Neoplasms Diseases 0.000 claims 1
- 208000029742 colonic neoplasm Diseases 0.000 claims 1
- 210000003027 ear inner Anatomy 0.000 claims 1
- 210000002889 endothelial cell Anatomy 0.000 claims 1
- 208000014018 liver neoplasm Diseases 0.000 claims 1
- 208000020816 lung neoplasm Diseases 0.000 claims 1
- 208000037841 lung tumor Diseases 0.000 claims 1
- 210000003668 pericyte Anatomy 0.000 claims 1
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 claims 1
- 208000023958 prostate neoplasm Diseases 0.000 claims 1
- 208000013718 rectal benign neoplasm Diseases 0.000 claims 1
- 208000024719 uterine cervix neoplasm Diseases 0.000 claims 1
- 239000002299 complementary DNA Substances 0.000 description 318
- 108090000623 proteins and genes Proteins 0.000 description 153
- 102000004169 proteins and genes Human genes 0.000 description 104
- 235000018102 proteins Nutrition 0.000 description 100
- 239000012634 fragment Substances 0.000 description 67
- 235000001014 amino acid Nutrition 0.000 description 47
- 229940024606 amino acid Drugs 0.000 description 44
- 150000001413 amino acids Chemical group 0.000 description 44
- 238000003556 assay Methods 0.000 description 41
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 39
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 39
- 108091034117 Oligonucleotide Proteins 0.000 description 35
- 102000005962 receptors Human genes 0.000 description 35
- 241001465754 Metazoa Species 0.000 description 34
- 108020003175 receptors Proteins 0.000 description 34
- 239000005557 antagonist Substances 0.000 description 30
- 150000001875 compounds Chemical class 0.000 description 25
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 24
- 238000003752 polymerase chain reaction Methods 0.000 description 24
- 125000000539 amino acid group Chemical group 0.000 description 23
- 238000009396 hybridization Methods 0.000 description 21
- 238000000746 purification Methods 0.000 description 21
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 20
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 20
- 239000003795 chemical substances by application Substances 0.000 description 19
- 238000004519 manufacturing process Methods 0.000 description 19
- 238000006467 substitution reaction Methods 0.000 description 19
- -1 survival factors Substances 0.000 description 19
- 210000001519 tissue Anatomy 0.000 description 19
- 239000000556 agonist Substances 0.000 description 18
- 239000001963 growth medium Substances 0.000 description 18
- REQCZEXYDRLIBE-UHFFFAOYSA-N procainamide Chemical compound CCN(CC)CCNC(=O)C1=CC=C(N)C=C1 REQCZEXYDRLIBE-UHFFFAOYSA-N 0.000 description 18
- 238000012216 screening Methods 0.000 description 18
- 238000011282 treatment Methods 0.000 description 18
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 17
- 239000000427 antigen Substances 0.000 description 17
- 230000000295 complement effect Effects 0.000 description 17
- 230000000694 effects Effects 0.000 description 17
- 230000003993 interaction Effects 0.000 description 17
- 239000013612 plasmid Substances 0.000 description 17
- 108091007433 antigens Proteins 0.000 description 16
- 102000036639 antigens Human genes 0.000 description 16
- 238000006243 chemical reaction Methods 0.000 description 16
- 239000003814 drug Substances 0.000 description 16
- 210000004408 hybridoma Anatomy 0.000 description 16
- 239000012528 membrane Substances 0.000 description 16
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 15
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 15
- 230000000692 anti-sense effect Effects 0.000 description 15
- 239000013604 expression vector Substances 0.000 description 15
- 230000004927 fusion Effects 0.000 description 15
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 15
- 239000002502 liposome Substances 0.000 description 15
- 238000002360 preparation method Methods 0.000 description 15
- 239000000243 solution Substances 0.000 description 15
- 239000003446 ligand Substances 0.000 description 14
- 108020004999 messenger RNA Proteins 0.000 description 14
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 13
- 239000000872 buffer Substances 0.000 description 13
- 238000001727 in vivo Methods 0.000 description 13
- 239000002609 medium Substances 0.000 description 13
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 12
- 239000003153 chemical reaction reagent Substances 0.000 description 12
- 238000010367 cloning Methods 0.000 description 12
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 12
- 238000005516 engineering process Methods 0.000 description 12
- 239000003623 enhancer Substances 0.000 description 12
- 239000003112 inhibitor Substances 0.000 description 12
- 210000004962 mammalian cell Anatomy 0.000 description 12
- 108091008146 restriction endonucleases Proteins 0.000 description 12
- 239000011780 sodium chloride Substances 0.000 description 12
- 239000000126 substance Substances 0.000 description 12
- 230000001225 therapeutic effect Effects 0.000 description 12
- 238000013518 transcription Methods 0.000 description 12
- 230000035897 transcription Effects 0.000 description 12
- 102000004190 Enzymes Human genes 0.000 description 11
- 108090000790 Enzymes Proteins 0.000 description 11
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 11
- 238000004458 analytical method Methods 0.000 description 11
- 238000013459 approach Methods 0.000 description 11
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 11
- 229940088598 enzyme Drugs 0.000 description 11
- 239000000047 product Substances 0.000 description 11
- 230000028327 secretion Effects 0.000 description 11
- 241000894006 Bacteria Species 0.000 description 10
- 229940127089 cytotoxic agent Drugs 0.000 description 10
- 239000004382 Amylase Substances 0.000 description 9
- 108010065511 Amylases Proteins 0.000 description 9
- 102000013142 Amylases Human genes 0.000 description 9
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 9
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 9
- 241000699666 Mus <mouse, genus> Species 0.000 description 9
- 239000002671 adjuvant Substances 0.000 description 9
- 235000019418 amylase Nutrition 0.000 description 9
- 239000000074 antisense oligonucleotide Substances 0.000 description 9
- 238000012230 antisense oligonucleotides Methods 0.000 description 9
- 238000004590 computer program Methods 0.000 description 9
- 208000035475 disorder Diseases 0.000 description 9
- 230000013595 glycosylation Effects 0.000 description 9
- 238000006206 glycosylation reaction Methods 0.000 description 9
- 238000000338 in vitro Methods 0.000 description 9
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 9
- 150000003384 small molecules Chemical class 0.000 description 9
- 230000009466 transformation Effects 0.000 description 9
- 230000014616 translation Effects 0.000 description 9
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 8
- 108020005544 Antisense RNA Proteins 0.000 description 8
- 108020004705 Codon Proteins 0.000 description 8
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 8
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 8
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 8
- 241000699670 Mus sp. Species 0.000 description 8
- 239000002202 Polyethylene glycol Substances 0.000 description 8
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 8
- 238000003776 cleavage reaction Methods 0.000 description 8
- 238000009472 formulation Methods 0.000 description 8
- 239000011159 matrix material Substances 0.000 description 8
- 229920001223 polyethylene glycol Polymers 0.000 description 8
- 239000011347 resin Substances 0.000 description 8
- 229920005989 resin Polymers 0.000 description 8
- 230000007017 scission Effects 0.000 description 8
- 238000007423 screening assay Methods 0.000 description 8
- 230000003248 secreting effect Effects 0.000 description 8
- 238000010561 standard procedure Methods 0.000 description 8
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 8
- 108020004635 Complementary DNA Proteins 0.000 description 7
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 7
- 241001529936 Murinae Species 0.000 description 7
- 206010035226 Plasma cell myeloma Diseases 0.000 description 7
- 108010022394 Threonine synthase Proteins 0.000 description 7
- 150000001720 carbohydrates Chemical class 0.000 description 7
- 238000005119 centrifugation Methods 0.000 description 7
- 210000000349 chromosome Anatomy 0.000 description 7
- 239000003184 complementary RNA Substances 0.000 description 7
- 239000003636 conditioned culture medium Substances 0.000 description 7
- 102000004419 dihydrofolate reductase Human genes 0.000 description 7
- 230000002255 enzymatic effect Effects 0.000 description 7
- 229940124452 immunizing agent Drugs 0.000 description 7
- 229940072221 immunoglobulins Drugs 0.000 description 7
- 238000011534 incubation Methods 0.000 description 7
- 238000002955 isolation Methods 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- 229910052751 metal Inorganic materials 0.000 description 7
- 239000002184 metal Substances 0.000 description 7
- 230000004048 modification Effects 0.000 description 7
- 238000012986 modification Methods 0.000 description 7
- 201000000050 myeloid neoplasm Diseases 0.000 description 7
- 239000007790 solid phase Substances 0.000 description 7
- 241000894007 species Species 0.000 description 7
- 238000001890 transfection Methods 0.000 description 7
- 230000009261 transgenic effect Effects 0.000 description 7
- 238000013519 translation Methods 0.000 description 7
- 238000005406 washing Methods 0.000 description 7
- 108020004491 Antisense DNA Proteins 0.000 description 6
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 6
- 102000053602 DNA Human genes 0.000 description 6
- 241000700159 Rattus Species 0.000 description 6
- 108700019146 Transgenes Proteins 0.000 description 6
- 150000007513 acids Chemical class 0.000 description 6
- 238000001042 affinity chromatography Methods 0.000 description 6
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 6
- 125000000151 cysteine group Chemical class N[C@@H](CS)C(=O)* 0.000 description 6
- 239000002254 cytotoxic agent Substances 0.000 description 6
- 231100000599 cytotoxic agent Toxicity 0.000 description 6
- 230000002950 deficient Effects 0.000 description 6
- 229940079593 drug Drugs 0.000 description 6
- 238000004520 electroporation Methods 0.000 description 6
- 230000006870 function Effects 0.000 description 6
- 239000000499 gel Substances 0.000 description 6
- 230000012010 growth Effects 0.000 description 6
- 230000002163 immunogen Effects 0.000 description 6
- 239000003550 marker Substances 0.000 description 6
- 230000001404 mediated effect Effects 0.000 description 6
- 230000001575 pathological effect Effects 0.000 description 6
- 239000008188 pellet Substances 0.000 description 6
- 239000012071 phase Substances 0.000 description 6
- 229920000642 polymer Polymers 0.000 description 6
- 102000040430 polynucleotide Human genes 0.000 description 6
- 108091033319 polynucleotide Proteins 0.000 description 6
- 239000002157 polynucleotide Substances 0.000 description 6
- 238000012163 sequencing technique Methods 0.000 description 6
- 239000001509 sodium citrate Substances 0.000 description 6
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 6
- 239000006228 supernatant Substances 0.000 description 6
- 238000003786 synthesis reaction Methods 0.000 description 6
- 229940124597 therapeutic agent Drugs 0.000 description 6
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 5
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 5
- 206010003445 Ascites Diseases 0.000 description 5
- 101100390711 Escherichia coli (strain K12) fhuA gene Proteins 0.000 description 5
- 239000004471 Glycine Substances 0.000 description 5
- 102000004877 Insulin Human genes 0.000 description 5
- 108090001061 Insulin Proteins 0.000 description 5
- 108020004511 Recombinant DNA Proteins 0.000 description 5
- 229920002472 Starch Polymers 0.000 description 5
- 241000700605 Viruses Species 0.000 description 5
- 235000004279 alanine Nutrition 0.000 description 5
- 239000002246 antineoplastic agent Substances 0.000 description 5
- 239000003816 antisense DNA Substances 0.000 description 5
- 210000004899 c-terminal region Anatomy 0.000 description 5
- 238000004422 calculation algorithm Methods 0.000 description 5
- 230000001413 cellular effect Effects 0.000 description 5
- 239000013522 chelant Substances 0.000 description 5
- 238000004132 cross linking Methods 0.000 description 5
- 238000013461 design Methods 0.000 description 5
- 238000001514 detection method Methods 0.000 description 5
- 238000009510 drug design Methods 0.000 description 5
- 238000007877 drug screening Methods 0.000 description 5
- 238000001415 gene therapy Methods 0.000 description 5
- 230000001900 immune effect Effects 0.000 description 5
- 230000001965 increasing effect Effects 0.000 description 5
- 229940125396 insulin Drugs 0.000 description 5
- 230000003834 intracellular effect Effects 0.000 description 5
- 230000007246 mechanism Effects 0.000 description 5
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 5
- 238000000159 protein binding assay Methods 0.000 description 5
- 238000003259 recombinant expression Methods 0.000 description 5
- 239000006152 selective media Substances 0.000 description 5
- 210000002027 skeletal muscle Anatomy 0.000 description 5
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 5
- 235000019698 starch Nutrition 0.000 description 5
- 239000008107 starch Substances 0.000 description 5
- 238000013268 sustained release Methods 0.000 description 5
- 239000012730 sustained-release form Substances 0.000 description 5
- 238000012546 transfer Methods 0.000 description 5
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 4
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 4
- 229920001817 Agar Polymers 0.000 description 4
- 102100026277 Alpha-galactosidase A Human genes 0.000 description 4
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 4
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 4
- 108091035707 Consensus sequence Proteins 0.000 description 4
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 4
- 241000196324 Embryophyta Species 0.000 description 4
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 4
- ZRALSGWEFCBTJO-UHFFFAOYSA-N Guanidine Chemical compound NC(N)=N ZRALSGWEFCBTJO-UHFFFAOYSA-N 0.000 description 4
- 241000238631 Hexapoda Species 0.000 description 4
- 101000718525 Homo sapiens Alpha-galactosidase A Proteins 0.000 description 4
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 description 4
- 108010091358 Hypoxanthine Phosphoribosyltransferase Proteins 0.000 description 4
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 4
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 4
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 4
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 description 4
- 239000004472 Lysine Substances 0.000 description 4
- 229930195725 Mannitol Natural products 0.000 description 4
- 108010052285 Membrane Proteins Proteins 0.000 description 4
- 238000012408 PCR amplification Methods 0.000 description 4
- 229910019142 PO4 Inorganic materials 0.000 description 4
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 4
- 239000007983 Tris buffer Substances 0.000 description 4
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 4
- 239000008272 agar Substances 0.000 description 4
- 239000003242 anti bacterial agent Substances 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 4
- 230000001588 bifunctional effect Effects 0.000 description 4
- 201000011510 cancer Diseases 0.000 description 4
- 239000000969 carrier Substances 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 239000002738 chelating agent Substances 0.000 description 4
- 238000004587 chromatography analysis Methods 0.000 description 4
- 235000018417 cysteine Nutrition 0.000 description 4
- 238000012217 deletion Methods 0.000 description 4
- 230000037430 deletion Effects 0.000 description 4
- 229960000633 dextran sulfate Drugs 0.000 description 4
- 230000029087 digestion Effects 0.000 description 4
- 239000000284 extract Substances 0.000 description 4
- 238000000855 fermentation Methods 0.000 description 4
- 230000004151 fermentation Effects 0.000 description 4
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 4
- 229940088597 hormone Drugs 0.000 description 4
- 239000005556 hormone Substances 0.000 description 4
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 238000003780 insertion Methods 0.000 description 4
- 230000037431 insertion Effects 0.000 description 4
- 239000012160 loading buffer Substances 0.000 description 4
- 210000004698 lymphocyte Anatomy 0.000 description 4
- 235000018977 lysine Nutrition 0.000 description 4
- 238000012423 maintenance Methods 0.000 description 4
- 239000000594 mannitol Substances 0.000 description 4
- 235000010355 mannitol Nutrition 0.000 description 4
- 239000003094 microcapsule Substances 0.000 description 4
- 238000002703 mutagenesis Methods 0.000 description 4
- 231100000350 mutagenesis Toxicity 0.000 description 4
- 230000035772 mutation Effects 0.000 description 4
- 239000013642 negative control Substances 0.000 description 4
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 4
- 239000010452 phosphate Substances 0.000 description 4
- 239000013641 positive control Substances 0.000 description 4
- 238000001556 precipitation Methods 0.000 description 4
- 230000004850 protein–protein interaction Effects 0.000 description 4
- 239000011541 reaction mixture Substances 0.000 description 4
- 230000001177 retroviral effect Effects 0.000 description 4
- 210000004989 spleen cell Anatomy 0.000 description 4
- 108700012359 toxins Proteins 0.000 description 4
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 4
- 241000701447 unidentified baculovirus Species 0.000 description 4
- 230000003612 virological effect Effects 0.000 description 4
- QFVHZQCOUORWEI-UHFFFAOYSA-N 4-[(4-anilino-5-sulfonaphthalen-1-yl)diazenyl]-5-hydroxynaphthalene-2,7-disulfonic acid Chemical compound C=12C(O)=CC(S(O)(=O)=O)=CC2=CC(S(O)(=O)=O)=CC=1N=NC(C1=CC=CC(=C11)S(O)(=O)=O)=CC=C1NC1=CC=CC=C1 QFVHZQCOUORWEI-UHFFFAOYSA-N 0.000 description 3
- 108010021809 Alcohol dehydrogenase Proteins 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 3
- 241000972773 Aulopiformes Species 0.000 description 3
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 3
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 3
- 108090000994 Catalytic RNA Proteins 0.000 description 3
- 102000053642 Catalytic RNA Human genes 0.000 description 3
- 108010001857 Cell Surface Receptors Proteins 0.000 description 3
- 229920002307 Dextran Polymers 0.000 description 3
- 241000233866 Fungi Species 0.000 description 3
- 102100029098 Hypoxanthine-guanine phosphoribosyltransferase Human genes 0.000 description 3
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 3
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 3
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 3
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 3
- 102000013463 Immunoglobulin Light Chains Human genes 0.000 description 3
- 108010065825 Immunoglobulin Light Chains Proteins 0.000 description 3
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 3
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- 102000018697 Membrane Proteins Human genes 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 101100178822 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) htrA1 gene Proteins 0.000 description 3
- 101100277437 Rhizobium meliloti (strain 1021) degP1 gene Proteins 0.000 description 3
- 241000283984 Rodentia Species 0.000 description 3
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 3
- 241000282887 Suidae Species 0.000 description 3
- IXKSXJFAGXLQOQ-XISFHERQSA-N WHWLQLKPGQPMY Chemical compound C([C@@H](C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)C1=CNC=N1 IXKSXJFAGXLQOQ-XISFHERQSA-N 0.000 description 3
- 238000002835 absorbance Methods 0.000 description 3
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 3
- 229960000723 ampicillin Drugs 0.000 description 3
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 3
- 229940088710 antibiotic agent Drugs 0.000 description 3
- 230000000890 antigenic effect Effects 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 235000009697 arginine Nutrition 0.000 description 3
- 239000001110 calcium chloride Substances 0.000 description 3
- 229910001628 calcium chloride Inorganic materials 0.000 description 3
- 238000004364 calculation method Methods 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 239000013599 cloning vector Substances 0.000 description 3
- 238000004440 column chromatography Methods 0.000 description 3
- 238000012875 competitive assay Methods 0.000 description 3
- 230000009918 complex formation Effects 0.000 description 3
- 239000000356 contaminant Substances 0.000 description 3
- 229920001577 copolymer Polymers 0.000 description 3
- 230000008878 coupling Effects 0.000 description 3
- 238000010168 coupling process Methods 0.000 description 3
- 238000005859 coupling reaction Methods 0.000 description 3
- 101150018266 degP gene Proteins 0.000 description 3
- 239000003599 detergent Substances 0.000 description 3
- 229960002086 dextran Drugs 0.000 description 3
- 238000000502 dialysis Methods 0.000 description 3
- 239000000539 dimer Substances 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 229940000406 drug candidate Drugs 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 239000012636 effector Substances 0.000 description 3
- 210000001671 embryonic stem cell Anatomy 0.000 description 3
- 239000006167 equilibration buffer Substances 0.000 description 3
- 150000002148 esters Chemical class 0.000 description 3
- 210000003527 eukaryotic cell Anatomy 0.000 description 3
- 239000012091 fetal bovine serum Substances 0.000 description 3
- 238000001914 filtration Methods 0.000 description 3
- 239000012530 fluid Substances 0.000 description 3
- 239000012737 fresh medium Substances 0.000 description 3
- 108020001507 fusion proteins Proteins 0.000 description 3
- 102000037865 fusion proteins Human genes 0.000 description 3
- 108010037896 heparin-binding hemagglutinin Proteins 0.000 description 3
- 238000013537 high throughput screening Methods 0.000 description 3
- 230000002209 hydrophobic effect Effects 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 238000002649 immunization Methods 0.000 description 3
- 229940127121 immunoconjugate Drugs 0.000 description 3
- 238000002372 labelling Methods 0.000 description 3
- 150000002632 lipids Chemical class 0.000 description 3
- 239000004005 microsphere Substances 0.000 description 3
- 238000002156 mixing Methods 0.000 description 3
- 230000003472 neutralizing effect Effects 0.000 description 3
- 235000015097 nutrients Nutrition 0.000 description 3
- 230000037361 pathway Effects 0.000 description 3
- 239000008194 pharmaceutical composition Substances 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 229920002401 polyacrylamide Polymers 0.000 description 3
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 3
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 3
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 3
- 239000002244 precipitate Substances 0.000 description 3
- 101150059999 pro gene Proteins 0.000 description 3
- 238000001742 protein purification Methods 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- 108091092562 ribozyme Proteins 0.000 description 3
- 235000019515 salmon Nutrition 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 239000012679 serum free medium Substances 0.000 description 3
- 239000011734 sodium Substances 0.000 description 3
- 239000001488 sodium phosphate Substances 0.000 description 3
- 229960003339 sodium phosphate Drugs 0.000 description 3
- 229910000162 sodium phosphate Inorganic materials 0.000 description 3
- 235000011008 sodium phosphates Nutrition 0.000 description 3
- 239000003381 stabilizer Substances 0.000 description 3
- 235000000346 sugar Nutrition 0.000 description 3
- 230000004083 survival effect Effects 0.000 description 3
- 108091005703 transmembrane proteins Proteins 0.000 description 3
- 102000035160 transmembrane proteins Human genes 0.000 description 3
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 3
- 238000010396 two-hybrid screening Methods 0.000 description 3
- 241000701161 unidentified adenovirus Species 0.000 description 3
- 241001430294 unidentified retrovirus Species 0.000 description 3
- 238000002424 x-ray crystallography Methods 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- GZCWLCBFPRFLKL-UHFFFAOYSA-N 1-prop-2-ynoxypropan-2-ol Chemical compound CC(O)COCC#C GZCWLCBFPRFLKL-UHFFFAOYSA-N 0.000 description 2
- VPFUWHKTPYPNGT-UHFFFAOYSA-N 3-(3,4-dihydroxyphenyl)-1-(5-hydroxy-2,2-dimethylchromen-6-yl)propan-1-one Chemical compound OC1=C2C=CC(C)(C)OC2=CC=C1C(=O)CCC1=CC=C(O)C(O)=C1 VPFUWHKTPYPNGT-UHFFFAOYSA-N 0.000 description 2
- OSJPPGNTCRNQQC-UWTATZPHSA-N 3-phospho-D-glyceric acid Chemical compound OC(=O)[C@H](O)COP(O)(O)=O OSJPPGNTCRNQQC-UWTATZPHSA-N 0.000 description 2
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 2
- GANZODCWZFAEGN-UHFFFAOYSA-N 5-mercapto-2-nitro-benzoic acid Chemical compound OC(=O)C1=CC(S)=CC=C1[N+]([O-])=O GANZODCWZFAEGN-UHFFFAOYSA-N 0.000 description 2
- 102000013563 Acid Phosphatase Human genes 0.000 description 2
- 108010051457 Acid Phosphatase Proteins 0.000 description 2
- 229920000936 Agarose Polymers 0.000 description 2
- 108010088751 Albumins Proteins 0.000 description 2
- 102000009027 Albumins Human genes 0.000 description 2
- 102000007698 Alcohol dehydrogenase Human genes 0.000 description 2
- 102100034044 All-trans-retinol dehydrogenase [NAD(+)] ADH1B Human genes 0.000 description 2
- 101710193111 All-trans-retinol dehydrogenase [NAD(+)] ADH4 Proteins 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 208000025978 Athletic injury Diseases 0.000 description 2
- 108090001008 Avidin Proteins 0.000 description 2
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 2
- 102100026189 Beta-galactosidase Human genes 0.000 description 2
- 208000020084 Bone disease Diseases 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 108090000565 Capsid Proteins Proteins 0.000 description 2
- 102000000844 Cell Surface Receptors Human genes 0.000 description 2
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 2
- 102000029816 Collagenase Human genes 0.000 description 2
- 108060005980 Collagenase Proteins 0.000 description 2
- 241000699802 Cricetulus griseus Species 0.000 description 2
- 241000701022 Cytomegalovirus Species 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 2
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 2
- 230000004544 DNA amplification Effects 0.000 description 2
- 238000001712 DNA sequencing Methods 0.000 description 2
- 230000004568 DNA-binding Effects 0.000 description 2
- 239000004375 Dextrin Substances 0.000 description 2
- 229920001353 Dextrin Polymers 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- 238000012286 ELISA Assay Methods 0.000 description 2
- 108010013369 Enteropeptidase Proteins 0.000 description 2
- 102100029727 Enteropeptidase Human genes 0.000 description 2
- 241001302584 Escherichia coli str. K-12 substr. W3110 Species 0.000 description 2
- 241000206602 Eukaryota Species 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 2
- 229930182566 Gentamicin Natural products 0.000 description 2
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 2
- 102000005731 Glucose-6-phosphate isomerase Human genes 0.000 description 2
- 108010070600 Glucose-6-phosphate isomerase Proteins 0.000 description 2
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 2
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Polymers OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 description 2
- 102000005744 Glycoside Hydrolases Human genes 0.000 description 2
- 108010031186 Glycoside Hydrolases Proteins 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 108090000144 Human Proteins Proteins 0.000 description 2
- 102000003839 Human Proteins Human genes 0.000 description 2
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 241000235649 Kluyveromyces Species 0.000 description 2
- 244000285963 Kluyveromyces fragilis Species 0.000 description 2
- 241001138401 Kluyveromyces lactis Species 0.000 description 2
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- 108010000817 Leuprolide Proteins 0.000 description 2
- 229910009891 LiAc Inorganic materials 0.000 description 2
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 2
- 241001024304 Mino Species 0.000 description 2
- CHJJGSNFBQVOTG-UHFFFAOYSA-N N-methyl-guanidine Natural products CNC(N)=N CHJJGSNFBQVOTG-UHFFFAOYSA-N 0.000 description 2
- 108090000189 Neuropeptides Proteins 0.000 description 2
- 101100407828 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) ptr-3 gene Proteins 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- 102000007079 Peptide Fragments Human genes 0.000 description 2
- 108010033276 Peptide Fragments Proteins 0.000 description 2
- 241000235648 Pichia Species 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 102000001253 Protein Kinase Human genes 0.000 description 2
- 108020005091 Replication Origin Proteins 0.000 description 2
- 108010039491 Ricin Proteins 0.000 description 2
- 241000235070 Saccharomyces Species 0.000 description 2
- 101100477031 Schizosaccharomyces pombe (strain 972 / ATCC 24843) sec71 gene Proteins 0.000 description 2
- 229920005654 Sephadex Polymers 0.000 description 2
- 239000012507 Sephadex™ Substances 0.000 description 2
- 229920002684 Sepharose Polymers 0.000 description 2
- 241000607720 Serratia Species 0.000 description 2
- 108010071390 Serum Albumin Proteins 0.000 description 2
- 102000007562 Serum Albumin Human genes 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 description 2
- 101150006914 TRP1 gene Proteins 0.000 description 2
- 239000004098 Tetracycline Substances 0.000 description 2
- 101710120037 Toxin CcdB Proteins 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 230000002411 adverse Effects 0.000 description 2
- 238000001261 affinity purification Methods 0.000 description 2
- 230000002776 aggregation Effects 0.000 description 2
- 238000004220 aggregation Methods 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 229960003896 aminopterin Drugs 0.000 description 2
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 2
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 239000003708 ampul Substances 0.000 description 2
- 238000000137 annealing Methods 0.000 description 2
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 2
- 239000003963 antioxidant agent Substances 0.000 description 2
- 235000006708 antioxidants Nutrition 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 206010003246 arthritis Diseases 0.000 description 2
- 235000010323 ascorbic acid Nutrition 0.000 description 2
- 229960005070 ascorbic acid Drugs 0.000 description 2
- 239000011668 ascorbic acid Substances 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 108010051210 beta-Fructofuranosidase Proteins 0.000 description 2
- 108010005774 beta-Galactosidase Proteins 0.000 description 2
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 2
- 238000004166 bioassay Methods 0.000 description 2
- 230000003115 biocidal effect Effects 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 238000006664 bond formation reaction Methods 0.000 description 2
- 210000000988 bone and bone Anatomy 0.000 description 2
- 229940098773 bovine serum albumin Drugs 0.000 description 2
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 239000004202 carbamide Substances 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 208000015100 cartilage disease Diseases 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 238000000423 cell based assay Methods 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 238000012412 chemical coupling Methods 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 230000002759 chromosomal effect Effects 0.000 description 2
- 229960002424 collagenase Drugs 0.000 description 2
- 230000000536 complexating effect Effects 0.000 description 2
- 238000005094 computer simulation Methods 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 239000003431 cross linking reagent Substances 0.000 description 2
- 230000001351 cycling effect Effects 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 230000001086 cytosolic effect Effects 0.000 description 2
- 239000003145 cytotoxic factor Substances 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 239000003405 delayed action preparation Substances 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 235000019425 dextrin Nutrition 0.000 description 2
- 239000000032 diagnostic agent Substances 0.000 description 2
- 229940039227 diagnostic agent Drugs 0.000 description 2
- SWSQBOPZIKWTGO-UHFFFAOYSA-N dimethylaminoamidine Natural products CN(C)C(N)=N SWSQBOPZIKWTGO-UHFFFAOYSA-N 0.000 description 2
- 150000002016 disaccharides Chemical class 0.000 description 2
- 150000004662 dithiols Chemical class 0.000 description 2
- 238000012377 drug delivery Methods 0.000 description 2
- CTSPAMFJBXKSOY-UHFFFAOYSA-N ellipticine Chemical compound N1=CC=C2C(C)=C(NC=3C4=CC=CC=3)C4=C(C)C2=C1 CTSPAMFJBXKSOY-UHFFFAOYSA-N 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 239000005038 ethylene vinyl acetate Substances 0.000 description 2
- 238000002825 functional assay Methods 0.000 description 2
- 238000001502 gel electrophoresis Methods 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 238000002523 gelfiltration Methods 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 210000004602 germ cell Anatomy 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 235000004554 glutamine Nutrition 0.000 description 2
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 229940093915 gynecological organic acid Drugs 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 238000002744 homologous recombination Methods 0.000 description 2
- 230000006801 homologous recombination Effects 0.000 description 2
- 239000000017 hydrogel Substances 0.000 description 2
- 229920001477 hydrophilic polymer Polymers 0.000 description 2
- 150000002463 imidates Chemical class 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 230000016784 immunoglobulin production Effects 0.000 description 2
- 238000011532 immunohistochemical staining Methods 0.000 description 2
- 230000002637 immunotoxin Effects 0.000 description 2
- 239000002596 immunotoxin Substances 0.000 description 2
- 229940051026 immunotoxin Drugs 0.000 description 2
- 231100000608 immunotoxin Toxicity 0.000 description 2
- 230000008676 import Effects 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 238000007901 in situ hybridization Methods 0.000 description 2
- 238000011065 in-situ storage Methods 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 150000002484 inorganic compounds Chemical class 0.000 description 2
- 229910010272 inorganic material Inorganic materials 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 239000001573 invertase Substances 0.000 description 2
- 235000011073 invertase Nutrition 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- RGLRXNKKBLIBQS-XNHQSDQCSA-N leuprolide acetate Chemical compound CC(O)=O.CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 RGLRXNKKBLIBQS-XNHQSDQCSA-N 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 238000011068 loading method Methods 0.000 description 2
- 210000001161 mammalian embryo Anatomy 0.000 description 2
- 238000013507 mapping Methods 0.000 description 2
- 210000000811 metacarpophalangeal joint Anatomy 0.000 description 2
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 238000000520 microinjection Methods 0.000 description 2
- 230000005012 migration Effects 0.000 description 2
- 238000013508 migration Methods 0.000 description 2
- 239000003226 mitogen Substances 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 150000002772 monosaccharides Chemical class 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 239000002736 nonionic surfactant Substances 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 101150093139 ompT gene Proteins 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 150000007524 organic acids Chemical class 0.000 description 2
- 235000005985 organic acids Nutrition 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 2
- 229920000747 poly(lactic acid) Polymers 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 239000013587 production medium Substances 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 229910052709 silver Inorganic materials 0.000 description 2
- 239000004332 silver Substances 0.000 description 2
- 229940126586 small molecule drug Drugs 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- FQENQNTWSFEDLI-UHFFFAOYSA-J sodium diphosphate Chemical compound [Na+].[Na+].[Na+].[Na+].[O-]P([O-])(=O)OP([O-])([O-])=O FQENQNTWSFEDLI-UHFFFAOYSA-J 0.000 description 2
- 229940048086 sodium pyrophosphate Drugs 0.000 description 2
- GEHJYWRUCIMESM-UHFFFAOYSA-L sodium sulfite Chemical compound [Na+].[Na+].[O-]S([O-])=O GEHJYWRUCIMESM-UHFFFAOYSA-L 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 238000000527 sonication Methods 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 238000009987 spinning Methods 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 230000010473 stable expression Effects 0.000 description 2
- 238000011146 sterile filtration Methods 0.000 description 2
- 239000008223 sterile water Substances 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 239000012536 storage buffer Substances 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 150000005846 sugar alcohols Chemical class 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 229960002180 tetracycline Drugs 0.000 description 2
- 229930101283 tetracycline Natural products 0.000 description 2
- 235000019364 tetracycline Nutrition 0.000 description 2
- 150000003522 tetracyclines Chemical class 0.000 description 2
- 235000019818 tetrasodium diphosphate Nutrition 0.000 description 2
- 239000001577 tetrasodium phosphonato phosphate Substances 0.000 description 2
- 125000003396 thiol group Chemical group [H]S* 0.000 description 2
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 229940104230 thymidine Drugs 0.000 description 2
- 239000003104 tissue culture media Substances 0.000 description 2
- 231100000607 toxicokinetics Toxicity 0.000 description 2
- 230000001131 transforming effect Effects 0.000 description 2
- 230000014621 translational initiation Effects 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 229960005486 vaccine Drugs 0.000 description 2
- 238000003260 vortexing Methods 0.000 description 2
- 239000011534 wash buffer Substances 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- FXYPGCIGRDZWNR-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-[[3-(2,5-dioxopyrrolidin-1-yl)oxy-3-oxopropyl]disulfanyl]propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCSSCCC(=O)ON1C(=O)CCC1=O FXYPGCIGRDZWNR-UHFFFAOYSA-N 0.000 description 1
- DIGQNXIGRZPYDK-WKSCXVIASA-N (2R)-6-amino-2-[[2-[[(2S)-2-[[2-[[(2R)-2-[[(2S)-2-[[(2R,3S)-2-[[2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2R)-2-[[(2S,3S)-2-[[(2R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2R)-2-[[2-[[2-[[2-[(2-amino-1-hydroxyethylidene)amino]-3-carboxy-1-hydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1,5-dihydroxy-5-iminopentylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]hexanoic acid Chemical compound C[C@@H]([C@@H](C(=N[C@@H](CS)C(=N[C@@H](C)C(=N[C@@H](CO)C(=NCC(=N[C@@H](CCC(=N)O)C(=NC(CS)C(=N[C@H]([C@H](C)O)C(=N[C@H](CS)C(=N[C@H](CO)C(=NCC(=N[C@H](CS)C(=NCC(=N[C@H](CCCCN)C(=O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)N=C([C@H](CS)N=C([C@H](CO)N=C([C@H](CO)N=C([C@H](C)N=C(CN=C([C@H](CO)N=C([C@H](CS)N=C(CN=C(C(CS)N=C(C(CC(=O)O)N=C(CN)O)O)O)O)O)O)O)O)O)O)O)O DIGQNXIGRZPYDK-WKSCXVIASA-N 0.000 description 1
- ALBODLTZUXKBGZ-JUUVMNCLSA-N (2s)-2-amino-3-phenylpropanoic acid;(2s)-2,6-diaminohexanoic acid Chemical compound NCCCC[C@H](N)C(O)=O.OC(=O)[C@@H](N)CC1=CC=CC=C1 ALBODLTZUXKBGZ-JUUVMNCLSA-N 0.000 description 1
- XMQUEQJCYRFIQS-YFKPBYRVSA-N (2s)-2-amino-5-ethoxy-5-oxopentanoic acid Chemical compound CCOC(=O)CC[C@H](N)C(O)=O XMQUEQJCYRFIQS-YFKPBYRVSA-N 0.000 description 1
- IEUUDEWWMRQUDS-UHFFFAOYSA-N (6-azaniumylidene-1,6-dimethoxyhexylidene)azanium;dichloride Chemical compound Cl.Cl.COC(=N)CCCCC(=N)OC IEUUDEWWMRQUDS-UHFFFAOYSA-N 0.000 description 1
- NWUYHJFMYQTDRP-UHFFFAOYSA-N 1,2-bis(ethenyl)benzene;1-ethenyl-2-ethylbenzene;styrene Chemical compound C=CC1=CC=CC=C1.CCC1=CC=CC=C1C=C.C=CC1=CC=CC=C1C=C NWUYHJFMYQTDRP-UHFFFAOYSA-N 0.000 description 1
- RKDVKSZUMVYZHH-UHFFFAOYSA-N 1,4-dioxane-2,5-dione Chemical compound O=C1COC(=O)CO1 RKDVKSZUMVYZHH-UHFFFAOYSA-N 0.000 description 1
- VILFTWLXLYIEMV-UHFFFAOYSA-N 1,5-difluoro-2,4-dinitrobenzene Chemical compound [O-][N+](=O)C1=CC([N+]([O-])=O)=C(F)C=C1F VILFTWLXLYIEMV-UHFFFAOYSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- 125000003287 1H-imidazol-4-ylmethyl group Chemical group [H]N1C([H])=NC(C([H])([H])[*])=C1[H] 0.000 description 1
- VILCJCGEZXAXTO-UHFFFAOYSA-N 2,2,2-tetramine Chemical compound NCCNCCNCCN VILCJCGEZXAXTO-UHFFFAOYSA-N 0.000 description 1
- GFYGOXKIMVSMJN-UHFFFAOYSA-N 2,2-diamino-1-(4-azidophenyl)heptan-1-one Chemical compound CCCCCC(N)(N)C(=O)C1=CC=C(N=[N+]=[N-])C=C1 GFYGOXKIMVSMJN-UHFFFAOYSA-N 0.000 description 1
- 150000003923 2,5-pyrrolediones Chemical class 0.000 description 1
- KDELTXNPUXUBMU-UHFFFAOYSA-N 2-[2-[bis(carboxymethyl)amino]ethyl-(carboxymethyl)amino]acetic acid boric acid Chemical compound OB(O)O.OB(O)O.OB(O)O.OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KDELTXNPUXUBMU-UHFFFAOYSA-N 0.000 description 1
- FZDFGHZZPBUTGP-UHFFFAOYSA-N 2-[[2-[bis(carboxymethyl)amino]-3-(4-isothiocyanatophenyl)propyl]-[2-[bis(carboxymethyl)amino]propyl]amino]acetic acid Chemical compound OC(=O)CN(CC(O)=O)C(C)CN(CC(O)=O)CC(N(CC(O)=O)CC(O)=O)CC1=CC=C(N=C=S)C=C1 FZDFGHZZPBUTGP-UHFFFAOYSA-N 0.000 description 1
- WYMDDFRYORANCC-UHFFFAOYSA-N 2-[[3-[bis(carboxymethyl)amino]-2-hydroxypropyl]-(carboxymethyl)amino]acetic acid Chemical compound OC(=O)CN(CC(O)=O)CC(O)CN(CC(O)=O)CC(O)=O WYMDDFRYORANCC-UHFFFAOYSA-N 0.000 description 1
- FBUTXZSKZCQABC-UHFFFAOYSA-N 2-amino-1-methyl-7h-purine-6-thione Chemical compound S=C1N(C)C(N)=NC2=C1NC=N2 FBUTXZSKZCQABC-UHFFFAOYSA-N 0.000 description 1
- BFSVOASYOCHEOV-UHFFFAOYSA-N 2-diethylaminoethanol Chemical compound CCN(CC)CCO BFSVOASYOCHEOV-UHFFFAOYSA-N 0.000 description 1
- XBBVURRQGJPTHH-UHFFFAOYSA-N 2-hydroxyacetic acid;2-hydroxypropanoic acid Chemical compound OCC(O)=O.CC(O)C(O)=O XBBVURRQGJPTHH-UHFFFAOYSA-N 0.000 description 1
- BIGBDMFRWJRLGJ-UHFFFAOYSA-N 3-benzyl-1,5-didiazoniopenta-1,4-diene-2,4-diolate Chemical compound [N-]=[N+]=CC(=O)C(C(=O)C=[N+]=[N-])CC1=CC=CC=C1 BIGBDMFRWJRLGJ-UHFFFAOYSA-N 0.000 description 1
- PQYGLZAKNWQTCV-HNNXBMFYSA-N 4-[N'-(2-hydroxyethyl)thioureido]-L-benzyl EDTA Chemical compound OCCNC(=S)NC1=CC=C(C[C@@H](CN(CC(O)=O)CC(O)=O)N(CC(O)=O)CC(O)=O)C=C1 PQYGLZAKNWQTCV-HNNXBMFYSA-N 0.000 description 1
- NLPWSMKACWGINL-UHFFFAOYSA-N 4-azido-2-hydroxybenzoic acid Chemical compound OC(=O)C1=CC=C(N=[N+]=[N-])C=C1O NLPWSMKACWGINL-UHFFFAOYSA-N 0.000 description 1
- 108010066676 Abrin Proteins 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 241000014654 Adna Species 0.000 description 1
- 241000589155 Agrobacterium tumefaciens Species 0.000 description 1
- WQVFQXXBNHHPLX-ZKWXMUAHSA-N Ala-Ala-His Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1cnc[nH]1)C(O)=O WQVFQXXBNHHPLX-ZKWXMUAHSA-N 0.000 description 1
- YYSWCHMLFJLLBJ-ZLUOBGJFSA-N Ala-Ala-Ser Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YYSWCHMLFJLLBJ-ZLUOBGJFSA-N 0.000 description 1
- 101710187573 Alcohol dehydrogenase 2 Proteins 0.000 description 1
- 101710133776 Alcohol dehydrogenase class-3 Proteins 0.000 description 1
- 108700028369 Alleles Proteins 0.000 description 1
- 244000153158 Ammi visnaga Species 0.000 description 1
- 235000010585 Ammi visnaga Nutrition 0.000 description 1
- BHSYMWWMVRPCPA-CYDGBPFRSA-N Arg-Arg-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H](N)CCCN=C(N)N BHSYMWWMVRPCPA-CYDGBPFRSA-N 0.000 description 1
- PTVGLOCPAVYPFG-CIUDSAMLSA-N Arg-Gln-Asp Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O PTVGLOCPAVYPFG-CIUDSAMLSA-N 0.000 description 1
- 208000002109 Argyria Diseases 0.000 description 1
- PTNFNTOBUDWHNZ-GUBZILKMSA-N Asn-Arg-Met Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(O)=O PTNFNTOBUDWHNZ-GUBZILKMSA-N 0.000 description 1
- LJUOLNXOWSWGKF-ACZMJKKPSA-N Asn-Asn-Glu Chemical compound C(CC(=O)O)[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)N)N LJUOLNXOWSWGKF-ACZMJKKPSA-N 0.000 description 1
- KHCNTVRVAYCPQE-CIUDSAMLSA-N Asn-Lys-Asn Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(O)=O KHCNTVRVAYCPQE-CIUDSAMLSA-N 0.000 description 1
- FANQWNCPNFEPGZ-WHFBIAKZSA-N Asp-Asp-Gly Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O FANQWNCPNFEPGZ-WHFBIAKZSA-N 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 241000351920 Aspergillus nidulans Species 0.000 description 1
- 241000228245 Aspergillus niger Species 0.000 description 1
- 101000669426 Aspergillus restrictus Ribonuclease mitogillin Proteins 0.000 description 1
- 102100022717 Atypical chemokine receptor 1 Human genes 0.000 description 1
- 241000713842 Avian sarcoma virus Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- 101001011741 Bos taurus Insulin Proteins 0.000 description 1
- 101000766308 Bos taurus Serotransferrin Proteins 0.000 description 1
- 241000701822 Bovine papillomavirus Species 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000222122 Candida albicans Species 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 101710158575 Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase Proteins 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- OKTJSMMVPCPJKN-NJFSPNSNSA-N Carbon-14 Chemical compound [14C] OKTJSMMVPCPJKN-NJFSPNSNSA-N 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 102100023321 Ceruloplasmin Human genes 0.000 description 1
- 108091062157 Cis-regulatory element Proteins 0.000 description 1
- 108010071942 Colony-Stimulating Factors Proteins 0.000 description 1
- 102000007644 Colony-Stimulating Factors Human genes 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 239000004971 Cross linker Substances 0.000 description 1
- 108700032819 Croton tiglium crotin II Proteins 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-UWTATZPHSA-N D-alanine Chemical compound C[C@@H](N)C(O)=O QNAYBMKLOCPYGJ-UWTATZPHSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-UHFFFAOYSA-N D-alpha-Ala Natural products CC([NH3+])C([O-])=O QNAYBMKLOCPYGJ-UHFFFAOYSA-N 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 101710202200 Endolysin A Proteins 0.000 description 1
- 241000588914 Enterobacter Species 0.000 description 1
- 241000588921 Enterobacteriaceae Species 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000588698 Erwinia Species 0.000 description 1
- 241000588722 Escherichia Species 0.000 description 1
- 241001646716 Escherichia coli K-12 Species 0.000 description 1
- IMROMDMJAWUWLK-UHFFFAOYSA-N Ethenol Chemical compound OC=C IMROMDMJAWUWLK-UHFFFAOYSA-N 0.000 description 1
- 102100037110 Eukaryotic translation initiation factor 3 subunit K Human genes 0.000 description 1
- 101710082714 Exotoxin A Proteins 0.000 description 1
- 108050001049 Extracellular proteins Proteins 0.000 description 1
- 108091008794 FGF receptors Proteins 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 102000044168 Fibroblast Growth Factor Receptor Human genes 0.000 description 1
- 102100026545 Fibronectin type III domain-containing protein 3B Human genes 0.000 description 1
- 229920001917 Ficoll Polymers 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- 241000700662 Fowlpox virus Species 0.000 description 1
- 108700004714 Gelonium multiflorum GEL Proteins 0.000 description 1
- NUSWUSKZRCGFEX-FXQIFTODSA-N Glu-Glu-Cys Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CS)C(O)=O NUSWUSKZRCGFEX-FXQIFTODSA-N 0.000 description 1
- 108010073178 Glucan 1,4-alpha-Glucosidase Proteins 0.000 description 1
- 102100022624 Glucoamylase Human genes 0.000 description 1
- 102000030595 Glucokinase Human genes 0.000 description 1
- 108010021582 Glucokinase Proteins 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- 102000009465 Growth Factor Receptors Human genes 0.000 description 1
- 108010009202 Growth Factor Receptors Proteins 0.000 description 1
- ZIXGXMMUKPLXBB-UHFFFAOYSA-N Guatambuinine Natural products N1C2=CC=CC=C2C2=C1C(C)=C1C=CN=C(C)C1=C2 ZIXGXMMUKPLXBB-UHFFFAOYSA-N 0.000 description 1
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 208000031886 HIV Infections Diseases 0.000 description 1
- 208000037357 HIV infectious disease Diseases 0.000 description 1
- 101100508941 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) ppa gene Proteins 0.000 description 1
- 241001149669 Hanseniaspora Species 0.000 description 1
- 241000700721 Hepatitis B virus Species 0.000 description 1
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 1
- 102000005548 Hexokinase Human genes 0.000 description 1
- 108700040460 Hexokinases Proteins 0.000 description 1
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 1
- LYCVKHSJGDMDLM-LURJTMIESA-N His-Gly Chemical compound OC(=O)CNC(=O)[C@@H](N)CC1=CN=CN1 LYCVKHSJGDMDLM-LURJTMIESA-N 0.000 description 1
- 101000678879 Homo sapiens Atypical chemokine receptor 1 Proteins 0.000 description 1
- 101000881804 Homo sapiens Eukaryotic translation initiation factor 3 subunit K Proteins 0.000 description 1
- 101000913642 Homo sapiens Fibronectin type III domain-containing protein 3B Proteins 0.000 description 1
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 1
- 101000946138 Homo sapiens Lipocalin-15 Proteins 0.000 description 1
- 101000917826 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-a Proteins 0.000 description 1
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 1
- 101000580722 Homo sapiens RNA-binding protein 26 Proteins 0.000 description 1
- 101000628885 Homo sapiens Suppressor of fused homolog Proteins 0.000 description 1
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 1
- 101000831834 Homo sapiens Transmembrane protein 231 Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 102000002265 Human Growth Hormone Human genes 0.000 description 1
- 108010000521 Human Growth Hormone Proteins 0.000 description 1
- 239000000854 Human Growth Hormone Substances 0.000 description 1
- 241000701109 Human adenovirus 2 Species 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 206010060378 Hyperinsulinaemia Diseases 0.000 description 1
- 206010070070 Hypoinsulinaemia Diseases 0.000 description 1
- 108010073807 IgG Receptors Proteins 0.000 description 1
- IOVUXUSIGXCREV-DKIMLUQUSA-N Ile-Leu-Phe Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 IOVUXUSIGXCREV-DKIMLUQUSA-N 0.000 description 1
- TUYOFUHICRWDGA-CIUDSAMLSA-N Ile-Met Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@H](C(O)=O)CCSC TUYOFUHICRWDGA-CIUDSAMLSA-N 0.000 description 1
- IPFKIGNDTUOFAF-CYDGBPFRSA-N Ile-Val-Arg Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CCCN=C(N)N IPFKIGNDTUOFAF-CYDGBPFRSA-N 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 102000012745 Immunoglobulin Subunits Human genes 0.000 description 1
- 108010079585 Immunoglobulin Subunits Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 208000026350 Inborn Genetic disease Diseases 0.000 description 1
- 238000012695 Interfacial polymerization Methods 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 241000588748 Klebsiella Species 0.000 description 1
- 241000235058 Komagataella pastoris Species 0.000 description 1
- FADYJNXDPBKVCA-UHFFFAOYSA-N L-Phenylalanyl-L-lysin Natural products NCCCCC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FADYJNXDPBKVCA-UHFFFAOYSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 241000481961 Lachancea thermotolerans Species 0.000 description 1
- 241000235651 Lachancea waltii Species 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- HSQGMTRYSIHDAC-BQBZGAKWSA-N Leu-Ala Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(O)=O HSQGMTRYSIHDAC-BQBZGAKWSA-N 0.000 description 1
- 102000004882 Lipase Human genes 0.000 description 1
- 108090001060 Lipase Proteins 0.000 description 1
- 239000004367 Lipase Substances 0.000 description 1
- 102100034721 Lipocalin-15 Human genes 0.000 description 1
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 239000006137 Luria-Bertani broth Substances 0.000 description 1
- 239000004907 Macro-emulsion Substances 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 102000003792 Metallothionein Human genes 0.000 description 1
- 108090000157 Metallothionein Proteins 0.000 description 1
- 244000302512 Momordica charantia Species 0.000 description 1
- 235000009811 Momordica charantia Nutrition 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical class ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 1
- 125000000729 N-terminal amino-acid group Chemical group 0.000 description 1
- WTBIAPVQQBCLFP-UHFFFAOYSA-N N.N.N.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O Chemical compound N.N.N.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O WTBIAPVQQBCLFP-UHFFFAOYSA-N 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 102000007339 Nerve Growth Factor Receptors Human genes 0.000 description 1
- 108010032605 Nerve Growth Factor Receptors Proteins 0.000 description 1
- 241000221960 Neurospora Species 0.000 description 1
- 241000221961 Neurospora crassa Species 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 230000004989 O-glycosylation Effects 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 108010067372 Pancreatic elastase Proteins 0.000 description 1
- 102000016387 Pancreatic elastase Human genes 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 108010087702 Penicillinase Proteins 0.000 description 1
- 241000228143 Penicillium Species 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- KIQUCMUULDXTAZ-HJOGWXRNSA-N Phe-Tyr-Tyr Chemical compound N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(O)=O KIQUCMUULDXTAZ-HJOGWXRNSA-N 0.000 description 1
- 102000001105 Phosphofructokinases Human genes 0.000 description 1
- 108010069341 Phosphofructokinases Proteins 0.000 description 1
- 102000012288 Phosphopyruvate Hydratase Human genes 0.000 description 1
- 108010022181 Phosphopyruvate Hydratase Proteins 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 101100413173 Phytolacca americana PAP2 gene Proteins 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 229920001030 Polyethylene Glycol 4000 Polymers 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 241001505332 Polyomavirus sp. Species 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 239000004372 Polyvinyl alcohol Substances 0.000 description 1
- 101800001357 Potential peptide Proteins 0.000 description 1
- 102400000745 Potential peptide Human genes 0.000 description 1
- 101100485741 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) Pro_1271 gene Proteins 0.000 description 1
- 101100126776 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) adk gene Proteins 0.000 description 1
- 101100446997 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) folD gene Proteins 0.000 description 1
- 101100205167 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) lysS gene Proteins 0.000 description 1
- 101100028536 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) panB gene Proteins 0.000 description 1
- 101100073771 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) thrB gene Proteins 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 241000588769 Proteus <enterobacteria> Species 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 1
- 101100084022 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) lapA gene Proteins 0.000 description 1
- 108010011939 Pyruvate Decarboxylase Proteins 0.000 description 1
- 102000013009 Pyruvate Kinase Human genes 0.000 description 1
- 108020005115 Pyruvate Kinase Proteins 0.000 description 1
- 102100027477 RNA-binding protein 26 Human genes 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 102000004879 Racemases and epimerases Human genes 0.000 description 1
- 108090001066 Racemases and epimerases Proteins 0.000 description 1
- OVSNDJXCFPSPDZ-UHFFFAOYSA-N Reactive red 120 Chemical compound OS(=O)(=O)C1=CC2=CC(S(O)(=O)=O)=CC(NC=3N=C(NC=4C=CC(NC=5N=C(NC=6C7=C(O)C(N=NC=8C(=CC=CC=8)S(O)(=O)=O)=C(C=C7C=C(C=6)S(O)(=O)=O)S(O)(=O)=O)N=C(Cl)N=5)=CC=4)N=C(Cl)N=3)=C2C(O)=C1N=NC1=CC=CC=C1S(O)(=O)=O OVSNDJXCFPSPDZ-UHFFFAOYSA-N 0.000 description 1
- 108091005682 Receptor kinases Proteins 0.000 description 1
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 1
- 101710100968 Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 241000223252 Rhodotorula Species 0.000 description 1
- SUYXJDLXGFPMCQ-INIZCTEOSA-N SJ000287331 Natural products CC1=c2cnccc2=C(C)C2=Nc3ccccc3[C@H]12 SUYXJDLXGFPMCQ-INIZCTEOSA-N 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- 241000235347 Schizosaccharomyces pombe Species 0.000 description 1
- 241000311088 Schwanniomyces Species 0.000 description 1
- 241001123650 Schwanniomyces occidentalis Species 0.000 description 1
- 108091058545 Secretory proteins Proteins 0.000 description 1
- 102000040739 Secretory proteins Human genes 0.000 description 1
- 108090000184 Selectins Proteins 0.000 description 1
- 102000003800 Selectins Human genes 0.000 description 1
- QMCDMHWAKMUGJE-IHRRRGAJSA-N Ser-Phe-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(O)=O QMCDMHWAKMUGJE-IHRRRGAJSA-N 0.000 description 1
- FZXOPYUEQGDGMS-ACZMJKKPSA-N Ser-Ser-Gln Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(O)=O FZXOPYUEQGDGMS-ACZMJKKPSA-N 0.000 description 1
- DKGRNFUXVTYRAS-UBHSHLNASA-N Ser-Ser-Trp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O DKGRNFUXVTYRAS-UBHSHLNASA-N 0.000 description 1
- 241000607768 Shigella Species 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 241000256248 Spodoptera Species 0.000 description 1
- 241000256251 Spodoptera frugiperda Species 0.000 description 1
- 241000269319 Squalius cephalus Species 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 102100026939 Suppressor of fused homolog Human genes 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 1
- WDLRUFUQRNWCPK-UHFFFAOYSA-N Tetraxetan Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CCN(CC(O)=O)CC1 WDLRUFUQRNWCPK-UHFFFAOYSA-N 0.000 description 1
- ZMZDMBWJUHKJPS-UHFFFAOYSA-M Thiocyanate anion Chemical compound [S-]C#N ZMZDMBWJUHKJPS-UHFFFAOYSA-M 0.000 description 1
- COYHRQWNJDJCNA-NUJDXYNKSA-N Thr-Thr-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O COYHRQWNJDJCNA-NUJDXYNKSA-N 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 108010000499 Thromboplastin Proteins 0.000 description 1
- 102000006601 Thymidine Kinase Human genes 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 108010034949 Thyroglobulin Proteins 0.000 description 1
- 102000009843 Thyroglobulin Human genes 0.000 description 1
- 102100030859 Tissue factor Human genes 0.000 description 1
- 241001149964 Tolypocladium Species 0.000 description 1
- 108700009124 Transcription Initiation Site Proteins 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 102100024183 Transmembrane protein 231 Human genes 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- 241000223259 Trichoderma Species 0.000 description 1
- 102000005924 Triose-Phosphate Isomerase Human genes 0.000 description 1
- 108700015934 Triose-phosphate isomerases Proteins 0.000 description 1
- 101710162629 Trypsin inhibitor Proteins 0.000 description 1
- 229940122618 Trypsin inhibitor Drugs 0.000 description 1
- ARJASMXQBRNAGI-YESZJQIVSA-N Tyr-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC2=CC=C(C=C2)O)N ARJASMXQBRNAGI-YESZJQIVSA-N 0.000 description 1
- 108091023045 Untranslated Region Proteins 0.000 description 1
- 108091034131 VA RNA Proteins 0.000 description 1
- 244000000188 Vaccinium ovalifolium Species 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 240000001866 Vernicia fordii Species 0.000 description 1
- 108020005202 Viral DNA Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 102100038968 WAP four-disulfide core domain protein 1 Human genes 0.000 description 1
- 241000235013 Yarrowia Species 0.000 description 1
- HMNZFMSWFCAGGW-XPWSMXQVSA-N [3-[hydroxy(2-hydroxyethoxy)phosphoryl]oxy-2-[(e)-octadec-9-enoyl]oxypropyl] (e)-octadec-9-enoate Chemical compound CCCCCCCC\C=C\CCCCCCCC(=O)OCC(COP(O)(=O)OCCO)OC(=O)CCCCCCC\C=C\CCCCCCCC HMNZFMSWFCAGGW-XPWSMXQVSA-N 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 239000003929 acidic solution Substances 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 238000012867 alanine scanning Methods 0.000 description 1
- 150000001299 aldehydes Chemical class 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- 108010001818 alpha-sarcin Proteins 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 150000001412 amines Chemical group 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 238000012443 analytical study Methods 0.000 description 1
- 238000004873 anchoring Methods 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 210000000628 antibody-producing cell Anatomy 0.000 description 1
- 239000002518 antifoaming agent Substances 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 239000002787 antisense oligonuctleotide Substances 0.000 description 1
- 210000001188 articular cartilage Anatomy 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 1
- 244000052616 bacterial pathogen Species 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 239000012867 bioactive agent Substances 0.000 description 1
- 229920002988 biodegradable polymer Polymers 0.000 description 1
- 239000004621 biodegradable polymer Substances 0.000 description 1
- 230000008033 biological extinction Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 230000006287 biotinylation Effects 0.000 description 1
- 238000007413 biotinylation Methods 0.000 description 1
- 210000002459 blastocyst Anatomy 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- IXIBAKNTJSCKJM-BUBXBXGNSA-N bovine insulin Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H]1CSSC[C@H]2C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3C=CC(O)=CC=3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3NC=NC=3)NC(=O)[C@H](CO)NC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O)=O)CSSC[C@@H](C(N2)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)C(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C=CC=CC=1)C(C)C)C1=CN=CN1 IXIBAKNTJSCKJM-BUBXBXGNSA-N 0.000 description 1
- 239000008366 buffered solution Substances 0.000 description 1
- 230000003139 buffering effect Effects 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229940041514 candida albicans extract Drugs 0.000 description 1
- FPPNZSSZRUTDAP-UWFZAAFLSA-N carbenicillin Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)C(C(O)=O)C1=CC=CC=C1 FPPNZSSZRUTDAP-UWFZAAFLSA-N 0.000 description 1
- 229960003669 carbenicillin Drugs 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 238000012219 cassette mutagenesis Methods 0.000 description 1
- 239000003729 cation exchange resin Substances 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 230000022534 cell killing Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 230000010307 cell transformation Effects 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 230000002032 cellular defenses Effects 0.000 description 1
- 230000030570 cellular localization Effects 0.000 description 1
- 230000009920 chelation Effects 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 238000011098 chromatofocusing Methods 0.000 description 1
- 239000012539 chromatography resin Substances 0.000 description 1
- 239000003593 chromogenic compound Substances 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 101150074451 clpP gene Proteins 0.000 description 1
- 101150043719 clpP1 gene Proteins 0.000 description 1
- 101150102296 clpP2 gene Proteins 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 238000000749 co-immunoprecipitation Methods 0.000 description 1
- 238000005354 coacervation Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 229940047120 colony stimulating factors Drugs 0.000 description 1
- 230000001447 compensatory effect Effects 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 230000006957 competitive inhibition Effects 0.000 description 1
- 239000008139 complexing agent Substances 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 230000001268 conjugating effect Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000005289 controlled pore glass Substances 0.000 description 1
- 238000013270 controlled release Methods 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000007822 coupling agent Substances 0.000 description 1
- 239000011243 crosslinked material Substances 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- UFULAYFCSOUIOV-UHFFFAOYSA-N cysteamine Chemical compound NCCS UFULAYFCSOUIOV-UHFFFAOYSA-N 0.000 description 1
- 102000003675 cytokine receptors Human genes 0.000 description 1
- 108010057085 cytokine receptors Proteins 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000006240 deamidation Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000022811 deglycosylation Effects 0.000 description 1
- 239000007857 degradation product Substances 0.000 description 1
- 230000003413 degradative effect Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000009795 derivation Methods 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 229930191339 dianthin Natural products 0.000 description 1
- 238000001085 differential centrifugation Methods 0.000 description 1
- 238000002050 diffraction method Methods 0.000 description 1
- 125000005442 diisocyanate group Chemical group 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 239000004205 dimethyl polysiloxane Substances 0.000 description 1
- 206010013023 diphtheria Diseases 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- ZWIBGKZDAWNIFC-UHFFFAOYSA-N disuccinimidyl suberate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCCC(=O)ON1C(=O)CCC1=O ZWIBGKZDAWNIFC-UHFFFAOYSA-N 0.000 description 1
- 125000002228 disulfide group Chemical group 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 238000009509 drug development Methods 0.000 description 1
- 238000007878 drug screening assay Methods 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 230000012202 endocytosis Effects 0.000 description 1
- 230000002616 endonucleolytic effect Effects 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- 108010028531 enomycin Proteins 0.000 description 1
- HKSZLNNOFSGOKW-UHFFFAOYSA-N ent-staurosporine Natural products C12=C3N4C5=CC=CC=C5C3=C3CNC(=O)C3=C2C2=CC=CC=C2N1C1CC(NC)C(OC)C4(C)O1 HKSZLNNOFSGOKW-UHFFFAOYSA-N 0.000 description 1
- 230000007515 enzymatic degradation Effects 0.000 description 1
- 230000006862 enzymatic digestion Effects 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 238000012869 ethanol precipitation Methods 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 238000002270 exclusion chromatography Methods 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 238000001400 expression cloning Methods 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- 239000003527 fibrinolytic agent Substances 0.000 description 1
- 239000000706 filtrate Substances 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 150000002222 fluorine compounds Chemical class 0.000 description 1
- 239000012537 formulation buffer Substances 0.000 description 1
- 238000005194 fractionation Methods 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 238000012252 genetic analysis Methods 0.000 description 1
- 208000016361 genetic disease Diseases 0.000 description 1
- 108060003196 globin Proteins 0.000 description 1
- 102000018146 globin Human genes 0.000 description 1
- 230000004190 glucose uptake Effects 0.000 description 1
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 1
- 125000000404 glutamine group Chemical group N[C@@H](CCC(N)=O)C(=O)* 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 230000002414 glycolytic effect Effects 0.000 description 1
- 229930182470 glycoside Natural products 0.000 description 1
- 150000002338 glycosides Chemical class 0.000 description 1
- 210000004349 growth plate Anatomy 0.000 description 1
- 125000001475 halogen functional group Chemical group 0.000 description 1
- 108010067006 heat stable toxin (E coli) Proteins 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 210000000548 hind-foot Anatomy 0.000 description 1
- 208000033519 human immunodeficiency virus infectious disease Diseases 0.000 description 1
- 229920001600 hydrophobic polymer Polymers 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 229920003063 hydroxymethyl cellulose Polymers 0.000 description 1
- 229940031574 hydroxymethyl cellulose Drugs 0.000 description 1
- 230000003451 hyperinsulinaemic effect Effects 0.000 description 1
- 201000008980 hyperinsulinism Diseases 0.000 description 1
- 230000035860 hypoinsulinemia Effects 0.000 description 1
- 101150020087 ilvG gene Proteins 0.000 description 1
- 230000014726 immortalization of host cell Effects 0.000 description 1
- 210000004201 immune sera Anatomy 0.000 description 1
- 229940042743 immune sera Drugs 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000000984 immunochemical effect Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 239000000138 intercalating agent Substances 0.000 description 1
- 230000008611 intercellular interaction Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- 239000000543 intermediate Substances 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 230000026045 iodination Effects 0.000 description 1
- 238000006192 iodination reaction Methods 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 1
- JJTUDXZGHPGLLC-UHFFFAOYSA-N lactide Chemical compound CC1OC(=O)C(C)OC1=O JJTUDXZGHPGLLC-UHFFFAOYSA-N 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 238000010667 large scale reaction Methods 0.000 description 1
- 230000002045 lasting effect Effects 0.000 description 1
- 150000002611 lead compounds Chemical class 0.000 description 1
- 108010071185 leucyl-alanine Proteins 0.000 description 1
- 229960004338 leuprorelin Drugs 0.000 description 1
- 235000019421 lipase Nutrition 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 238000009630 liquid culture Methods 0.000 description 1
- 210000005229 liver cell Anatomy 0.000 description 1
- 210000005265 lung cell Anatomy 0.000 description 1
- 229940087857 lupron Drugs 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 230000002101 lytic effect Effects 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 229960003151 mercaptamine Drugs 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- YCXSYMVGMXQYNT-UHFFFAOYSA-N methyl 3-[(4-azidophenyl)disulfanyl]propanimidate Chemical compound COC(=N)CCSSC1=CC=C(N=[N+]=[N-])C=C1 YCXSYMVGMXQYNT-UHFFFAOYSA-N 0.000 description 1
- DFTAZNAEBRBBKP-UHFFFAOYSA-N methyl 4-sulfanylbutanimidate Chemical compound COC(=N)CCCS DFTAZNAEBRBBKP-UHFFFAOYSA-N 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 108010010621 modeccin Proteins 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 239000002547 new drug Substances 0.000 description 1
- 102000042567 non-coding RNA Human genes 0.000 description 1
- 238000001668 nucleic acid synthesis Methods 0.000 description 1
- 229920002113 octoxynol Polymers 0.000 description 1
- 229940046166 oligodeoxynucleotide Drugs 0.000 description 1
- 229940124276 oligodeoxyribonucleotide Drugs 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 150000002894 organic compounds Chemical class 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 239000006174 pH buffer Substances 0.000 description 1
- 238000004091 panning Methods 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 229950009506 penicillinase Drugs 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 210000005105 peripheral blood lymphocyte Anatomy 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 108010076042 phenomycin Proteins 0.000 description 1
- 101150009573 phoA gene Proteins 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 1
- 150000004713 phosphodiesters Chemical group 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 239000000902 placebo Substances 0.000 description 1
- 229940068196 placebo Drugs 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920000729 poly(L-lysine) polymer Polymers 0.000 description 1
- 229920000435 poly(dimethylsiloxane) Polymers 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 229940057838 polyethylene glycol 4000 Drugs 0.000 description 1
- 229920002338 polyhydroxyethylmethacrylate Polymers 0.000 description 1
- 108010055896 polyornithine Proteins 0.000 description 1
- 229920002714 polyornithine Polymers 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229920001296 polysiloxane Polymers 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 238000011176 pooling Methods 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 230000001323 posttranslational effect Effects 0.000 description 1
- 230000002028 premature Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 108010077112 prolyl-proline Proteins 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 235000019419 proteases Nutrition 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 230000006916 protein interaction Effects 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 229940024999 proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 230000008707 rearrangement Effects 0.000 description 1
- 230000010837 receptor-mediated endocytosis Effects 0.000 description 1
- 239000001044 red dye Substances 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000010242 retro-orbital bleeding Methods 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000013391 scatchard analysis Methods 0.000 description 1
- 101150017402 sec72 gene Proteins 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 210000000717 sertoli cell Anatomy 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- PTLRDCMBXHILCL-UHFFFAOYSA-M sodium arsenite Chemical compound [Na+].[O-][As]=O PTLRDCMBXHILCL-UHFFFAOYSA-M 0.000 description 1
- 239000012064 sodium phosphate buffer Substances 0.000 description 1
- 235000010265 sodium sulphite Nutrition 0.000 description 1
- HAEPBEMBOAIUPN-UHFFFAOYSA-L sodium tetrathionate Chemical compound O.O.[Na+].[Na+].[O-]S(=O)(=O)SSS([O-])(=O)=O HAEPBEMBOAIUPN-UHFFFAOYSA-L 0.000 description 1
- 238000005063 solubilization Methods 0.000 description 1
- 230000007928 solubilization Effects 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- HKSZLNNOFSGOKW-FYTWVXJKSA-N staurosporine Chemical compound C12=C3N4C5=CC=CC=C5C3=C3CNC(=O)C3=C2C2=CC=CC=C2N1[C@H]1C[C@@H](NC)[C@@H](OC)[C@]4(C)O1 HKSZLNNOFSGOKW-FYTWVXJKSA-N 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 210000001768 subcellular fraction Anatomy 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000004114 suspension culture Methods 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 208000001608 teratocarcinoma Diseases 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- CNHYKKNIIGEXAY-UHFFFAOYSA-N thiolan-2-imine Chemical compound N=C1CCCS1 CNHYKKNIIGEXAY-UHFFFAOYSA-N 0.000 description 1
- 229960000103 thrombolytic agent Drugs 0.000 description 1
- 229960002175 thyroglobulin Drugs 0.000 description 1
- 230000036964 tight binding Effects 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 108091006106 transcriptional activators Proteins 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 239000012096 transfection reagent Substances 0.000 description 1
- 238000000844 transformation Methods 0.000 description 1
- 230000010474 transient expression Effects 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- YNJBWRMUSHSURL-UHFFFAOYSA-N trichloroacetic acid Chemical compound OC(=O)C(Cl)(Cl)Cl YNJBWRMUSHSURL-UHFFFAOYSA-N 0.000 description 1
- HRXKRNGNAMMEHJ-UHFFFAOYSA-K trisodium citrate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O HRXKRNGNAMMEHJ-UHFFFAOYSA-K 0.000 description 1
- 229940038773 trisodium citrate Drugs 0.000 description 1
- 239000002753 trypsin inhibitor Substances 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 239000012138 yeast extract Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4748—Tumour specific antigens; Tumour rejection antigen precursors [TRAP], e.g. MAGE
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
- C07K14/4703—Inhibitors; Suppressors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70546—Integrin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/82—Translation products from oncogenes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K17/00—Carrier-bound or immobilised peptides; Preparation thereof
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/001—Oxidoreductases (1.) acting on the CH-CH group of donors (1.3)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/1048—Glycosyltransferases (2.4)
- C12N9/1051—Hexosyltransferases (2.4.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/90—Isomerases (5.)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
- C12P21/02—Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
- C12P21/06—Preparation of peptides or proteins produced by the hydrolysis of a peptide bond, e.g. hydrolysate products
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
- C12Q1/6883—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
- C12Q1/6886—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/5011—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing antineoplastic activity
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/5014—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing toxicity
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/502—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing non-proliferative effects
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/5044—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving specific cell types
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/5044—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving specific cell types
- G01N33/5047—Cells of the immune system
- G01N33/505—Cells of the immune system involving T-cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/5044—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving specific cell types
- G01N33/5061—Muscle cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57484—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6803—General methods of protein analysis not limited to specific proteins or families of proteins
- G01N33/6845—Methods of identifying protein-protein interactions in protein mixtures
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2799/00—Uses of viruses
- C12N2799/02—Uses of viruses as vector
- C12N2799/021—Uses of viruses as vector for the expression of a heterologous nucleic acid
- C12N2799/026—Uses of viruses as vector for the expression of a heterologous nucleic acid where the vector is derived from a baculovirus
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/136—Screening for pharmacological compounds
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/158—Expression markers
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/04—Endocrine or metabolic disorders
- G01N2800/042—Disorders of carbohydrate metabolism, e.g. diabetes, glucose metabolism
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y10—TECHNICAL SUBJECTS COVERED BY FORMER USPC
- Y10S—TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y10S530/00—Chemistry: natural resins or derivatives; peptides or proteins; lignins or reaction products thereof
- Y10S530/827—Proteins from mammals or birds
- Y10S530/828—Cancer
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y10—TECHNICAL SUBJECTS COVERED BY FORMER USPC
- Y10S—TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y10S530/00—Chemistry: natural resins or derivatives; peptides or proteins; lignins or reaction products thereof
- Y10S530/866—Chemistry: natural resins or derivatives; peptides or proteins; lignins or reaction products thereof involving immunoglobulin or antibody fragment, e.g. fab', fab, fv, fc, heavy chain or light chain
Definitions
- the present invention relates generally to the identification and isolation of novel DNA and to the recombinant production of novel polypeptides.
- Extracellular proteins play important roles in, among other things, the formation, differentiation and maintenance of multicellular organisms.
- secreted polypeptides for instance, mitogenic factors, survival factors, cytotoxic factors, differentiation factors, neuropeptides, and hormones
- secreted polypeptides or signaling molecules normally pass through the cellular secretory pathway to reach their site of action in the extracellular environment.
- Secreted proteins have various industrial applications, including as pharmaceuticals, diagnostics, biosensors and bioreactors.
- Most protein drugs available at present, such as thrombolytic agents, interferons, interleukins, erythropoietins, colony stimulating factors, and various other cytokines, are secretory proteins.
- Their receptors, which are membrane proteins, also have potential as therapeutic or diagnostic agents.
- Efforts are being undertaken by both industry and proficient to identify new, native secreted proteins. Many efforts are focused on the screening of mammalian recombinant DNA libraries to identify the coding sequences for novel secreted proteins. Examples of screening methods and techniques are described in the literature [see, for example, Klein et al., Proc. Natl. Acad. Sci. 93:7108-7113 (1996); U.S. Pat. No. 5,536,637)].
- Membrane-bound proteins and receptors can play important roles in, among other things, the formation, differentiation and maintenance of multicellular organisms.
- membrane-bound proteins and cell receptors include, but are not limited to, cytokine receptors, receptor kinases, receptor phosphatases, receptors involved in cell-cell interactions, and cellular adhesin molecules like selectins and integrins. For instance, transduction of signals that regulate cell growth and differentiation is regulated in part by phosphorylation of various cellular proteins. Protein tyrosine kinases, enzymes that catalyze that process, can also act as growth factor receptors. Examples include fibroblast growth factor receptor and nerve growth factor receptor.
- Membrane-bound proteins and receptor molecules have various industrial applications, including as pharmaceutical and diagnostic agents.
- Receptor immunoadhesins for instance, can be employed as therapeutic agents to block receptor-ligand interactions.
- the membrane-bound proteins can also be employed for screening of potential peptide or small molecule inhibitors of the relevant receptor/ligand interaction.
- the invention provides an isolated nucleic acid molecule comprising a nucleotide sequence that encodes a PRO polypeptide.
- the isolated nucleic acid molecule comprises a nucleotide sequence having at least about 80% nucleic acid sequence identity, alternatively at least about 81% nucleic acid sequence identity, alternatively at least about 82% nucleic acid sequence identity, alternatively at least about 83% nucleic acid sequence identity, alternatively at least about 84% nucleic acid sequence identity, alternatively at least about 85% nucleic acid sequence identity, alternatively at least about 86% nucleic acid sequence identity, alternatively at least about 87% nucleic acid sequence identity, alternatively at least about 88% nucleic acid sequence identity, alternatively at least about 89% nucleic acid sequence identity, alternatively at least about 90% nucleic acid sequence identity, alternatively at least about 91% nucleic acid sequence identity, alternatively at least about 92% nucleic acid sequence identity, alternatively at least about 93% nucleic acid sequence identity, alternatively at least about 94% nucleic acid sequence identity, alternatively at least about 95% nucleic acid sequence identity, alternatively at least about 96% nu
- the isolated nucleic acid molecule comprises a nucleotide sequence having at least about 80% nucleic acid sequence identity, alternatively at least about 81% nucleic acid sequence identity, alternatively at least about 82% nucleic acid sequence identity, alternatively at least about 83% nucleic acid sequence identity, alternatively at least about 84% nucleic acid sequence identity, alternatively at least about 85% nucleic acid sequence identity, alternatively at least about 86% nucleic acid sequence identity, alternatively at least about 87% nucleic acid sequence identity, alternatively at least about 88% nucleic acid sequence identity, alternatively at least about 89% nucleic acid sequence identity, alternatively at least about 90% nucleic acid sequence identity, alternatively at least about 91% nucleic acid sequence identity, alternatively at least about 92% nucleic acid sequence identity, alternatively at least about 93% nucleic acid sequence identity, alternatively at least about 94% nucleic acid sequence identity, alternatively at least about 95% nucleic acid sequence identity, alternatively at least about 96% nu
- the invention concerns an isolated nucleic acid molecule comprising a nucleotide sequence having at least about 80% nucleic acid sequence identity, alternatively at least about 81% nucleic acid sequence identity, alternatively at least about 82% nucleic acid sequence identity, alternatively at least about 83% nucleic acid sequence identity, alternatively at least about 84% nucleic acid sequence identity, alternatively at least about 85% nucleic acid sequence identity, alternatively at least about 86% nucleic acid sequence identity, alternatively at least about 87% nucleic acid sequence identity, alternatively at least about 88% nucleic acid sequence identity, alternatively at least about 89% nucleic acid sequence identity, alternatively at least about 90% nucleic acid sequence identity, alternatively at least about 91% nucleic acid sequence identity, alternatively at least about 92% nucleic acid sequence identity, alternatively at least about 93% nucleic acid sequence identity, alternatively at least about 94% nucleic acid sequence identity, alternatively at least about 95% nucleic acid sequence identity, alternatively
- Another aspect the invention provides an isolated nucleic acid molecule comprising a nucleotide sequence encoding a PRO polypeptide which is either transmembrane domain-deleted or transmembrane domain-inactivated, or is complementary to such encoding nucleotide sequence, wherein the transmembrane domain(s) of such polypeptide are disclosed herein. Therefore, soluble extracellular domains of the herein described PRO polypeptides are contemplated.
- Another embodiment is directed to fragments of a PRO polypeptide coding sequence, or the complement thereof, that may find use as, for example, hybridization probes, for encoding fragments of a PRO polypeptide that may optionally encode a polypeptide comprising a binding site for an anti-PRO antibody or as antisense oligonucleotide probes.
- nucleic acid fragments are usually at least about 10 nucleotides in length, alternatively at least about 15 nucleotides in length, alternatively at least about 20 nucleotides in length, alternatively at least about 30 nucleotides in length, alternatively at least about 40 nucleotides in length, alternatively at least about 50 nucleotides in length, alternatively at least about 60 nucleotides in length, alternatively at least about 70 nucleotides in length, alternatively at least about 80 nucleotides in length, alternatively at least about 90 nucleotides in length, alternatively at least about 100 nucleotides in length, alternatively at least about 110 nucleotides in length, alternatively at least about 120 nucleotides in length, alternatively at least about 130 nucleotides in length, alternatively at least about 140 nucleotides in length, alternatively at least about 150 nucleotides in length, alternatively at least about 160 nucleotides in length, alternatively at least about 170 nucleo
- novel fragments of a PRO polypeptide-encoding nucleotide sequence may be determined in a routine manner by aligning the PRO polypeptide-encoding nucleotide sequence with other known nucleotide sequences using any of a number of well known sequence alignment programs and determining which PRO polypeptide-encoding nucleotide sequence fragment(s) are novel. All of such PRO polypeptide-encoding nucleotide sequences are contemplated herein. Also contemplated are the PRO polypeptide fragments encoded by these nucleotide molecule fragments, preferably those PRO polypeptide fragments that comprise a binding site for an anti-PRO antibody.
- the invention provides isolated PRO polypeptide encoded by any of the isolated nucleic acid sequences hereinabove identified.
- the invention concerns an isolated PRO polypeptide, comprising an amino acid sequence having at least about 80% amino acid sequence identity, alternatively at least about 81% amino acid sequence identity, alternatively at least about 82% amino acid sequence identity, alternatively at least about 83% amino acid sequence identity, alternatively at least about 84% amino acid sequence identity, alternatively at least about 85% amino acid sequence identity, alternatively at least about 86% amino acid sequence identity, alternatively at least about 87% amino acid sequence identity, alternatively at least about 88% amino acid sequence identity, alternatively at least about 89% amino acid sequence identity, alternatively at least about 90% amino acid sequence identity, alternatively at least about 91% amino acid sequence identity, alternatively at least about 92% amino acid sequence identity, alternatively at least about 93% amino acid sequence identity, alternatively at least about 94% amino acid sequence identity, alternatively at least about 95% amino acid sequence identity, alternatively at least about 96% amino acid sequence identity, alternatively at least about 97% amino acid sequence identity, alternatively at least about 98% amino acid sequence identity and alternatively at
- the invention concerns an isolated PRO polypeptide comprising an amino acid sequence having at least about 80% amino acid sequence identity, alternatively at least about 81% amino acid sequence identity, alternatively at least about 82% amino acid sequence identity, alternatively at least about 83% amino acid sequence identity, alternatively at least about 84% amino acid sequence identity, alternatively at least about 85% amino acid sequence identity, alternatively at least about 86% amino acid sequence identity, alternatively at least about 87% amino acid sequence identity, alternatively at least about 88% amino acid sequence identity, alternatively at least about 89% amino acid sequence identity, alternatively at least about 90% amino acid sequence identity, alternatively at least about 91% a mino acid sequence identity, alternatively at least about 92% amino acid sequence identity, alternatively at least about 93% amino acid sequence identity, alternatively at least about 94% amino acid sequence identity, alternatively at least about 95% amino acid sequence identity, alternatively at least about 96% amino acid sequence identity, alternatively at least about 97% amino acid sequence identity, alternatively at least about 9 8% a mino acid
- the invention provides an isolated PRO polypeptide without the N-terminal signal sequence and/or the initiating methionine and is encoded by a nucleotide sequence that encodes such an amino acid sequence as hereinbefore described.
- Processes for producing the same are also herein described, wherein those processes comprise culturing a host cell comprising a vector which comprises the appropriate encoding nucleic acid molecule under conditions suitable for expression of the PRO polypeptide and recovering the PRO polypeptide from the cell culture.
- Another aspect the invention provides an isolated PRO polypeptide which is either transmembrane domain-deleted or transmembrane domain-inactivated.
- Processes for producing the same are also herein described, wherein those processes comprise culturing a host cell comprising a vector which comprises the appropriate encoding nucleic acid molecule under conditions suitable for expression of the PRO polypeptide and recovering the PRO polypeptide from the cell culture.
- the invention concerns agonists and antagonists of a native PRO polypeptide as defined herein.
- the agonist or antagonist is an anti-PRO antibody or a small molecule.
- the invention concerns a method of identifying agonists or antagonists to a PRO polypeptide which comprise contacting the PRO polypeptide with a candidate molecule and monitoring a biological activity mediated by said PRO polypeptide.
- the PRO polypeptide is a native PRO polypeptide.
- the invention concerns a composition of matter comprising a PRO polypeptide, or an agonist or antagonist of a PRO polypeptide as herein described, or an anti-PRO antibody, in combination with a carrier.
- the carrier is a pharmaceutically acceptable carrier.
- Another embodiment of the present invention is directed to the use of a PRO polypeptide, or an agonist or antagonist thereof as hereinbefore described, or an anti-PRO antibody, for the preparation of a medicament useful in the treatment of a condition which is responsive to the PRO polypeptide, an agonist or antagonist thereof or an anti-PRO antibody.
- the invention provides vectors comprising DNA encoding any of the herein described polypeptides.
- Host cell comprising any such vector are also provided.
- the host cells may be CHO cells, E. coli, or yeast.
- a process for producing any of the herein described polypeptides is further provided and comprises culturing host cells under conditions suitable for expression of the desired polypeptide and recovering the desired polypeptide from the cell culture.
- the invention provides chimeric molecules comprising any of the herein described polypeptides fused to a heterologous polypeptide or amino acid sequence.
- Example of such chimeric molecules comprise any of the herein described polypeptides fused to an epitope tag sequence or a Fc region of an immunoglobulin.
- the invention provides an antibody which binds, preferably specifically, to any of the above or below described polypeptides.
- the antibody is a monoclonal antibody, humanized antibody, antibody fragment or single-chain antibody.
- the invention provides oligonucleotide probes which may be useful for isolating genomic and cDNA nucleotide sequences, measuring or detecting expression of an associated gene or as antisense probes, wherein those probes may be derived from any of the above or below described nucleotide sequences. Preferred probe lengths are described above.
- the present invention is directed to methods of using the PRO polypeptides of the present invention for a variety of uses based upon the functional biological assay data presented in the Examples below.
- FIG. 1 shows a nucleotide sequence (SEQ ID NO: 1) of a native sequence PRO177 cDNA, wherein SEQ ID NO:1 is a clone designated herein as “DNA16438-1387”.
- FIG. 2 shows the amino acid sequence (SEQ ID NO:2) derived from the coding sequence of SEQ ID NO: 1 shown in FIG. 1.
- FIG. 3 shows a nucleotide sequence (SEQ ID NO:3) of a native sequence PRO3574 cDNA, wherein SEQ ID NO:3 is a clone designated herein as “DNA19360-2552”.
- FIG. 4 shows the amino acid sequence (SEQ ID NO:4) derived from the coding sequence of SEQ ID NO:3 shown in FIG. 3.
- FIG. 5 shows a nucleotide sequence (SEQ ID NO:5) of a native sequence PRO1280 cDNA, wherein SEQ ID NO:5 is a clone designated herein as “DNA33455-1548”.
- FIG. 6 shows the amino acid sequence (SEQ ID NO:6) derived from the coding sequence of SEQ ID NO:5 shown in FIG. 5.
- FIG. 7 shows a nucleotide sequence (SEQ ID NO:7) of a native sequence PRO4984 cDNA, wherein SEQ ID NO:7 is a clone designated herein as “DNA37155-2651”.
- FIG. 8 shows the amino acid sequence (SEQ ID NO:8) derived from the coding sequence of SEQ ID NO:7 shown in FIG. 7.
- FIG. 9 shows a nucleotide sequence (SEQ ID NO:9) of a native sequence PRO4988 cDNA, wherein SEQ ID NO:9 is a clone designated herein as “DNA38269-2654”.
- FIG. 10 shows the amino acid sequence (SEQ ID NO: 10) derived from the coding sequence of SEQ ID NO:9 shown in FIG. 9.
- FIG. 11 shows a nucleotide sequence (SEQ ID NO:i 1) of a native sequence PRO305 cDNA, wherein SEQ ID NO: 11 is a clone designated herein as “DNA40619-1220”.
- FIG. 12 shows the amino acid sequence (SEQ ID NO: 12) derived from the coding sequence of SEQ ID NO: 11 shown in FIG. 11.
- FIG. 13 shows a nucleotide sequence (SEQ ID NO: 13) of a native sequence PRO1866 cDNA, wherein SEQ ID NO:13 is a clone designated herein as “DNA44174-2513”.
- FIG. 14 shows the amino acid sequence (SEQ ID NO: 14) derived from the coding sequence of SEQ ID NO: 13 shown in FIG. 13.
- FIG. 15 shows a nucleotide sequence (SEQ ID NO: 15) of a native sequence PRO4996 cDNA, wherein SEQ ID NO: 15 is a clone designated herein as “DNA44675-2662”.
- FIG. 16 shows the amino acid sequence (SEQ ID NO: 16) derived from the coding sequence of SEQ ID NO:15 shown in FIG. 15.
- FIG. 17 shows anucleotide sequence (SEQ ID NO: 17) of a native sequence PRO4406 cDNA, wherein SEQ ID NO: 17 is a clone designated herein as “DNA45408-2615”.
- FIG. 18 shows the amino acid sequence (SEQ ID NO:18) derived from the coding sequence of SEQ ID NO:17 shown in FIG. 17.
- FIG. 19 shows a nucleotide sequence (SEQ ID NO: 19) of a native sequence PRO1120 cDNA, wherein SEQ ID NO:19 is a clone designated herein as “DNA48606-1479”.
- FIG. 20 shows the amino acid sequence (SEQ ID NO:20) derived from the coding sequence of SEQ ID NO:19 shown in FIG. 19.
- FIG. 21 shows a nucleotide sequence (SEQ ID NO:21) of a native sequence PRO4990 cDNA, wherein SEQ ID NO:21 is a clone designated herein as “DNA52753-2656”.
- FIG. 22 shows the amino acid sequence (SEQ ID NO:22) derived from the coding sequence of SEQ ID NO:21 shown in FIG. 21.
- FIG. 23 shows a nucleotide sequence (SEQ ID NO:23) of a native sequence PRO738 cDNA, wherein SEQ ID NO:23 is a clone designated herein as “DNA53915-1258”.
- FIG. 24 shows the amino acid sequence (SEQ ID NO:24) derived from the coding sequence of SEQ ID NO:23 shown in FIG. 23.
- FIG. 25 shows anucleotide sequence (SEQ ID NO:25) of a native sequence PRO3577 cDNA, wherein SEQ ID NO:25 is a clone designated herein as “DNA53991-2553”.
- FIG. 26 shows the amino acid sequence (SEQ ID NO:26) derived from the coding sequence of SEQ ID NO:25 shown in FIG. 25.
- FIG. 27 shows a nucleotide sequence (SEQ ID NO:27) of a native sequence PRO1879 cDNA, wherein SEQ ID NO:27 is a clone designated herein as “DNA54009-2517”.
- FIG. 28 shows the amino acid sequence (SEQ ID NO:28) derived from the coding sequence of SEQ ID NO:27 shown in FIG. 27.
- FIG. 29 shows a nucleotide sequence (SEQ ID NO:29) of a native sequence PRO1471 cDNA, wherein SEQ ID NO:29 is a clone designated herein as “DNA56055-1643”.
- FIG. 30 shows the amino acid sequence (SEQ ID NO:30) derived from the coding sequence of SEQ ID NO:29 shown in FIG. 29. 1
- FIG. 31 shows a nucleotide sequence (SEQ ID NO:3 1) of a native sequence PRO1114 cDNA, wherein SEQ ID NO:31 is a clone designated herein as “DNA57033-1403”.
- FIG. 32 shows the amino acid sequence (SEQ ID NO:32) derived from the coding sequence of SEQ ID NO:31 shown in FIG. 31.
- FIG. 33 shows a nucleotide sequence (SEQ ID NO:33) of anative sequence PRO1076 cDNA, wherein SEQ ID NO:33 is a clone designated herein as “DNA57252-1453”.
- FIG. 34 shows the amino acid sequence (SEQ ID NO:34) derived from the coding sequence of SEQ ID NO:33 shown in FIG. 33.
- FIG. 35 shows a nucleotide sequence (SEQ ID NO:35) of a native sequence PRO1483 cDNA, wherein SEQ ID NO:35 is a clone designated herein as “DNA58799-1652”.
- FIG. 36 shows the amino acid sequence (SEQ ID NO:36) derived from the coding sequence of SEQ ID NO:35 shown in FIG. 35.
- FIG. 37 shows a nucleotide sequence (SEQ ID NO:37) of a native sequence PRO4985 cDNA, wherein SEQ ID NO:37 is a clone designated herein as “DNA59770-2652”.
- FIG. 38 shows the amino acid sequence (SEQ ID NO:38) derived from the coding sequence of SEQ ID NO:37 shown in FIG. 37.
- FIG. 39 shows a nucleotide sequence (SEQ ID NO:39) of a native sequence PRO5000 cDNA, wherein SEQ ID NO:39 is a clone designated herein as “DNA59774-2665”.
- FIG. 40 shows the amino acid sequence (SEQ ID NO:40) derived from the coding sequence of SEQ ID NO:39 shown in FIG. 39.
- FIG. 41 shows anucleotide sequence (SEQ ID NO:41) of a native sequence PRO1881 cDNA, wherein SEQ ID NO:41 is a clone designated herein as “DNA60281-2518”.
- FIG. 42 shows the amino acid sequence (SEQ ID NO:42) derived from the coding sequence of SEQ ID NO:41 shown in FIG. 41.
- FIG. 43 shows a nucleotide sequence (SEQ ID NO:43) of a native sequence PRO4314 cDNA, wherein SEQ ID NO:43 is a clone designated herein as “DNA60736-2559”.
- FIG. 44 shows the amino acid sequence (SEQ ID NO:44) derived from the coding sequence of SEQ ID NO:43 shown in FIG. 43.
- FIG. 45 shows a nucleotide sequence (SEQ ID NO:45) of a native sequence PRO4987 cDNA, wherein SEQ ID NO:45 is a clone designated herein as “DNA61875-2653”.
- FIG. 46 shows the amino acid sequence (SEQ ID NO:46) derived from the coding sequence of SEQ ID NO:45 shown in FIG. 45.
- FIG. 47 shows a nucleotide sequence (SEQ ID NO:47) of a native sequence PRO4313 cDNA, wherein SEQ ID NO:47 is a clone designated herein as “DNA62312-2558”.
- FIG. 48 shows the amino acid sequence (SEQ ID NO:48) derived from the coding sequence of SEQ ID NO:47 shown in FIG. 47.
- FIG. 49 shows a nucleotide sequence (SEQ ID NO:49) of a native sequence PRO4799 cDNA, wherein SEQ ID NO:49 is a clone designated herein as “DNA62849-1604”.
- FIG. 50 shows the amino acid sequence (SEQ ID NO:50) derived from the coding sequence of SEQ ID NO:49 shown in FIG. 49.
- FIG. 51 shows a nucleotide sequence (SEQ ID NO:51) of a native sequence PRO4995 cDNA, wherein SEQ ID NO:51 is a clone designated herein as “DNA66307-2661”.
- FIG. 52 shows the amino acid sequence (SEQ ID NO:52) derived from the coding sequence of SEQ ID NO:51 shown in FIG. 51.
- FIG. 53 shows anucleotide sequence (SEQ ID NO:53) of a native sequence PRO1341 cDNA, wherein SEQ ID NO:53 is a clone designated herein as “DNA66677-2535”.
- FIG. 54 shows the amino acid sequence (SEQ ID NO:54) derived from the coding sequence of SEQ ID NO:53 shown in FIG. 53.
- FIG. 55 shows anucleotide sequence (SEQ ID NO:55) of a native sequence PRO1777 cDNA, wherein SEQ ID NO:55 is a clone designated herein as “DNA71235-1706”.
- FIG. 56 shows the amino acid sequence (SEQ ID NO:56) derived from the coding sequence of SEQ ID NO:55 shown in FIG. 55.
- FIG. 57 shows a nucleotide sequence (SEQ ID NO:57) of a native sequence PRO3580 cDNA, wherein SEQ ID NO:57 is a clone designated herein as “DNA71289-2547”.
- FIG. 58 shows the amino acid sequence (SEQ ID NO:58) derived from the coding sequence of SEQ ID NO:57 shown in FIG. 57.
- FIG. 59 shows a nucleotide sequence (SEQ ID NO:59) of a native sequence PRO1779 cDNA, wherein SEQ ID NO:59 is a clone designated herein as “DNA73775-1707”.
- FIG. 60 shows the amino acid sequence (SEQ ID NO:60) derived from the coding sequence of SEQ ID NO:59 shown in FIG. 59.
- FIG. 61 shows a nucleotide sequence (SEQ ID NO:61) of anative sequencePRO1754 cDNA, wherein SEQ ID NO:61 is a clone designated herein as “DNA76385-1692”.
- FIG. 62 shows the amino acid sequence (SEQ ID NO:62) derived from the coding sequence of SEQ ID NO:61 shown in FIG. 61.
- FIG. 63 shows a nucleotide sequence (SEQ ID NO:63) of a native sequencePRO1906 cDNA, wherein SEQ ID NO:63 is a clone designated herein as “DNA76395-2527”.
- FIG. 64 shows the amino acid sequence (SEQ ID NO:64) derived from the coding sequence of SEQ ID NO:63 shown in FIG. 63.
- FIG. 65 shows a nucleotide sequence (SEQ ID NO:65) of anative sequence PRO1870 cDNA, wherein SEQ ID NO:65 is a clone designated herein as “DNA77622-2516”.
- FIG. 66 shows the amino acid sequence (SEQ ID NO:66) derived from the coding sequence of SEQ ID NO:65 shown in FIG. 65.
- FIG. 67 shows a nucleotide sequence (SEQ ID NO:67) of a native sequence PRO4329 cDNA, wherein SEQ ID NO:67 is a clone designated herein as “DNA77629-2573”.
- FIG. 68 shows the amino acid sequence (SEQ ID NO:68) derived from the coding sequence of SEQ ID NO:67 shown in FIG. 67.
- FIG. 69 shows a nucleotide sequence (SEQ ID NO:69) of a native sequence PRO4979 cDNA, wherein SEQ ID NO:69 is a clone designated herein as “DNA77645-2648”.
- FIG. 70 shows the amino acid sequence (SEQ ID NO:70) derived from the coding sequence of SEQ ID NO:69 shown in FIG. 69.
- FIG. 71 shows a nucleotide sequence (SEQ ID NO:71) of a native sequence PRO1885 cDNA, wherein SEQ ID NO:71 is a clone designated herein as “DNA79302-2521”.
- FIG. 72 shows the amino acid sequence (SEQ ID NO:72) derived from the coding sequence of SEQ ID NO:71 shown in FIG. 71.
- FIG. 73 shows anucleotide sequence (SEQ ID NO:73) of a native sequencePRO1882 cDNA, wherein SEQ ID NO:73 is a clone designated herein as “DNA79865-2519”.
- FIG. 74 shows the amino acid sequence (SEQ ID NO:74) derived from the coding sequence of SEQ ID NO:73 shown in FIG. 73.
- FIG. 75 shows a nucleotide sequence (SEQ ID NO:75) of a native sequence PRO4989 cDNA, wherein SEQ ID NO:75 is a clone designated herein as “DNA80135-2655”.
- FIG. 76 shows the amino acid sequence (SEQ ID NO:76) derived from the coding sequence of SEQ ID NO:75 shown in FIG. 75.
- FIG. 77 shows anucleotide sequence (SEQ ID NO:77) of a native sequence PRO4323 cDNA, wherein SEQ ID NO:77 is a clone designated herein as “DNA80794-2568”.
- FIG. 78 shows the amino acid sequence (SEQ ID NO:78) derived from the coding sequence of SEQ ID NO:77 shown in FIG. 77.
- FIG. 79 shows anucleotide sequence (SEQ ID NO:79) of anative sequence PRO1886 cDNA, wherein SEQ ID NO:79 is a clone designated herein as “DNA80796-2523”.
- FIG. 80 shows the amino acid sequence (SEQ ID NO:80) derived from the coding sequence of SEQ ID NO:79 shown in FIG. 79.
- FIG. 81 shows anucleotide sequence (SEQ ID NO:81) of a native sequence PRO4395 cDNA, wherein SEQ ID NO:81 is a clone designated herein as “DNA80840-2605”.
- FIG. 82 shows the amino acid sequence (SEQ ID NO:82) derived from the coding sequence of SEQ ID NO:81 shown in FIG. 81.
- FIG. 83 shows a nucleotide sequence (SEQ ID NO:83) of a native sequence PRO1782 cDNA, wherein SEQ ID NO:83 is a clone designated herein as “DNA80899-2501 ”.
- FIG. 84 shows the amino acid sequence (SEQ ID NO:84) derived from the coding sequence of SEQ ID NO:83 shown in FIG. 83.
- FIG. 85 shows a nucleotide sequence (SEQ Ip NO:85) of a native sequence PRO4338 cDNA, wherein SEQ ID NO:85 is a clone designated herein as “DNA81228-2580”.
- FIG. 86 shows the amino acid sequence (SEQ ID NO:86) derived from the coding sequence of SEQ ID NO:85 shown in FIG. 85.
- FIG. 87 shows a nucleotide sequence (SEQ ID NO:87) of a native sequence PRO4341 cDNA, wherein SEQ ID NO:87 is a clone designated herein as “DNA81761-2583”.
- FIG. 88 shows the amino acid sequence (SEQ ID NO:88) derived from the coding sequence of SEQ ID NO:87 shown in FIG. 87.
- FIG. 89 shows a nucleotide sequence (SEQ ID NO:89) of a native sequence PRO5990 cDNA, wherein SEQ ID NO:89 is a clone designated herein as “DNA96042-2682”.
- FIG. 90 shows the amino acid sequence (SEQ ID NO:90) derived from the coding sequence of SEQ ID NO:89 shown in FIG. 89.
- FIG. 91 shows a nucleotide sequence (SEQ ID NO:91) of a native sequence PRO3438 cDNA, wherein SEQ ID NO:91 is a clone designated herein as “DNA82364-2538”.
- FIG. 92 shows the amino acid sequence (SEQ ID NO:92) derived from the coding sequence of SEQ ID NO:91 shown in FIG. 91.
- FIG. 93 shows a nucleotide sequence (SEQ ID NO:93) of a native sequence PRO4321 cDNA, wherein SEQ ID NO:93 is a clone designated herein as “DNA82424-2566”.
- FIG. 94 shows the amino acid sequence (SEQ ID NO:94) derived from the coding sequence of SEQ ID NO:93 shown in FIG. 93.
- FIG. 95 shows a nucleotide sequence (SEQ ID NO:95) of a native sequence PRO4304 cDNA, wherein SEQ ID NO:95 is a clone designated herein as “DNA82430-2557”.
- FIG. 96 shows the amino acid sequence (SEQ ID NO:96) derived from the coding sequence of SEQ ID NO:95 shown in FIG. 95.
- FIG. 97 shows a nucleotide sequence (SEQ ID NO:97) of a native sequence PRO1801 cDNA, wherein SEQ ID NO:97 is a clone designated herein as “DNA83500-2506”.
- FIG. 98 shows the amino acid sequence (SEQ ID NO:98) derived from the coding sequence of SEQ ID NO:97 shown in FIG. 97.
- FIG. 99 shows a nucleotide sequence (SEQ ID NO:99) of a native sequence PRO4403 cDNA, wherein SEQ ID NO:99 is a clone designated herein as “DNA83509-2612”.
- FIG. 100 shows the amino acid sequence (SEQ ID NO: 100) derived from the coding sequence of SEQ ID NO:99 shown in FIG. 99.
- FIG. 101 shows a nucleotide sequence (SEQ ID NO: 101) of a native sequence PRO4324 cDNA, wherein SEQ ID NO: 101 is a clone designated herein as “DNA83560-2569”.
- FIG. 102 shows the amino acid sequence (SEQ ID NO: 102) derived from the coding sequence of SEQ ID NO:101 shown in FIG. 101.
- FIG. 103 shows a nucleotide sequence (SEQ ID NO: 103) of a native sequence PRO4303 cDNA, wherein SEQ ID NO: 103 is a clone designated herein as “DNA84139-2555”.
- FIG. 104 shows the amino acid sequence (SEQ ID NO: 104) derived from the coding sequence of SEQ ID NO:103 shown in FIG. 103.
- FIG. 105 shows a nucleotide sequence (SEQ ID NO: 105) of a native sequence PRO4305 cDNA, wherein SEQ ID NO: 105 is a clone designated herein as “DNA84141-2556”.
- FIG. 106 shows the amino acid sequence (SEQ ID NO:106) derived from the coding sequence of SEQ ID NO: 105 shown in FIG. 105.
- FIG. 107 shows a nucleotide sequence (SEQ ID NO: 107) of a native sequence PRO4404 cDNA, wherein SEQ ID NO:107 is a clone designated herein as “DNA84142-2613”.
- FIG. 108 shows the amino acid sequence (SEQ ID NO: 108) derived from the coding sequence of SEQ ID NO: 107 shown in FIG. 107.
- FIG. 109 shows a nucleotide sequence (SEQ ID NO:109) of a native sequence PRO1884 cDNA, wherein SEQ ID NO: 109 is a clone designated herein as “DNA84318-2520”.
- FIG. 110 shows the amino acid sequence (SEQ ID NO: 110) derived from the coding sequence of SEQ ID NO: 109 shown in FIG. 109.
- FIG. 111 shows a nucleotide sequence (SEQ ID NO: 111) of a native sequence PRO4349 cDNA, wherein SEQ ID NO: 111 is a clone designated herein as “DNA84909-2590”.
- FIG. 112 shows the amino acid sequence (SEQ ID NO: 112) derived from the coding sequence of SEQ ID NO: 111 shown in FIG. 111.
- FIG. 113 shows a nucleotide sequence (SEQ ID NO:113) of a native sequence PRO4401 cDNA, wherein SEQ ID NO: 113 is a clone designated herein as “DNA84912-2610”.
- FIG. 114 shows the amino acid sequence (SEQ ID NO: 114) derived from the coding sequence of SEQ IDNO:113 shown in FIG. 113.
- FIG. 115 shows a nucleotide sequence (SEQ ID NO: 115) of a native sequence PRO1867 cDNA, wherein SEQ ID NO: 115 is a clone designated herein as “DNA84925-2514”.
- FIG. 116 shows the amino acid sequence (SEQ ID NO: 116) derived from the coding sequence of SEQ ID NO: 115 shown in FIG. 115.
- FIG. 117 shows a nucleotide sequence (SEQ ID NO:117) of a native sequence PRO4319 cDNA, wherein SEQ ID NO: 117 is a clone designated herein as “DNA84928-2564”.
- FIG. 118 shows the amino acid sequence (SEQ ID NO: 118) derived from the coding sequence of SEQ ID NO: 117 shown in FIG. 117.
- FIG. 119 shows a nucleotide sequence (SEQ ID NO:119) of a native sequence PRO4991 cDNA, wherein SEQ ID NO: 119 is a clone designated herein as “DNA84932-2657”.
- FIG. 120 shows the amino acid sequence (SEQ ID NO: 120) derived from the coding sequence of SEQ ID NO:119 shown in FIG. 119.
- FIG. 121 shows a nucleotide sequence (SEQ ID NO: 121) of a native sequence PRO4398 cDNA, wherein SEQ ID NO:121 is a clone designated herein as “DNA86592-2607”.
- FIG. 122 shows the amino acid sequence (SEQ ID NO: 122) derived from the coding sequence of SEQ ID NO:121 shown in FIG. 121.
- FIG. 123 shows a nucleotide sequence (SEQ ID NO: 123) of a native sequence PRO4346 cDNA, wherein SEQ ID NO: 123 is a clone designated herein as “DNA86594-2587”.
- FIG. 124 shows the amino acid sequence (SEQ ID NO:124) derived from the coding sequence of SEQ ID NO: 123 shown in FIG. 123.
- FIG. 125 shows a nucleotide sequence (SEQ ID NO: 125) of a native sequence PRO4350 cDNA, wherein SEQ ID NO: 125 is a clone designated herein as “DNA86647-2591”.
- FIG. 126 shows the amino acid sequence (SEQ ID NO:126) derived from the coding sequence of SEQ ID NO:125 shown in FIG. 125.
- FIG. 127 shows a nucleotide sequence (SEQ ID NO: 127) of a native sequence PRO4318 cDNA, wherein SEQ ID NO: 127 is a clone designated herein as “DNA87185-2563”.
- FIG. 128 shows the amino acid sequence (SEQ ID NO: 128) derived from the coding sequence of SEQ ID NO:127 shown in FIG. 127.
- FIG. 129 shows a nucleotide sequence (SEQ ID NO: 129) of a native sequence PRO4340 cDNA, wherein SEQ ID NO: 129 is a clone designated herein as “DNA87656-2582”.
- FIG. 130 shows the amino acid sequence (SEQ ID NO: 130) derived from the coding sequence of SEQ ID NO:129 shown in FIG. 129.
- FIG. 131 shows a nucleotide sequence (SEQ ID NO: 131) of a native sequence PRO4400 cDNA, wherein SEQ ID NO: 131 is a clone designated herein as “DNA87974-2609”.
- FIG. 132 shows the amino acid sequence (SEQ ID NO: 132) derived from the coding sequence of SEQ ID NO: 131 shown in FIG. 131.
- FIG. 133 shows a nucleotide sequence (SEQ ID NO: 133) of a native sequence PRO4320 cDNA, wherein SEQ ID NO: 133 is a clone designated herein as “DNA88001-2565”.
- FIG. 134 shows the amino acid sequence (SEQ ID NO: 134) derived from the coding sequence of SEQ ID NO:133 shown in FIG. 133.
- FIG. 135 shows a nucleotide sequence (SEQ ID NO: 135) of a native sequence PRO4409 cDNA, wherein SEQ ID NO: 135 is a clone designated herein as “DNA88004-2575”.
- FIG. 136 shows the amino acid sequence (SEQ ID NO: 136) derived from the coding sequence of SEQ ID NO:135 shown in FIG. 135.
- FIG. 137 shows a nucleotide sequence (SEQ ID NO: 137) of a native sequence PRO4399 cDNA, wherein SEQ ID NO: 137 is a clone designated herein as “DNA89220-2608”.
- FIG. 138 shows the amino acid sequence (SEQ ID NO: 138) derived from the coding sequence of SEQ ID NO:137 shown in FIG. 137.
- FIG. 139 shows a nucleotide sequence (SEQ ID NO: 139) of a native sequence PRO4418 cDNA, wherein SEQ ID NO: 139 is a clone designated herein as “DNA89947-2618”.
- FIG. 140 shows the amino acid sequence (SEQ ID NO: 140) derived from the coding sequence of SEQ ID NO:139 shown in FIG. 139.
- FIG. 141 shows a nucleotide sequence (SEQ ID NO: 141) of a native sequence PRO4330 cDNA, wherein SEQ ID NO: 141 is a clone designated herein as “DNA90842-2574”.
- FIG. 142 shows the amino acid sequence (SEQ ID NO: 142) derived from the coding sequence of SEQ ID NO:141 shown in FIG. 141.
- FIG. 143 shows a nucleotide sequence (SEQ ID NO: 143) of a native sequence PRO4339 cDNA, wherein SEQ ID NO: 143 is a clone designated herein as “DNA91775-2581”.
- FIG. 144 shows the amino acid sequence (SEQ ID NO: 144) derived from the coding sequence of SEQ ID NO: 143 shown in FIG. 143.
- FIG. 145 shows a nucleotide sequence (SEQ ID NO:145) of a native sequence PRO4326 cDNA, wherein SEQ ID NO: 145 is a clone designated herein as “DNA91779-2571 ”.
- FIG. 146 shows the amino acid sequence (SEQ ID NO: 146) derived from the coding sequence of SEQ ID NO: 145 shown in FIG. 145.
- FIG. 147 shows a nucleotide sequence (SEQ ID NO: 147) of a native sequence PRO6014 cDNA, wherein SEQ ID NO: 147 is a clone designated herein as “DNA92217-2697”.
- FIG. 148 shows the amino acid sequence (SEQ ID NO: 148) derived from the coding sequence of SEQ ID NO: 147 shown in FIG. 147.
- FIG. 149 shows a nucleotide sequence (SEQ ID NO: 149) of a native sequence PRO3446 cDNA, wherein SEQ ID NO: 149 is a clone designated herein as “DNA92219-2541 ”.
- FIG. 150 shows the amino acid sequence (SEQ ID NO:150) derived from the coding sequence of SEQ ID NO: 149 shown in FIG. 149.
- FIG. 151 shows a nucleotide sequence (SEQ ID NO:151) of a native sequence PRO4322 cDNA, wherein SEQ ID NO: 151 is a clone designated herein as “DNA92223-2567”.
- FIG. 152 shows the amino acid sequence (SEQ ID NO:152) derived from the coding sequence of SEQ ID NO: 151 shown in FIG. 151.
- FIG. 153 shows a nucleotide sequence (SEQ ID NO:153) of a native sequence PRO4381 cDNA, wherein SEQ ID NO: 153 is a clone designated herein as “DNA92225-2603”.
- FIG. 154 shows the amino acid sequence (SEQ ID NO: 154) derived from the coding sequence of SEQ ID NO:153 shown in FIG. 153.
- FIG. 155 shows a nucleotide sequence (SEQ ID NO: 155) of a native sequence PRO4348 cDNA, wherein SEQ ID NO: 155 is a clone designated herein as “DNA92232-2589”.
- FIG. 156 shows the amino acid sequence (SEQ ID NO: 156) derived from the coding sequence of SEQ ID NO:155 shown in FIG. 155.
- FIG. 157 shows a nucleotide sequence (SEQ ID NO: 157) of a native sequence PRO4371 cDNA, wherein SEQ ID NO: 157 is a clone designated herein as “DNA92233-2599”.
- FIG. 158 shows the amino acid sequence (SEQ ID NO:158) derived from the coding sequence of SEQ ID NO:157 shown in FIG. 157.
- FIG. 159 shows a nucleotide sequence (SEQ ID NO: 159) of a native sequence PRO3742 cDNA, wherein SEQ ID NO: 159 is a clone designated herein as “DNA92243-2549”.
- FIG. 160 shows the amino acid sequence (SEQ ID NO: 160) derived from the coding sequence of SEQ ID NO: 159 shown in FIG. 159.
- FIG. 161 shows a nucleotide sequence (SEQ ID NO:161) of a native sequence PRO5773 cDNA, wherein SEQ ID NO:161 is a clone designated herein as “DNA92253-2671”.
- FIG. 162 shows the amino acid sequence (SEQ ID NO: 162) derived from the coding sequence of SEQ ID NO: 161 shown in FIG. 161.
- FIG. 163 shows a nucleotide sequence (SEQ ID NO: 163) of a native sequence PRO5774 cDNA, wherein SEQ ID NO: 163 is a clone designated herein as “DNA92254-2672”.
- FIG. 164 shows the amino acid sequence (SEQ ID NO: 164) derived from the coding sequence of SEQ ID NO: 163 shown in FIG. 163.
- FIG. 165 shows a nucleotide sequence (SEQ ID NO: 165) of a native sequence PRO4343 cDNA, wherein SEQ ID NO: 165 is a clone designated herein as “DNA92255-2584”.
- FIG. 166 shows the amino acid sequence (SEQ ID NO:166) derived from the coding sequence of SEQ ID NO: 165 shown in FIG. 165.
- FIG. 167 shows a nucleotide sequence (SEQ ID NO: 167) of a native sequence PRO4325 cDNA, wherein SEQ ID NO: 167 is a clone designated herein as “DNA92269-2570”.
- FIG. 168 shows the amino acid sequence (SEQ ID NO: 168) derived from the coding sequence of SEQ ID NO: 167 shown in FIG. 167.
- FIG. 169 shows a nucleotide sequence (SEQ ID NO:169) of a native sequence PRO4347 cDNA, wherein SEQ ID NO: 169 is a clone designated herein as “DNA92288-2588”.
- FIG. 170 shows the amino acid sequence (SEQ ID NO: 170) derived from the coding sequence of SEQ ID NO: 169 shown in FIG. 169.
- FIG. 171 shows a nucleotide sequence (SEQ ID NO: 171) of a native sequence PRO3743 cDNA, wherein SEQ ID NO: 171 is a clone designated herein as “DNA92290-2550”.
- FIG. 172 shows the amino acid sequence (SEQ ID NO: 172) derived from the coding sequence of SEQ ID NO:171 shown in FIG. 171.
- FIG. 173 shows a nucleotide sequence (SEQ ID NO:173) of a native sequence PRO4426 cDNA, wherein SEQ ID NO: 173 is a clone designated herein as “DNA93012-2622”.
- FIG. 174 shows the amino acid sequence (SEQ ID NO:174) derived from the coding sequence of SEQ ID NO: 173 shown in FIG. 173.
- FIG. 175 shows a nucleotide sequence (SEQ ID NO:175) of a native sequence PRO4500 cDNA, wherein SEQ ID NO: 175 is a clone designated herein as “DNA93020-2642”.
- FIG. 176 shows the amino acid sequence (SEQ ID NO: 176) derived from the coding sequence of SEQ ID NO:175 shown in FIG. 175.
- FIG. 177 shows a nucleotide sequence (SEQ ID NO: 177) of a native sequence PRO4389 cDNA, wherein SEQ ID NO: 177 is a clone designated herein as “DNA94830-2604”.
- FIG. 178 shows the amino acid sequence (SEQ ID NO: 178) derived from the coding sequence of SEQ ID NO:177 shown in FIG. 177.
- FIG. 179 shows a nucleotide sequence (SEQ ID NO: 179) of a native sequence PRO4337 cDNA, wherein SEQ ID NO: 179 is a clone designated herein as “DNA94833-2579”.
- FIG. 180 shows the amino acid sequence (SEQ ID NO: 180) derived from the coding sequence of SEQ ID NO: 179 shown in FIG. 179.
- FIG. 181 shows a nucleotide sequence (SEQ ID NO: 181) of a native sequence PRO4992 cDNA, wherein SEQ ID NO: 181 is a clone designated herein as “DNA94838-2658”.
- FIG. 182 shows the amino acid sequence (SEQ ID NO: 182) derived from the coding sequence of SEQ ID NO:181 shown in FIG. 181.
- FIG. 183 shows a nucleotide sequence (SEQ ID NO: 183) of a native sequence PRO5996 cDNA, wherein SEQ ID NO: 183 is a clone designated herein as “DNA94844-2686”.
- FIG. 184 shows the amino acid sequence (SEQ ID NO: 184) derived from the coding sequence of SEQ ID NO: 183 shown in FIG. 183.
- FIG. 185 shows a nucleotide sequence (SEQ ID NO: 185) of a native sequence PRO4345 cDNA, wherein SEQ ID NO: 185 is a clone designated herein as “DNA94854-2586”.
- FIG. 186 shows the amino acid sequence (SEQ ID NO: 186) derived from the coding sequence of SEQ ID NO: 185 shown in FIG. 185.
- FIG. 187 shows a nucleotide sequence (SEQ ID NO: 187) of a native sequence PRO4978 cDNA, wherein SEQ ID NO: 187 is a clone designated herein as “DNA95930”.
- FIG. 188 shows the amino acid sequence (SEQ ID NO: 188) derived from the coding sequence of SEQ ID NO: 187 shown in FIG. 187.
- FIG. 189 shows a nucleotide sequence (SEQ ID NO: 189) of a native sequence PRO5780 cDNA, wherein SEQ ID NO: 189 is a clone designated herein as “DNA96868-2677”.
- FIG. 190 shows the amino acid sequence (SEQ ID NO: 190) derived from the coding sequence of SEQ ID NO:189 shown in FIG. 189.
- FIG. 191 shows a nucleotide sequence (SEQ ID NO: 191) of a native sequence PRO5992 cDNA, wherein SEQ ID NO: 191 is a clone designated herein as “DNA96871-2683”.
- FIG. 192 shows the amino acid sequence (SEQ ID NO: 192) derived from the coding sequence of SEQ ID NO: 191 shown in FIG. 191.
- FIG. 193 shows a nucleotide sequence (SEQ ID NO: 193) of a native sequence PRO4428 cDNA, wherein SEQ ID NO: 193 is a clone designated herein as “DNA96880-2624”.
- FIG. 194 shows the amino acid sequence (SEQ ID NO: 194) derived from the coding sequence of SEQ ID NO: 193 shown in FIG. 193.
- FIG. 195 shows a nucleotide sequence (SEQ ID NO: 195) of a native sequence PRO4994 cDNA, wherein SEQ ID NO: 195 is a clone designated herein as “DNA96986-2660”.
- FIG. 196 shows the amino acid sequence (SEQ ID NO:196) derived from the coding sequence of SEQ ID NO: 195 shown in FIG. 195.
- FIG. 197 shows a nucleotide sequence (SEQ ID NO: 197) of a native sequence PRO5995 cDNA, wherein SEQ ID NO: 197 is a clone designated herein as “DNA96988-2685”.
- FIG. 198 shows the amino acid sequence (SEQ ID NO:198) derived from the coding sequence of SEQ ID NO: 197 shown in FIG. 197.
- FIG. 199 shows a nucleotide sequence (SEQ ID NO:199) of a native sequence PRO6094 cDNA, wherein SEQ ID NO: 199 is a clone designated herein as “DNA96995-2709”.
- FIG. 200 shows the amino acid sequence (SEQ ID NO:200) derived from the coding sequence of SEQ ID NO: 199 shown in FIG. 199.
- FIG. 201 shows a nucleotide sequence (SEQ ID NO:201) of a native sequence PRO4317 cDNA, wherein SEQ ID NO:201 is a clone designated herein as “DNA97004-2562”.
- FIG. 202 shows the amino acid sequence (SEQ ID NO:202) derived from the coding sequence of SEQ ID NO:201 shown in FIG. 201.
- FIG. 203 shows a nucleotide sequence (SEQ ID NO:203) of a native sequence PRO5997 cDNA, wherein SEQ ID NO:203 is a clone designated herein as “DNA97005-2687”.
- FIG. 204 shows the amino acid sequence (SEQ ID NO:204) derived from the coding sequence of SEQ ID NO:203 shown in FIG. 203.
- FIG. 205 shows a nucleotide sequence (SEQ ID NO:205) of a native sequence PRO5005 cDNA, wherein SEQ ID NO:205 is a clone designated herein as “DNA97009-2668”.
- FIG. 206 shows the amino acid sequence (SEQ ID NO:206) derived from the coding sequence of SEQ ID NO:205 shown in FIG. 205.
- FIG. 207 shows a nucleotide sequence (SEQ ID NO:207) of a native sequence PRO5004 cDNA, wherein SEQ ID NO:207 is a clone designated herein as “DNA97013-2667”.
- FIG. 208 shows the amino acid sequence (SEQ ID NO:208) derived from the coding sequence of SEQ ID NO:207 shown in FIG. 207.
- FIG. 209 shows a nucleotide sequence (SEQ ID NO:209) of a native sequence PRO6001 cDNA, wherein SEQ ID NO:209 is a clone designated herein as “DNA98380-2690”.
- FIG. 210 shows the amino acid sequence (SEQ ID NO:210) derived from the coding sequence of SEQ ID NO:209 shown in FIG. 209.
- FIG. 211 shows a nucleotide sequence (SEQ ID NO:211) of a native sequence PRO6013 cDNA, wherein SEQ ID NO:211 is a clone designated herein as “DNA98561-2696”.
- FIG. 212 shows the amino acid sequence (SEQ ID NO:212) derived from the coding sequence of SEQ ID NO:211 shown in FIG. 211.
- FIG. 213 shows a nucleotide sequence (SEQ ID NO:213) of a native sequence PRO4502 cDNA, wherein SEQ ID NO:213 is a clone designated herein as “DNA98575-2644”.
- FIG. 214 shows the amino acid sequence (SEQ ID NO:214) derived from the coding sequence of SEQ ID NO:213 shown in FIG. 213.
- FIG. 215 shows a nucleotide sequence (SEQ ID NO:215) of a native sequence PRO6007 cDNA, wherein SEQ ID NO:215 is a clone designated herein as “DNA98593-2694”.
- FIG. 216 shows the amino acid sequence (SEQ ID NO:216) derived from the coding sequence of SEQ ID NO:215 shown in FIG. 215.
- FIG. 217 shows a nucleotide sequence (SEQ ID NO:217) of a native sequence PRO6028 cDNA, wherein SEQ ID NO:217 is a clone designated herein as “DNA98600-2703”.
- FIG. 218 shows the amino acid sequence (SEQ ID NO:218) derived from the coding sequence of SEQ ID NO:217 shown in FIG. 217.
- FIG. 219 shows a nucleotide sequence (SEQ ID NO:219) of a native sequence PRO100 cDNA, wherein SEQ ID NO:219 is a clone designated herein as “DNA99333”.
- FIG. 220 shows the amino acid sequence (SEQ ID NO:220) derived from the coding sequence of SEQ ID NO:219 shown in FIG. 219.
- FIG. 221 shows a nucleotide sequence (SEQ ID NO:221) of a native sequence PRO4327 cDNA, wherein SEQ ID NO:221 is a clone designated herein as “DNA99391-2572”.
- FIG. 222 shows the amino acid sequence (SEQ ID NO:222) derived from the coding sequence of SEQ ID NO:221 shown in FIG. 221.
- FIG. 223 shows a nucleotide sequence (SEQ ID NO:223) of a native sequence PRO4315 cDNA, wherein SEQ ID NO:223 is a clone designated herein as “DNA99393-2560”.
- FIG. 224 shows the amino acid sequence (SEQ ID NO:224) derived from the coding sequence of SEQ ID NO:223 shown in FIG. 223.
- FIG. 225 shows a nucleotide sequence (SEQ ID NO:225) of a native sequence PRO5993 cDNA, wherein SEQ ID NO:225 is a clone designated herein as “DNA100276-2684”.
- FIG. 226 shows the amino acid sequence (SEQ ID NO:226) derived from the coding sequence of SEQ ID NO:225 shown in FIG. 225.
- FIG. 227 shows a nucleotide sequence (SEQ ID NO:227) of a native sequence PRO4503 cDNA, wherein SEQ ID NO:227 is a clone designated herein as “DNA100312-2645”.
- FIG. 228 shows the amino acid sequence (SEQ ID NO:228) derived from the coding sequence of SEQ ID NO:227 shown in FIG. 227.
- FIG. 229 shows a nucleotide sequence (SEQ ID NO:229) of a native sequence PRO4976 cDNA, wherein SEQ ID NO:229 is a clone designated herein as “DNA100902-2646”.
- FIG. 230 shows the amino acid sequence (SEQ ID NO:230) derived from the coding sequence of SEQ ID NO:229 shown in FIG. 229.
- FIG. 231 shows a nucleotide sequence (SEQ ID NO:231) of a native sequence PRO5798 cDNA, wherein SEQ ID NO:231 is a clone designated herein as “DNA102899-2679”.
- FIG. 232 shows the amino acid sequence (SEQ ID NO:232) derived from the coding sequence of SEQ ID NO:231 shown in FIG. 231.
- FIG. 233 shows a nucleotide sequence (SEQ ID NO:233) of a native sequence PRO6242 cDNA, wherein SEQ ID NO:233 is a clone designated herein as “DNA104875-2720”.
- FIG. 234 shows the amino acid sequence (SEQ ID NO:234) derived from the coding sequence of SEQ ID NO:233 shown in FIG. 233.
- FIG. 235 shows a nucleotide sequence (SEQ ID NO:235) of a native sequence PRO6095 cDNA, wherein SEQ ID NO:235 is a clone designated herein as “DNA105680-2710”.
- FIG. 236 shows the amino acid sequence (SEQ ID NO:236) derived from the coding sequence of SEQ ID NO:235 shown in FIG. 235.
- FIG. 237 shows a nucleotide sequence (SEQ ID NO:237) of a native sequence PRO6093 cDNA, wherein SEQ ID NO:237 is a clone designated herein as “DNA105779-2708”.
- FIG. 238 shows the amino acid sequence (SEQ ID NO:238) derived from the coding sequence of SEQ ID NO:237 shown in FIG. 237.
- FIG. 239 shows a nucleotide sequence (SEQ ID NO:239) of a native sequence PRO6012 cDNA, wherein SEQ ID NO:239 is a clone designated herein as “DNA105794-2695”.
- FIG. 240 shows the amino acid sequence (SEQ ID NO:240) derived from the coding sequence of SEQ ID NO:239 shown in FIG. 239.
- FIG. 241 shows a nucleotide sequence (SEQ ID NO:241) of a native sequence PRO6027 cDNA, wherein SEQ ID NO:241 is a clone designated herein as “DNA105838-2702”.
- FIG. 242 shows the amino acid sequence (SEQ ID NO:242) derived from the coding sequence of SEQ ID NO:241 shown in FIG. 241.
- FIG. 243 shows a nucleotide sequence (SEQ ID NO:243) of a native sequence PRO6181 cDNA, wherein SEQ ID NO:243 is a clone designated herein as “DNA107698-2715”.
- FIG. 244 shows the amino acid sequence (SEQ ID NO:244) derived from the coding sequence of SEQ ID NO:243 shown in FIG. 243.
- FIG. 245 shows a nucleotide sequence (SEQ ID NO:245) of a native sequence PRO6097 cDNA, wherein SEQ ID NO:245 is a clone designated herein as “DNA107701-2711”.
- FIG. 246 shows the amino acid sequence (SEQ ID NO:246) derived from the coding sequence of SEQ ID NO:245 shown in FIG. 245.
- FIG. 247 shows a nucleotide sequence (SEQ ID NO:247) of a native sequence PRO6090 cDNA, wherein SEQ ID NO:247 is a clone designated herein as “DNA107781-2707”.
- FIG. 248 shows the amino acid sequence (SEQ ID NO:248) derived from the coding sequence of SEQ ID NO:247 shown in FIG. 247.
- FIG. 249 shows a nucleotide sequence (SEQ ID NO:249) of a native sequence PRO7171 cDNA, wherein SEQ ID NO:249 is a clone designated herein as “DNA108670-2744”.
- FIG. 250 shows the amino acid sequence (SEQ ID NO:250) derived from the coding sequence of SEQ ID NO:249 shown in FIG. 249.
- FIG. 251 shows a nucleotide sequence (SEQ ID NO:251) of a native sequence PRO6258 cDNA, wherein SEQ ID NO:251 is a clone designated herein as “DNA108688-2725”.
- FIG. 252 shows the amino acid sequence (SEQ ID NO:252) derived from the coding sequence of SEQ ID NO:251 shown in FIG. 251.
- FIG. 253 shows a nucleotide sequence (SEQ ID NO:253) of a native sequence PRO9820 cDNA, wherein SEQ ID NO:253 is a clone designated herein as “DNA108769-2765”.
- FIG. 254 shows the amino acid sequence (SEQ ID NO:254) derived from the coding sequence of SEQ ID NO:253 shown in FIG. 253.
- FIG. 255 shows a nucleotide sequence (SEQ ID NO:255) of a native sequence PRO6243 cDNA, wherein SEQ ID NO:255 is a clone designated herein as “DNA108935-2721”.
- FIG. 256 shows the amino acid sequence (SEQ ID NO:256) derived from the coding sequence of SEQ ID NO:255 shown in FIG. 255.
- FIG. 257 shows a nucleotide sequence (SEQ ID NO:257) of a native sequence PRO6182 cDNA, wherein SEQ ID NO:257 is a clone designated herein as “DNA110700-2716”.
- FIG. 258 shows the amino acid sequence (SEQ ID NO:258) derived from the coding sequence of SEQ ID NO:257 shown in FIG. 257.
- FIG. 259 shows a nucleotide sequence (SEQ ID NO:259) of a native sequence PRO6079 cDNA, wherein SEQ ID NO:259 is a clone designated herein as “DNA111750-2706”.
- FIG. 260 shows the amino acid sequence (SEQ ID NO:260) derived from the coding sequence of SEQ ID NO:259 shown in FIG. 259.
- FIG. 261 shows a nucleotide sequence (SEQ ID NO:261) of a native sequence PRO7434 cDNA, wherein SEQ ID NO:261 is a clone designated herein as “DNA123430-2755”.
- FIG. 262 shows the amino acid sequence (SEQ ID NO:262) derived from the coding sequence of SEQ ID NO:261 shown in FIG. 261.
- FIG. 263 shows a nucleotide sequence (SEQ ID NO:263) of a native sequence PRO9865 cDNA, wherein SEQ ID NO:263 is a clone designated herein as “DNA125154-2785”.
- FIG. 264 shows the amino acid sequence (SEQ ID NO:264) derived from the coding sequence of SEQ ID NO:263 shown in FIG. 263.
- FIG. 265 shows a nucleotide sequence (SEQ ID NO:265) of a native sequence PRO9828 cDNA, wherein SEQ ID NO:265 is a clone designated herein as “DNA142238-2768”.
- FIG. 266 shows the amino acid sequence (SEQ ID NO:266) derived from the coding sequence of SEQ ID NO:265 shown in FIG. 265.
- FIG. 267 shows a nucleotide sequence (SEQ ID NO:267) of a native sequence PRO196 cDNA, wherein SEQ ID NO:267 is a clone designated herein as “DNA22779-1130”.
- FIG. 268 shows the amino acid sequence (SEQ ID NO:268) derived from the coding sequence of SEQ ID NO:267 shown in FIG. 267.
- FIG. 269 shows a nucleotide sequence (SEQ ID NO:269) of a native sequence PRO197 cDNA, wherein SEQ ID NO:269 is a clone designated herein as “DNA22780-1078”.
- FIG. 270 shows the amino acid sequence (SEQ ID NO:270) derived from the coding sequence of SEQ ID NO:269 shown in FIG. 269.
- FIG. 271 shows a nucleotide sequence (SEQ ID NO:271) of a native sequence PRO195 cDNA, wherein SEQ ID NO:271 is a clone designated herein as “DNA26847-1395”.
- FIG. 272 shows the amino acid sequence (SEQ ID NO:272) derived from the coding sequence of SEQ ID NO:271 shown in FIG. 271.
- FIG. 273 shows a nucleotide sequence (SEQ ID NO:273) of a native sequence PRO187 cDNA, wherein SEQ ID NO:273 is a clone designated herein as “DNA27864-1155”.
- FIG. 274 shows the amino acid sequence (SEQ ID NO:274) derived from the coding sequence of SEQ ID NO:273 shown in FIG. 273.
- FIG. 275 shows a nucleotide sequence (SEQ ID NO:275) of a native sequence PRO182 cDNA, wherein SEQ ID NO:275 is a clone designated herein as “DNA27865-1091”.
- FIG. 276 shows the amino acid sequence (SEQ ID NO:276) derived from the coding sequence of SEQ ID NO:275 shown in FIG. 275.
- FIG. 277 shows a nucleotide sequence (SEQ ID NO:277) of a native sequence PRO188 cDNA, wherein SEQ ID NO:277 is a clone designated herein as “DNA28497-1130.
- FIG. 278 shows the amino acid sequence (SEQ ID NO:278) derived from the coding sequence of SEQ ID NO:277 shown in FIG. 277.
- FIG. 279 shows a nucleotide sequence (SEQ ID NO:279) of a native sequence PRO183 cDNA, wherein SEQ ID NO:279 is a clone designated herein as “DNA28498”.
- FIG. 280 shows the amino acid sequence (SEQ ID NO:280) derived from the coding sequence of SEQ ID NO:279 shown in FIG. 279.
- FIG. 281 shows a nucleotide sequence (SEQ ID NO:281) of a native sequence PRO184 cDNA, wherein SEQ ID NO:281 is a clone designated herein as “DNA28500”.
- FIG. 282 shows the amino acid sequence (SEQ ID NO:282) derived from the coding sequence of SEQ ID NO: 281 shown in FIG. 281.
- FIG. 283 shows a nucleotide sequence (SEQ ID NO:283) of a native sequence PRO185 cDNA, wherein SEQ ID NO:283 is a clone designated herein as “DNA28503”.
- FIG. 284 shows the amino acid sequence (SEQ ID NO:284) derived from the coding sequence of SEQ ID NO:283 shown in FIG. 283.
- FIG. 285 shows a nucleotide sequence (SEQ ID NO:285) of a native sequence PRO200 cDNA, wherein SEQ ID NO:285 is a clone designated herein as “DNA29101-1122”.
- FIG. 286 shows the amino acid sequence (SEQ ID NO:286) derived from the coding sequence of SEQ ID NO:285 shown in FIG. 285.
- FIG. 287 shows a nucleotide sequence (SEQ ID NO:287) of a native sequence PRO202 cDNA, wherein SEQ ID NO:287 is a clone designated herein as “DNA30869”.
- FIG. 288 shows the amino acid sequence (SEQ ID NO:288) derived from the coding sequence of SEQ ID NO:287 shown in FIG. 287.
- FIG. 289 shows a nucleotide sequence (SEQ ID NO:289) of a native sequence PRO214 cDNA, wherein SEQ ID NO:289 is a clone designated herein as “DNA32286-1191”.
- FIG. 290 shows the amino acid sequence (SEQ ID NO:290) derived from the coding sequence of SEQ ID NO:289 shown in FIG. 289.
- FIG. 291 shows a nucleotide sequence (SEQ ID NO:291) of a native sequence PRO215 cDNA, wherein SEQ ID NO:291 is a clone designated herein as “DNA32288-1132”.
- FIG. 292 shows the amino acid sequence (SEQ ID NO:292) derived from the coding sequence of SEQ ID NO:291 shown in FIG. 291.
- FIG. 293 shows a nucleotide sequence (SEQ ID NO:293) of a native sequence PRO219 cDNA, wherein SEQ ID NO:293 is a clone designated herein as “DNA32290-1164”.
- FIG. 294 shows dh aacid sequence (SEQ ID NO:294) derived from the coding sequence of SEQ ID NO:293 shown in FIG. 293.
- FIG. 295 shows a nucle sqnce (SEQ ID NO:295) of a native sequence PRO211 cDNA, wherein SEQ ID NO:295 is a clone designated herein as “DNA32292-1131”.
- FIG. 296 shows the amino acid sequence (SEQ ID NO:296) derived from f codingsequenceofSEQ ID NO:295 shown in FIG. 295.
- FIG. 297 shows a nucloctde sequence (SEQ ID NO:297) of a native sequence PRO220 cDNA, wherein SEQ ID NO:297 is a cloneded herein as “DNA322981132”.
- FIG. 298 shows the amino add sequence (SEQ ID NO:298) derived from the coding sequence of SEQ ID NO:297 shown in FIG. 297.
- FIG. 299 shows a nucleotide sequence (SEQ ID NO:299) of a native sequence PRO366 cDNA, wherein SEQ ID NO:299 b a clone delegate herein “DNA33085-1110”.
- FIG. 300 shows the acid sequence (SEQ ID NO:300) derived from the coding sequence of SEQ ID NO:299 shown in FIG. 299.
- FIG. 301 shows a nucleotide sequence (SEQ ID NO:301) of a native sequence PRO216 cDNA, wherein SEQ ID NO:301 is a clone designated herein as “DNA33087-1158”.
- FIG. 302 shows the amino acid sequence (SEQ ID NO:302) derived from the coding sequence of SEQ ID NO:301 shown FIG. 301.
- FIG. 303 shows a nucleotide sequence (SEQ ID NO:303) of a native sequence PRO221 cDNA, wherein SEQ ID NO:303 is a clone designated herein as “DNA33089-1132”.
- FIG. 304 shows the amino acid sequence (SEQ ID NO:304) derived from the coding sequence of SEQ ID NO:303 shown in FIG. 303.
- FIG. 305 shows a nucleotide sequence (SEQ ID NO:305) of a native sequence PRO228 cDNA, wherein SEQ ID NO:305 is a clone designated herein as -DNA33092-1202”.
- FIG. 306 shows the amino acid sequence (SEQ ID NO:306) derived from the coding sequence of SEQ ID NO:305 shown in FIG. 305.
- FIG. 307 shows a nucleotide sequence (SEQ ID NO:307) of a native sequence PRO217 cDNA, wherein SEQ ID NO:307 is a clone designated are as “DNA33094-1131”.
- FIG. 308 shows the amino acid sequence (SEQ ID NO:308) derived from the coding sequence of SEQ ID NO:307 shown in FIG. 307.
- FIG. 309 shows a nucleotide sequence (SEQ ID NO:309) of a native sequence PRO222 cDNA, wherein SEQ ID NO:309 is a clone designated herein as “DNA33107-1135”.
- FIG. 310 shows the amino acid sequence (SEQ ID NO:310) derived from the coding sequence of SEQ ID NO:309 shown in FIG. 309.
- FIG. 311 shows a nucleotide sequence (SEQ ID NO:311) of a native sequence PRO224 cDNA, wherein SEQ ID NO:311 is a clone designated herein as “DNA33221-1133”.
- FIG. 312 shows the amino acid sequence (SEQ ID NO:312) derived from the coding sequence of SEQ ID NO:311 shown in FIG. 311.
- FIG. 313 shows a nucleotide sequence (SEQ ID NO:313) of a native sequence PRO230 cDNA, wherein SEQ ID NO:313 is a clone designated herein as “DNA33223-1136”.
- FIG. 314 shows the amino acid sequence (SEQ ID NO:314) derived from the coding sequence of SEQ ID NO:313 shown in FIG. 313.
- FIG. 315 shows a nucleotide sequence (SEQ ID NO:315) of a native sequence PRO198 cDNA, wherein SEQ ID NO:315 is a clone designated herein as “DNA33457-1078”.
- FIG. 316 shows the amino acid sequence (SEQ ID NO:316) derived from the coding sequence of SEQ ID NO:315 shown in FIG. 315.
- FIG. 317 shows a nucleotide sequence (SEQ ID NO:317) of a native sequence PRO226 cDNA, wherein SEQ ID NO:317 is a clone designated herein as “DNA33460-1166”.
- FIG. 318 shows the amino acid sequence (SEQ ID NO:318) derived from the coding sequence of SEQ ID NO:317 shown in FIG. 317.
- FIG. 319 shows a nucleotide sequence (SEQ ID NO:319) of a native sequence PRO261 cDNA, wherein SEQ ID NO:319 is a clone designated herein as “DNA33473-1176”.
- FIG. 320 shows the amino acid sequence (SEQ ID NO:320) derived from the coding sequence of SEQ ID NO:319 shown in FIG. 319.
- FIG. 321 shows a nucleotide sequence (SEQ ID NO:321) of a native sequence PRO242 cDNA, wherein SEQ ID NO:321 is a clone designated herein as “DNA33785-1143”.
- FIG. 322 shows the amino acid sequence (SEQ ID NO:322) derived from the coding sequence of SEQ ID NO:321 shown in FIG. 321.
- FIG. 323 shows a nucleotide sequence (SEQ ID NO:323) of a native sequence PRO227 cDNA, wherein SEQ ID NO:323 is a clone designated herein as “DNA33786-1132”.
- FIG. 324 shows the amino acid sequence (SEQ ID NO:324) derived from the coding sequence of SEQ ID NO:323 shown in FIG. 323.
- FIG. 325 shows a nucleotide sequence (SEQ ID NO:325) of a native sequence PRO237 cDNA, wherein SEQ ID NO:325 is a clone designated herein as “DNA34353-1428”.
- FIG. 326 shows the amino acid sequence (SEQ ID NO:326) derived from the coding sequence of SEQ ID NO:325 shown in FIG. 325.
- FIG. 327 shows a nucleotide sequence (SEQ ID NO:327) of a native sequence PRO241 cDNA, wherein SEQ ID NO:327 is a clone designated herein as “DNA34392-1170”.
- FIG. 328 shows the amino acid sequence (SEQ ID NO:328) derived from the coding sequence of SEQ ID NO:327 shown in FIG. 327.
- FIG. 329 shows a nucleotide sequence (SEQ ID NO:329) of a native sequence PRO231 cDNA, wherein SEQ ID NO:329 is a clone designated herein as “DNA34434-1139”.
- FIG. 330 shows the amino acid sequence (SEQ ID NO:330) derived from the coding sequence of SEQ ID NO:329 shown in FIG. 329.
- FIG. 331 shows a nucleotide sequence (SEQ ID NO:331) of a native sequence PRO235 cDNA, wherein SEQ ID NO:331 is a clone designated herein as “DNA35558-1167”.
- FIG. 332 shows the amino acid sequence (SEQ ID NO:332) derived from the coding sequence of SEQ ID NO:331 shown in FIG. 331.
- FIG. 333 shows a nucleotide sequence (SEQ ID NO:333) of a native sequence PRO323 cDNA, wherein SEQ ID NO:333 is a clone designated herein as “DNA35595-1228”.
- FIG. 334 shows the amino acid sequence (SEQ ID NO:334) derived from the coding sequence of SEQ ID NO:333 shown in FIG. 333.
- FIG. 335 shows a nucleotide sequence (SEQ ID NO:335) of a native sequence PRO245 cDNA, wherein SEQ ID NO:335 is a clone designated herein as “DNA35638-1216”.
- FIG. 336 shows the amino acid sequence (SEQ ID NO:336) derived from the coding sequence of SEQ ID NO:335 shown in FIG. 335.
- FIG. 337 shows a nucleotide sequence (SEQ ID NO:337) of a native sequence PRO246 cDNA, wherein SEQ ID NO:337 is a clone designated herein as “DNA35639-1172”.
- FIG. 338 shows the amino acid sequence (SEQ ID NO:338) derived from the coding sequence of SEQ ID NO:337 shown in FIG. 337.
- FIG. 339 shows a nucleotide sequence (SEQ ID NO:339) of a native sequence PRO288 cDNA, wherein SEQ ID NO:339 is a clone designated herein as “DNA35663-1129”.
- FIG. 340 shows the amino acid sequence (SEQ ID NO:340) derived from the coding sequence of SEQ ID NO:339 shown in FIG. 339.
- FIG. 341 shows a nucleotide sequence (SEQ ID NO:341) of a native sequence PRO248 cDNA, wherein SEQ ID NO:341 is a clone designated herein as “DNA35674-1142”.
- FIG. 342 shows the amino acid sequence (SEQ ID NO:342) derived from the coding sequence of SEQ ID NO:341 shown in FIG. 341.
- FIG. 343 shows a nucleotide sequence (SEQ ID NO:343) of a native sequence PRO257 cDNA, wherein SEQ ID NO:343 is a clone designated herein as “DNA35841-1173”.
- FIG. 344 shows the amino acid sequence (SEQ ID NO:344) derived from the coding sequence of SEQ ID NO:343 shown in FIG. 343.
- FIG. 345 shows a nucleotide sequence (SEQ ID NO:345) of a native sequence PRO172 cDNA, wherein SEQ ID NO:345 is a clone designated herein as “DNA35916-1161 ”.
- FIG. 346 shows the amino acid sequence (SEQ ID NO:346) derived from the coding sequence of SEQ ID NO:345 shown in FIG. 345.
- FIG. 347 shows a nucleotide sequence (SEQ ID NO:347) of a native sequence PRO258 cDNA, wherein SEQ ID NO:347 is a clone designated herein as “DNA35918-1174”.
- FIG. 348 shows the amino acid sequence (SEQ ID NO:348) derived from the coding sequence of SEQ ID NO:347 shown in FIG. 347.
- FIG. 349 shows a nucleotide sequence (SEQ ID NO:349) of a native sequence PRO265 cDNA, wherein SEQ ID NO:349 is a clone designated herein as “DNA36350-1158”.
- FIG. 350 shows the amino acid sequence (SEQ ID NO:350) derived from the coding sequence of SEQ ID NO:349 shown in FIG. 349.
- FIG. 351 shows a nucleotide sequence (SEQ ID NO:351) of a native sequence PRO326 cDNA, wherein SEQ ID NO:351 is a clone designated herein as “DNA37140-1234”.
- FIG. 352 shows the amino acid sequence (SEQ ID NO:352) derived from the coding sequence of SEQ ID NO:351 shown in FIG. 351.
- FIG. 353 shows a nucleotide sequence (SEQ ID NO:353) of a native sequence PRO266 cDNA, wherein SEQ ID NO:353 is a clone designated herein as “DNA37150-1178”.
- FIG. 354 shows the amino acid sequence (SEQ ID NO:354) derived from the coding sequence of SEQ ID NO:353 shown in FIG. 353.
- FIG. 355 shows a nucleotide sequence (SEQ ID NO:355) of a native sequence PRO269 cDNA, wherein SEQ ID NO:355 is a clone designated herein as “DNA38260-1180”.
- FIG. 356 shows the amino acid sequence (SEQ ID NO:356) derived from the coding sequence of SEQ ID NO:355 shown in FIG. 355.
- FIG. 357 shows a nucleotide sequence (SEQ ID NO:357) of a native sequence PRO285 cDNA, wherein SEQ ID NO:357 is a clone designated herein as “DNA40021-1154”.
- FIG. 358 shows the amino acid sequence (SEQ ID NO:358) derived from the coding sequence of SEQ ID NO:357 shown in FIG. 357.
- FIG. 359 shows a nucleotide sequence (SEQ ID NO:359) of a native sequence PRO328 cDNA, wherein SEQ ID NO:359 is a clone designated herein as “DNA40587-1231”.
- FIG. 360 shows the amino acid sequence (SEQ ID NO:360) derived from the coding sequence of SEQ ID NO:359 shown in FIG. 359.
- FIG. 361 shows a nucleotide sequence (SEQ ID NO:361) of a native sequence PRO344 cDNA, wherein SEQ ID NO:361 is a clone designated herein as “DNA40592-1242”.
- FIG. 362 shows the amino acid sequence (SEQ ID NO:362) derived from the coding sequence of SEQ ID NO:361 shown in FIG. 361.
- FIG. 363 shows a nucleotide sequence (SEQ ID NO:363) of a native sequence PRO272 cDNA, wherein SEQ ID NO:363 is a clone designated herein as “DNA40620-1183”.
- FIG. 364 shows the amino acid sequence (SEQ ID NO:364) derived from the coding sequence of SEQ ID NO:363 shown in FIG. 363.
- FIG. 365 shows a nucleotide sequence (SEQ ID NO:365) of a native sequence PRO301 cDNA, wherein SEQ ID NO:365 is a clone designated herein as “DNA40628-1216”.
- FIG. 366 shows the amino acid sequence (SEQ ID NO:366) derived from the coding sequence of SEQ ID NO:365 shown in FIG. 365.
- FIG. 367 shows a nucleotide sequence (SEQ ID NO:367) of a native sequence PRO331 cDNA, wherein SEQ ID NO:367 is a clone designated herein as “DNA40981-1234”.
- FIG. 368 shows the amino acid sequence (SEQ ID NO:368) derived from the coding sequence of SEQ ID NO:367 shown in FIG. 367.
- FIG. 369 shows a nucleotide sequence (SEQ ID NO:369) of a native sequence PRO332 cDNA, wherein SEQ ID NO:369 is a clone designated herein as “DNA40982-1235”.
- FIG. 370 shows the amino acid sequence (SEQ ID NO:370) derived from the coding sequence of SEQ ID NO:369 shown in FIG. 369.
- FIG. 371 shows a nucleotide sequence (SEQ ID NO:371) of a native sequence PRO353 cDNA, wherein SEQ ID NO:371 is a clone designated herein as “DNA41234-1242”.
- FIG. 372 shows the amino acid sequence (SEQ ID NO:372) derived from the coding sequence of SEQ ID NO:371 shown in FIG. 371.
- FIG. 373 shows a nucleotide sequence (SEQ ID NO:373) of a native sequence PRO310 cDNA, wherein SEQ ID NO:373 is a clone designated herein as “DNA43046-1225”.
- FIG. 374 shows the amino acid sequence (SEQ ID NO:374) derived from the coding sequence of SEQ ID NO:373 shown in FIG. 373.
- FIG. 375 shows a nucleotide sequence (SEQ ID NO:375) of a native sequence PRO337 cDNA, wherein SEQ ID NO:375 is a clone designated herein as “DNA43316-1237”.
- FIG. 376 shows the amino acid sequence (SEQ ID NO:376) derived from the coding sequence of SEQ ID NO:375 shown in FIG. 375.
- FIG. 377 shows a nucleotide sequence (SEQ ID NO:377) of a native sequence PRO346 cDNA, wherein SEQ ID NO:377 is a clone designated herein as “DNA44167-1243”.
- FIG. 378 shows the amino acid sequence (SEQ ID NO:378) derived from the coding sequence of SEQ ID NO:377 shown in FIG. 377.
- FIG. 379 shows a nucleotide sequence (SEQ ID NO:379) of a native sequence PRO350 cDNA, wherein SEQ ID NO:379 is a clone designated herein as “DNA44175-1314”.
- FIG. 380 shows the amino acid sequence (SEQ ID NO:380) derived from the coding sequence of SEQ ID NO:379 shown in FIG. 379.
- FIG. 381 shows a nucleotide sequence (SEQ ID NO:381) of a native sequence PRO526 cDNA, wherein SEQ ID NO:381 is a clone designated herein as “DNA44184-1319”.
- FIG. 382 shows the amino acid sequence (SEQ ID NO:382) derived from the coding sequence of SEQ ID NO:381 shown in FIG. 381.
- FIG. 383 shows a nucleotide sequence (SEQ ID NO:383) of a native sequence PRO381 cDNA, wherein SEQ ID NO:383 is a clone designated herein as “DNA44194-1317”.
- FIG. 384 shows the amino acid sequence (SEQ ID NO:384) derived from the coding sequence of SEQ ID NO:383 shown in FIG. 383.
- FIG. 385 shows a nucleotide sequence (SEQ ID NO:385) of a native sequence PRO846 cDNA, wherein SEQ ID NO:385 is a clone designated herein as “DNA44196-1353”.
- FIG. 386 shows the amino acid sequence (SEQ ID NO:386) derived from the coding sequence of SEQ ID NO:385 shown in FIG. 385.
- FIG. 387 shows a nucleotide sequence (SEQ ID NO:387) of a native sequence PRO363 cDNA, wherein SEQ ID NO:387 is a clone designated herein as “DNA45419-1252”.
- FIG. 388 shows the amino acid sequence (SEQ ID NO:388) derived from the coding sequence of SEQ ID NO:387 shown in FIG. 387.
- FIG. 389 shows a nucleotide sequence (SEQ ID NO:389) of a native sequence PRO3,65 cDNA, wherein SEQ ID NO:389 is a clone designated herein as “DNA46777-1253”.
- FIG. 390 shows the amino acid sequence (SEQ ID NO:390) derived from the coding sequence of SEQ ID NO:389 shown in FIG. 389.
- FIG. 391 shows a nucleotide sequence (SEQ ID NO:391) of a native sequence PRO1310 cDNA, wherein SEQ ID NO:391 is a clone designated herein as “DNA47394-1572”.
- FIG. 392 shows the amino acid sequence (SEQ ID NO:392) derived from the coding sequence of SEQ ID NO:391 shown in FIG. 391.
- FIG. 393 shows a nucleotide sequence (SEQ ID NO:393) of a native sequence PRO731 cDNA, wherein SEQ ID NO:393 is a clone designated herein as “DNA48331-1329”.
- FIG. 394 shows the amino acid sequence (SEQ ID NO:394) derived from the coding sequence of SEQ ID NO:393 shown in FIG. 393.
- FIG. 395 shows a nucleotide sequence (SEQ ID NO:395) of a native sequence PRO322 cDNA, wherein SEQ ID NO:395 is a clone designated herein as “DNA48336-1309”.
- FIG. 396 shows the amino acid sequence (SEQ ID NO:396) derived from the coding sequence of SEQ ID NO:395 shown in FIG. 395.
- FIG. 397 shows a nucleotide sequence (SEQ ID NO:397) of a native sequence PRO536 cDNA, wherein SEQ ID NO:397 is a clone designated herein as “DNA49142-1430”.
- FIG. 398 shows the amino acid sequence (SEQ ID NO:398) derived from the coding sequence of SEQ ID NO:397 shown in FIG. 397.
- FIG. 399 shows a nucleotide sequence (SEQ ID NO:399) of a native sequence PRO719 cDNA, wherein SEQ ID NO:399 is a clone designated herein as “DNA49646-1327”.
- FIG. 400 shows the amino acid sequence (SEQ ID NO:400) derived from the coding sequence of SEQ ID NO:399 shown in FIG. 399.
- FIG. 401 shows a nucleotide sequence (SEQ ID NO:401) of a native sequence PRO619 cDNA, wherein SEQ ID NO:401 is a clone designated herein as “DNA49821-1562”.
- FIG. 402 shows the amino acid sequence (SEQ ID NO:402) derived from the coding sequence of SEQ ID NO:401 shown in FIG. 401.
- FIG. 403 shows a nucleotide sequence (SEQ ID NO:403) of a native sequence PRO771 cDNA, wherein SEQ ID NO:403 is a clone designated herein as “DNA49829-1346”.
- FIG. 404 shows the amino acid sequence (SEQ ID NO:404) derived from the coding sequence of SEQ ID NO:403 shown in FIG. 403.
- FIG. 405 shows a nucleotide sequence (SEQ ID NO:405) of a native sequence PRO1083 cDNA, wherein SEQ ID NO:405 is a clone designated herein as “DNA50921-1458”.
- FIG. 406 shows the amino acid sequence (SEQ ID NO:406) derived from the coding sequence of SEQ ID NO:405 shown in FIG. 405.
- FIG. 407 shows a nucleotide sequence (SEQ ID NO:407) of a native sequence PRO862 cDNA, wherein SEQ ID NO:407 is a clone designated herein as “DNA52187-1354”.
- FIG. 408 shows the amino acid sequence (SEQ ID NO:408) derived from the coding sequence of SEQ ID NO:407 shown in FIG. 407.
- FIG. 409 shows a nucleotide sequence (SEQ ID NO:409) of a native sequence PRO733 cDNA, wherein SEQ ID NO:409 is a clone designated herein as “DNA52196-1348”.
- FIG. 410 shows the amino acid sequence (SEQ ID NO:410) derived from the coding sequence of SEQ ID NO:409 shown in FIG. 409.
- FIG. 411 shows a nucleotide sequence (SEQ ID NO:411) of a native sequence PRO1188 cDNA, wherein SEQ ID NO:411 is a clone designated herein as “DNA52598-1518”.
- FIG. 412 shows the amino acid sequence (SEQ ID NO:412) derived from the coding sequence of SEQ ID NO:411 shown in FIG. 411.
- FIG. 413 shows a nucleotide sequence (SEQ ID NO:413) of a native sequence PRO770 cDNA, wherein SEQ ID NO:413 is a clone designated herein as “DNA54228-1366”.
- FIG. 414 shows the amino acid sequence (SEQ ID NO:414) derived from the coding sequence of SEQ ID NO:413 shown in FIG. 413.
- FIG. 415 shows a nucleotide sequence (SEQ ID NO:415) of a native sequence PRO1080 cDNA, wherein SEQ ID NO:415 is a clone designated herein as “DNA56047-1456”.
- FIG. 416 shows the amino acid sequence (SEQ ID NO:416) derived from the coding sequence of SEQ ID NO:415 shown in FIG. 415.
- FIG. 417 shows a nucleotide sequence (SEQ ID NO:417) of a native sequence PRO1017 cDNA, wherein SEQ ID NO:417 is a clone designated herein as “DNA56112-1379”.
- FIG. 418 shows the amino acid sequence (SEQ ID NO:418) derived from the coding sequence of SEQ ID NO:417 shown in FIG. 417.
- FIG. 419 shows a nucleotide sequence (SEQ ID NO:419) of a native sequence PRO1016 cDNA, wherein SEQ ID NO:419 is a clone designated herein as “DNA56113-1378”.
- FIG. 420 shows the amino acid sequence (SEQ ID NO:420) derived from the coding sequence of SEQ ID NO:419 shown in FIG. 419.
- FIG. 421 shows a nucleotide sequence (SEQ ID NO:421) of a native sequence PRO792 cDNA, wherein SEQ ID NO:421 is a clone designated herein as “DNA56352-1358”.
- FIG. 422 shows the amino acid sequence (SEQ ID NO:422) derived from the coding sequence of SEQ ID NO:421 shown in FIG. 421.
- FIG. 423 shows a nucleotide sequence (SEQ ID NO:423) of a native sequence PRO938 cDNA, wherein SEQ ID NO:423 is a clone designated herein as “DNA56433-1406”.
- FIG. 424 shows the amino acid sequence (SEQ ID NO:424) derived from the coding sequence of SEQ ID NO:423 shown in FIG. 423.
- FIG. 425 shows a nucleotide sequence (SEQ ID NO:425) of a native sequence PRO1012 cDNA, wherein SEQ ID NO:425 is a clone designated herein as “DNA56439-1376”.
- FIG. 426 shows the amino acid sequence (SEQ ID NO:426) derived from the coding sequence of SEQ ID NO:425 shown in FIG. 425.
- FIG. 427 shows a nucleotide sequence (SEQ ID NO:427) of a native sequence PRO1008 cDNA, wherein SEQ ID NO:427 is a clone designated herein as “DNA57530-1375”.
- FIG. 428 shows the amino acid sequence (SEQ ID NO:428) derived from the coding sequence of SEQ ID NO:427 shown in FIG. 427.
- FIG. 429 shows a nucleotide sequence (SEQ ID NO:429) of a native sequence PRO1075 cDNA, wherein SEQ ID NO:429 is a clone designated herein as “DNA57689-1385”.
- FIG. 430 shows the amino acid sequence (SEQ ID NO:430) derived from the coding sequence of SEQ ID NO:429 shown in FIG. 429.
- FIG. 431 shows a nucleotide sequence (SEQ ID NO:431) of a native sequence PRO1007 cDNA, wherein SEQ ID NO:431 is a clone designated herein as “DNA57690-1374”.
- FIG. 432 shows the amino acid sequence (SEQ ID NO:432) derived from the coding sequence of SEQ ID NO:431 shown in FIG. 431.
- FIG. 433 shows a nucleotide sequence (SEQ ID NO:433) of a native sequence PRO1056 cDNA, wherein SEQ ID NO:433 is a clone designated herein as “DNA57693-1424”.
- FIG. 434 shows the amino acid sequence (SEQ ID NO:434) derived from the coding sequence of SEQ ID NO:433 shown in FIG. 433.
- FIG. 435 shows a nucleotide sequence (SEQ ID NO:435) of a native sequence PRO791 cDNA, wherein SEQ ID NO:435 is a clone designated herein as “DNA57838-1337”.
- FIG. 436 shows the amino acid sequence (SEQ ID NO:436) derived from the coding sequence of SEQ ID NO:435 shown in FIG. 435.
- FIG. 437 shows a nucleotide sequence (SEQ ID NO:437) of a native sequence PRO111 cDNA, wherein SEQ ID NO:437 is a clone designated herein as “DNA58721-1475”.
- FIG. 438 shows the amino acid sequence (SEQ ID NO:438) derived from the coding sequence of SEQ ID NO:437 shown in FIG. 437.
- FIG. 439 shows a nucleotide sequence (SEQ ID NO:439) of a native sequence PRO812 cDNA, wherein SEQ ID NO:439 is a clone designated herein as “DNA59205-1421”.
- FIG. 440 shows the amino acid sequence (SEQ ID NO:440) derived from the coding sequence of SEQ ID NO:439 shown in FIG. 439.
- FIG. 441 shows a nucleotide sequence (SEQ ID NO:441) of a native sequence PRO1066 cDNA, wherein SEQ ID NO:441 is a clone designated herein as “DNA59215-1425”.
- FIG. 442 shows the amino acid sequence (SEQ ID NO:442) derived from the coding sequence of SEQ ID NO:441 shown in FIG. 441.
- FIG. 443 shows a nucleotide sequence (SEQ ID NO:443) of a native sequence PRO1185 cDNA, wherein SEQ ID NO:443 is a clone designated herein as “DNA59220-1514”.
- FIG. 444 shows the amino acid sequence (SEQ ID NO:444) derived from the coding sequence of SEQ ID NO:443 shown in FIG. 443.
- FIG. 445 shows a nucleotide sequence (SEQ ID NO:445) of a native sequence PRO1031 cDNA, wherein SEQ ID NO:445 is a clone designated herein as “DNA59294-1381”.
- FIG. 446 shows the amino acid sequence (SEQ ID NO:446) derived from the coding sequence of SEQ ID NO:445 shown in FIG. 445.
- FIG. 447 shows a nucleotide sequence (SEQ ID NO:447) of a native sequence PRO1360 cDNA, wherein SEQ ID NO:447 is a clone designated herein as “DNA59488-1603”.
- FIG. 448 shows the amino acid sequence (SEQ ID NO:448) derived from the coding sequence of SEQ ID NO:447 shown in FIG. 447.
- FIG. 449 shows a nucleotide sequence (SEQ ID NO:449) of a native sequence PRO1309 cDNA, wherein SEQ ID NO:449 is a clone designated herein as “DNA59588-1571”.
- FIG. 450 shows the amino acid sequence (SEQ ID NO:450) derived from the coding sequence of SEQ ID NO:449 shown in FIG. 449.
- FIG. 451 shows a nucleotide sequence (SEQ ID NO:451) of a native sequence PRO1107 cDNA, wherein SEQ ID NO:451 is a clone designated herein as “DNA59606-1471”.
- FIG. 452 shows the amino acid sequence (SEQ ID NO:452) derived from the coding sequence of SEQ ID NO:451 shown in FIG. 451.
- FIG. 453 shows a nucleotide sequence (SEQ ID NO:453) of a native sequence PRO836 cDNA, wherein SEQ ID NO:453 is a clone designated herein as “DNA59620-1463 ”.
- FIG. 454 shows the amino acid sequence (SEQ ID NO:454) derived from the coding sequence of SEQ ID NO:453 shown in FIG. 453.
- FIG. 455 shows a nucleotide sequence (SEQ ID NO:455) of a native sequence PROL 132 cDNA, wherein SEQ ID NO:455 is a clone designated herein as “DNA59767-1489”.
- FIG. 456 shows the amino acid sequence (SEQ ID NO:456) derived from the coding sequence of SEQ ID NO:455 shown in FIG. 455.
- FIG. 457 shows a nucleotide sequence (SEQ ID NO:457) of a native sequence PRO1131 cDNA, wherein SEQ ID NO:457 is a clone designated herein as “DNA59777-1480”.
- FIG. 458 shows the amino acid sequence (SEQ ID NO:458) derived from the coding sequence of SEQ ID NO:457 shown in FIG. 457.
- FIG. 459 shows a nucleotide sequence (SEQ ID NO:459) of a native sequence PRO1130 cDNA, wherein SEQ ID NO:459 is a clone designated herein as “DNA59814-1486”.
- FIG. 460 shows the amino acid sequence (SEQ ID NO:460) derived from the coding sequence of SEQ ID NO:459 shown in FIG. 459.
- FIG. 461 shows a nucleotide sequence (SEQ ID NO:461) of a native sequence PRO844 cDNA, wherein SEQ ID NO:461 is a clone designated herein as “DNA59839-1461”.
- FIG. 462 shows the amino acid sequence (SEQ ID NO:462) derived from the coding sequence of SEQ ID NO:461 shown in FIG. 461.
- FIG. 463 shows a nucleotide sequence (SEQ ID NO:463) of a native sequence PRO1154 cDNA, wherein SEQ ID NO:463 is a clone designated herein as “DNA59846-1503”.
- FIG. 464 shows the amino acid sequence (SEQ ID NO:464) derived from the coding sequence of SEQ ID NO:463 shown in FIG. 463.
- FIG. 465 shows a nucleotide sequence (SEQ ID NO:465) of a native sequence PRO1181 cDNA, wherein SEQ ID NO:465 is a clone designated herein as “DNA59847-1511”.
- FIG. 466 shows the amino acid sequence (SEQ ID NO:466) derived from the coding sequence of SEQ ID NO:465 shown in FIG. 465.
- FIG. 467 shows a nucleotide sequence (SEQ ID NO:467) of a native sequence PRO1126 cDNA, wherein SEQ ID NO:467 is a clone designated herein as “DNA60615-1483”.
- FIG. 468 shows the amino acid sequence (SEQ ID NO:468) derived from the coding sequence of SEQ ID NO:467 shown in FIG. 467.
- FIG. 469 shows a nucleotide sequence (SEQ ID NO:469) of a native sequence PRO1186 cDNA, wherein SEQ ID NO:469 is a clone designated herein as “DNA60621-1516”.
- FIG. 470 shows the amino acid sequence (SEQ ID NO:470) derived from the coding sequence of SEQ ID NO:469 shown in FIG. 469.
- FIG. 471 shows a nucleotide sequence (SEQ ID NO:471) of a native sequence PRO1198 cDNA, wherein SEQ ID NO:471 is a clone designated herein as “DNA60622-1525”.
- FIG. 472 shows the amino acid sequence (SEQ ID NO:472) derived from the coding sequence of SEQ ID NO:471 shown in FIG. 471.
- FIG. 473 shows a nucleotide sequence (SEQ ID NO:473) of a native sequence PRO1159 cDNA, wherein SEQ ID NO:473 is a clone designated herein as “DNA60627-1508”.
- FIG. 474 shows the amino acid sequence (SEQ ID NO:474) derived from the coding sequence of SEQ ID NO:473 shown in FIG. 473.
- FIG. 475 shows a nucleotide sequence (SEQ ID NO:475) of a native sequence PRO1265 cDNA, wherein SEQ ID NO:475 is a clone designated herein as “DNA60764-1533”.
- FIG. 476 shows the amino acid sequence (SEQ ID NO:476) derived from the coding sequence of SEQ ID NO:475 shown in FIG. 475.
- FIG. 477 shows a nucleotide sequence (SEQ ID NO:477) of a native sequence PRO1250 cDNA, wherein SEQ ID NO:477 is a clone designated herein as “DNA60775-1532”.
- FIG. 478 shows the amino acid sequence (SEQ ID NO:478) derived from the coding sequence of SEQ ID NO:477 shown in FIG. 477.
- FIG. 479 shows a nucleotide sequence (SEQ ID NO:479) of a native sequence PRO1475 cDNA, wherein SEQ ID NO:479 is a clone designated herein as “DNA61185-1646”.
- FIG. 480 shows the amino acid sequence (SEQ ID NO:480) derived from the coding sequence of SEQ ID NO:479 shown in FIG. 479.
- FIG. 481 shows a nucleotide sequence (SEQ ID NO:481) of a native sequence PRO1312 cDNA, wherein SEQ ID NO:481 is a clone designated herein as “DNA61873-1574”.
- FIG. 482 shows the amino acid sequence (SEQ ID NO:482) derived from the coding sequence of SEQ ID NO:481 shown in FIG. 481.
- FIG. 483 shows a nucleotide sequence (SEQ ID NO:483) of a native sequence PRO1308 cDNA, wherein SEQ ID NO:483 is a clone designated herein as “DNA62306-1570”.
- FIG. 484 shows the amino acid sequence (SEQ ID NO:484) derived from the coding sequence of SEQ ID NO:483 shown in FIG. 483.
- FIG. 485 shows a nucleotide sequence (SEQ ID NO:485) of a native sequence PRO1326 cDNA, wherein SEQ ID NO:485 is a clone designated herein as “DNA62808-1582”.
- FIG. 486 shows the amino acid sequence (SEQ ID NO:486) derived from the coding sequence of SEQ ID NO:485 shown in FIG. 485.
- FIG. 487 shows a nucleotide sequence (SEQ ID NO:487) of a native sequence PRO1192 cDNA, wherein SEQ ID NO:487 is a clone designated herein as “DNA62814-1521 ”.
- FIG. 488 shows the amino acid sequence (SEQ ID NO:488) derived from the coding sequence of SEQ ID NO:487 shown in FIG. 487.
- FIG. 489 shows a nucleotide sequence (SEQ ID NO:489) of a native sequence PRO1246 cDNA, wherein SEQ ID NO:489 is a clone designated herein as “DNA64885-1529”.
- FIG. 490 shows the amino acid sequence (SEQ ID NO:490) derived from the coding sequence of SEQ ID NO:489 shown in FIG. 489.
- FIG. 491 shows a nucleotide sequence (SEQ ID NO:491) of a native sequence PRO1356 cDNA, wherein SEQ ID NO:491 is a clone designated herein as “DNA64886-1601”.
- FIG. 492 shows the amino acid sequence (SEQ ID NO:492) derived from the coding sequence of SEQ ID NO:491 shown in FIG. 491.
- FIG. 493 shows a nucleotide sequence (SEQ ID NO:493) of a native sequence PRO1275 cDNA, wherein SEQ ID NO:493 is a clone designated herein as “DNA64888-1542”.
- FIG. 494 shows the amino acid sequence (SEQ ID NO:494) derived from the coding sequence of SEQ ID NO:493 shown in FIG. 493.
- FIG. 495 shows a nucleotide sequence (SEQ ID NO:495) of a native sequence PRO1274 cDNA, wherein SEQ ID NO:495 is a clone designated herein as “DNA64889-1541”.
- FIG. 496 shows the amino acid sequence (SEQ ID NO:496) derived from the coding sequence of SEQ ID NO:495 shown in FIG. 495.
- FIG. 497 shows a nucleotide sequence (SEQ ID NO:497) of a native sequence PRO1358 cDNA, wherein SEQ ID NO:497 is a clone designated herein as “DNA64890-1612”.
- FIG. 498 shows the amino acid sequence (SEQ ID NO:498) derived from the coding sequence of SEQ ID NO:497 shown in FIG. 497.
- FIG. 499 shows a nucleotide sequence (SEQ ID NO:499) of a native sequence PRO1286 cDNA, wherein SEQ ID NO:499 is a clone designated herein as “DNA64903-1553”.
- FIG. 500 shows the amino acid sequence (SEQ ID NO:500) derived from the coding sequence of SEQ ID NO:499 shown in FIG. 499.
- FIG. 501 shows a nucleotide sequence (SEQ ID NO:501) of a native sequence PRO1294 cDNA, wherein SEQ ID NO:501 is a clone designated herein as “DNA64905-1558”.
- FIG. 502 shows the amino acid sequence (SEQ ID NO:502) derived from the coding sequence of SEQ ID NO:501 shown in FIG. 501.
- FIG. 503 shows a nucleotide sequence (SEQ ID NO:503) of a native sequence PRO1273 cDNA, wherein SEQ ID NO:503 is a clone designated herein as “DNA65402-1540”.
- FIG. 504 shows the amino acid sequence (SEQ ID NO:504) derived from the coding sequence of SEQ ID NO:503 shown in FIG. 503.
- FIG. 505 shows a nucleotide sequence (SEQ ID NO:505) of a native sequence PRO1279 cDNA, wherein SEQ ID NO:505 is a clone designated herein as “DNA65405-1547”.
- FIG. 506 shows the amino acid sequence (SEQ ID NO:506) derived from the coding sequence of SEQ ID NO:505 shown in FIG. 505.
- FIG. 507 shows a nucleotide sequence (SEQ ID NO:507) of a native sequence PRO1195 cDNA, wherein SEQ ID NO:507 is a clone designated herein as “DNA65412-1523 ”.
- FIG. 508 shows the amino acid sequence (SEQ ID NO:508) derived from the coding sequence of SEQ ID NO:507 shown in FIG. 507.
- FIG. 509 shows a nucleotide sequence (SEQ ID NO:509) of a native sequence PRO1271 cDNA, wherein SEQ ID NO:509 is a clone designated herein as “DNA66309-1538”.
- FIG. 510 shows the amino acid sequence (SEQ ID NO:510) derived from the coding sequence of SEQ ID NO:509 shown in FIG. 509.
- FIG. 511 shows a nucleotide sequence (SEQ ID NO:511) of a native sequence PRO1338 cDNA, wherein SEQ ID NO:511 is a clone designated herein as “DNA66667-1596”.
- FIG. 512 shows the amino acid sequence (SEQ ID NO:512) derived from the coding sequence of SEQ ID NO:511 shown in FIG. 511.
- FIG. 513 shows a nucleotide sequence (SEQ ID NO:513) of a native sequence PRO1343 cDNA, wherein SEQ ID NO:513 is a clone designated herein as “DNA66675-1587”.
- FIG. 514 shows the amino acid sequence (SEQ ID NO:514) derived from the coding sequence of SEQ ID NO:513 shown in FIG. 513.
- FIG. 515 shows a nucleotide sequence (SEQ ID NO:515) of a native sequence PRO1434 cDNA, wherein SEQ ID NO:515 is a clone designated herein as “DNA68818-2536”.
- FIG. 516 shows the amino acid sequence (SEQ ID NO:516) derived from the coding sequence of SEQ ID NO:515 shown in FIG. 515.
- FIG. 517 shows a nucleotide sequence (SEQ ID NO:517) of a native sequence PRO1418 cDNA, wherein SEQ ID NO:517 is a clone designated herein as “DNA68864-1629”.
- FIG. 518 shows the amino acid sequence (SEQ ID NO:518) derived from the coding sequence of SEQ ID NO:517 shown in FIG. 517.
- FIG. 519 shows a nucleotide sequence (SEQ ID NO:519) of a native sequence PRO1387 cDNA, wherein SEQ ID NO:519 is a clone designated herein as “DNA68872-1620”.
- FIG. 520 shows the amino acid sequence (SEQ ID NO:520) derived from the coding sequence of SEQ ID NO:519 shown in FIG. 519.
- FIG. 521 shows a nucleotide sequence (SEQ ID NO:521) of a native sequence PRO1384 cDNA, wherein SEQ ID NO:521 is a clone designated herein as “DNA71159-1617”.
- FIG. 522 shows the amino acid sequence (SEQ ID NO:522) derived from the coding sequence of SEQ ID NO:521 shown in FIG. 521.
- FIG. 523 shows a nucleotide sequence (SEQ ID NO:523) of a native sequence PRO1565 cDNA, wherein SEQ ID NO:523 is a clone designated herein as “DNA73727-1673”.
- FIG. 524 shows the amino acid sequence (SEQ ID NO:524) derived from the coding sequence of SEQ ID NO:523 shown in FIG. 523.
- FIG. 525 shows a nucleotide sequence (SEQ ID NO:525) of a native sequence PRO1474 cDNA, wherein SEQ ID NO:525 is a clone designated herein as “DNA73739-1645”.
- FIG. 526 shows the amino acid sequence (SEQ ID NO:526) derived from the coding sequence of SEQ ID NO:525 shown in FIG. 525.
- FIG. 527 shows a nucleotide sequence (SEQ ID NO:527) of a native sequence PRO1917 cDNA, wherein SEQ ID NO:527 is a clone designated herein as “DNA76400-2528”.
- FIG. 528 shows the amino acid sequence (SEQ ID NO:528) derived from the coding sequence of SEQ ID NO:527 shown in FIG. 527.
- FIG. 529 shows a nucleotide sequence (SEQ ID NO:529) of a native sequence PRO1787 cDNA, wherein SEQ ID NO:529 is a clone designated herein as “DNA76510-2504”.
- FIG. 530 shows the amino acid sequence (SEQ ID NO:530) derived from the coding sequence of SEQ ID NO:529 shown in FIG. 529.
- FIG. 531 shows a nucleotide sequence (SEQ ID NO:531) of a native sequence PRO1556 cDNA, wherein SEQ ID NO:531 is a clone designated herein as “DNA76529-1666”.
- FIG. 532 shows the amino acid sequence (SEQ ID NO:532) derived from the coding sequence of SEQ ID NO:531 shown in FIG. 531.
- FIG. 533 shows a nucleotide sequence (SEQ ID NO:533) of a native sequence PRO1561 cDNA, wherein SEQ ID NO:533 is a clone designated herein as “DNA76538-1670”.
- FIG. 534 shows the amino acid sequence (SEQ ID NO:534) derived from the coding sequence of SEQ ID NO:533 shown in FIG. 533.
- FIG. 535 shows a nucleotide sequence (SEQ ID NO:535) of a native sequence PRO1693 cDNA, wherein SEQ ID NO:535 is a clone designated herein as “DNA77301-1708”.
- FIG. 536 shows the amino acid sequence (SEQ ID NO:536) derived from the coding sequence of SEQ ID NO:535 shown in FIG. 535.
- FIG. 537 shows a nucleotide sequence (SEQ ID NO:537) of a native sequence PRO1868 cDNA, wherein SEQ ID NO:537 is a clone designated herein as “DNA77624-2515”.
- FIG. 538 shows the amino acid sequence (SEQ ID NO:538) derived from the coding sequence of SEQ ID NO:537 shown in FIG. 537.
- FIG. 539 shows a nucleotide sequence (SEQ ID NO:539) of a native sequence PRO1890 cDNA, wherein SEQ ID NO:539 is a clone designated herein as “DNA79230-2525”.
- FIG. 540 shows the amino acid sequence (SEQ ID NO:540) derived from the coding sequence of SEQ ID NO:539 shown in FIG. 539.
- FIG. 541 shows a nucleotide sequence (SEQ ID NO:541) of a native sequence PRO1887 cDNA, wherein SEQ ID NO:541 is a clone designated herein as “DNA79862-2522”.
- FIG. 542 shows the amino acid sequence (SEQ ID NO:542) derived from the coding sequence of SEQ ID NO:541 shown in FIG. 541.
- FIG. 543 shows a nucleotide sequence (SEQ ID NO:543) of a native sequence PRO4353 cDNA, wherein SEQ ID NO:543 is a clone designated herein as “DNA80145-2594”.
- FIG. 544 shows the amino acid sequence (SEQ ID NO:544) derived from the coding sequence of SEQ ID NO:543 shown in FIG. 543.
- FIG. 545 shows a nucleotide sequence (SEQ ID NO:545) of a native sequence PRO1801 cDNA, wherein SEQ ID NO:545 is a clone designated herein as “DNA83500-2506”.
- FIG. 546 shows the amino acid sequence (SEQ ID NO:546) derived from the coding sequence of SEQ ID NO:545 shown in FIG. 545.
- FIG. 547 shows a nucleotide sequence (SEQ ID NO:547) of a native sequence PRO4357 cDNA, wherein SEQ ID NO:547 is a clone designated herein as “DNA84917-2597”.
- FIG. 548 shows the amino acid sequence (SEQ ID NO:548) derived from the coding sequence of SEQ ID NO:547 shown in FIG. 547.
- FIG. 549 shows a nucleotide sequence (SEQ ID NO:549) of a native sequence PRO4302 cDNA, wherein SEQ ID NO:549 is a clone designated herein as “DNA92218-2554”.
- FIG. 550 shows the amino acid sequence (SEQ ID NO:550) derived from the coding sequence of SEQ ID NO:549 shown in FIG. 549.
- PRO polypeptide and “PRO” as used herein and when immediately followed by a numerical designation refer to various polypeptides, wherein the complete designation (i.e., PRO/number) refers to specific polypeptide sequences as described herein.
- the terms “PRO/number polypeptide” and “PRO/number” wherein the term “number” is provided as an actual numerical designation as used herein encompass native sequence polypeptides and polypeptide variants (which are further defined herein).
- the PRO polypeptides described herein may be isolated from a variety of sources, such as from human tissue types or from another source, or prepared by recombinant or synthetic methods.
- PRO polypeptide refers to each individual PRO/number polypeptide disclosed herein.
- PRO polypeptide refers to each of the polypeptides individually as well as jointly. For example, descriptions of the preparation of, purification of, derivation of, formation of antibodies to or against, administration of, compositions containing, treatment of a disease with, etc., pertain to each polypeptide of the invention individually.
- the term “PRO polypeptide” also includes variants of the PRO/number polypeptides disclosed herein.
- a “native sequence PRO polypeptide” comprises a polypeptide having the same amino acid sequence as the corresponding PRO polypeptide derived from nature. Such native sequence PRO polypeptides can be isolated from nature or can be produced by recombinant or synthetic means.
- the term “native sequence PRO polypeptide” specifically encompasses naturally-occurring truncated or secreted forms of the specific PRO polypeptide (e.g., an extracellular domain sequence), naturally-occurring variant forms (e.g., alternatively spliced forms) and naturally-occurring allelic variants of the polypeptide.
- the native sequence PRO polypeptides disclosed herein are mature or full-length native sequence polypeptides comprising the full-length amino acids sequences shown in the accompanying figures. Start and stop codons are shown in bold font and underlined in the figures. However, while the PRO polypeptide disclosed in the accompanying figures are shown to begin with methionine residues designated herein as amino acid position 1 in the figures, it is conceivable and possible that other methionine residues located either upstream or downstream from the amino acid position 1 in the figures may be employed as the starting amino acid residue for the PRO polypeptides.
- the PRO polypeptide “extracellular domain” or “ECD” refers to a form of the PRO polypeptide which is essentially free of the transmembrane and cytoplasmic domains. Ordinarily, a PRO polypeptide ECD will have less than 1% of such transmembrane and/or cytoplasmic domains and preferably, will have less than 0.5% of such domains. It will be understood that any transmembrane domains identified for the PRO polypeptides of the present invention are identified pursuant to criteria routinely employed in the art for identifying that type of hydrophobic domain. The exact boundaries of a transmembrane domain may vary but most likely by no more than about 5 amino acids at either end of the domain as initially identified herein.
- an extracellular domain of a PRO polypeptide may contain from about 5 or fewer amino acids on either side of the transmembrane domain/extracellular domain boundary as identified in the Examples or specification and such polypeptides, with or without the associated signal peptide, and nucleic acid encoding them, are comtemplated by the present invention.
- cleavage of a signal sequence from a secreted polypeptide is not entirely uniform, resulting in more than one secreted species.
- These mature polypeptides, where the signal peptide is cleaved within no more than about 5 amino acids on either side of the C-terminal boundary of the signal peptide as identified herein, and the polynucleotides encoding them, are contemplated by the present invention.
- PRO polypeptide variant means an active PRO polypeptide as defined above or below having at least about 80% amino acid sequence identity with a full-length native sequence PRO polypeptide sequence as disclosed herein, a PRO polypeptide sequence lacking the signal peptide as disclosed herein, an extracellular domain of a PRO polypeptide, with or without the signal peptide, as disclosed herein or any other fragment of a full-length PRO polypeptide sequence as disclosed herein.
- Such PRO polypeptide variants include, for instance, PRO polypeptides wherein one or more amino acid residues are added, or deleted, at the N- or C-terminus of the full-length native amino acid sequence.
- a PRO polypeptide variant will have at least about 80% amino acid sequence identity, alternatively at least about 81% amino acid sequence identity, alternatively at least about 82% amino acid sequence identity, alternatively at least about 83% amino acid sequence identity, alternatively at least about 84% amino acid sequence identity, alternatively at least about 85% amino acid sequence identity, alternatively at least about 86% amino acid sequence identity, alternatively at least about 87% amino acid sequence identity, alternatively at least about 88% amino acid sequence identity, alternatively at least about 89% amino acid sequence identity, alternatively at least about 90% amino acid sequence identity, alternatively at least about 91% amino acid sequence identity, alternatively at least about 92% amino acid sequence identity, alternatively at least about 93% amino acid sequence identity, alternatively at least about 94% amino acid sequence identity, alternatively at least about 95% amino acid sequence identity, alternatively at least about 96% amino acid sequence identity, alternatively at least about 97% amino acid sequence identity, alternatively at least about 98% amino acid sequence identity and alternatively at least about 99% amino acid sequence identity to a full-length
- PRO variant polypeptides are at least about 10 amino acids in length, alternatively at least about 20 amino acids in length, alternatively at least about 30 amino acids in length, alternatively at least about 40 amino acids in length, alternatively at least about 50 amino acids in length, alternatively at least about 60 amino acids in length, alternatively at least about 70 amino acids in length, alternatively at least about 80 amino acids in length, alternatively at least about 90 amino acids in length, alternatively at least about 100 amino acids in length, alternatively at least about 150 amino acids in length, alternatively at least about 200 amino acids in length, alternatively at least about 300 amino acids in length, or more.
- Percent (%) amino acid sequence identity with respect to the PRO polypeptide sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific PRO polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2, wherein the complete source code for the ALIGN-2 program is provided in Table 1 below.
- the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc. and the source code shown in Table 1 below has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087.
- the ALIGN-2 program is publicly available through Genentech, Inc., South San Francisco, Calif. or may be compiled from the source code provided in Table 1 below.
- the ALIGN-2 program should be compiled for use on a UNIX operating system, preferably digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
- % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows:
- Tables 2 and 3 demonstrate how to calculate the % amino acid sequence identity of the amino acid sequence designated “Comparison Protein” to the amino acid sequence designated “PRO”, wherein “PRO” represents the amino acid sequence of a hypothetical PRO polypeptide of interest, “Comparison Protein” represents the amino acid sequence of a polypeptide against which the “PRO” polypeptide of interest is being compared, and “X, “Y” and “Z” each represent different hypothetical amino acid residues.
- a % amino acid sequence identity value is determined by dividing (a) the number of matching identical amino acid residues between the amino acid sequence of the PRO polypeptide of interest having a sequence derived from the native PRO polypeptide and the comparison amino acid sequence of interest (i.e., the sequence against which the PRO polypeptide of interest is being compared which may be a PRO variant polypeptide) as determined by WU-BLAST-2 by (b) the total number of amino acid residues of the PRO polypeptide of interest.
- amino acid sequence A is the comparison amino acid sequence of interest and the amino acid sequence B is the amino acid sequence of the PRO polypeptide of interest.
- Percent amino acid sequence identity may also be determined using the sequence comparison program NCBI-BLAST2 (Altschul et al., Nucleic Acids Res. 25:3389-3402 (1997)).
- NCBI-BLAST2 sequence comparison program may be downloaded from http://www.ncbi.nlm.nih.gov or otherwise obtained from the National Institute of Health, Bethesda, Md.
- % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows:
- PRO variant polynucleotide or “PRO variant nucleic acid sequence” means a nucleic acid molecule which encodes an active PRO polypeptide as defined below and which has at least about 80% nucleic acid sequence identity with a nucleotide acid sequence encoding a full-length native sequence PRO polypeptide sequence as disclosed herein, a full-length native sequence PRO polypeptide sequence lacking the signal peptide as disclosed herein, an extracellular domain of a PRO polypeptide, with or without the signal peptide, as disclosed herein or any other fragment of a full-length PRO polypeptide sequence as disclosed herein.
- a PRO variantpolynucleotide will have at least about 80% nucleic acid sequence identity, alternatively at least about 81% nucleic acid sequence identity, alternatively at least about 82% nucleic acid sequence identity, alternatively at least about 83% nucleic acid sequence identity, alternatively at least about 84% nucleic acid sequence identity, alternatively at least about 85% nucleic acid sequence identity, alternatively at least about 86% nucleic acid sequence identity, alternatively at least about 87% nucleic acid sequence identity, alternatively at least about 88% nucleic acid sequence identity, alternatively at least about 89% nucleic acid sequence identity, alternatively at least about 90% nucleic acid sequence identity, alternatively at least about 91% nucleic acid sequence identity, alternatively at least about 92% nucleic acid sequence identity, alternatively at least about 93% nucleic acid sequence identity, alternatively at least about 94% nucleic acid sequence identity, alternatively at least about 95% nucleic acid sequence identity, alternatively at least about 96% nucleic acid sequence identity, alternatively
- PRO variant polynucleotides are at least about 30 nucleotides in length, alternatively at least about 60 nucleotides in length, alternatively at least about 90 nucleotides in length, alternatively at least about 120 nucleotides in length, alternatively at least about 150 nucleotides in length, alternatively at least about 180 nucleotides in length, alternatively at least about 210 nucleotides in length, alternatively at least about 240 nucleotides in length, alternatively at least about 270 nucleotides in length, alternatively at least about 300 nucleotides in length, alternatively at least about 450 nucleotides in length, alternatively at least about 600 nucleotides in length, alternatively at least about 900 nucleotides in length, or more.
- Percent (%) nucleic acid sequence identity with respect to PRO-encoding nucleic acid sequences identified herein is defined as the percentage of nucleotides in a candidate sequence that are identical with the nucleotides in the PRO nucleic acid sequence of interest, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent nucleic acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software.
- % nucleic acid sequence identity values are generated using the sequence comparison computer program ALIGN-2, wherein the complete source code for the ALIGN-2 program is provided in Table 1 below.
- the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc. and the source code shown in Table 1 below has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No.
- TXU510087 The ALIGN-2 program is publicly available through Genentech, Inc., South San Francisco, Calif. or may be compiled from the source code provided in Table 1 below. The ALIGN-2 program should be compiled for use on a UNIX operating system, preferably digital UNIX V4.OD. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
- the % nucleic acid sequence identity of a given nucleic acid sequence C to, with, or against a given nucleic acid sequence D is calculated as follows:
- W is the number of nucleotides scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of C and D
- Z is the total number of nucleotides in D. It will be appreciated that where the length of nucleic acid sequence C is not equal to the length of nucleic acid sequence D, the % nucleic acid sequence identity of C to D will not equal the % nucleic acid sequence identity of D to C.
- Tables 4 and 5 demonstrate how to calculate the % nucleic acid sequence identity of the nucleic acid sequence designated “Comparison DNA” to the nucleic acid sequence designated “PRO-DNA”, wherein “PRO-DNA” represents a hypothetical PRO-encoding nucleic acid sequence of interest, “Comparison DNA” represents the nucleotide sequence of a nucleic acid molecule against which the “PRO-DNA” nucleic acid molecule of interest is being compared, and “N”, “L” and “V” each represent different hypothetical nucleotides.
- a % nucleic acid sequence identity value is determined by dividing (a) the number of matching identical nucleotides between the nucleic acid sequence of the PRO polypeptide-encoding nucleic acid molecule of interest having a sequence derived from the native sequence PRO polypeptide-encoding nucleic acid and the comparison nucleic acid molecule of interest (i.e., the sequence against which the PRO polypeptide-encoding nucleic acid molecule of interest is being compared which may be a variant PRO polynucleotide) as determined by WU-BLAST-2 by (b) the total number of nucleotides of the PRO polypeptide-encoding nucleic acid molecule of interest.
- nucleic acid sequence A is the comparison nucleic acid molecule of interest and the nucleic acid sequence B is the nucleic acid sequence of the PRO polypeptide-encoding nucleic acid molecule of interest.
- Percent nucleic acid sequence identity may also be determined using the sequence comparison program NCBI-BLAST2 (Altschul et al., Nucleic Acids Res. 25:3389-3402 (1997)).
- NCBI-BLAST2 sequence comparison program may be downloaded from http://www.ncbi.nlm.nih.gov or otherwise obtained from the National Institute of Health, Bethesda, MD.
- % nucleic acid sequence identity of a given nucleic acid sequence C to, with, or against a given nucleic acid sequence D is calculated as follows:
- W is the number of nucleotides scored as identical matches by the sequence alignment program NCBI-BLAST2 in that program's alignment of C and D
- Z is the total number of nucleotides in D. It will be appreciated that where the length of nucleic acid sequence C is not equal to the length of nucleic acid sequence D, the % nucleic acid sequence identity of C to D will not equal the % nucleic acid sequence identity of D to C.
- PRO variant polynucleotides are nucleic acid molecules that encode an active PRO polypeptide and which are capable of hybridizing, preferably under stringent hybridization and wash conditions, to nucleotide sequences encoding a full-length PRO polypeptide as disclosed herein.
- PRO variant polypeptides may be those that are encoded by a PRO variant polynucleofide.
- Isolated when used to describe the various polypeptides disclosed herein, means polypeptide that has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials that would typically interfere with diagnostic or therapeutic uses for the polypeptide, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes.
- the polypeptide will be purified (1) to a degree sufficient to obtain at least 15 residues of N-terminal orintemal amino acid sequence by use of a spinning cup sequenator, or (2) to homogeneity by SDS-PAGE under non-reducing or reducing conditions using Coomassie blue or, preferably, silver stain.
- Isolated polypeptide includes polypeptide in situ within recombinant cells, since at least one component of the PRO polypeptide natural environment will not be present. Ordinarily, however, isolated polypeptide will be prepared by at least one purification step.
- An “isolated” PRO polypeptide-encoding nucleic acid or other polypeptide-encoding nucleic acid is a nucleic acid molecule that is identified and separated from at least onecontaminant nucleic acid molecule with which it is ordinarily associated in the natural source of the polypeptide-encoding nucleic acid.
- An isolated polypeptide-encoding nucleic acid molecule is other than in the form or setting in which it is found in nature. Isolated polypeptide-encoding nucleic acid molecules therefore are distinguished from the specific polypeptide-encoding nucleic acid molecule as it exists in natural cells.
- an isolated polypeptide-encoding nucleic acid molecule includes polypeptide-encoding nucleic acid molecules contained in cells that ordinarily express the polypeptide where, for example, the nucleic acid molecule is in a chromosomal location different from that of natural cells.
- control sequences refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism.
- the control sequences that are suitable for prokaryotes include a promoter, optionally an operator sequence, and a ribosome binding site.
- Eukaryotic cells are known to utilize promoters, polyadenylation signals, and enhancers.
- Nucleic acid is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence.
- DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide;
- a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or
- a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
- “operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
- antibody is used in the broadest sense and specifically covers, for example, single anti-PRO monoclonal antibodies (including agonist, antagonist, and neutralizing antibodies), anti-PRO antibody compositions with polyepitopic specificity, single chain anti-PRO antibodies, and fragments of anti-PRO antibodies (see below).
- monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally-occurring mutations that may be present in minor amounts.
- “Stringency” of hybridization reactions is readily determinable by one of ordinary skill in the art, and generally is an empirical calculation dependent upon probe length, washing temperature, and salt concentration. In general, longer probes require higher temperatures for proper annealing, while shorter probes need lower temperatures. Hybridization generally depends on the ability of denatured DNA to reanneal when complementary strands are present in an environment below their melting temperature. The higher the degree of desired homology between the probe and hybridizable sequence, the higher the relative temperature which can be used. As a result, it follows that higher relative temperatures would tend to make the reaction conditions more stringent, while lower temperatures less so. For additional details and explanation of stringency of hybridization reactions, see Ausubel et al., Current Protocols in Molecular Biology, Wiley Interscience Publishers, (1995).
- “Stringent conditions” or “high stringency conditions”, as defined herein, may be identified by those that: (1) employ low ionic strength and high temperature for washing, for example 0.015 M sodium chloride/0.0015 M sodium citrate/0.1% sodium dodecyl sulfate at 50° C.; (2) employ during hybridization a denaturing agent, such as formamide, for example, 50% (v/v) formamide with 0.1% bovine serum albumin/0.1% Ficoll/0.1% polyvinylpyrrolidone/50 mM sodium phosphate buffer at pH 6.5 with 750 mM sodium chloride, 75 mM sodium citrate at 42° C.; or (3) employ 50% formamide, 5 ⁇ SSC (0.75 M NaCl, 0.075 M sodium citrate), 50 mnM sodium phosphate (pH 6.8), 0.1% sodium pyrophosphate, 5 ⁇ Denhardt's solution, sonicated salmon sperm DNA (50 ⁇ g/ml), 0.1% SDS, and 10%
- Modely stringent conditions may be identified as described by Sambrook et al., Molecular Cloning: A Laboratory Manual, New York: Cold Spring Harbor Press, 1989, and include the use of washing solution and hybridization conditions (e.g., temperature, ionic strength and %SDS) less stringent that those described above.
- washing solution and hybridization conditions e.g., temperature, ionic strength and %SDS
- An example of moderately stringent conditions is overnight incubation at 37° C.
- epitope tagged when used herein refers to a chimeric polypeptide comprising a PRO polypeptide fused to a “tag polypeptide”.
- the tag polypeptide has enough residues to provide an epitope against which an antibody can be made, yet is short enough such that it does not interfere with activity of the polypeptide to which it is fused.
- the tag polypeptide preferably also is fairly unique so that the antibody does not substantially cross-react with other epitopes.
- Suitable tag polypeptides generally have at least six amino acid residues and usually between about 8 and 50 amino acid residues (preferably, between about 10 and 20 amino acid residues).
- immunoadhesin designates antibody-like molecules which combine the binding specificity of a heterologous protein (an “adhesin”) with the effector functions of immunoglobulin constant domains.
- the immunoadhesins comprise a fusion of an amino acid sequence with the desired binding specificity which is other than the antigen recognition and binding site of an antibody (i.e., is “heterologous”), and an immunoglobulin constant domain sequence.
- the adhesin part of an immunoadhesin molecule typically is a contiguous amino acid sequence comprising at least the binding site of a receptor or a ligand.
- the immunoglobulin constant domain sequence in the immunoadhesin may be obtained from any immunoglobulin, such as IgG-1, IgG-2, IgG-3, or IgG4 subtypes, IgA (including IgA-1 and IgA-2), IgE, IgD or IgM.
- immunoglobulin such as IgG-1, IgG-2, IgG-3, or IgG4 subtypes, IgA (including IgA-1 and IgA-2), IgE, IgD or IgM.
- “Active” or “activity” for the purposes herein refers to form(s) of a PRO polypeptide which retain a biological andlor an immunological activity of native or naturally-occurring PRO, wherein “biological” activity refers to a biological function (either inhibitory or stimulatory) caused by a native or naturally-occurring PRO other than the ability to induce the production of an antibody against an antigenic epitope possessed by a native or naturally-occurring PRO and an “immunological” activity refers to the ability to induce the production of an antibody against an antigenic epitope possessed by a native or naturally-occurring PRO.
- the term “antagonist” is used in the broadest sense, and includes any molecule that partially or fully blocks, inhibits, or neutralizes a biological activity of a native PRO polypeptide disclosed herein.
- the term “agonist” is used in the broadest sense and includes any molecule that mimics a biological activity of a native PRO polypeptide disclosed herein.
- Suitable agonist or antagonist molecules specifically include agonist or antagonist antibodies or antibody fragments, fragments or amino acid sequence variants of native PRO polypeptides, peptides, antisense oligonucleotides, small organic molecules, etc.
- Methods for identifying agonists or antagonists of a PRO polypeptide may comprise contacting a PRO polypeptide with a candidate agonist or antagonist molecule and measuring a detectable change in one or more biological activities normally associated with the PRO polypeptide.
- Treatment refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) the targeted pathologic condition or disorder.
- Those in need of treatment include those already with the disorder as well as those prone to have the disorder or those in whom the disorder is to be prevented.
- Chronic administration refers to administration of the agent(s) in a continuous mode as opposed to an acute mode, so as to maintain the initial therapeutic effect (activity) for an extended period of time.
- Intermittent administration is treatment that is not consecutively done without interruption, but rather is cyclic in nature.
- “Mammal” for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, cats, cattle, horses, sheep, pigs, goats, rabbits, etc. Preferably, the mammal is human.
- Administration “in combination with” one or more further therapeutic agents includes simultaneous (concurrent) and consecutive administration in any order.
- Carriers as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers which are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution.
- physiologically acceptable carriers include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEENTM, polyethylene glycol (PEG), and PLURONICSTM.
- buffers such as phosphate, citrate, and other organic acids
- antioxidants including ascorbic acid
- proteins such as serum albumin,
- Antibody fragments comprise aportion of an intact antibody, preferably the antigen binding or variable region of the intact antibody.
- antibody fragments include Fab, Fab′, F(ab′) 2 , and Fv fragments; diabodies; linear antibodies (Zapata et al., Protein Eng. 8(10): 1057-1062[1995]); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
- Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, each with a single antigen-binding site, and a residual “Fc” fragment, a designation reflecting the ability to crystallize readily.
- Pepsin treatment yields an F(ab′) 2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen.
- Fv is the minimum antibody fragment which contains a complete antigen-recognition and -binding site. This region consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association. It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface of the V H -V L dimer. Collectively, the six CDRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
- the Fab fragment also contains the constant domain of the light chain and the first constant domain (CH1) of the heavy chain.
- Fab fragments differ from Fab′ fragments by the addition of a few residues at the carboxy terminus of the heavy chain CHI domain including one or more cysteines from the antibody hinge region.
- Fab′-SH is the designation herein for Fab′ in which the cysteine residue(s) of the constant domains bear a free thiol group.
- F(ab′) 2 antibody fragments originally were produced as pairs of Fab′ fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
- the “light chains” of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their constant domains.
- immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgGI, IgG2, IgG3, IgG4, IgA, and IgA2.
- Single-chain Fv or “sFv” antibody fragments comprise the V H and V L domains of antibody, wherein these domains are present in a single polypeptide chain.
- the Fv polypeptide further comprises a polypeptide linker between the V H and V L domains which enables the sFv to form the desired structure for antigen binding.
- diabodies refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (V H ) connected to a light-chain variable domain (V L ) in the same polypeptide chain (V H -V L ).
- V H heavy-chain variable domain
- V L light-chain variable domain
- the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
- Diabodies are described more fully in, for example, EP 404,097; WO 93/11161; and Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
- an “isolated” antibody is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
- the antibody will be purified (1) to greater than 95% by weight of antibody as determined by the Lowry method, and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain.
- Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
- An antibody that “specifically binds to” or is “specific for” a particular polypeptide or an epitope on a particular polypeptide is one that binds to that particular polypeptide or epitope on a particular polypeptide without substantially binding to any other polypeptide or polypeptide epitope.
- label when used herein refers to a detectable compound or composition which is conjugated directly or indirectly to the antibody so as to generate a “labeled” antibody.
- the label may be detectable by itself (e.g. radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition which is detectable.
- solid phase is meant a non-aqueous matrix to which the antibody of the present invention can adhere.
- solid phases encompassed herein include those formed partially or entirely of glass (e.g., controlled pore glass), polysaccharides (e.g., agarose), polyacrylamides, polystyrene, polyvinyl alcohol and silicones.
- the solid phase can comprise the well of an assay plate; in others it is a purification column (e.g., an affinity chromatography column). This term also includes a discontinuous solid phase of discrete particles, such as those described in U.S. Pat. No. 4,275,149.
- a “liposome” is a small vesicle composed of various types of lipids, phospholipids and/or surfactant which is useful for delivery of a drug (such as a PRO polypeptide or antibody thereto) to a mammal.
- a drug such as a PRO polypeptide or antibody thereto
- the components of the liposome are commonly arranged in a bilayer formation, similar to the lipid arrangement of biological membranes.
- a “small molecule” is defined herein to have a molecular weight below about 500 Daltons.
- an “effective amount” of a polypeptide disclosed herein or an agonist or antagonist thereof is an amount sufficient to carry out a specifically stated purpose.
- An “effective amount” may be determined empirically and in a routine manner, in relation to the stated purpose.
- the present invention provides newly identified and isolated nucleotide sequences encoding polypeptides referred to in the present application as PRO polypeptides.
- cDNAs encoding various PRO polypeptides have been identified and isolated, as disclosed in further detail in the Examples below. It is noted that proteins produced in separate expression rounds may be given different PRO numbers but the UNQ number is unique for any given DNA and the encoded protein, and will not be changed.
- PRO/number the protein encoded by the full length native nucleic acid molecules disclosed herein as well as all further native homologues and variants included in the foregoing definition of PRO, will be referred to as “PRO/number”, regardless of their origin or mode of preparation.
- PRO variants can be prepared.
- PRO variants can be prepared by introducing appropriate nucleotide changes into the PRO DNA, and/or by synthesis of the desired PRO polypeptide.
- amino acid changes may alter post-translational processes of the PRO, such as changing the number or position of glycosylation sites or altering the membrane anchoring characteristics.
- Variations in the native full-length sequence PRO or in various domains of the PRO described herein can be made, for example, using any of the techniques and guidelines for conservative and non-conservative mutations set forth, for instance, in U.S. Pat. No. 5,364,934.
- Variations may be a substitution, deletion or insertion of one or more codons encoding the PRO that results in a change in the amino acid sequence of the PRO as compared with the native sequence PRO.
- the variation is by substitution of at least one amino acid with any other amino acid in one or more of the domains of the PRO.
- Guidance in determining which amino acid residue may be inserted, substituted or deleted without adversely affecting the desired activity may be found by comparing the sequence of the PRO with that of homologous known protein molecules and minimizing the number of amino acid sequence changes made in regions of high homology.
- Amino acid substitutions can be the result of replacing one amino acid with another amino acid having similar structural and/or chemical properties, such as the replacement of a leucine with a serine, i.e., conservative amino acid replacements.
- Insertions or deletions may optionally be in the range of about 1 to 5 amino acids. The variation allowed may be determined by systematically making insertions, deletions or substitutions of amino acids in the sequence and testing the resulting variants for activity exhibited by the full-length or mature native sequence.
- PRO polypeptide fragments are provided herein. Such fragments may be truncated at the N-terminus or C-terminus, or may lack internal residues, for example, when compared with a full length native protein. Certain fragments lack amino acid residues that are not essential for a desired biological activity of the PRO polypeptide.
- PRO fragments may be prepared by any of a number of conventional techniques. Desired peptide fragments may be chemically synthesized. An alternative approach involves generating PRO fragments by enzymatic digestion, e.g., by treating the protein with an enzyme known to cleave proteins at sites defined by particular amino acid residues, orby digesting the DNA with suitable restriction enzymes and isolating the desired fragment. Yet another suitable technique involves isolating and amplifying a DNA fragment encoding a desired polypeptide fragment, by polymerase chain reaction (PCR). Oligonucleotides that define the desired termini of the DNA fragment are employed at the 5′ and 3′ primers in the PCR. Preferably, PRO polypeptide fragments share at least one biological and/or immunological activity with the native PRO polypeptide disclosed herein.
- PCR polymerase chain reaction
- Substantial modifications in function or immunological identity of the PRO polypeptide are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
- Naturally occurring residues are divided into groups based on common side-chain properties:
- Non-conservative substitutions will entail exchanging a member of one of these classes for another class. Such substituted residues also may be introduced into the conservative substitution sites or, more preferably, into the remaining (non-conserved) sites.
- the variations can be made using methods known in the art such as oligonucleotide-mediated (site-directed) mutagenesis, alanine scanning, and PCR mutagenesis.
- Site-directed mutagenesis [Carter et al., Nucl. Acids Res., 13:4331 (1986); Zoller et al., Nucl. Acids Res., 10:6487 (1987)]
- cassette mutagenesis [Wells et al., Gene, 34:315 (1985)]
- restriction selection mutagenesis Wells et al., Philos. Trans. R. Soc. London SerA, 317:415 (1986)] or other known techniques can be performed on the cloned DNA to produce the PRO variant DNA.
- Scanning amino acid analysis can also be employed to identify one or more amino acids along a contiguous sequence.
- preferred scanning amino acids are relatively small, neutral amino acids.
- amino acids include alanine, glycine, serine, and cysteine.
- Alanine is typically a preferred scanning amino acid among this group because it eliminates the side-chain beyond the beta-carbon and is less likely to alter the main-chain conformation of the variant [Cunningham and Wells, Science, 244: 1081-1085 (1989)].
- Alanine is also typically preferred because it is the most common amino acid. Further, it is frequently found in both buried and exposed positions [Creighton, The Proteins, (W. H. Freeman & Co., N.Y.); Chothia, J. Mol. Biol., 150:1 (1976)]. If alanine substitution does not yield adequate amounts of variant, an isoteric amino acid can be used.
- Covalent modifications of PRO are included within the scope of this invention.
- One type of covalent modification includes reacting targeted amino acid residues of a PRO polypeptide with an organic derivatizing agent that is capable of reacting with selected side chains or the N- or C- terminal residues of the PRO.
- Derivatization with bifunctional agents is useful, for instance, for crosslinking PRO to a water-insoluble support matrix or surface for use in the method for purifying anti-PRO antibodies, and vice-versa.
- crosslinking agents include, e.g., 1,1-bis(diazoacetyl)-2-phenylethane, glutaraldehyde, N-hydroxysuccinimide esters, for example, esters with 4-azidosalicylic acid, homobifunctional imidoesters, including disuccinimidyl esters such as 3,3′-dithiobis(succinimidylpropionate), bifunctional maleimides such as bis-N-maleimido-1,8-octane and agents such as methyl-3-[(p-azidophenyl)dithio]propioimidate.
- 1,1-bis(diazoacetyl)-2-phenylethane glutaraldehyde
- N-hydroxysuccinimide esters for example, esters with 4-azidosalicylic acid
- homobifunctional imidoesters including disuccinimidyl esters such as 3,3′-dithiobis(s
- Another type of covalent modification of the PRO polypeptide included within the scope of this invention comprises altering the native glycosylation pattern of the polypeptide.
- “Altering the native glycosylation pattern” is intended for purposes herein to mean deleting one or more carbohydrate moieties found in native sequence PRO (either by removing the underlying glycosylation site or by deleting the glycosylation by chemical and/or enzymatic means), and/or adding one or more glycosylation sites that are not present in the native sequence PRO.
- the phrase includes qualitative changes in the glycosylation of the native proteins, involving a change in the nature and proportions of the various carbohydrate moieties present.
- Addition of glycosylation sites to the PRO polypeptide may be accomplished by altering the amino acid sequence.
- the alteration may be made, for example, by the addition of, or substitution by, one or more serine or threonine residues to the native sequence PRO (for O-linked glycosylation sites).
- the PRO amino acid sequence may optionally be altered through changes at the DNA level, particularly by mutating the DNA encoding the PRO polypeptide at preselected bases such that codons are generated that will translate into the desired amino acids.
- Another means of increasing the number of carbohydrate moieties on the PRO polypeptide is by chemical or enzymatic coupling of glycosides to the polypeptide. Such methods are described in the art, e.g., in WO 87/05330 published Sep. 11, 1987, and in Aplin and Wriston, CRC Crit. Rev. Biochem., pp. 259-306 (1981).
- Removal of carbohydrate moieties present on the PRO polypeptide may be accomplished chemically or enzymatically or by mutational substitution of codons encoding for amino acid residues that serve as targets for glycosylation.
- Chemical deglycosylation techniques are known in the art and described, for instance, by Hakimuddin, etal., Arch. Biochem. Biophys., 259:52 (1987) and by Edge et al., Anal. Biochem., 118:131(1981).
- Enzymatic cleavage of carbohydrate moieties on polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al., Meth. Enzymol., 138:350 (1987).
- PRO polypeptide comprises linking the PRO polypeptide to one of a variety of nonproteinaceous polymers, e.g., polyethylene glycol (PEG), polypropylene glycol, or polyoxyalkylenes, in the manner set forth in U.S. Pat. Nos. 4,640,835; 4,496,689; 4,301,144; 4,670,417; 4,791,192 or 4,179,337.
- PEG polyethylene glycol
- polypropylene glycol polypropylene glycol
- polyoxyalkylenes polyoxyalkylenes
- the PRO of the present invention may also be modified in a way to form a chimeric molecule comprising PRO fused to another, heterologous polypeptide or amino acid sequence.
- such a chimeric molecule comprises a fusion of the PRO with a tag polypeptide which provides an epitope to which an anti-tag antibody can selectively bind.
- the epitope tag is generally placed at the amino- or carboxyl- terminus of the PRO. The presence of such epitope-tagged forms of the PRO can be detected using an antibody against the tag polypeptide. Also, provision of the epitope tag enables the PRO to be readily purified by affinity purification using an anti-tag antibody or another type of affinity matrix that binds to the epitope tag.
- tag polypeptides and their respective antibodies are well known in the art.
- poly-histidine poly-his
- poly-histidine-glycine poly-his-glycine tags
- flu HA tag polypeptide and its antibody 12CA5 [Field et al., Mol. Cell. Biol., 8:2159-2165 (1988)]
- c-myc tag and the 8F9, 3C7, 6E10, G4, B7 and 9E10 antibodies thereto [Evan et al., Molecular and Cellular Biology, 5:3610-3616 (1985)]
- Herpes Simplex virus glycoprotein D (gD) tag and its antibody [Paborsky et al., Protein Engineering, 3(6):547-553 (1990)].
- tag polypeptides include the Flag-peptide [Hopp et al., BioTechnology,6:1204-1210 (1988)]; the KT3 epitope peptide [Martin et al., Science, 255:192-194 (1992)]; an a-tubulin epitope peptide [Skinner et al., J. Biol. Chem., 266:15163-15166 (1991)]; and the T7 gene 10 protein peptide tag [Lutz-Freyermuth et al., Proc. Natl. Acad. Sci. USA, 87:6393-6397 (1990)].
- the chimeric molecule may comprise a fusion of the PRO with an immunoglobulin or a particular region of an immirunoglobulin.
- an immunoglobulin also referred to as an “immunoadhesin”
- a fusion could be to the Fc region of an IgG molecule.
- the Ig fusions preferably include the substitution of a soluble (transmembrane domain deleted or inactivated) form of a PRO polypeptide in place of at least one variable region within an Ig molecule.
- the immunoglobulin fusion includes the hinge, CH2 and CH3, or the hinge, CH1, CH2 and CH3 regions of an IgGI molecule.
- PRO sequence or portions thereof, may be produced by direct peptide synthesis using solid-phase techniques [see, e.g., Stewart et al., Solid-Phase Peptide Synthesis, W. H. Freeman Co., San Francisco, Calif. (1969); Merrifield, J. Am. Chem. Soc., 85:2149-2154 (1963)]. In vitro protein synthesis may be performed using manual techniques or by automation.
- Automated synthesis may be accomplished, for instance, using an Applied Biosystems Peptide Synthesizer (Foster City, Calif.) using manufacturer's instructions.
- Various portions of the PRO may be chemically synthesized separately and combined using chemical or enzymatic methods to produce the full-length PRO.
- DNA encoding PRO may be obtained from a cDNA library prepared from tissue believed to possess the PRO mRNA andto express it at a detectable level. Accordingly, human PRO DNA can be conveniently obtained from a cDNA library prepared from human tissue, such as described in the Examples.
- the PRO-encoding gene may also be obtained from a genomic library or by known synthetic procedures (e.g., automated nucleic acid synthesis).
- Libraries can be screened with probes (such as antibodies to the PRO or oligonucleotides of at least about 20-80 bases) designed to identify the gene of interest or the protein encoded by it. Screening the cDNA or genomic library with the selected probe may be conducted using standard procedures, such as described in Sambrook et al., Molecular Cloning: A Laboratory Manual (New York: Cold Spring Harbor Laboratory Press, 1989). An alternative means to isolate the gene encoding PRO is to use PCR methodology [Sambrook et al., supra; Dieffenbach et al., PCR Primer: A Laboratory Manual (Cold Spring Harbor Laboratory Press, 1995)].
- the oligonucleotide sequences selected as probes should be of sufficient length and sufficiently unambiguous that false positives are minimized.
- the oligonucleotide is preferably labeled such that it can be detected upon hybridization to DNA in the library being screened. Methods of labeling are well known in the art, and include the use of radiolabels like 32 P-labeled ATP, biotinylation or enzyme labeling. Hybridization conditions, including moderate stringency and high stringency, are provided in Sambrook et al., supra.
- Sequences identified in such library screening methods can be compared and aligned to other known sequences deposited and available in public databases such as GenBank or other private sequence databases. Sequence identity (at either the amino acid or nucleotide level) within defined regions of the molecule or across the full-length sequence can be determined using methods known in the art and as described herein.
- Nucleic acid having protein coding sequence may be obtained by screening selected cDNA or genomic libraries using the deduced amino acid sequence disclosed herein for the first time, and, if necessary, using conventional primer extension procedures as described in Sambrook et al., supra, to detect precursors and processing intermediates of mRNA that may not have been reverse-transcribed into cDNA.
- Host cells are transfected or transformed with expression or cloning vectors described herein for PRO production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
- the culture conditions such as media, temperature, pH and the like, can be selected by the skilled artisan without undue experimentation. In general, principles, protocols, and practical techniques for maximizing the productivity of cell cultures can be found in Mammalian Cell Biotechnology: a Practical Approach, M. Butler, ed. (IRL Press, 1991) and Sambrook et al., supra.
- Methods of eukaryotic cell transfection and prokaryotic cell transformation are known to the ordinarily skilled artisan, for example, CaCl 2 , CaPO 4 , liposome-mediated and electroporation. Depending on the host cell used, transformation is performed using standard techniques appropriate to such cells.
- the calcium treatment employing calcium chloride, as described in Sambrook et al., supra, or electroporation is generally used for prokaryotes.
- Infection with Agrobacterium tumefaciens is used for transformation of certain plant cells, as described by Shaw et al., Gene 23:315 (1983) and WO 89/05859 published Jun. 29, 1989.
- DNA into cells such as by nuclear microinjection, electroporation, bacterial protoplast fusion with intact cells, or polycations, e.g., polybrene, polyornithine, may also be used.
- polycations e.g., polybrene, polyornithine.
- Suitable host cells for cloning or expressing the DNA in the vectors herein include prokaryote, yeast, or higher eukaryote cells.
- Suitable prokaryotes include but are not limited to eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as E. coli.
- Various E. coli strains are publicly available, such as E. coli K12 strain MM294 (ATCC 31,446); E. coli X1776 (ATCC 31,537); E. coli strain W3110 (ATCC 27,325) and K5 772 (ATCC 53,635).
- suitable prokaryotic host cells include Enterobacteriaceaesuch as Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g., Salmonella typhimurium, Serratia, e.g., Serratia marcescans, and Shigella, as well as Bacilli such as B. subtilis and B. lichenifornis (e.g., B. lichenifornis 41P disclosed in DD 266,710published Apr. 12, 1989), Pseudomonas such as P. aeruginosa, and Streptomyces. These examples are illustrative rather than limiting.
- Strain W3110 is one particularly preferred host or parent host because it is a common host strain for recombinant DNA product fermentations.
- the host cell secretes minimal amounts of proteolytic enzymes.
- strain W3 110 may be modified to effect a genetic mutation in the genes encoding proteins endogenous to the host, with examples of such hosts including E. coli W3 110 strain 1A2, which has the complete genotype tonA; E. coli W3 110 strain 9E4, which has the complete genotype tonA ptr3; E.
- coli W3 110 strain 27C7 (ATCC 55,244), which has the complete genotype tonA ptr3 phoA E15 (argF-lac)169 degP ompT kan r ;
- E. coli W3 110 strain 37D6 which has the complete genotype tonA ptr3phoA E15 (argF-lac)169 degP ompT rbs7 ilvG kan r ;
- E. coli W3110 strain 40B4 which is strain 37D6 with a non-kanamycin resistant degP deletion mutation; and an E. coli strain having mutant periplasmic protease disclosed in U.S. Pat. No. 4,946,783 issued Aug. 7, 1990.
- in vitro methods of cloning e.g., PCR or other nucleic acid polymerase reactions, are suitable.
- eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for PRO-encoding vectors.
- Saccharomyces cerevisiae is a commonly used lower eukaryotic host microorganism.
- Others include Schizosaccharomyces pombe (Beach and Nurse, Nature, 290:140[1981]; EP 139,383 published May 2, 1985); Kluyveromyces hosts (U.S. Pat. No. 4,943,529; Fleer et al., Bio/Technoloy, 9:968-975 (1991)) such as, e.g., K.
- lactis (MW98-8C, CBS683, CBS4574; Louvencourt et al., J. Bacteriol., 154(2):737-742[1983]), K. fragilis (ATCC 12,424), K. bulgaricus (ATCC 16,045), K. wickeramii (ATCC 24,178), K. waltii (ATCC 56,500), K. drosophilarum (ATCC 36,906; Van den Berg et al., Bio/Technology, 8:135 (1990)), K. thermotolerans, and K. marxianus; yarrowia (EP 402,226); Pichia pastoris (EP 183,070; Sreekrishna et al., J.
- Methylotropic yeasts are suitable herein and include, but are not limited to, yeast capable of growth on methanol selected from the genera consisting of Hansenula, Candida, Kloeckera, Pichia, Saccharomyces, Torulopsis, and Rhodotorula. A list of specific species that are exemplary of this class of yeasts may be found in C. Anthony, The Biochemistry of Methylotrophs, 269 (1982).
- Suitable host cells for the expression of glycosylated PRO are derived from multicellular organisms.
- invertebrate cells include insect cells such as Drosophila S2 and Spodoptera Sf9, as well as plant cells.
- useful mammalian host cell lines include Chinese hamster ovary (CHO) and COS cells. More specific examples include monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol., 36:59 (1977)); Chinese hamster ovary cells/-DHFR (CHO, Urlaub and Chasin, Proc. Natl. Acad. Sci.
- mice sertoli cells TM4, Mather, Biol. Reprod., 23:243-251 (1980)
- human lung cells W138, ATCC CCL 75
- human liver cells Hep G2, HB 8065
- mouse mammary tumor MMT 060562, ATCC CCL51. The selection of the appropriate host cell is deemed to be within the skill in the art.
- the nucleic acid (e.g., cDNA or genomic DNA) encoding PRO may be inserted into a replicable vector for cloning (amplification of the DNA) or for expression.
- a replicable vector for cloning (amplification of the DNA) or for expression.
- the vector may, for example, be in the form of a plasmid, cosmid, viral particle, or phage.
- the appropriate nucleic acid sequence may be inserted into the vector by a variety of procedures. In general, DNA is inserted into an appropriate restriction endonuclease site(s) using techniques known in the art.
- Vector components generally include, but are not limited to, one or more of a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence. Construction of suitable vectors containing one or more of these components employs standard ligation techniques which are known to the skilled artisan.
- the PRO may be produced recombinantly not only directly, but also as a fusion polypeptide with a heterologous polypeptide, which may be a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide.
- a heterologous polypeptide which may be a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide.
- the signal sequence may be a component of the vector, or it may be a part of the PRO-encoding DNA that is inserted into the vector.
- the signal sequence may be a prokaryotic signal sequence selected, for example, from the group of the alkaline phosphatase, penicillinase, Ipp, or heat-stable enterotoxin II leaders.
- the signal sequence may be, e.g., the yeast invertase leader, alpha factor leader (including Saccharomyces and Kluyveromyces ⁇ -factor leaders, the latter described in U.S. Pat. No. 5,010,182), or acid phosphatase leader, the C. albicans glucoamylase leader (EP 362,179 published Apr. 4, 1990), or the signal described in WO 90/13646 published Nov. 15, 1990.
- mammalian signal sequences may be used to direct secretion of the protein, such as signal sequences from secreted polypeptides of the same or related species, as well as viral secretory leaders.
- Both expression and cloning vectors contain a nucleic acid sequence that enables the vector to replicate in one or more selected host cells. Such sequences are well known for a variety of bacteria, yeast, and viruses.
- the origin of replication from the plasmid pBR322 is suitable for most Gram-negative bacteria, the 2 ⁇ plasmid origin is suitable for yeast, and various viral origins (SV40, polyoma, adenovirus, VSV or BPV) are useful for cloning vectors in mammalian cells.
- Selection genes will typically contain a selection gene, also termed a selectable marker.
- Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic deficiencies, or (c) supply critical nutrients not available from complex media, e.g., the gene encoding D-alanine racemase forBacilli.
- Suitable selectable markers for mammalian cells are those that enable the identification of cells competent to take up the PRO-encoding nucleic acid, such as DHFR or thymidine kinase.
- An appropriate host cell when wild-type DHFR is employed is the CHO cell line deficient in DHFR activity, prepared and propagated as described by Urlaub et al., Proc. Natl. Acad. Sci. USA, 77:4216 (1980).
- a suitable selection gene for use in yeast is the trp1 gene present in the yeast plasmid YRp7 [Stinchcomb et al., Nature, 282:39 (1979); Kingsman et al., Gene, 7:141(1979); Tschemper et al., Gene, 10:157(1980)].
- the trp1 gene provides a selection marker for a mutant strain of yeast lacking the ability to grow in tryptophan, for example, ATCC No. 44076 or PEP4-1 [Jones, Genetics, 85:12 (1977)].
- Expression and cloning vectors usually contain apromoter operably linked to the PRO-encoding nucleic acid sequence to direct mRNA synthesis. Promoters recognized by a variety of potential host cells are well known. Promoters suitable for use with prokaryotic hosts include the P-lactamase and lactose promoter systems [Changetal., Nature, 275:615 (1978); Goeddeletal., Nature, 281:544 (1979)], alkaline phosphatase, atryptophan (trp) promoter system [Goeddel, Nucleic Acids Res., 8:4057 (1980); EP 36,776], and hybrid promoters such as the tac promoter [deBoer et al., Proc. Natl. Acad. Sci. USA, 80:21-25 (1983)]. Promoters for use in bacterial systems also will contain a Shine-Dalgarno (S.D.) sequence operably linked to the DNA encoding PRO.
- S.D. Shin
- Suitable promoting sequences for use with yeast hosts include the promoters for 3-phosphoglycerate kinase [Hitzeman et al., J. Biol. Chem., 255:2073 (1980)] or other glycolytic enzymes [Hess et al., J. Adv.
- enolase such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3-phosphoglycerate mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isome
- yeast promoters which are inducible promoters having the additional advantage of transcription controlled by growth conditions, are the promoter regions for alcohol dehydrogenase 2, isocytochrome C, acid phosphatase, degradative enzymes associated with nitrogen metabolism, metallothionein, glyceraldehyde-3-phosphate dehydrogenase, and enzymes responsible for maltose and galactose utilization. Suitable vectors and promoters for use in yeast expression are further described in EP 73,657.
- PRO transcription from vectors in mammalian host cells is controlled, for example, by promoters obtained from the genomes of viruses such as polyoma virus, fowlpox virus (UK 2,211,504 published Jul. 5, 1989), adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and Simian Virus 40 (SV40), fromheterologous mammalianpromoters, e.g., the actin promoter or an immunoglobulin promoter, and from heat-shock promoters, provided such promoters are compatible with the host cell systems.
- viruses such as polyoma virus, fowlpox virus (UK 2,211,504 published Jul. 5, 1989), adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retro
- Enhancers are cis-acting elements of DNA, usually about from 10 to 300 bp, that act on a promoter to increase its transcription.
- Many enhancer sequences are now known from mammalian genes (globin, elastase, albumin, a-fetoprotein, and insulin). Typically, however, one will use an enhancer from a eukaryotic cell virus.
- Examples include the SV40 enhancer on the late side of the replication origin (bp 100-270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers.
- the enhancer may be spliced into the vector at a position 5′ or 3′ to the PRO coding sequence, but is preferably located at a site 5′ from the promoter.
- Expression vectors used in eukaryotic host cells will also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5′ and, occasionally 3′, untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding PRO.
- Gene amplification and/or expression may be measured in a sample directly, for example, by conventional Southern blotting, Northern blotting to quantitate the transcription of mRNA [Thomas, Proc. Natl. Acad. Sci. USA, 77:5201-5205 (1980)], dot blotting (DNA analysis), or in situ hybridization, using an appropriately labeled probe, based on the sequences provided herein.
- antibodies may be employed that can recognize specific duplexes, including DNA duplexes, RNA duplexes, and DNA-RNA hybrid duplexes or DNA-protein duplexes. The antibodies in turn may be labeled and the assay may be carried out where the duplex is bound to a surface, so that upon the formation of duplex on the surface, the presence of antibody bound to the duplex can be detected.
- Gene expression may be measured by immunological methods, such as immunohistochemical staining of cells or tissue sections and assay of cell culture or body fluids, to quantitate directly the expression of gene product.
- Antibodies useful for immunohistochemical staining and/or assay of sample fluids may be either monoclonal or polyclonal, and may be prepared in any mammal. Conveniently, the antibodies may be prepared against a native sequence PRO polypeptide or against a synthetic peptide based on the DNA sequences provided herein or against exogenous sequence fused to PRO DNA and encoding a specific antibody epitope.
- Forms of PRO may be recovered from culture medium or from host cell lysates. If membrane-bound, it can be released from the membrane using a suitable detergent solution (e.g. Triton-X 100) or by enzymatic cleavage. Cells employed in expression of PRO can be disrupted by various physical or chemical means, such as freeze-thaw cycling, sonication, mechanical disruption, or cell lysing agents.
- a suitable detergent solution e.g. Triton-X 100
- Cells employed in expression of PRO can be disrupted by various physical or chemical means, such as freeze-thaw cycling, sonication, mechanical disruption, or cell lysing agents.
- the following procedures are exemplary of suitable purification procedures: by fractionation on an ion-exchange column; ethanol precipitation; reverse phase HPLC; chromatography on silica or on a cation-exchange resin such as DEAE; chromatofocusing; SDS-PAGE; ammonium sulfate precipitation; gel filtration using, for example, Sephadex G-75; protein A Sepharose columns to remove contaminants such as IgG; and metal chelating columns to bind epitope-tagged forms of the PRO.
- Nucleotide sequences (or their complement) encoding PRO have various applications in the art of molecular biology, including uses as hybridization probes, in chromosome and gene mapping and in the generation of anti-sense RNA and DNA.
- PRO nucleic acid will also be useful for the preparation of PRO polypeptides by the recombinant techniques described herein.
- the full-length native sequence PRO gene, or portions thereof, may be used as hybridization probes for a cDNA library to isolate the full-length PRO cDNA or to isolate still other cDNAs (for instance, those encoding naturally-occurring variants of PRO or PRO from other species) which have a desired sequence identity to the native PRO sequence disclosed herein.
- the length of the probes will be about 20 to about 50 bases.
- the hybridization probes may be derived from at least partially novel regions of the full length native nucleotide sequence wherein those regions may be determined without undue experimentation or from genomic sequences including promoters, enhancer elements and introns of native sequence PRO.
- a screening method will comprise isolating the coding region of the PRO gene using the known DNA sequence to synthesize a selected probe of about 40 bases.
- Hybridization probes may be labeled by a variety of labels, including radionucleotides such as 32 P or 35 S, or enzymatic labels such as alkaline phosphatase coupled to the probe via avidin/biotin coupling systems. Labeled probes having a sequence complementary to that of the PRO gene of the present invention can be used to screen libraries of human cDNA, genomic DNA or mRNA to determine which members of such libraries the probe hybridizes to. Hybridization techniques are described in further detail in the Examples below.
- antisense or sense oligonucleotides comprising a singe-stranded nucleic acid sequence (either RNA or DNA) capable of binding to target PRO mRNA (sense) or PRO DNA (antisense) sequences.
- Antisense or sense oligonucleotides comprise a fragment of the coding region of PRO DNA. Such a fragment generally comprises at least about 14 nucleotides, preferably from about 14 to 30 nucleotides.
- Stein and Cohen Cancer Res. 48:2659, 1988
- van der Krol et al. BioTechnigues 6:958, 1988.
- binding of antisense or sense oligonucleotides to target nucleic acid sequences results in the formation of duplexes that block transcription or translation of the target sequence by one of several means, including enhanced degradation of the duplexes, premature termination of transcription or translation, or by other means.
- the antisense oligonucleotides thus may be used to block expression of PRO proteins.
- Antisense or sense oligonucleotides further comprise oligonucleotides having modified sugar-phosphodiester backbones (or other sugar linkages, such as those described in WO 91/06629) and wherein such sugar linkages are resistant to endogenous nucleases. Such oligonucleotides with resistant sugar linkages are stable.in vivo (i.e., capable of resisting enzymatic degradation) but retain sequence specificity to be able to bind to target nucleotide sequences.
- sense or antisense oligonucleotides include those oligonucleotides which are covalently linked to organic moieties, such as those described in WO 90/10048, and other moieties that increases affinity of the oligonucleotide for a target nucleic acid sequence, such as poly-(L-lysine).
- intercalating agents such as ellipticine, and alkylating agents or metal complexes may be attached to sense or antisense oligonucleotides to modify binding specificities of the antisense or sense oligonucleotide for the target nucleotide sequence.
- Antisense or sense oligonucleotides may be introduced into a cell containing the target nucleic acid sequence by any gene transfer method, including, for example, CaPO 4 -mediated DNA transfection, electroporation, or by using gene transfer vectors such as Epstein-Barr virus.
- an antisense or sense oligonucleotide is inserted into a suitable retroviral vector.
- a cell containing the target nucleic acid sequence is contacted with the recombinant retroviral vector, either in vivo or ex vivo.
- Suitable retroviral vectors include, but are not limited to, those derived from the murine retrovirus M-MuLV, N2 (a retrovirus derived from M-MuLV), or the double copy vectors designated DCTSA, DCT5B and DCT5C (see WO 90/13641).
- Sense or antisense oligonucleotides also may be introduced into a cell containing the target nucleotide sequence by formation of a conjugate with a ligand binding molecule, as described in WO 91/04753.
- Suitable ligand binding molecules include, but are not limited to, cell surface receptors, growth factors, other cytokines, or other ligands that bind to cell surface receptors.
- conjugation of the ligand binding molecule does not substantially interfere with the ability of the ligand binding molecule to bind to its corresponding molecule or receptor, or block entry of the sense or antisense oligonucleotide or its conjugated version into the cell.
- a sense or an antisense oligonucleotide may be introduced into a cell containing the target nucleic acid sequence by formation of an oligonucleotide-lipid complex, as described in WO 90/10448.
- the sense or antisense oligonucleotide-lipid complex is preferably dissociated within the cell by an endogenous lipase.
- Antisense or sense RNA or DNA molecules are generally at least about 5 bases in length, about 10 bases in length, about 15 bases in length, about 20 bases in length, about 25 bases in length, about 30 bases in length, about 35 bases in length, about 40 bases in length, about 45 bases in length, about 50 bases in length, about 55 bases in length, about 60 bases in length, about 65 bases in length, about 70 bases in length, about 75 bases in length, about 80 bases in length, about 85 bases in length, about 90 bases in length, about 95 bases in length, about 100 bases in length, or more.
- the probes may also be employed in PCR techniques to generate a pool of sequences for identification of closely related PRO coding sequences.
- Nucleotide sequences encoding a PRO can also be used to construct hybridization probes for mapping the gene which encodes that PRO and for the genetic analysis of individuals with genetic disorders.
- the nucleotide sequences provided herein may be mapped to a chromosome and specific regions of a chromosome using known techniques, such as in situ hybridization, linkage analysis against known chromosomal markers, and hybridization screening with libraries.
- the coding sequences for PRO encode a protein which binds to another protein (example, where the PRO is a receptor)
- the PRO can be used in assays to identify the other proteins or molecules involved in the binding interaction. By such methods, inhibitors of the receptor/ligand binding interaction can be identified. Proteins involved in such binding interactions can also be used to screen for peptide or small molecule inhibitors or agonists of the binding interaction. Also, the receptor PRO can be used to isolate correlative ligand(s). Screening assays can be designed to find lead compounds that mirnic the biological activity of a native PRO or a receptor for PRO.
- screening assays will include assays amenable to high-throughput screening of chemical libraries, making them particularly suitable for identifying small molecule drug candidates.
- Small molecules contemplated include synthetic organic or inorganic compounds.
- the assays can be performed in a variety of formats, including protein-protein binding assays, biochemical screening assays, immunoassays and cell based assays, which are well characterized in the art.
- Nucleic acids which encode PRO or its modified formns can also be used to generate either transgenic animals or “knock out” animals which, in turn, are useful in the development and screening of therapeutically useful reagents.
- a transgenic animal e.g., a mouse or rat
- a transgenic animal is an animal having cells that contain a transgene, which transgene was introduced into the animal or an ancestor of the animal at a prenatal, e.g., an embryonic stage.
- a transgene is a DNA which is integrated into the genome of a cell from which a transgenic animal develops.
- cDNA encoding PRO can be used to clone genomic DNA encoding PRO in accordance with established techniques and the genomic sequences used to generate transgenic animals that contain cells which express DNA encoding PRO.
- Methods for generating transgenic animals, particularly animals such as mice or rats, have become conventional in the art and are described, for example, in U.S. Pat. Nos. 4,736,866 and 4,870,009.
- particular cells would be targeted for PRO transgene incorporation with tissue-specific enhancers.
- Transgenic animals that include a copy of a transgene encoding PRO introduced into the germ line of the animal at an embryonic stage can be used to examine the effect of increased expression of DNA encoding PRO.
- Such animals can be used as tester animals for reagents thought to confer protection from, for example, pathological conditions associated with its overexpression.
- an animal is treated with the reagent and a reduced incidence of the pathological condition, compared to untreated animals bearing the transgene, would indicate a potential therapeutic intervention for the pathological condition.
- non-human homologues of PRO can be used to construct a PRO “knock out” animal which has a defective or altered gene encoding PRO as a result of homologous recombination between the endogenous gene encoding PRO and altered genomic DNA encoding PRO introduced into an embryonic stem cell of the animal.
- cDNA encoding PRO can be used to clone genomic DNA encoding PRO in accordance with established techniques. A portion of the genomic DNA encoding PRO can be deleted or replaced with another gene, such as a gene encoding a selectable marker which can be used to monitor integration.
- flanking DNA typically, several kilobases of unaltered flanking DNA (both at the 5′ and 3′ ends) are included in the vector [see e.g., Thomas and Capecchi, Cell, 51:503 (1987) for a description of homologous recombination vectors].
- the vector is introduced into an embryonic stem cell line (e.g., by electroporation) and cells in which the introduced DNA has homologously recombined with the endogenous DNA are selected [see e.g., Li et al., Cell, 69:915 (1992)].
- the selected cells are then injected into a blastocyst of an animal (e.g., a mouse or rat) to form aggregation chimeras [see e.g., Bradley, in Teratocarcinomas and Embryonic Stem Cells: A Practical Approach, E. J. Robertson, ed. (IRL, Oxford, 1987), pp. 113-152].
- a chimeric embryo can then be implanted into a suitable pseudopregnant female foster animal and the embryo brought to term to create a “knock out” animal.
- Progeny harboring the homologously recombined DNA in their germ cells can be identified by standard techniques and used to breed animals in which all cells of the animal contain the homologously recombined DNA.
- Knockout animals can be characterized for instance, for their ability to defend against certain pathological conditions and for their development of pathological conditions due to absence of the PRO polypeptide.
- Nucleic acid encoding the PRO polypeptides may also be used in gene therapy.
- genes are introduced into cells in order to achieve in vivo synthesis of a therapeutically effective genetic product, for example for replacement of a defective gene.
- Gene therapy includes both conventional gene therapy where a lasting effect is achieved by a single treatment, and the administration of gene therapeutic agents, which involves the one time or repeated administration of a therapeutically effective DNA or mRNA.
- Antisense RNAs and DNAs can be used as therapeutic agents for blocking the expression of certain genes in vivo. It has already been shown that short antisense oligonucleotides can be imported into cells where they act as inhibitors, despite their low intracellular concentrations caused by their restricted uptake by the cell membrane.
- oligonucleotides can be modified to enhance their uptake, e.g. by substituting their negatively charged phosphodiester groups by uncharged groups.
- nucleic acids there are a variety of techniques available for introducing nucleic acids into viable cells.
- the techniques vary depending upon whether the nucleic acid is transferred into cultured cells in vitro, or in vivo in the cells of the intended host.
- Techniques suitable for the transfer of nucleic acid into mammalian cells in vitro include the use of liposomes, electroporation, microinjection, cell fusion, DEAE-dextran, the calcium phosphate precipitation method, etc.
- the currently preferred in vivo gene transfer techniques include transfection with viral (typically retroviral) vectors and viral coat protein-liposome mediated transfection (Dzau et al., Trends in Biotechnology 11,205-210[1993]).
- the nucleic acid source with an agent that targets the target cells, such as an antibody specific for a cell surface membrane protein or the target cell, a ligand for a receptor on the target cell, etc.
- an agent that targets the target cells such as an antibody specific for a cell surface membrane protein or the target cell, a ligand for a receptor on the target cell, etc.
- proteins which bind to a cell surface membrane protein associated with endocytosis may be used for targeting and/or to facilitate uptake, e.g. capsid proteins or fragments thereof tropic for aparticular cell type, antibodies forproteins which undergo internalization in cycling, proteins that target intracellular localization and enhance intracellular half-life.
- the technique of receptor-mediated endocytosis is described, for example, by Wu et al., J. Biol. Chem.
- PRO polypeptides described herein may also be employed as molecular weight markers for protein electrophoresis purposes and the isolated nucleic acid sequences may be used for recombinantly expressing those markers.
- nucleic acid molecules encoding the PRO polypeptides or fragments thereof described herein are useful for chromosome identification.
- Each PRO nucleic acid molecule of the present invention can be used as a chromosome marker.
- PRO polypeptides and nucleic acid molecules of the present invention may also be used diagnostically for tissue typing, wherein the PRO polypeptides of the present invention may be differentially expressed in one tissue as compared to another, preferably in a diseased tissue as compared to a normal tissue of the same tissue type.
- PRO nucleic acid molecules will find use for generating probes for PCR, Northern analysis, Southern analysis and Western analysis.
- PRO polypeptides described herein may also be employed as therapeutic agents.
- the PRO polypeptides of the present invention can be formulated according to known methods to prepare pharmaceutically useful compositions, whereby the PRO product hereof is combined in admixture with a pharmaceutically acceptable carrier vehicle.
- Therapeutic formulations are prepared for storage by mixing the active ingredient having the desired degree of purity with optional physiologically acceptable carriers, excipients or stabilizers ( Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions.
- Acceptable carriers, excipients or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone, amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEENTM, PLURONICSTM or PEG.
- buffers such as phosphate, citrate and other organic acids
- antioxidants including ascorbic acid
- the formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes, prior to or following lyophilization and reconstitution.
- compositions herein generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
- the route of administration is in accord with known methods, e.g. injection or infusion by intravenous, intraperitoneal, intracerebral, intramuscular, intraocular, intraarterial or intralesional routes, topical administration, or by sustained release systems.
- Dosages and desired drug concentrations of pharmaceutical compositions of the present invention may vary depending on the particular use envisioned. The determination of the appropriate dosage or route of administration is well within the skill of an ordinary physician. Animal experiments provide reliable guidance for the determination of effective doses for human therapy. Interspecies scaling of effective doses can be performed following the principles laid down by Mordenti, J. and Chappell, W. “The use of interspecies scaling in toxicokinetics” In Toxicokinetics and New Drug Development, Yacobi et al., Eds., Pergamon Press, New York 1989, pp. 42-96.
- a PRO polypeptide or agonist or antagonist thereof When in vivo administration of a PRO polypeptide or agonist or antagonist thereof is employed, normal dosage amounts may vary from about 10 nglkg to up to 100 mg/kg of mammal body weight or more per day, preferably about 1 itg/kg/day to 10 mg/kg/day, depending upon the route of administration.
- Guidance as to particular dosages and methods of delivery is provided in the literature; see, for example, U.S. Pat. Nos. 4,657,760; 5,206,344; or 5,225,212. It is anticipated that different formulations will be effective for different treatment compounds and different disorders, that administration targeting one organ or tissue, for example, may necessitate delivery in a manner different from that to another organ or tissue.
- microencapsulation of the PRO polypeptide is contemplated. Microencapsulation of recombinant proteins for sustained release has been successfully performed with human growth hormone (rhGH), interferon-(rhIFN-), interleukin-2, and MN rgp120. Johnson et al., Nat. Med., 2:795-799 (1996); Yasuda, Biomed.
- rhGH human growth hormone
- rhIFN- interferon-(rhIFN-)
- interleukin-2 interleukin-2
- MN rgp120 MN rgp120
- the sustained-release formulations of these proteins were developed using poly-lactic-coglycolic acid (PLGA) polymer due to its biocompatibility and wide range of biodegradable properties.
- PLGA poly-lactic-coglycolic acid
- the degradation products of PLGA, lactic and glycolic acids, can be cleared quickly within the human body.
- the degradability of this polymer can be adjusted from months to years depending on its molecular weight and composition.
- Lewis “Controlled release of bioactive agents from lactide/glycolide polymer,” in: M. Chasin and R. Langer (Eds.), Biodegradable Polymers as Drug Delivery Systems (Marcel Dekker: New York, 1990), pp. 1-41.
- This invention encompasses methods of screening compounds to identify those that mimic the PRO polypeptide (agonists) or prevent the effect of the PRO polypeptide (antagonists).
- Screening assays for antagonist drug candidates are designed to identify compounds that bind or complex with the PRO polypeptides encoded by the genes identified herein, or otherwise interfere with the interaction of the encoded polypeptides with other cellular proteins.
- Such screening assays will include assays amenable to high-throughput screening of chemical libraries, making them particularly suitable for identifying small molecule drug candidates.
- the assays can be performed in a variety of formats, including protein-protein binding assays, biochemical screening assays, immunoassays, and cell-based assays, which are well characterized in the art.
- the interaction is binding and the complex formed can be isolated or detected in the reaction mixture.
- the PRO polypeptide encoded by the gene identified herein or the drug candidate is immobilized on a solid phase, e.g., on a microtiter plate, by covalent or non-covalent attachments.
- Non-covalent attachment generally is accomplished by coating the solid surface with a solution of the PRO polypeptide and drying.
- an immobilized antibody e.g., a monoclonal antibody, specific for the PRO polypeptide to be immobilized can be used to anchor it to a solid surface.
- the assay is performed by adding the non-immobilized component, which may be labeled by a detectable label, to the immobilized component, e.g., the coated surface containing the anchored component.
- the non-reacted components are removed, e.g., by washing, and complexes anchored on the solid surface are detected.
- the detection of label immobilized on the surface indicates that complexing occurred.
- complexing can be detected, for example, by using a labeled antibody specifically binding the immobilized complex.
- the candidate compound interacts with but does not bind to a particular PRO polypeptide encoded by a gene identified herein, its interaction with that polypeptide can be assayed by methods well known for detecting protein-protein interactions.
- assays include traditional approaches, such as, e.g., cross-linking, co-immunoprecipitation, and co-purification through gradients or chromatographic columns.
- protein-protein interactions can be monitored by using a yeast-based genetic system described by Fields and co-workers (Fields and Song, Nature (London), 340:245-246 (1989); Chien et al., Proc. Natl. Acad. Sci.
- yeast GALA Many transcriptional activators, such as yeast GALA, consist of two physically discrete modular domains, one acting as the DNA-binding domain, the other one functioning as the transcription-activation domain.
- the yeast expression system described in the foregoing publications (generally referred to as the “two-hybrid system”) takes advantage of this property, and employs two hybrid proteins, one in which the target protein is fused to the DNA-binding domain of GALA, and another, in which candidate activating proteins are fused to the activation domain.
- GALl-lacZ reporter gene under control of a GALA-activated promoter depends on reconstitution of GALA activity via protein-protein interaction. Colonies containing interacting polypeptides are detected with a chromogenic substrate for ⁇ -galactosidase.
- a complete kit (MATCHRAKERTM) for identifying protein-protein interactions between two specific proteins using the two-hybrid technique is commercially available from Clontech. This system can also be extended to map protein domains involved in specific protein interactions as well as to pinpoint amino acid residues that are crucial for these interactions.
- the PRO polypeptide may be added to a cell along with the compound to be screened for a particular activity and the ability of the compound to inhibit the activity of interest in the presence of the PRO polypeptide indicates that the compound is an antagonist to the PRO polypeptide.
- antagonists may be detected by combining the PRO polypeptide and a potential antagonist with membrane-bound PRO polypeptide receptors or recombinant receptors under appropriate conditions for a competitive inhibition assay.
- the PRO polypeptide can be labeled, such as by radioactivity, such that the number of PRO polypeptide molecules bound to the receptor can be used to determine the effectiveness of the potential antagonist.
- the gene encoding the receptor can be identified by numerous methods known to those of skill in the art, for example, ligand panning and FACS sorting. Coligan et al., Current Protocols in Immun., 1(2): Chapter 5 (1991).
- expression cloning is employed wherein polyadenylated RNA is prepared from a cell responsive to the PRO polypeptide and a cDNA library created from this RNA is divided into pools and used to transfect COS cells or other cells that are not responsive to the PRO polypeptide. Transfected cells that are grown on glass slides are exposed to labeled PRO polypeptide.
- the PRO polypeptide can be labeled by a variety of means including iodination or inclusion of a recognition site for a site-specific protein kinase. Following fixation and incubation, the slides are subjected to autoradiographic analysis. Positive pools are identified and sub-pools are prepared and re-transfected using an interactive sub-pooling and re-screening process, eventually yielding a single clone that encodes the putative receptor.
- labeled PRO polypeptide can be photoaffinity-linked with cell membrane or extract preparations that express the receptor molecule. Cross-linked material is resolved by PAGE and exposed to X-ray film. The labeled complex containing the receptor can be excised, resolved into peptide fragments, and subjected to protein micro-sequencing. The amino acid sequence obtained from micro- sequencing would be used to design a set of degenerate oligonucleotide probes to screen a cDNA library to identify the gene encoding the putative receptor.
- mammalian cells or a membrane preparation expressing the receptor would be incubated with labeled PRO polypeptide in the presence of the candidate compound. The ability of the compound to enhance or block this interaction could then be measured.
- potential antagonists include an oligonucleotide that binds to the fusions of immunoglobulin with PRO polypeptide, and, in particular, antibodies including, without limitation, poly- and monoclonal antibodies and antibody fragments, single-chain antibodies, anti-idiotypic antibodies, and chimeric or humanized versions of such antibodies or fragments, as well as human antibodies and antibody fragments.
- a potential antagonist may be a closely related protein, for example, a mutated form of the PRO polypeptide that recognizes the receptor but imparts no effect, thereby competitively inhibiting the action of the PRO polypeptide.
- Another potential PRO polypeptide antagonist is an antisense RNA or DNA construct prepared using antisense technology, where, e.g., an antisense RNA or DNA molecule acts to block directly the translation of mRNA by hybridizing to targeted mRNA and preventing protein translation.
- Antisense technology can be used to control gene expression through triple-helix formation or antisense DNA or RNA, both of which methods are based on binding of apolynucleotide to DNA or RNA.
- the 5′coding portion of the polynucleotide sequence, which encodes the mature PRO polypeptides herein, is used to design an antisense RNA oligonucleotide of from about 10 to 40 base pairs in length.
- a DNA oligonucleotide is designed to be complementary to a region of the gene involved in transcription (triple helix—see Lee et al., Nucl. Acids Res., 6:3073 (1979); Cooney et al., Science, 241: 456 (1988); Dervan et al., Science, 251:1360 (1991)), thereby preventing transcription and the production of the PRO polypeptide.
- the antisense RNA oligonucleotide hybridizes to the mRNA in vivo and blocks translation of the mRNA molecule into the PRO polypeptide (antisense—Okano, Neurochem., 56:560 (1991); Oligodeoxynucleotides as Antisense Inhibitors of Gene Expression (CRC Press: Boca Raton, Fla., 1988).
- the oligonucleotides described above can also be delivered to cells such that the antisense RNA or DNA may be expressed in vivo to inhibit production of the PRO polypeptide.
- antisense DNA is used, oligodeoxyribonucleotides derived from the translation-initiation site, e.g., between about ⁇ 10 and +10 positions of the target gene nucleotide sequence, are preferred.
- Potential antagonists include small molecules that bind to the active site, the receptor binding site, or growth factor or other relevant binding site of the PRO polypeptide, thereby blocking the normal biological activity of the PRO polypeptide.
- small molecules include, but are not limited to, small peptides or peptide-like molecules, preferably soluble peptides, and synthetic non-peptidyl organic or inorganic compounds.
- Ribozymes are enzymatic RNA molecules capable of catalyzing the specific cleavage of RNA. Ribozymes act by sequence-specific hybridization to the complementary target RNA, followed by endonucleolytic cleavage. Specific ribozyme cleavage sites within a potential RNA target can be identified by known techniques. For further details see, e.g., Rossi, Current Biology, 4:469471 (1994), and PCT publication No. WO 97/33551 (published Sep. 18, 1997).
- Nucleic acid molecules in triple-helix formation used to inhibit transcription should be single-stranded and composed of deoxynucleotides.
- the base composition of these oligonucleotides is designed such that it promotes triple-helix formation via Hoogsteen base-pairing rules, which generally require sizeable stretches of purines or pyrimidines on one strand of a duplex.
- Hoogsteen base-pairing rules which generally require sizeable stretches of purines or pyrimidines on one strand of a duplex.
- Diagnostic and therapeutic uses of the herein disclosed molecules may also be based upon the positive functional assay hits disclosed and described below.
- the present invention further provides anti-PRO antibodies.
- Exemplary antibodies include polyclonal, monoclonal, humanized, bispecific, and heteroconjugate antibodies.
- the anti-PRO antibodies may comprise polyclonal antibodies. Methods of preparing polyclonal antibodies are known to the skilled artisan. Polyclonal antibodies can be raised in a mammal, for example, by one or more injections of an immunizing agent and, if desired, an adjuvant. Typically, the immunizing agent and/or adjuvant will be injected in the mammal by multiple subcutaneous or intraperitoneal injections.
- the immunizing agent may include the PRO polypeptide or a fusion protein thereof. It may be useful to conjugate the immunizing agent to aprotein known to be immunogenic in the mammal being immunized.
- immunogenic proteins include but are not limited to keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, and soybean trypsin inhibitor.
- adjuvants which may be employed include Freund's complete adjuvant and MPL-TDM adjuvant (monophosphoryl Lipid A, synthetic trehalose dicorynomycolate).
- the immunization protocol may be selected by one skilled in the art without undue experimentation.
- the anti-PRO antibodies may, alternatively, be monoclonal antibodies.
- Monoclonal antibodies may be prepared using hybridoma methods, such as those described by Kohler and Milstein, Nature, 256:495 (1975).
- a hybridoma method a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent.
- the lymphocytes may be immunized in vitro.
- the immunizing agent will typically include the PRO polypeptide or a fusion protein thereof.
- PBLs peripheral blood lymphocytes
- spleen cells or lymph node cells are used if non-human mammalian sources are desired.
- the lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell [Goding, Monoclonal Antibodies: Principles and Practice, Academic Press, (1986) pp. 59-103].
- Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin.
- rat or mouse myeloma cell lines are employed.
- the hybridoma cells may be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells.
- a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells.
- the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (“HAT medium”), which substances prevent the growth of HGPRT-deficient cells.
- Preferred immortalized cell lines are those that fuse efficiently, support stable high level expression of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. More preferred immortalized cell lines are murine myeloma lines, which can be obtained, for instance, from the Salk Institute Cell Distribution Center, San Diego, California and the American Type Culture Collection, Manassas, Virginia. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies [Kozbor, J. Immunol., 133:3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, Marcel Dekker, Inc., New York, (1987) pp. 51-63].
- the culture medium in which the hybridoma cells are cultured can then be assayed for the presence of monoclonal antibodies directed against PRO.
- the binding specificity of monoclonal antibodies produced by the hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA).
- RIA radioimmunoassay
- ELISA enzyme-linked immunoabsorbent assay
- the binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson and Pollard, Anal. Biochem., 107:220 (1980).
- the clones may be subdloned by limiting dilution procedures and grown by standard methods [Goding, supra]. Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium and RPMI-1640 medium. Alternatively, the hybridoma cells may be grown in vivo as ascites in a mammal.
- the monoclonal antibodies secreted by the subclones may be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
- the monoclonal antibodies may also be made by recombinant DNA methods, such as those described in U.S. Pat. No. 4,816,567.
- DNA encoding the monoclonal antibodies of the invention can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies).
- the hybridoma cells of the invention serve as a preferred source of such DNA.
- the DNA may be placed into expression vectors, which are then transfected into host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
- the DNA also may be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences [U.S. Pat. No. 4,816,567; Morrison et al., u or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide.
- non-immunoglobulin polypeptide can be substituted for the constant domains of an antibody of the invention, or can be substituted for the variable domains of one antigen-combining site of an antibody of the invention to create a chimeric bivalent antibody.
- the antibodies may be monovalent antibodies.
- Methods for preparing monovalent antibodies are well known in the art. For example, one method involves recombinant expression of immunoglobulin light chain and modified heavy chain.
- the heavy chain is truncated generally at any point in the Fc region so as to prevent heavy chain crosslinking.
- the relevant cysteine residues are substituted with another amino acid residue or are deleted so as to prevent crosslinking.
- the anti-PRO antibodies of the invention may further comprise humanized antibodies or human antibodies.
- Humanized forms of non-human (e.g., murine) antibodies are chimeric inununoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab′, F(ab′) 2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human inmuunoglobulin.
- Humanized antibodies include human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity.
- CDR complementary determining region
- Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues.
- Humanized antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
- the humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin [Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol., 2:593-596(1992)].
- Fc immunoglobulin constant region
- a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as “import” residues, which are typically taken from an “import” variable domain. Humanization can be essentially performed following the method of Winter and co-workers [Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)], by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody.
- humanized antibodies are chimeric antibodies (U.S. Pat. No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
- humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
- Human antibodies can also be produced using various techniques known in the art, including phage display libraries [Hoogenboom and Winter, J. Mol. Biol. 227:381 (1991); Marks et al., J. Mol. Biol. 222:581 (1991)].
- the techniques of Cole et al. and Boerner et al. are also available for the preparation of human monoclonal antibodies (Cole et al., Monoclonal Antibodies and Cancer Therany, Alan R. Liss, p.77 (1985) and Boerner et al., J. Immunol., 147(1):86-95 (1991)].
- human antibodies can be made by introducing of human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Pat. Nos.
- the antibodies may also be affinity matured using known selection and/or mutagenesis methods as described above.
- Preferred affinity matured antibodies have an affinity which is five times, more preferably 10 times, even more preferably 20 or 30 times greater than the starting antibody (generally murine, humanized or human) from which the matured antibody is prepared.
- Bispecific antibodies are monoclonal, preferably human or humanized, antibodies that have binding specificities for at least two different antigens.
- one of the binding specificities is for the PRO, the other one is for any other antigen, and preferably for a cell-surface protein or receptor or receptor subunit.
- Antibody variable domains with the desired binding specificities can be fused to immunoglobulin constant domain sequences.
- the fusion preferably is with an immunoglobulin heavy-chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is preferred to have the first heavy-chain constant region (CHI) containing the site necessary for light-chain binding present in at least one of the fusions.
- CHI first heavy-chain constant region
- the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers which are recovered from recombinant cell culture.
- the preferred interface comprises at least a part of the CH3 region of an antibody constant domain.
- one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g. tyrosine or tryptophan).
- Compensatory “cavities” of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine). This provides a mechanism for increasing the yield of the heterodimer over other unwanted end-products such as homodimers.
- Bispecific antibodies can be prepared as full length antibodies or antibody fragments (e.g. F(ab′) 2 bispecific antibodies). Techniques for generating bispecific antibodies from antibody fragments have been described in the literature. For example, bispecific antibodies can be prepared can be prepared using chemical linkage. Brennan et al., Science 229:81 (1985) describe a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab′) 2 fragments. These fragments are reduced in the presence of the dithiol complexing agent sodium arsenite to stabilize vicinal dithiols and prevent intermolecular disulfide formation. The Fab′ fragments generated are then converted to thionitrobenzoate (TNB) derivatives.
- TAB thionitrobenzoate
- One of the Fab′-TNB derivatives is then reconverted to the Fab′-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab′-TNB derivative to form the bispecific antibody.
- the bispecific antibodies produced can be used as agents for the selective immobilization of enzymes.
- Fab′ fragments may be directly recovered from E. coli and chemically coupled to form bispecific antibodies. Shalaby et al., J. Exp. Med. 175:217-225 (1992) describe the production of a fully humanized bispecific antibody F(ab′) 2 molecule. Each Fab′ fragment was separately secreted from E. coli and subjected to directed chemical coupling in vitro to form the bispecific antibody. The bispecific antibody thus formed was able to bind to cells overexpressing the ErbB2 receptor and normal human T cells, as well as trigger the lytic activity of human cytotoxic lymphocytes against human breast tumor targets.
- bispecific antibodies have been produced using leucine zippers.
- the leucine zipper peptides from the Fos and Jun proteins were linked to the Fab′ portions of two different antibodies by gene fusion.
- the antibody homodimers were reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers. This method can also be utilized for the production of antibody homodimers.
- the fragments comprise a heavy-chain variable domain (V H ) connected to a light-chain variable domain (V L ) by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the V H and V L domains of one fragment are forced to pair with the complementary V L and V H domains of another fragment, thereby forming two antigen-binding sites.
- V H and V L domains of one fragment are forced to pair with the complementary V L and V H domains of another fragment, thereby forming two antigen-binding sites.
- sFv single-chain Fv
- Antibodies with more than two valencies are contemplated.
- trispecific antibodies can be prepared. Tutt et al., J. Immunol. 147:60 (1991).
- bispecific antibodies may bind to two different epitopes on a given PRO polypeptide herein.
- an anti-PRO polypeptide arm may be combined with an arm which binds to a triggering molecule on a leukocyte such as a T-cell receptor molecule (e.g. CD2, CD3, CD28, or B7), or Fc receptors for IgG (Fc ⁇ R), such as Fc ⁇ RI (CD64), Fc ⁇ RII (CD32) and Fc ⁇ RIII (CD16) so as to focus cellular defense mechanisms to the cell expressing the particular PRO polypeptide.
- Bispecific antibodies may also be used to localize cytotoxic agents to cells which express a particular PRO polypeptide.
- These antibodies possess a PRO-binding arm and an arm which binds a cytotoxic agent or a radionuclide chelator, such as EOTUBE, DPTA, DOTA, or TETA.
- a cytotoxic agent or a radionuclide chelator such as EOTUBE, DPTA, DOTA, or TETA.
- Another bispecific antibody of interest binds the PRO polypeptide and further binds tissue factor (Th).
- Heteroconjugate antibodies are also within the scope of the present invention.
- Heteroconjugate antibodies are composed of two covalently joined antibodies. Such antibodies have, for example, been proposed to target immune system cells to unwanted cells [U.S. Pat. No.4,676,980], and for treatment of HIV infection [WO 91/00360; WO 92/200373; EP 03089].
- the antibodies may be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents.
- immunotoxins may be constructed using a disulfide exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include irninothiolate and methyl-4-mercaptobutyrimidate and those disclosed, for example, in U.S. Pat. No. 4,676,980.
- cysteine residue(s) may be introduced into the Fc region, thereby allowing interchain disulfide bond formation in this region.
- the homodimeric antibody thus generated may have improved internalization capability and/or increased complement-mediated cell killing and antibody-dependent cellular cytotoxicity (ADCC). See Caron et al., J. Exp Med., 176:
- Homodimeric antibodies with enhanced anti-tumoractivity may also be prepared using heterobifunctional cross-linkers as described in Wolff et al. Cancer Research, 53: 2560-2565 (1993).
- an antibody can be engineered that has dual Fc regions and may thereby have enhanced complementlysis andADCC capabilities. See Stevenson et al., Anti-Cancer Drug Design. 3: 219-230 (1989).
- the invention also pertains to immunoconjugates comprising an antibody conjugated to a cytotoxic agent 20 such as a chemotherapeutic agent, toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
- a cytotoxic agent 20 such as a chemotherapeutic agent, toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
- Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa ), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
- radionuclides are available for the production of radioconjugated antibodies. Examples include 212 Bi, 131 I, 131 In, 90 Y, and 186 Re. Conjugates of the antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as his (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as tolyene 2,6-diisocyanate), and bis
- a ricin immunotoxin can be prepared as described in Vitetta et al., Science, 238: 1098 (1987).
- Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See WO94/11026.
- the antibody may be conjugated to a “receptor” (such streptavidin) for utilization in tumor pretargeting wherein the antibody-receptor conjugate is administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and then administration of a “ligand” (e.g., avidin) that is conjugated to a cytotoxic agent (e.g., a radionucleotide).
- a receptor such streptavidin
- a ligand e.g., avidin
- cytotoxic agent e.g., a radionucleotide
- the antibodies disclosed herein may also be formulated as immunoliposomes.
- Liposomes containing the antibody are prepared by methods known in the art, such as described in Epstein et al., Proc. Natl. Acad. Sci. USA, 82: 3688 (1985); Hwang et al., Proc. Natl Acad. Sci. USA, 77: 4030 (1980); and U.S. Pat. Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Pat. No. 5,013,556.
- Particularly useful liposomes can be generated by the reverse-phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
- Fab′ fragments of the antibody of the present invention can be conjugated to the liposomes as described in Martin et al., J. Biol. Chem. 257: 286-288 (1982) via adisulfide-interchange reaction.
- a chemotherapeutic agent such as Doxorubicin is optionally contained within the liposome. See Gabizon et al., J. National Cancer Inst., 81(19): 1484 (1989).
- Antibodies specifically binding a PRO polypeptide identified herein, as well as other molecules identified by the screening assays disclosed hereinbefore, can be administered for the treatment of various disorders in the form of pharmaceutical compositions.
- the PRO polypeptide is intracellular and whole antibodies are used as inhibitors, internalizing antibodies are preferred.
- lipofections or liposomes can also be used to deliver the antibody, or an antibody fragment, into cells.
- the smallest inhibitory fragment that specifically binds to the binding domain of the target protein is preferred.
- peptide molecules can be designed that retain the ability to bind the target protein sequence.
- Such peptides can be synthesized chemically and/or produced by recombinant DNA technology. See, e.g., Marasco et al., Proc. Natl. Acad. Sci. USA, 90:7889-7893 (1993).
- the formulation herein may also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
- the composition may comprise an agent that enhances its function, such as, for example, a cytotoxic agent, cytokine, chemotherapeutic agent, or growth-inhibitory agent.
- cytotoxic agent such as, for example, a cytotoxic agent, cytokine, chemotherapeutic agent, or growth-inhibitory agent.
- Such molecules are suitably present in combination in amounts that are effective for the purpose intended.
- the active ingredients may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules) or in macroemulsions.
- colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules
- the formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.
- Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), orpoly(vinylalcohol)), polylactides (U.S. Pat. No.
- copolymers of L-glutarnic acid and ⁇ ethyl-L-glutamate copolymers of L-glutarnic acid and ⁇ ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOTTM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-( ⁇ )-3-hydroxybutyric acid. While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods.
- encapsulated antibodies When encapsulated antibodies remain in the body for a long time, they may denature or aggregate as a result of exposure to moisture at 37 ° C., resulting in a loss of biological activity and possible changes in immunogenicity. Rational strategies can be devised for stabilization depending on the mechanism involved. For example, if the aggregation mechanism is discovered to be intermolecular S-S bond formation through thio-disulfide interchange, stabilization may be achieved by modifying sulfhydryl residues, lyophilizing from acidic solutions, controlling moisture content, using appropriate additives, and developing specific polymer matrix compositions.
- anti-PRO antibodies of the invention have various utilities.
- anti-PRO antibodies may be used in diagnostic assays for PRO, e.g., detecting its expression (and in some cases, differential expression) in specific cells, tissues, or serum.
- diagnostic assay techniques known in the art may be used, such as competitive binding assays, direct or indirect sandwich assays and inmunoprecipitation assays conducted in either heterogeneous or homogeneous phases [Zola, Monoclonal Antibodies: A Manual of Techniques, CRC Press, Inc. (1987) pp. 147-158].
- the antibodies used in the diagnostic assays can be labeled with a detectable moiety.
- the detectable moiety should be capable of producing, either directly or indirectly, a detectable signal.
- the detectable moiety may be a radioisotope, such as 3 H, 14 C, 32 P, 35 S, or 125 I, a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate, rhodamine, or luciferin, or an enzyme, such as alkaline phosphatase, beta-galactosidase or horseradish peroxidase.
- any method known in the art for conjugating the antibody to the detectable moiety may be employed, including those methods described by Hunter et al., Nature, 144:945 (1962); David et al., Biochemistry, 13:1014 (1974); Pain et al., J. Immunol. Meth., 40:219 (1981); and Nygren, J. Histochem and Cytochem., 30:407 (1982).
- Anti-PRO antibodies also are useful for the affinity purification of PRO from recombinant cell culture or natural sources.
- the antibodies against PRO are immobilized on a suitable support, such a Sephadex resin or filter paper, using methods well known in the art.
- the immobilized antibody then is contacted with a sample containing the PRO to be purified, and thereafter the support is washed with a suitable solvent that will remove substantially all the material in the sample except the PRO, which is bound to the immobilized antibody. Finally, the support is washed with another suitable solvent that will release the PRO from the antibody.
- the extracellular domain (ECD) sequences (including the secretion signal sequence, if any) from about 950 known secreted proteins from the Swiss-Prot public database were used to search EST databases.
- the EST databases included public databases (e.g., Dayhoff, GenBank), and proprietary databases (e.g. LIFESEQTM, Incyte Pharmaceuticals, Palo Alto, Calif.).
- the search was performed using the computer program BLAST or BLAST-2 (Altschul et al., Methods in Enzvmology 266:460-480 (1996)) as a comparison of the ECD protein sequences to a 6 frame translation of the EST sequences. Those comparisons with a BLAST score of 70 (or in some cases 90) or greater that did not encode known proteins were clustered and assembled into consensus DNA sequences with the program “phrap” (Phil Green, University of Washington, Seattle, Wash.).
- oligonucleotides were then synthesized and used to identify by PCR a cDNA library that contained the sequence of interest and for use as probes to isolate a clone of the full-length coding sequence for a PRO polypeptide.
- Forward and reverse PCR primers generally range from 20 to 30 nucleotides and are often designed to give a PCR product of about 100-1000 bp in length.
- the probe sequences are typically 40-55 bp in length.
- additional oligonucleotides are synthesized when the consensus sequence is greater than about 1-1.5 kbp.
- DNA from the libraries was screened by PCR amplification, as per Ausubel et al., Current Protocols in Molecular Biology, with the PCR primer pair. A positive library was then used to isolate clones encoding the gene of interest using the probe oligonucleotide and one of the primer pairs.
- the cDNA libraries used to isolate the cDNA clones were constructed by standard methods using commercially available reagents such as those from Invitrogen, San Diego, CA.
- the cDNA was primed with oligo dT containing a NotI site, linked with blunt to SalI hemikinased adaptors, cleaved with NotI, sized appropriately by gel electrophoresis, and cloned in a defined orientation into a suitable cloning vector (such as pRKB or pRKD; pRK5B is a precursor of pRK5D that does not contain the SfiI site; see, Holmes et al., Science, 253:1278-1280 (1991)) in the unique XhoI and Noti sites.
- a suitable cloning vector such as pRKB or pRKD; pRK5B is a precursor of pRK5D that does not contain the SfiI site; see, Holmes
- mRNA was isolated from a human tissue of interest using reagents and protocols from Invitrogen, San Diego, CA (Fast Track 2). This RNA was used to generate an oligo dT primed cDNA library in the vector pRK5D using reagents and protocols from Life Technologies, Gaithersburg, MD (Super Script Plasmid System). In this procedure, the double stranded cDNA was sized to greater than 1000 bp and the SalIINotl linkered cDNA was cloned into Xhol/Notl cleaved vector.
- pRK5D is a cloning vector that has an sp6 transcription initiation site followed by an SfiI restriction enzyme site preceding the XhoILNotI cDNA cloning sites.
- a secondary cDNA library was generated in order to preferentially represent the 5′ ends of the primary cDNA clones.
- Sp6 RNA was generated from the primary library (described above), and this RNA was used to generate a random primed cDNA library in the vector pSST-AMY.0 using reagents and protocols from Life Technologies (Super Script Plasmid System, referenced above). In this procedure the double stranded cDNA was sized to 500-1000 bp, linkered with blunt to NotI adaptors, cleaved with SfiI, and cloned into SfiI/NotI cleaved vector.
- pSST-AMY.0 is a cloning vector that has a yeast alcohol dehydrogenase promoter preceding the cDNA cloning sites and the mouse amylase sequence (the mature sequence without the secretion signal) followed by the yeast alcohol dehydrogenase terminator, after the cloning sites.
- cDNAs cloned into this vector that are fused in frame with amylase sequence will lead to the secretion of amylase from appropriately transfected yeast colonies.
- DNA from the library described in paragraph 2 above was chilled on ice to which was added electrocompetent DH1OB bacteria (Life Technologies, 20 ml). The bacteria and vector mixture was then electroporated as recommended by the manufacturer. Subsequently, SOC media (Life Technologies, 1 ml) was added and the mixture was incubated at 37° C. for 30 minutes. The transformants were then plated onto 20 standard 150 mm LB plates containing ampicillin and incubated for 16 hours (37° C.). Positive colonies were scraped off the plates and the DNA was isolated from the bacterial pellet using standard protocols, e.g. CsCl-gradient. The purified DNA was then carried on to the yeast protocols below.
- yeast methods were divided into three categories: (1) Transformation of yeast with the plasmid/cDNA combined vector; (2) Detection and isolation of yeast clones secreting amylase; and (3) PCR amplification of the insert directly from the yeast colony and purification of the DNA for sequencing and further analysis.
- yeast strain used was HD56-5A (ATCC-90785). This strain has the following genotype: MAT alpha, ura3-52, leu2-3, leu2-112, his3-11, his3-15, MAL + , SUC + , GAL + .
- yeast mutants can be employed that have deficient post-translational pathways. Such mutants may have translocation deficient alleles in sec71, sec72, sec62, with truncated sec71 being most preferred.
- antagonists including antisense nucleotides and/or ligands which interfere with the normal operation of these genes, other proteins implicated in this post translation pathway (e.g., SEC61p, SEC72p, SEC62p, SEC63p, TDJ1p or SSA1p-4p) or the complex formation of these proteins may also be preferably employed in combination with the amylase-expressing yeast.
- other proteins implicated in this post translation pathway e.g., SEC61p, SEC72p, SEC62p, SEC63p, TDJ1p or SSA1p-4p
- the complex formation of these proteins may also be preferably employed in combination with the amylase-expressing yeast.
- the cells were then harvested and prepared for transformation by transfer into GS3 rotor bottles in a Sorval GS3 rotor at 5,000 rpm for 5 minutes, the supernatant discarded, and then resuspended into sterile water, and centrifuged again in 50 ml falcon tubes at 3,500 rpm in a Beckman GS-6KR centrifuge. The supernatant was discarded and the cells were subsequently washed with LiAc/TE (10 ml, 10 mM Tris—HCl, 1 mM EDTA pH 7.5, 100 mM Li 2 OOCCH 3 ), and resuspended into LiAc/TE (2.5 ml).
- LiAc/TE 10 ml, 10 mM Tris—HCl, 1 mM EDTA pH 7.5, 100 mM Li 2 OOCCH 3
- Transformation took place by mixing the prepared cells (100 ⁇ l) with freshly denatured single stranded salmon testes DNA (Lofstrand Labs, Gaithersburg, Md.) and transforming DNA (1 ⁇ g, vol. ⁇ 10 ⁇ l) in microfuge tubes. The mixture was mixed briefly by vortexing, then 40% PEG/TE (600 ⁇ l , 40% polyethylene glycol-4000, 10 mM Tris—HCl, 1 mM EDTA, 100 mM Li 2 OOCCH 3 , pH 7.5) was added. This mixture was gently mixed and incubated at 30° C. while agitating for 30 minutes. The cells were then heat shocked at 42° C.
- TE 500 ⁇ l, 10 mM Tris—HCl, 1 mM EDTA pH 7.5
- the cells were then diluted into TE (1 ml) and aliquots (200 ⁇ l) were spread onto the selective media previously prepared in 150 mm growth plates (VWR).
- the selective media used was a synthetic complete dextrose agar lacking uracil (SCD-Ura) prepared as described in Kaiser et al., Methods in Yeast Genetics, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., p.208-210 (1994). Transformants were grown at 30° C. for 2-3 days.
- the detection of colonies secreting amylase was performed by including red starch in the selective growth media.
- Starch was coupled to the red dye (Reactive Red-120, Sigrna) as per the procedure described by Biely et al., Anal. Biochem. 172:176-179 (1988).
- the coupled starch was incorporated into the SCD-Ura agar plates atafinal concentration of 0.15% (w/v), and was buffered withpotassiumphosphateto apH of 7.0 (50-100 mM final concentration).
- PCR was then performed as follows: a. Denature 92° C., 5 minutes b. 3 cycles of: Denature 92° C., 30 seconds Anneal 59° C., 30 seconds Extend 72° C., 60 seconds c. 3 cycles of: Denature 92° C., 30 seconds Anneal 57° C., 30 seconds Extend 72° C., 60 seconds d. 25 cycles of: Denature 92° C., 30 seconds Anneal 55° C., 30 seconds Extend 72° C., 60 seconds e. Hold 4° C.
- the nucleotides following the first ATG must code for at least 35 unambiguous amino acids without any stop codons. If the first ATG has the required amnino acids, the second is not examined. If neither meets the requirement, the candidate sequence is not scored. In order to determine whether the EST sequence contains an authentic signal sequence, the DNA and corresponding amino acid sequences surrounding the ATG codon are scored using a set of seven sensors (evaluation parameters) known to be associated with secretion signals. Use of this algorithm resulted in the identification of numerous polypeptide-encoding nucleic acid sequences.
- DNA comprising the coding sequence of full-length or mature PRO as disclosed herein is employed as a probe to screen for homologous DNAs (such as those encoding naturally-occurring variants of PRO) in human tissue cDNA libraries or human tissue genomic libraries.
- Hybridization and washing of filters containing either library DNAs is performed under the following high stringency conditions.
- Hybridization of radiolabeled PRO-derived probe to the filters is performed in a solution of 50% formamide, 5 ⁇ SSC, 0.1% SDS, 0.1% sodium pyrophosphate, 50 mM sodiumphosphate, pH 6.8, 2 ⁇ Denhardt's solution, and 10% dextran sulfate at 42° C. for 20 hours. Washing of the filters is performed in an aqueous solution of O. lx SSC and 0.1% SDS at 42° C.
- DNAs having a desired sequence identity with the DNA encoding full-length native sequence PRO can then be identified using standard techniques known in the art.
- This example illustrates preparation of an unglycosylated form of PRO by recombinant expression in E. coli.
- the DNA sequence encoding PRO is initially amplified using selected PCR primers.
- the primers should contain restriction enzyme sites which correspond to the restriction enzyme sites on the selected expression vector.
- a variety of expression vectors may be employed.
- An example of a suitable vector is pBR322 (derived from E. coli; see Bolivar et al., Gene, 2:95 (1977)) which contains genes for ampicillin and tetracycline resistance.
- the vector is digested with restriction enzyme and dephosphorylated.
- the PCR amplified sequences are then ligated into the vector.
- the vector will preferably include sequences which encode for an antibiotic resistance gene, a trp promoter, a polyhis leader (including the first six STh codons, polyhis sequence, and enterokinase cleavage site), the PRO coding region, lambda transcriptional terminator, and an argU gene.
- the ligation mixture is then used to transform a selected E. coli strain using the methods described in Sambrook et al., supra. Transformants are identified by their ability to grow on LB plates and antibiotic resistant colonies are then selected. Plasmid DNA can be isolated and confirmed by restriction analysis and DNA sequencing.
- Selected clones can be grown overnight in liquid culture medium such as LB broth supplemented with antibiotics.
- the overnight culture may subsequently be used to inoculate a larger scale culture.
- the cells are then grown to a desired optical density, during which the expression promoter is turned on.
- the cells After culturing the cells for several more hours, the cells can be harvested by centrifugation.
- the cell pellet obtained by the centrifugation can be solubilized using various agents known in the art, and the solubilized PRO protein can then be purified using a metal chelating column under conditions that allow tight binding of the protein.
- PRO may be expressed in E. coli in a poly-His tagged form, using the following procedure.
- the DNA encoding PRO is initially amplified using selected PCR primers.
- the primers will contain restriction enzyme sites which correspond to the restriction enzyme sites on the selected expression vector, and other useful sequences providing for efficient and reliable translation initiation, rapid purification on a metal chelation column, and proteolytic removal with enterokinase.
- the PCR-amplified, poly-His tagged sequences are then ligated into an expression vector, which is used to transform an E. coli host based on strain 52 (W3 110 fuhA(tonA) lon galE rpoHts(htpRts) clpP(laclq).
- Transformants are first grown in LB containing 50 mg/ml carbenicillin at 30° C. with shaking until an O.D.600 of 3-5 is reached. Cultures are then diluted 50-100 fold into CRAP media (prepared by mixing 3.57 g (NH 4 ) 2 SO 4 , 0.71 g sodium citrate •2H20, 1.07 g KCl, 5.36 g Difco yeast extract, 5.36 g Sheffield hycase SF in 500 mL water, as well as 110 mM MPOS, pH 7.3, 0.55% (w/v) glucose and 7 mM MgSO 4 ) and grown for approximately 20-30 hours at 30° C. with shaking. Samples are removed to verify expression by SDS-PAGE analysis, and the bulk culture is centrifuged to pellet the cells. Cell pellets are frozen until purification and refolding.
- CRAP media prepared by mixing 3.57 g (NH 4 ) 2 SO 4 , 0.71 g sodium citrate •2H20, 1.07 g KCl
- E. coli paste from 0.5 to 1 L fermentations (6-10 g pellets) is resuspended in 10 volumes (w/v) in 7 M guanidine, 20 mM Tris, pH 8 buffer.
- Solid sodium sulfite and sodium tetrathionate is added to make final concentrations of 0.1M and 0.02 M, respectively, and the solution is stirred overnight at 4° C. This step results in a denatured protein with all cysteine residues blocked by sulfitolization.
- the solution is centrifuged at 40,000 rpm in a Beckman Ultracentifuge for 30 min.
- the supernatant is diluted with 3-5 volumes of metal chelate column buffer (6 M guanidine, 20 mM Tris, pH 7.4) and filtered through 0.22 micron filters to clarify.
- the clarified extract is loaded onito a 5 ml Qiagen Ni-NTA metal chelate column equilibrated in the metal chelate column buffer.
- the column is washed with additional buffer containing 50 mM imidazole (Calbiochem, Utrol grade), pH 7.4.
- the protein is eluted with buffer containing 250 mM imidazole. Fractions containing the desired protein are pooled and stored at 4° C. Protein concentration is estimated by its absorbance at 280 nm using the calculated extinction coefficient based on its amino acid sequence.
- the proteins are refolded by diluting the sample slowly into freshly prepared refolding buffer consisting of: 20 mM Tris, pH 8.6, 0.3 M NaCl, 2.5 M urea, 5 mM cysteine, 20 mM glycine and 1 mM EDTA. Refolding volumes are chosen so that the final protein concentration is between 50 to 100 micrograms/ml.
- the refolding solution is stirred gently at 4° C. for 12-36 hours.
- the refolding reaction is quenched by the addition of TFA to a final concentration of 0.4% (pH of approximately 3).
- the solution is filtered through a 0.22 micron filter and acetonitrile is added to 2-10% final concentration.
- the refolded protein is chromatographed on a Poros Ri/H reversed phase column using a mobile buffer of 0.1% TFA with elution with a gradient of acetonitrile from 10 to 80%. Aliquots of fractions with A280 absorbance are analyzed on SDS polyacrylamide gels and fractions containing homogeneous refolded protein are pooled. Generally, the properly refolded species of most proteins are eluted at the lowest concentrations of acetonitrile since those species are the most compact with their hydrophobic interiors shielded from interaction with the reversed phase resin. Aggregated species are usually eluted at higher acetonitrile concentrations. In addition to resolving misfolded forms of proteins from the desired formn, the reversed phase step also removes endotoxin from the samples.
- Fractions containing the desired folded PRO polypeptide are pooled and the acetonitrile removed using a gentle stream of nitrogen directed at the solution. Proteins are formulated into 20 mM Hepes, pH 6.8 with 0.14 M sodium chloride and 4% mannitol by dialysis or by gel filtration using G25 Superfine (Pharmacia) resins equilibrated in the formulation buffer and sterile filtered.
- This example illustrates preparation of a potentially glycosylated form of PRO by recombinant expression in mammalian cells.
- the vector pRK5 (see EP 307,247, published March 15, 1989), is employed as the expression vector.
- the PRO DNA is ligated into pRK5 with selected restriction enzymes to allow insertion of the PRO DNA using ligation methods such as described in Sambrook et al., supra.
- the resulting vector is called pRK5-PRO.
- the selected host cells may be 293 cells.
- Human 293 cells (ATCC CCL 1573) are grown to confluence in tissue culture plates in medium such as DMEM supplemented with fetal calf serum and optionally, nutrient components and/or antibiotics.
- About 10 Ig pRK5-PRO DNA is mixed with about 1 ⁇ g DNA encoding the VA RNA gene [Thimmappaya et al., Cell, 31:543 (1982)] and dissolved in 500 ⁇ l of 1 mnM Tris—HCl, 0.1 mM EDTA, 0.227 M CaCl 2 .
- the culture medium is removed and replaced with culture medium (alone) or culture medium containing 200 ⁇ Ci/mn 35 S-cysteine and 200 ⁇ Ci/ml 35 S-methionine.
- culture medium alone
- culture medium containing 200 ⁇ Ci/mn 35 S-cysteine and 200 ⁇ Ci/ml 35 S-methionine After a 12 hour incubation, the conditioned medium is collected, concentrated on a spin filter, and loaded onto a 15% SDS gel. The processed gel may be dried and exposed to film for a selected period of time to reveal the presence of PRO polypeptide.
- the cultures containing transfected cells may undergo further incubation (in serum free medium) and the medium is tested in selected bioassays.
- PRO may be introduced into 293 cells transiently using the dextran sulfate method described by Somparyrac et al., Proc. Natl. Acad. Sci., 12:7575 (1981). 293 cells are grown to maximal density in a spinner flask and 700 ug pRK5-PRO DNA is added. The cells are first concentrated from the spinner flask by centrifugation and washed with PBS. The DNA-dextran precipitate is incubated on the cell pellet for four hours.
- the cells are treated with 20% glycerol for 90 seconds, washed with tissue culture medium, and re-introduced into the spinner flask containing tissue culture medium, 5 ⁇ g/ml bovine insulin and 0.1 ⁇ g/ml bovine transferrin. After about four days, the conditioned media is centrifuged and filtered to remove cells and debris. The sample containing expressed PRO can then be concentrated and purified by any selected method, such as dialysis and/or column chromatography.
- PRO in another embodiment, can be expressed in CHO cells.
- the pRK5-PRO can be transfected into CHO cells using known reagents such as CaPO 4 or DEAE-dextran.
- the cell cultures can be incubated, and the medium replaced with culture medium (alone) or medium containing a radiolabel such as 35 S-methionine.
- the culture medium may be replaced with serum free medium.
- the cultures are incubated for about 6 days, and then the conditioned medium is harvested.
- the medium containing the expressed PRO can then be concentrated and purified by any selected method.
- Epitope-tagged PRO may also be expressed in host CHO cells.
- the PRO may be subcloned out of the pRK5 vector.
- the subclone insert can undergo PCR to fuse in frame with a selected epitope tag such as a poly-his tag into a Baculovirus expression vector.
- the poly-his tagged PRO insert can then be subcloned into a SV40 driven vector containing a selection marker such as DHFR for selection of stable clones.
- the CHO cells can be transfected (as described above) with the SV40 driven vector. Labeling may be performed, as described above, to verify expression.
- the culture medium containing the expressed poly-His tagged PRO can then be concentrated and purified by any selected method, such as by Ni 2+ -chelate affinity chromatography.
- PRO may also be expressed in CHO and/or COS cells by a transient expression procedure or in CHO cells by another stable expression procedure.
- Stable expression in CHO cells is performed using the following procedure.
- the proteins are expressed as an IgG construct (immunoadhesin), in which the coding sequences for the soluble forms (e.g. extracellular domains) of the respective proteins are fused to an IgGI constant region sequence containing the hinge, CH2 and CH2 domains and/or is a poly-His tagged form.
- CHO expression vectors are constructed to have compatible restriction sites 5′ and 3′ of the DNA of interest to allow the convenient shuttling of cDNA's.
- the vector used expression in CHO cells is as described in Lucas et al., Nucl. Acids Res. 24:9 (1774-1779 (1996), and uses the SV40 early promoter/enhancer to drive expression of the cDNA of interest and dihydrofolate reductase (DHFR).
- DHFR expression permits selection for stable maintenance of the plasmid following transfection.
- the ampules containing the plasmid DNA are thawed by placement into water bath and mixed by vortexing.
- the contents are pipetted into a centrifuge tube containing 10 niLs of media and centrifuged at 1000 rpm for 5 minutes.
- the supernatant is aspirated and the cells are resuspended in 10 mL of selective media (0.2 ⁇ m filtered PS20 with 5% 0.2 ⁇ m diafiltered fetal bovine serum).
- the cells are then aliquoted into a 100 mL spinner containing 90 mL of selective media. After 1-2 days, the cells are transferred into a 250 mL spinner filled with 150 mL selective growth medium and incubated at 37° C.
- spinners After another 2-3 days, 250 mL, 500 mL and 2000 mL spinners are seeded with 3 ⁇ 10 5 cells/mL.
- the cell media is exchanged with fresh media by centrifugation and resuspension in production medium.
- any suitable CHO media may be employed, a production medium described in U.S. Pat. No. 5,122,469, issued June 16, 1992 may actually be used.
- a 3L production spinner is seeded at 1.2 ⁇ 10 6 cells/mL. On day 0, the cell number pH ie determined. On day 1, the spinner is sampled and sparging with filtered air is commenced.
- the spinner On day 2, the spinner is sampled, the temperature shifted to 33° C., and 30 mL of 500 ⁇ g/L glucose and 0.6 mL of 10% antifoam (e.g., 35% polydimethylsiloxane emulsion, Dow Corning 365 Medical Grade Emulsion) taken. Throughout the production, the pH is adjusted as necessary to keep it at around 7.2. After 10 days, or until the viability dropped below 70%, the cell culture is harvested by centrifugation and filtering through a 0.22 ⁇ m filter. The filtrate was either stored at 4° C. or immediately loaded onto columns for purification.
- 10% antifoam e.g., 35% polydimethylsiloxane emulsion, Dow Corning 365 Medical Grade Emulsion
- the proteins are purified using a Ni-NTA column (Qiagen). Before purification, imidazole is added to the conditioned media to a concentration of 5 mM. The conditioned media is pumped onto a 6 ml Ni-NTA column equilibrated in 20 mM Hepes, pH 7.4, buffer containing 0.3 M NaCl and 5 mM imidazole at a flow rate of 4-5 ml/min. at 4° C. After loading, the column is washed with additional equilibration buffer and the protein eluted with equilibration buffer containing 0.25 M imidazole.
- the highly purified protein is subsequently desalted into a storage buffer containing 10 mM Hepes, 0.14 M NaCl and 4% mannitol, pH 6.8, with a 25 ml G25 Superfine (Pharmacia) column and stored at ⁇ 80° C.
- Immunoadhesin (Fc-containing) constructs are purified from the conditioned media as follows.
- the conditioned medium is pumped onto a 5 ml Protein A column (Pharmacia) which had been equilibrated in 20 mM Na phosphate buffer, pH 6.8. After loading, the column is washed extensively with equilibration buffer before elution with 100 mM citric acid, pH 3.5.
- the eluted protein is immediately neutralized by collecting 1 ml fractions into tubes containing 275 ⁇ L of 1 M Tris buffer, pH 9.
- the highly purified protein is subsequently desalted into storage buffer as described above for the poly-His tagged proteins. The homogeneity is assessed by SDS polyacrylamide gels and by N-terminal amino acid sequencing by Edman degradation.
- yeast expression vectors are constructed for intracellular production or secretion of PRO from the ADH2/GAPDH promoter.
- DNA encoding PRO and the promoter is inserted into suitable restriction enzyme sites in the selected plasmid to direct intracellular expression of PRO.
- DNA encoding PRO can be cloned into the selected plasmid, together with DNA encoding the ADH2/GAPDH promoter, a native PRO signal peptide or other mammalian signal peptide, or, for example, a yeast alpha-factor or invertase secretory signal/leader sequence, and linker sequences (if needed) for expression of PRO.
- yeast cells such as yeast strain AB 110
- yeast cells can then be transformed with the expression plasmids described above and cultured in selected fermentation media.
- the transformed yeast supernatants can be analyzed by precipitation with 10% trichloroacetic acid and separation by SDS-PAGE, followed by staining of the gels with Coomassie Blue stain.
- Recombinant PRO can subsequently be isolated and purified by removing the yeast cells from the fermentation medium by centrifugation and then concentrating the medium using selected cartridge filters.
- the concentrate containing PRO may further be purified using selected column chromatography resins.
- sequence coding for PRO is fused upstream of an epitope tag contained within a baculovirus expression vector.
- epitope tags include poly-his tags and immunoglobulin tags (like Fc regions of IgG).
- a variety of plasmids may be employed, including plasmids derived from commercially available plasmids such as pVL1393 (Novagen).
- the sequence encoding PRO or the desired portion of the coding sequence of PRO such as the sequence encoding the extracellular domain of a transmembrane protein or the sequence encoding the mature protein if the protein is extracellular is amplified by PCR with primers complementary to the 5′ and 3′ regions.
- the 5′ primer may incorporate flanking (selected) restriction enzyme sites.
- the product is then digested with those selected restriction enzymes and subcloned into the expression vector.
- Recombinant baculovirus is generated by co-transfecting the above plasmid and BaculoGoldTM virus DNA (Pharmingen) into Spodoptera frugiperda (“Sf9”) cells (ATCC CRL 1711) using lipofectin (commercially available from GIBCO-BRL). After 4-5 days of incubation at 28° C., the released viruses are harvested and used for further amplifications. Viral infection and protein expression are performed as described by O'Reilley et al., Baculovirus expression vectors: A Laboratory Manual, Oxford: Oxford University Press (1994).
- Expressed poly-his tagged PRO can then be purified, for example, by Ni 2+ -chelate affinity chromatography as follows. Extracts are prepared from recombinant virus-infected Sf9 cells as described by Rupert et al., Nature, 362:175-179 (1993). Briefly, Sf9 cells are washed, resuspended in sonication buffer (25 mL Hepes, pH 7.9; 12.5 mM MgCl 2 ; 0.1 mM EDTA; 10% glycerol; 0.1% NP40; 0.4 M KCl), and sonicated twice for 20 seconds on ice.
- sonication buffer 25 mL Hepes, pH 7.9; 12.5 mM MgCl 2 ; 0.1 mM EDTA; 10% glycerol; 0.1% NP40; 0.4 M KCl
- the sonicates are cleared by centrifugation, and the supernatant is diluted 50-fold in loading buffer (50 mM phosphate, 300 mM NaCl, 10% glycerol, pH 7.8) and filtered through a 0.45 ⁇ m filter.
- loading buffer 50 mM phosphate, 300 mM NaCl, 10% glycerol, pH 7.8
- a Ni 2+ -NTA agarose column (comrnercially available from Qiagen) is prepared with a bed volume of 5 mL, washed with 25 rnL of water and equilibrated with 25 mL of loading buffer.
- the filtered cell extract is loaded onto the column at 0.5 mL per minute.
- the column is washed to baseline A 280 with loading buffer, at which point fraction collection is started.
- the column is washed with a secondary wash buffer (50 mM phosphate; 300 mM NaCl, 10% glycerol, pH 6.0), which elutes nonspecifically bound protein.
- a secondary wash buffer 50 mM phosphate; 300 mM NaCl, 10% glycerol, pH 6.0
- the column is developed with a 0 to 500 mM Irnidazole gradient in the secondary wash buffer.
- One mL fractions are collected and analyzed by SDS-PAGE and silver staining or Western blot with Ni 2+ -NTA-conjugated to alkaline phosphatase (Qiagen). Fractions containing the eluted His 10 -tagged PRO are pooled and dialyzed against loading buffer.
- purification of the IgG tagged (or Fc tagged) PRO can be performed using known chromatography techniques, including for instance, Protein A or protein G column chromatography.
- Immunogens that may be employed include purified PRO, fusion proteins containing PRO, and cells expressing recombinant PRO on the cell surface. Selection of the immunogen can be made by the skilled artisan without undue experimentation.
- mice such as Balb/c are immunized with the PRO immunogen emulsified in complete Freund's adjuvant and injected subcutaneously or intraperitoneally in an amount from 1-100 micrograms.
- the immunogen is emulsified in MPL-TDM adjuvant (Ribi Immunochemical Research, Hamilton, Mont.) and injected into the animal's hind foot pads.
- MPL-TDM adjuvant Ribi Immunochemical Research, Hamilton, Mont.
- the immunized mice are then boosted 10 to 12 days later with additional immunogen emulsified in the selected adjuvant. Thereafter, for several weeks, the mice may also be boosted with additional immunization injections. Serum samples may be periodically obtained from the mice by retro-orbital bleeding for testing in ELISA assays to detect anti-PRO antibodies.
- the animals “positive” for antibodies canbe injected with a final intravenous injection of PRO.
- the mice Three to four days later, the mice are sacrificed and the spleen cells are harvested.
- the spleen cells are then fused (using 35% polyethylene glycol) to a selected murine myeloma cell line such as P3X63AgU.1, available from ATCC, No. CRL 1597.
- the fusions generate hybridoma cells which can then be plated in 96 well tissue culture plates containing HAT (hypoxanthine, aminopterin, and thymidine) medium to inhibit proliferation of non-fused cells, myeloma hybrids, and spleen cell hybrids.
- HAT hyperxanthine, aminopterin, and thymidine
- hybridoma cells will be screened in an ELISA for reactivity against PRO. Determination of “positive” hybridoma cells secreting the desired monoclonal antibodies against PRO is within the skill in the art.
- the positive hybridoma cells can be injected intraperitoneally into syngeneic Balb/c mice to produce ascites containing the anti-PRO monoclonal antibodies.
- the hybridoma cells can be grown in tissue culture flasks or roller bottles. Purification of the monoclonal antibodies produced in the ascites can be accomplished using ammonium sulfate precipitation, followed by gel exclusion chromatography. Alternatively, affinity chromatography based upon binding of antibody to protein A or protein G can be employed.
- Native or recombinant PRO polypeptides may be purified by a variety of standard techniques in the art of protein purification. For example, pro-PRO polypeptide, mature PRO polypeptide, or pre-PRO polypeptide is purified by immunoaffinity chromatography using antibodies specific for the PRO polypeptide of interest. In general, an immunoaffinity column is constructed by covalently coupling the anti-PRO polypeptide antibody to an activated chromatographic resin.
- Polyclonal immunoglobulins are prepared from immune sera either by precipitation with ammonium sulfate or by purification on immobilizedProtein A (Pharmacial.KB Biotechnology, Piscataway, N.J.). Likewise, monoclonal antibodies are prepared from mouse ascites fluid by ammonium sulfate precipitation or chromatography on immobilized Protein A. Partially purified immunoglobulin is covalently attached to a chromatographic resin such as CnBr-acfivated SEPHAROSETM (Pharmacia LKB Biotechnology). The antibody is coupled to the resin, the resin is blocked, and the derivative resin is washed according to the manufacturer's instructions.
- a chromatographic resin such as CnBr-acfivated SEPHAROSETM (Pharmacia LKB Biotechnology). The antibody is coupled to the resin, the resin is blocked, and the derivative resin is washed according to the manufacturer's instructions.
- Such an immunoaffinity column is utilized in the purification of PRO polypeptide by preparing a fraction from cells containing PRO polypeptide in a soluble form. This preparation is derived by solubilization of the whole cell or of a subcellular fraction obtained via differential centrifugation by the addition of detergent or by other methods well known in the art. Alternatively, soluble PRO polypeptide containing a signal sequence may be secreted in useful quantity into the medium in which the cells are grown.
- a soluble PRO polypeptide-containing preparation is passed over the immunoaffinity column, and the column is washed under conditions that allow the preferential absorbance of PRO polypeptide (e.g., high ionic strength buffers in the presence of detergent). Then, the column is eluted under conditions that disrupt antibody/PRO polypeptide binding (e.g., a low pH buffer such as approximately pH 2-3, or a high concentration of a chaotrope such as urea or thiocyanate ion), and PRO polypeptide is collected.
- a low pH buffer such as approximately pH 2-3
- a chaotrope such as urea or thiocyanate ion
- This invention is particularly useful for screening compounds by using PRO polypeptides or binding fragment thereof in any of a variety of drug screening techniques.
- the PRO polypeptide or fragment employed in such a test may either be free in solution, affixed to a solid support, borne on a cell surface, or located intracellularly.
- One method of drug screening utilizes eukaryotic or prokaryotic host cells which are stably transformed with recombinant nucleic acids expressing the PRO polypeptide or fragment. Drugs are screened against such transformed cells in competitive binding assays. Such cells, either in viable or fixed form, can be used for standard binding assays.
- One may measure, for example, the formation of complexes between PRO polypeptide or a fragment and the agent being tested. Alternatively, one can examine the diminution in complex formation between the PRO polypeptide and its target cell or target receptors caused by the agent being tested.
Abstract
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid sequences, chimeric polypeptide molecules comprising the polypeptides of the present invention fused to heterologous polypeptide sequences, antibodies which bind to the polypeptides of the present invention and to methods for producing the polypeptides of the present invention.
Description
- The present invention relates generally to the identification and isolation of novel DNA and to the recombinant production of novel polypeptides.
- Extracellular proteins play important roles in, among other things, the formation, differentiation and maintenance of multicellular organisms. The fate of many individual cells, e.g., proliferation, migration, differentiation, or interaction with other cells, is typically governed by information received from other cells and/or the immediate environment. This information is often transmitted by secreted polypeptides (for instance, mitogenic factors, survival factors, cytotoxic factors, differentiation factors, neuropeptides, and hormones) which are, in turn, received and interpreted by diverse cell receptors or membrane-bound proteins. These secreted polypeptides or signaling molecules normally pass through the cellular secretory pathway to reach their site of action in the extracellular environment.
- Secreted proteins have various industrial applications, including as pharmaceuticals, diagnostics, biosensors and bioreactors. Most protein drugs available at present, such as thrombolytic agents, interferons, interleukins, erythropoietins, colony stimulating factors, and various other cytokines, are secretory proteins. Their receptors, which are membrane proteins, also have potential as therapeutic or diagnostic agents. Efforts are being undertaken by both industry and academia to identify new, native secreted proteins. Many efforts are focused on the screening of mammalian recombinant DNA libraries to identify the coding sequences for novel secreted proteins. Examples of screening methods and techniques are described in the literature [see, for example, Klein et al.,Proc. Natl. Acad. Sci. 93:7108-7113 (1996); U.S. Pat. No. 5,536,637)].
- Membrane-bound proteins and receptors can play important roles in, among other things, the formation, differentiation and maintenance of multicellular organisms. The fate of many individual cells, e.g., proliferation, migration, differentiation, or interaction with other cells, is typically governed by information received from other cells and/or the immediate environment. This information is often transmitted by secreted polypeptides (for instance, mitogenic factors, survival factors, cytotoxic factors, differentiation factors, neuropeptides, and hormones) which are, in turn, received and interpreted by diverse cell receptors or membrane-bound proteins. Such membrane-bound proteins and cell receptors include, but are not limited to, cytokine receptors, receptor kinases, receptor phosphatases, receptors involved in cell-cell interactions, and cellular adhesin molecules like selectins and integrins. For instance, transduction of signals that regulate cell growth and differentiation is regulated in part by phosphorylation of various cellular proteins. Protein tyrosine kinases, enzymes that catalyze that process, can also act as growth factor receptors. Examples include fibroblast growth factor receptor and nerve growth factor receptor.
- Membrane-bound proteins and receptor molecules have various industrial applications, including as pharmaceutical and diagnostic agents. Receptor immunoadhesins, for instance, can be employed as therapeutic agents to block receptor-ligand interactions. The membrane-bound proteins can also be employed for screening of potential peptide or small molecule inhibitors of the relevant receptor/ligand interaction.
- Efforts are being undertaken by both industry and academia to identify new, native receptor or membrane-bound proteins. Many efforts are focused on the screening of mammalian recombinant DNA libraries to identify the coding sequences for novel receptor or membrane-bound proteins.
- In one embodiment, the invention provides an isolated nucleic acid molecule comprising a nucleotide sequence that encodes a PRO polypeptide.
- In one aspect, the isolated nucleic acid molecule comprises a nucleotide sequence having at least about 80% nucleic acid sequence identity, alternatively at least about 81% nucleic acid sequence identity, alternatively at least about 82% nucleic acid sequence identity, alternatively at least about 83% nucleic acid sequence identity, alternatively at least about 84% nucleic acid sequence identity, alternatively at least about 85% nucleic acid sequence identity, alternatively at least about 86% nucleic acid sequence identity, alternatively at least about 87% nucleic acid sequence identity, alternatively at least about 88% nucleic acid sequence identity, alternatively at least about 89% nucleic acid sequence identity, alternatively at least about 90% nucleic acid sequence identity, alternatively at least about 91% nucleic acid sequence identity, alternatively at least about 92% nucleic acid sequence identity, alternatively at least about 93% nucleic acid sequence identity, alternatively at least about 94% nucleic acid sequence identity, alternatively at least about 95% nucleic acid sequence identity, alternatively at least about 96% nucleic acid sequence identity, alternatively at least about 97% nucleic acid sequence identity, alternatively at least about 98% nucleic acid sequence identity and alternatively at least about 99% nucleic acid sequence identity to (a) a DNA molecule encoding a PRO polypeptide having a full-length amino acid sequence as disclosed herein, an amino acid sequence lacking the signal peptide as disclosed herein, an extracellular domain of a transmembrane protein, with or without the signal peptide, as disclosed herein or any other specifically defined fragment of the full-length amino acid sequence as disclosed herein, or (b) the complement of the DNA molecule of (a).
- In other aspects, the isolated nucleic acid molecule comprises a nucleotide sequence having at least about 80% nucleic acid sequence identity, alternatively at least about 81% nucleic acid sequence identity, alternatively at least about 82% nucleic acid sequence identity, alternatively at least about 83% nucleic acid sequence identity, alternatively at least about 84% nucleic acid sequence identity, alternatively at least about 85% nucleic acid sequence identity, alternatively at least about 86% nucleic acid sequence identity, alternatively at least about 87% nucleic acid sequence identity, alternatively at least about 88% nucleic acid sequence identity, alternatively at least about 89% nucleic acid sequence identity, alternatively at least about 90% nucleic acid sequence identity, alternatively at least about 91% nucleic acid sequence identity, alternatively at least about 92% nucleic acid sequence identity, alternatively at least about 93% nucleic acid sequence identity, alternatively at least about 94% nucleic acid sequence identity, alternatively at least about 95% nucleic acid sequence identity, alternatively at least about 96% nucleic acid sequence identity, alternatively at least about 97% nucleic acid sequence identity, alternatively at least about 98% nucleic acid sequence identity and alternatively at least about 99% nucleic acid sequence identity to (a) aDNA molecule comprising the coding sequence of a full-length PRO polypeptide cDNA as disclosed herein, the coding sequence of a PRO polypeptide lacking the signal peptide as disclosed herein, the coding sequence of an extracellular domain of a transmembrane PRO polypeptide, with or without the signal peptide, as disclosed herein or the coding sequence of any other specifically defined fragment of the full-length amino acid sequence as disclosed herein, or (b) the complement of the DNA molecule of (a).
- In a further aspect, the invention concerns an isolated nucleic acid molecule comprising a nucleotide sequence having at least about 80% nucleic acid sequence identity, alternatively at least about 81% nucleic acid sequence identity, alternatively at least about 82% nucleic acid sequence identity, alternatively at least about 83% nucleic acid sequence identity, alternatively at least about 84% nucleic acid sequence identity, alternatively at least about 85% nucleic acid sequence identity, alternatively at least about 86% nucleic acid sequence identity, alternatively at least about 87% nucleic acid sequence identity, alternatively at least about 88% nucleic acid sequence identity, alternatively at least about 89% nucleic acid sequence identity, alternatively at least about 90% nucleic acid sequence identity, alternatively at least about 91% nucleic acid sequence identity, alternatively at least about 92% nucleic acid sequence identity, alternatively at least about 93% nucleic acid sequence identity, alternatively at least about 94% nucleic acid sequence identity, alternatively at least about 95% nucleic acid sequence identity, alternatively at least about 96% nucleic acid sequence identity, alternatively at least about 97% nucleic acid sequence identity, alternatively at least about 98% nucleic acid sequence identity and alternatively at least about 99% nucleic acid sequence identity to (a) a DNA molecule that encodes the same mature polypeptide encoded by any of the human protein cDNAs deposited with the ATCC as disclosed herein, or (b) the complement of the DNA molecule of (a).
- Another aspect the invention provides an isolated nucleic acid molecule comprising a nucleotide sequence encoding a PRO polypeptide which is either transmembrane domain-deleted or transmembrane domain-inactivated, or is complementary to such encoding nucleotide sequence, wherein the transmembrane domain(s) of such polypeptide are disclosed herein. Therefore, soluble extracellular domains of the herein described PRO polypeptides are contemplated.
- Another embodiment is directed to fragments of a PRO polypeptide coding sequence, or the complement thereof, that may find use as, for example, hybridization probes, for encoding fragments of a PRO polypeptide that may optionally encode a polypeptide comprising a binding site for an anti-PRO antibody or as antisense oligonucleotide probes. Such nucleic acid fragments are usually at least about 10 nucleotides in length, alternatively at least about 15 nucleotides in length, alternatively at least about 20 nucleotides in length, alternatively at least about 30 nucleotides in length, alternatively at least about 40 nucleotides in length, alternatively at least about 50 nucleotides in length, alternatively at least about 60 nucleotides in length, alternatively at least about 70 nucleotides in length, alternatively at least about 80 nucleotides in length, alternatively at least about 90 nucleotides in length, alternatively at least about 100 nucleotides in length, alternatively at least about 110 nucleotides in length, alternatively at least about 120 nucleotides in length, alternatively at least about 130 nucleotides in length, alternatively at least about 140 nucleotides in length, alternatively at least about 150 nucleotides in length, alternatively at least about 160 nucleotides in length, alternatively at least about 170 nucleotides in length, alternatively at least about 180 nucleotides in length, alternatively at least about 190 nucleotides in length, alternatively at least about 200 nucleotides in length, alternatively at least about 250 nucleotides in length, alternatively at least about 300 nucleotides in length, alternatively at least about 350 nucleotides in length, alternatively at least about 400 nucleotides in length, alternatively at least about 450 nucleotides in length, alternatively at least about 500 nucleotides in length, alternatively at least about 600 nucleotides in length, alternatively at least about 700 nucleotides in length, alternatively at least about 800 nucleotides in length, alternatively at least about 900 nucleotides in length and alternatively at least about 1000 nucleotides in length, wherein in this context the term “about” means the referenced nucleotide sequence length plus or minus 10% of that referenced length. It is noted that novel fragments of a PRO polypeptide-encoding nucleotide sequence may be determined in a routine manner by aligning the PRO polypeptide-encoding nucleotide sequence with other known nucleotide sequences using any of a number of well known sequence alignment programs and determining which PRO polypeptide-encoding nucleotide sequence fragment(s) are novel. All of such PRO polypeptide-encoding nucleotide sequences are contemplated herein. Also contemplated are the PRO polypeptide fragments encoded by these nucleotide molecule fragments, preferably those PRO polypeptide fragments that comprise a binding site for an anti-PRO antibody.
- In another embodiment, the invention provides isolated PRO polypeptide encoded by any of the isolated nucleic acid sequences hereinabove identified.
- In a certain aspect, the invention concerns an isolated PRO polypeptide, comprising an amino acid sequence having at least about 80% amino acid sequence identity, alternatively at least about 81% amino acid sequence identity, alternatively at least about 82% amino acid sequence identity, alternatively at least about 83% amino acid sequence identity, alternatively at least about 84% amino acid sequence identity, alternatively at least about 85% amino acid sequence identity, alternatively at least about 86% amino acid sequence identity, alternatively at least about 87% amino acid sequence identity, alternatively at least about 88% amino acid sequence identity, alternatively at least about 89% amino acid sequence identity, alternatively at least about 90% amino acid sequence identity, alternatively at least about 91% amino acid sequence identity, alternatively at least about 92% amino acid sequence identity, alternatively at least about 93% amino acid sequence identity, alternatively at least about 94% amino acid sequence identity, alternatively at least about 95% amino acid sequence identity, alternatively at least about 96% amino acid sequence identity, alternatively at least about 97% amino acid sequence identity, alternatively at least about 98% amino acid sequence identity and alternatively at least about 99% amino acid sequence identity to a PRO polypeptide having a full-length amino acid sequence as disclosed herein, an amino acid sequence lacking the signal peptide as disclosed herein, an extracellular domain of a transmembrane protein, with or without the signal peptide, as disclosed herein or any other specifically defined fragment of the full-length amino acid sequence as disclosed herein.
- In a further aspect, the invention concerns an isolated PRO polypeptide comprising an amino acid sequence having at least about 80% amino acid sequence identity, alternatively at least about 81% amino acid sequence identity, alternatively at least about 82% amino acid sequence identity, alternatively at least about 83% amino acid sequence identity, alternatively at least about 84% amino acid sequence identity, alternatively at least about 85% amino acid sequence identity, alternatively at least about 86% amino acid sequence identity, alternatively at least about 87% amino acid sequence identity, alternatively at least about 88% amino acid sequence identity, alternatively at least about 89% amino acid sequence identity, alternatively at least about 90% amino acid sequence identity, alternatively at least about 91% a mino acid sequence identity, alternatively at least about 92% amino acid sequence identity, alternatively at least about 93% amino acid sequence identity, alternatively at least about 94% amino acid sequence identity, alternatively at least about 95% amino acid sequence identity, alternatively at least about 96% amino acid sequence identity, alternatively at least about 97% amino acid sequence identity, alternatively at least about 9 8% a mino acid sequence identity and alternatively at least about 99% amino acid sequence identity to an amino acid sequence encoded by any of the human protein cDNAs deposited with the ATCC as disclosed herein.
- In a specific aspect, the invention provides an isolated PRO polypeptide without the N-terminal signal sequence and/or the initiating methionine and is encoded by a nucleotide sequence that encodes such an amino acid sequence as hereinbefore described. Processes for producing the same are also herein described, wherein those processes comprise culturing a host cell comprising a vector which comprises the appropriate encoding nucleic acid molecule under conditions suitable for expression of the PRO polypeptide and recovering the PRO polypeptide from the cell culture.
- Another aspect the invention provides an isolated PRO polypeptide which is either transmembrane domain-deleted or transmembrane domain-inactivated. Processes for producing the same are also herein described, wherein those processes comprise culturing a host cell comprising a vector which comprises the appropriate encoding nucleic acid molecule under conditions suitable for expression of the PRO polypeptide and recovering the PRO polypeptide from the cell culture.
- In yet another embodiment, the invention concerns agonists and antagonists of a native PRO polypeptide as defined herein. In a particular embodiment, the agonist or antagonist is an anti-PRO antibody or a small molecule.
- In a further embodiment, the invention concerns a method of identifying agonists or antagonists to a PRO polypeptide which comprise contacting the PRO polypeptide with a candidate molecule and monitoring a biological activity mediated by said PRO polypeptide. Preferably, the PRO polypeptide is a native PRO polypeptide.
- In a still further embodiment, the invention concerns a composition of matter comprising a PRO polypeptide, or an agonist or antagonist of a PRO polypeptide as herein described, or an anti-PRO antibody, in combination with a carrier. Optionally, the carrier is a pharmaceutically acceptable carrier.
- Another embodiment of the present invention is directed to the use of a PRO polypeptide, or an agonist or antagonist thereof as hereinbefore described, or an anti-PRO antibody, for the preparation of a medicament useful in the treatment of a condition which is responsive to the PRO polypeptide, an agonist or antagonist thereof or an anti-PRO antibody.
- In other embodiments of the present invention, the invention provides vectors comprising DNA encoding any of the herein described polypeptides. Host cell comprising any such vector are also provided. By way of example, the host cells may be CHO cells,E. coli, or yeast. A process for producing any of the herein described polypeptides is further provided and comprises culturing host cells under conditions suitable for expression of the desired polypeptide and recovering the desired polypeptide from the cell culture.
- In other embodiments, the invention provides chimeric molecules comprising any of the herein described polypeptides fused to a heterologous polypeptide or amino acid sequence. Example of such chimeric molecules comprise any of the herein described polypeptides fused to an epitope tag sequence or a Fc region of an immunoglobulin.
- In another embodiment, the invention provides an antibody which binds, preferably specifically, to any of the above or below described polypeptides. Optionally, the antibody is a monoclonal antibody, humanized antibody, antibody fragment or single-chain antibody.
- In yet other embodiments, the invention provides oligonucleotide probes which may be useful for isolating genomic and cDNA nucleotide sequences, measuring or detecting expression of an associated gene or as antisense probes, wherein those probes may be derived from any of the above or below described nucleotide sequences. Preferred probe lengths are described above.
- In yet other embodiments, the present invention is directed to methods of using the PRO polypeptides of the present invention for a variety of uses based upon the functional biological assay data presented in the Examples below.
- FIG. 1 shows a nucleotide sequence (SEQ ID NO: 1) of a native sequence PRO177 cDNA, wherein SEQ ID NO:1 is a clone designated herein as “DNA16438-1387”.
- FIG. 2 shows the amino acid sequence (SEQ ID NO:2) derived from the coding sequence of SEQ ID NO: 1 shown in FIG. 1.
- FIG. 3 shows a nucleotide sequence (SEQ ID NO:3) of a native sequence PRO3574 cDNA, wherein SEQ ID NO:3 is a clone designated herein as “DNA19360-2552”.
- FIG. 4 shows the amino acid sequence (SEQ ID NO:4) derived from the coding sequence of SEQ ID NO:3 shown in FIG. 3.
- FIG. 5 shows a nucleotide sequence (SEQ ID NO:5) of a native sequence PRO1280 cDNA, wherein SEQ ID NO:5 is a clone designated herein as “DNA33455-1548”.
- FIG. 6 shows the amino acid sequence (SEQ ID NO:6) derived from the coding sequence of SEQ ID NO:5 shown in FIG. 5.
- FIG. 7 shows a nucleotide sequence (SEQ ID NO:7) of a native sequence PRO4984 cDNA, wherein SEQ ID NO:7 is a clone designated herein as “DNA37155-2651”.
- FIG. 8 shows the amino acid sequence (SEQ ID NO:8) derived from the coding sequence of SEQ ID NO:7 shown in FIG. 7.
- FIG. 9 shows a nucleotide sequence (SEQ ID NO:9) of a native sequence PRO4988 cDNA, wherein SEQ ID NO:9 is a clone designated herein as “DNA38269-2654”.
- FIG. 10 shows the amino acid sequence (SEQ ID NO: 10) derived from the coding sequence of SEQ ID NO:9 shown in FIG. 9.
- FIG. 11 shows a nucleotide sequence (SEQ ID NO:i 1) of a native sequence PRO305 cDNA, wherein SEQ ID NO: 11 is a clone designated herein as “DNA40619-1220”.
- FIG. 12 shows the amino acid sequence (SEQ ID NO: 12) derived from the coding sequence of SEQ ID NO: 11 shown in FIG. 11.
- FIG. 13 shows a nucleotide sequence (SEQ ID NO: 13) of a native sequence PRO1866 cDNA, wherein SEQ ID NO:13 is a clone designated herein as “DNA44174-2513”.
- FIG. 14 shows the amino acid sequence (SEQ ID NO: 14) derived from the coding sequence of SEQ ID NO: 13 shown in FIG. 13.
- FIG. 15 shows a nucleotide sequence (SEQ ID NO: 15) of a native sequence PRO4996 cDNA, wherein SEQ ID NO: 15 is a clone designated herein as “DNA44675-2662”.
- FIG. 16 shows the amino acid sequence (SEQ ID NO: 16) derived from the coding sequence of SEQ ID NO:15 shown in FIG. 15.
- FIG. 17 shows anucleotide sequence (SEQ ID NO: 17) of a native sequence PRO4406 cDNA, wherein SEQ ID NO: 17 is a clone designated herein as “DNA45408-2615”.
- FIG. 18 shows the amino acid sequence (SEQ ID NO:18) derived from the coding sequence of SEQ ID NO:17 shown in FIG. 17.
- FIG. 19 shows a nucleotide sequence (SEQ ID NO: 19) of a native sequence PRO1120 cDNA, wherein SEQ ID NO:19 is a clone designated herein as “DNA48606-1479”.
- FIG. 20 shows the amino acid sequence (SEQ ID NO:20) derived from the coding sequence of SEQ ID NO:19 shown in FIG. 19.
- FIG. 21 shows a nucleotide sequence (SEQ ID NO:21) of a native sequence PRO4990 cDNA, wherein SEQ ID NO:21 is a clone designated herein as “DNA52753-2656”.
- FIG. 22 shows the amino acid sequence (SEQ ID NO:22) derived from the coding sequence of SEQ ID NO:21 shown in FIG. 21.
- FIG. 23 shows a nucleotide sequence (SEQ ID NO:23) of a native sequence PRO738 cDNA, wherein SEQ ID NO:23 is a clone designated herein as “DNA53915-1258”.
- FIG. 24 shows the amino acid sequence (SEQ ID NO:24) derived from the coding sequence of SEQ ID NO:23 shown in FIG. 23.
- FIG. 25 shows anucleotide sequence (SEQ ID NO:25) of a native sequence PRO3577 cDNA, wherein SEQ ID NO:25 is a clone designated herein as “DNA53991-2553”.
- FIG. 26 shows the amino acid sequence (SEQ ID NO:26) derived from the coding sequence of SEQ ID NO:25 shown in FIG. 25.
- FIG. 27 shows a nucleotide sequence (SEQ ID NO:27) of a native sequence PRO1879 cDNA, wherein SEQ ID NO:27 is a clone designated herein as “DNA54009-2517”.
- FIG. 28 shows the amino acid sequence (SEQ ID NO:28) derived from the coding sequence of SEQ ID NO:27 shown in FIG. 27.
- FIG. 29 shows a nucleotide sequence (SEQ ID NO:29) of a native sequence PRO1471 cDNA, wherein SEQ ID NO:29 is a clone designated herein as “DNA56055-1643”.
- FIG. 30 shows the amino acid sequence (SEQ ID NO:30) derived from the coding sequence of SEQ ID NO:29 shown in FIG. 29. 1 FIG. 31 shows a nucleotide sequence (SEQ ID NO:3 1) of a native sequence PRO1114 cDNA, wherein SEQ ID NO:31 is a clone designated herein as “DNA57033-1403”.
- FIG. 32 shows the amino acid sequence (SEQ ID NO:32) derived from the coding sequence of SEQ ID NO:31 shown in FIG. 31.
- FIG. 33 shows a nucleotide sequence (SEQ ID NO:33) of anative sequence PRO1076 cDNA, wherein SEQ ID NO:33 is a clone designated herein as “DNA57252-1453”.
- FIG. 34 shows the amino acid sequence (SEQ ID NO:34) derived from the coding sequence of SEQ ID NO:33 shown in FIG. 33.
- FIG. 35 shows a nucleotide sequence (SEQ ID NO:35) of a native sequence PRO1483 cDNA, wherein SEQ ID NO:35 is a clone designated herein as “DNA58799-1652”.
- FIG. 36 shows the amino acid sequence (SEQ ID NO:36) derived from the coding sequence of SEQ ID NO:35 shown in FIG. 35.
- FIG. 37 shows a nucleotide sequence (SEQ ID NO:37) of a native sequence PRO4985 cDNA, wherein SEQ ID NO:37 is a clone designated herein as “DNA59770-2652”.
- FIG. 38 shows the amino acid sequence (SEQ ID NO:38) derived from the coding sequence of SEQ ID NO:37 shown in FIG. 37.
- FIG. 39 shows a nucleotide sequence (SEQ ID NO:39) of a native sequence PRO5000 cDNA, wherein SEQ ID NO:39 is a clone designated herein as “DNA59774-2665”.
- FIG. 40 shows the amino acid sequence (SEQ ID NO:40) derived from the coding sequence of SEQ ID NO:39 shown in FIG. 39.
- FIG. 41 shows anucleotide sequence (SEQ ID NO:41) of a native sequence PRO1881 cDNA, wherein SEQ ID NO:41 is a clone designated herein as “DNA60281-2518”.
- FIG. 42 shows the amino acid sequence (SEQ ID NO:42) derived from the coding sequence of SEQ ID NO:41 shown in FIG. 41.
- FIG. 43 shows a nucleotide sequence (SEQ ID NO:43) of a native sequence PRO4314 cDNA, wherein SEQ ID NO:43 is a clone designated herein as “DNA60736-2559”.
- FIG. 44 shows the amino acid sequence (SEQ ID NO:44) derived from the coding sequence of SEQ ID NO:43 shown in FIG. 43.
- FIG. 45 shows a nucleotide sequence (SEQ ID NO:45) of a native sequence PRO4987 cDNA, wherein SEQ ID NO:45 is a clone designated herein as “DNA61875-2653”.
- FIG. 46 shows the amino acid sequence (SEQ ID NO:46) derived from the coding sequence of SEQ ID NO:45 shown in FIG. 45.
- FIG. 47 shows a nucleotide sequence (SEQ ID NO:47) of a native sequence PRO4313 cDNA, wherein SEQ ID NO:47 is a clone designated herein as “DNA62312-2558”.
- FIG. 48 shows the amino acid sequence (SEQ ID NO:48) derived from the coding sequence of SEQ ID NO:47 shown in FIG. 47.
- FIG. 49 shows a nucleotide sequence (SEQ ID NO:49) of a native sequence PRO4799 cDNA, wherein SEQ ID NO:49 is a clone designated herein as “DNA62849-1604”.
- FIG. 50 shows the amino acid sequence (SEQ ID NO:50) derived from the coding sequence of SEQ ID NO:49 shown in FIG. 49.
- FIG. 51 shows a nucleotide sequence (SEQ ID NO:51) of a native sequence PRO4995 cDNA, wherein SEQ ID NO:51 is a clone designated herein as “DNA66307-2661”.
- FIG. 52 shows the amino acid sequence (SEQ ID NO:52) derived from the coding sequence of SEQ ID NO:51 shown in FIG. 51.
- FIG. 53 shows anucleotide sequence (SEQ ID NO:53) of a native sequence PRO1341 cDNA, wherein SEQ ID NO:53 is a clone designated herein as “DNA66677-2535”.
- FIG. 54 shows the amino acid sequence (SEQ ID NO:54) derived from the coding sequence of SEQ ID NO:53 shown in FIG. 53.
- FIG. 55 shows anucleotide sequence (SEQ ID NO:55) of a native sequence PRO1777 cDNA, wherein SEQ ID NO:55 is a clone designated herein as “DNA71235-1706”.
- FIG. 56 shows the amino acid sequence (SEQ ID NO:56) derived from the coding sequence of SEQ ID NO:55 shown in FIG. 55.
- FIG. 57 shows a nucleotide sequence (SEQ ID NO:57) of a native sequence PRO3580 cDNA, wherein SEQ ID NO:57 is a clone designated herein as “DNA71289-2547”.
- FIG. 58 shows the amino acid sequence (SEQ ID NO:58) derived from the coding sequence of SEQ ID NO:57 shown in FIG. 57.
- FIG. 59 shows a nucleotide sequence (SEQ ID NO:59) of a native sequence PRO1779 cDNA, wherein SEQ ID NO:59 is a clone designated herein as “DNA73775-1707”.
- FIG. 60 shows the amino acid sequence (SEQ ID NO:60) derived from the coding sequence of SEQ ID NO:59 shown in FIG. 59.
- FIG. 61 shows a nucleotide sequence (SEQ ID NO:61) of anative sequencePRO1754 cDNA, wherein SEQ ID NO:61 is a clone designated herein as “DNA76385-1692”.
- FIG. 62 shows the amino acid sequence (SEQ ID NO:62) derived from the coding sequence of SEQ ID NO:61 shown in FIG. 61.
- FIG. 63 shows a nucleotide sequence (SEQ ID NO:63) of a native sequencePRO1906 cDNA, wherein SEQ ID NO:63 is a clone designated herein as “DNA76395-2527”.
- FIG. 64 shows the amino acid sequence (SEQ ID NO:64) derived from the coding sequence of SEQ ID NO:63 shown in FIG. 63.
- FIG. 65 shows a nucleotide sequence (SEQ ID NO:65) of anative sequence PRO1870 cDNA, wherein SEQ ID NO:65 is a clone designated herein as “DNA77622-2516”.
- FIG. 66 shows the amino acid sequence (SEQ ID NO:66) derived from the coding sequence of SEQ ID NO:65 shown in FIG. 65.
- FIG. 67 shows a nucleotide sequence (SEQ ID NO:67) of a native sequence PRO4329 cDNA, wherein SEQ ID NO:67 is a clone designated herein as “DNA77629-2573”.
- FIG. 68 shows the amino acid sequence (SEQ ID NO:68) derived from the coding sequence of SEQ ID NO:67 shown in FIG. 67.
- FIG. 69 shows a nucleotide sequence (SEQ ID NO:69) of a native sequence PRO4979 cDNA, wherein SEQ ID NO:69 is a clone designated herein as “DNA77645-2648”.
- FIG. 70 shows the amino acid sequence (SEQ ID NO:70) derived from the coding sequence of SEQ ID NO:69 shown in FIG. 69.
- FIG. 71 shows a nucleotide sequence (SEQ ID NO:71) of a native sequence PRO1885 cDNA, wherein SEQ ID NO:71 is a clone designated herein as “DNA79302-2521”.
- FIG. 72 shows the amino acid sequence (SEQ ID NO:72) derived from the coding sequence of SEQ ID NO:71 shown in FIG. 71.
- FIG. 73 shows anucleotide sequence (SEQ ID NO:73) of a native sequencePRO1882 cDNA, wherein SEQ ID NO:73 is a clone designated herein as “DNA79865-2519”.
- FIG. 74 shows the amino acid sequence (SEQ ID NO:74) derived from the coding sequence of SEQ ID NO:73 shown in FIG. 73.
- FIG. 75 shows a nucleotide sequence (SEQ ID NO:75) of a native sequence PRO4989 cDNA, wherein SEQ ID NO:75 is a clone designated herein as “DNA80135-2655”.
- FIG. 76 shows the amino acid sequence (SEQ ID NO:76) derived from the coding sequence of SEQ ID NO:75 shown in FIG. 75.
- FIG. 77 shows anucleotide sequence (SEQ ID NO:77) of a native sequence PRO4323 cDNA, wherein SEQ ID NO:77 is a clone designated herein as “DNA80794-2568”.
- FIG. 78 shows the amino acid sequence (SEQ ID NO:78) derived from the coding sequence of SEQ ID NO:77 shown in FIG. 77.
- FIG. 79 shows anucleotide sequence (SEQ ID NO:79) of anative sequence PRO1886 cDNA, wherein SEQ ID NO:79 is a clone designated herein as “DNA80796-2523”.
- FIG. 80 shows the amino acid sequence (SEQ ID NO:80) derived from the coding sequence of SEQ ID NO:79 shown in FIG. 79.
- FIG. 81 shows anucleotide sequence (SEQ ID NO:81) of a native sequence PRO4395 cDNA, wherein SEQ ID NO:81 is a clone designated herein as “DNA80840-2605”.
- FIG. 82 shows the amino acid sequence (SEQ ID NO:82) derived from the coding sequence of SEQ ID NO:81 shown in FIG. 81.
- FIG. 83 shows a nucleotide sequence (SEQ ID NO:83) of a native sequence PRO1782 cDNA, wherein SEQ ID NO:83 is a clone designated herein as “DNA80899-2501 ”.
- FIG. 84 shows the amino acid sequence (SEQ ID NO:84) derived from the coding sequence of SEQ ID NO:83 shown in FIG. 83.
- FIG. 85 shows a nucleotide sequence (SEQ Ip NO:85) of a native sequence PRO4338 cDNA, wherein SEQ ID NO:85 is a clone designated herein as “DNA81228-2580”.
- FIG. 86 shows the amino acid sequence (SEQ ID NO:86) derived from the coding sequence of SEQ ID NO:85 shown in FIG. 85.
- FIG. 87 shows a nucleotide sequence (SEQ ID NO:87) of a native sequence PRO4341 cDNA, wherein SEQ ID NO:87 is a clone designated herein as “DNA81761-2583”.
- FIG. 88 shows the amino acid sequence (SEQ ID NO:88) derived from the coding sequence of SEQ ID NO:87 shown in FIG. 87.
- FIG. 89 shows a nucleotide sequence (SEQ ID NO:89) of a native sequence PRO5990 cDNA, wherein SEQ ID NO:89 is a clone designated herein as “DNA96042-2682”.
- FIG. 90 shows the amino acid sequence (SEQ ID NO:90) derived from the coding sequence of SEQ ID NO:89 shown in FIG. 89.
- FIG. 91 shows a nucleotide sequence (SEQ ID NO:91) of a native sequence PRO3438 cDNA, wherein SEQ ID NO:91 is a clone designated herein as “DNA82364-2538”.
- FIG. 92 shows the amino acid sequence (SEQ ID NO:92) derived from the coding sequence of SEQ ID NO:91 shown in FIG. 91.
- FIG. 93 shows a nucleotide sequence (SEQ ID NO:93) of a native sequence PRO4321 cDNA, wherein SEQ ID NO:93 is a clone designated herein as “DNA82424-2566”.
- FIG. 94 shows the amino acid sequence (SEQ ID NO:94) derived from the coding sequence of SEQ ID NO:93 shown in FIG. 93.
- FIG. 95 shows a nucleotide sequence (SEQ ID NO:95) of a native sequence PRO4304 cDNA, wherein SEQ ID NO:95 is a clone designated herein as “DNA82430-2557”.
- FIG. 96 shows the amino acid sequence (SEQ ID NO:96) derived from the coding sequence of SEQ ID NO:95 shown in FIG. 95.
- FIG. 97 shows a nucleotide sequence (SEQ ID NO:97) of a native sequence PRO1801 cDNA, wherein SEQ ID NO:97 is a clone designated herein as “DNA83500-2506”.
- FIG. 98 shows the amino acid sequence (SEQ ID NO:98) derived from the coding sequence of SEQ ID NO:97 shown in FIG. 97.
- FIG. 99 shows a nucleotide sequence (SEQ ID NO:99) of a native sequence PRO4403 cDNA, wherein SEQ ID NO:99 is a clone designated herein as “DNA83509-2612”.
- FIG. 100 shows the amino acid sequence (SEQ ID NO: 100) derived from the coding sequence of SEQ ID NO:99 shown in FIG. 99.
- FIG. 101 shows a nucleotide sequence (SEQ ID NO: 101) of a native sequence PRO4324 cDNA, wherein SEQ ID NO: 101 is a clone designated herein as “DNA83560-2569”.
- FIG. 102 shows the amino acid sequence (SEQ ID NO: 102) derived from the coding sequence of SEQ ID NO:101 shown in FIG. 101.
- FIG. 103 shows a nucleotide sequence (SEQ ID NO: 103) of a native sequence PRO4303 cDNA, wherein SEQ ID NO: 103 is a clone designated herein as “DNA84139-2555”.
- FIG. 104 shows the amino acid sequence (SEQ ID NO: 104) derived from the coding sequence of SEQ ID NO:103 shown in FIG. 103.
- FIG. 105 shows a nucleotide sequence (SEQ ID NO: 105) of a native sequence PRO4305 cDNA, wherein SEQ ID NO: 105 is a clone designated herein as “DNA84141-2556”.
- FIG. 106 shows the amino acid sequence (SEQ ID NO:106) derived from the coding sequence of SEQ ID NO: 105 shown in FIG. 105.
- FIG. 107 shows a nucleotide sequence (SEQ ID NO: 107) of a native sequence PRO4404 cDNA, wherein SEQ ID NO:107 is a clone designated herein as “DNA84142-2613”.
- FIG. 108 shows the amino acid sequence (SEQ ID NO: 108) derived from the coding sequence of SEQ ID NO: 107 shown in FIG. 107.
- FIG. 109 shows a nucleotide sequence (SEQ ID NO:109) of a native sequence PRO1884 cDNA, wherein SEQ ID NO: 109 is a clone designated herein as “DNA84318-2520”.
- FIG. 110 shows the amino acid sequence (SEQ ID NO: 110) derived from the coding sequence of SEQ ID NO: 109 shown in FIG. 109.
- FIG. 111 shows a nucleotide sequence (SEQ ID NO: 111) of a native sequence PRO4349 cDNA, wherein SEQ ID NO: 111 is a clone designated herein as “DNA84909-2590”.
- FIG. 112 shows the amino acid sequence (SEQ ID NO: 112) derived from the coding sequence of SEQ ID NO: 111 shown in FIG. 111.
- FIG. 113 shows a nucleotide sequence (SEQ ID NO:113) of a native sequence PRO4401 cDNA, wherein SEQ ID NO: 113 is a clone designated herein as “DNA84912-2610”.
- FIG. 114 shows the amino acid sequence (SEQ ID NO: 114) derived from the coding sequence of SEQ IDNO:113 shown in FIG. 113.
- FIG. 115 shows a nucleotide sequence (SEQ ID NO: 115) of a native sequence PRO1867 cDNA, wherein SEQ ID NO: 115 is a clone designated herein as “DNA84925-2514”.
- FIG. 116 shows the amino acid sequence (SEQ ID NO: 116) derived from the coding sequence of SEQ ID NO: 115 shown in FIG. 115.
- FIG. 117 shows a nucleotide sequence (SEQ ID NO:117) of a native sequence PRO4319 cDNA, wherein SEQ ID NO: 117 is a clone designated herein as “DNA84928-2564”.
- FIG. 118 shows the amino acid sequence (SEQ ID NO: 118) derived from the coding sequence of SEQ ID NO: 117 shown in FIG. 117.
- FIG. 119 shows a nucleotide sequence (SEQ ID NO:119) of a native sequence PRO4991 cDNA, wherein SEQ ID NO: 119 is a clone designated herein as “DNA84932-2657”.
- FIG. 120 shows the amino acid sequence (SEQ ID NO: 120) derived from the coding sequence of SEQ ID NO:119 shown in FIG. 119.
- FIG. 121 shows a nucleotide sequence (SEQ ID NO: 121) of a native sequence PRO4398 cDNA, wherein SEQ ID NO:121 is a clone designated herein as “DNA86592-2607”.
- FIG. 122 shows the amino acid sequence (SEQ ID NO: 122) derived from the coding sequence of SEQ ID NO:121 shown in FIG. 121.
- FIG. 123 shows a nucleotide sequence (SEQ ID NO: 123) of a native sequence PRO4346 cDNA, wherein SEQ ID NO: 123 is a clone designated herein as “DNA86594-2587”.
- FIG. 124 shows the amino acid sequence (SEQ ID NO:124) derived from the coding sequence of SEQ ID NO: 123 shown in FIG. 123.
- FIG. 125 shows a nucleotide sequence (SEQ ID NO: 125) of a native sequence PRO4350 cDNA, wherein SEQ ID NO: 125 is a clone designated herein as “DNA86647-2591”.
- FIG. 126 shows the amino acid sequence (SEQ ID NO:126) derived from the coding sequence of SEQ ID NO:125 shown in FIG. 125.
- FIG. 127 shows a nucleotide sequence (SEQ ID NO: 127) of a native sequence PRO4318 cDNA, wherein SEQ ID NO: 127 is a clone designated herein as “DNA87185-2563”.
- FIG. 128 shows the amino acid sequence (SEQ ID NO: 128) derived from the coding sequence of SEQ ID NO:127 shown in FIG. 127.
- FIG. 129 shows a nucleotide sequence (SEQ ID NO: 129) of a native sequence PRO4340 cDNA, wherein SEQ ID NO: 129 is a clone designated herein as “DNA87656-2582”.
- FIG. 130 shows the amino acid sequence (SEQ ID NO: 130) derived from the coding sequence of SEQ ID NO:129 shown in FIG. 129.
- FIG. 131 shows a nucleotide sequence (SEQ ID NO: 131) of a native sequence PRO4400 cDNA, wherein SEQ ID NO: 131 is a clone designated herein as “DNA87974-2609”.
- FIG. 132 shows the amino acid sequence (SEQ ID NO: 132) derived from the coding sequence of SEQ ID NO: 131 shown in FIG. 131.
- FIG. 133 shows a nucleotide sequence (SEQ ID NO: 133) of a native sequence PRO4320 cDNA, wherein SEQ ID NO: 133 is a clone designated herein as “DNA88001-2565”.
- FIG. 134 shows the amino acid sequence (SEQ ID NO: 134) derived from the coding sequence of SEQ ID NO:133 shown in FIG. 133.
- FIG. 135 shows a nucleotide sequence (SEQ ID NO: 135) of a native sequence PRO4409 cDNA, wherein SEQ ID NO: 135 is a clone designated herein as “DNA88004-2575”.
- FIG. 136 shows the amino acid sequence (SEQ ID NO: 136) derived from the coding sequence of SEQ ID NO:135 shown in FIG. 135.
- FIG. 137 shows a nucleotide sequence (SEQ ID NO: 137) of a native sequence PRO4399 cDNA, wherein SEQ ID NO: 137 is a clone designated herein as “DNA89220-2608”.
- FIG. 138 shows the amino acid sequence (SEQ ID NO: 138) derived from the coding sequence of SEQ ID NO:137 shown in FIG. 137.
- FIG. 139 shows a nucleotide sequence (SEQ ID NO: 139) of a native sequence PRO4418 cDNA, wherein SEQ ID NO: 139 is a clone designated herein as “DNA89947-2618”.
- FIG. 140 shows the amino acid sequence (SEQ ID NO: 140) derived from the coding sequence of SEQ ID NO:139 shown in FIG. 139.
- FIG. 141 shows a nucleotide sequence (SEQ ID NO: 141) of a native sequence PRO4330 cDNA, wherein SEQ ID NO: 141 is a clone designated herein as “DNA90842-2574”.
- FIG. 142 shows the amino acid sequence (SEQ ID NO: 142) derived from the coding sequence of SEQ ID NO:141 shown in FIG. 141.
- FIG. 143 shows a nucleotide sequence (SEQ ID NO: 143) of a native sequence PRO4339 cDNA, wherein SEQ ID NO: 143 is a clone designated herein as “DNA91775-2581”.
- FIG. 144 shows the amino acid sequence (SEQ ID NO: 144) derived from the coding sequence of SEQ ID NO: 143 shown in FIG. 143.
- FIG. 145 shows a nucleotide sequence (SEQ ID NO:145) of a native sequence PRO4326 cDNA, wherein SEQ ID NO: 145 is a clone designated herein as “DNA91779-2571 ”.
- FIG. 146 shows the amino acid sequence (SEQ ID NO: 146) derived from the coding sequence of SEQ ID NO: 145 shown in FIG. 145.
- FIG. 147 shows a nucleotide sequence (SEQ ID NO: 147) of a native sequence PRO6014 cDNA, wherein SEQ ID NO: 147 is a clone designated herein as “DNA92217-2697”.
- FIG. 148 shows the amino acid sequence (SEQ ID NO: 148) derived from the coding sequence of SEQ ID NO: 147 shown in FIG. 147.
- FIG. 149 shows a nucleotide sequence (SEQ ID NO: 149) of a native sequence PRO3446 cDNA, wherein SEQ ID NO: 149 is a clone designated herein as “DNA92219-2541 ”.
- FIG. 150 shows the amino acid sequence (SEQ ID NO:150) derived from the coding sequence of SEQ ID NO: 149 shown in FIG. 149.
- FIG. 151 shows a nucleotide sequence (SEQ ID NO:151) of a native sequence PRO4322 cDNA, wherein SEQ ID NO: 151 is a clone designated herein as “DNA92223-2567”.
- FIG. 152 shows the amino acid sequence (SEQ ID NO:152) derived from the coding sequence of SEQ ID NO: 151 shown in FIG. 151.
- FIG. 153 shows a nucleotide sequence (SEQ ID NO:153) of a native sequence PRO4381 cDNA, wherein SEQ ID NO: 153 is a clone designated herein as “DNA92225-2603”.
- FIG. 154 shows the amino acid sequence (SEQ ID NO: 154) derived from the coding sequence of SEQ ID NO:153 shown in FIG. 153.
- FIG. 155 shows a nucleotide sequence (SEQ ID NO: 155) of a native sequence PRO4348 cDNA, wherein SEQ ID NO: 155 is a clone designated herein as “DNA92232-2589”.
- FIG. 156 shows the amino acid sequence (SEQ ID NO: 156) derived from the coding sequence of SEQ ID NO:155 shown in FIG. 155.
- FIG. 157 shows a nucleotide sequence (SEQ ID NO: 157) of a native sequence PRO4371 cDNA, wherein SEQ ID NO: 157 is a clone designated herein as “DNA92233-2599”.
- FIG. 158 shows the amino acid sequence (SEQ ID NO:158) derived from the coding sequence of SEQ ID NO:157 shown in FIG. 157.
- FIG. 159 shows a nucleotide sequence (SEQ ID NO: 159) of a native sequence PRO3742 cDNA, wherein SEQ ID NO: 159 is a clone designated herein as “DNA92243-2549”.
- FIG. 160 shows the amino acid sequence (SEQ ID NO: 160) derived from the coding sequence of SEQ ID NO: 159 shown in FIG. 159.
- FIG. 161 shows a nucleotide sequence (SEQ ID NO:161) of a native sequence PRO5773 cDNA, wherein SEQ ID NO:161 is a clone designated herein as “DNA92253-2671”.
- FIG. 162 shows the amino acid sequence (SEQ ID NO: 162) derived from the coding sequence of SEQ ID NO: 161 shown in FIG. 161.
- FIG. 163 shows a nucleotide sequence (SEQ ID NO: 163) of a native sequence PRO5774 cDNA, wherein SEQ ID NO: 163 is a clone designated herein as “DNA92254-2672”.
- FIG. 164 shows the amino acid sequence (SEQ ID NO: 164) derived from the coding sequence of SEQ ID NO: 163 shown in FIG. 163.
- FIG. 165 shows a nucleotide sequence (SEQ ID NO: 165) of a native sequence PRO4343 cDNA, wherein SEQ ID NO: 165 is a clone designated herein as “DNA92255-2584”.
- FIG. 166 shows the amino acid sequence (SEQ ID NO:166) derived from the coding sequence of SEQ ID NO: 165 shown in FIG. 165.
- FIG. 167 shows a nucleotide sequence (SEQ ID NO: 167) of a native sequence PRO4325 cDNA, wherein SEQ ID NO: 167 is a clone designated herein as “DNA92269-2570”.
- FIG. 168 shows the amino acid sequence (SEQ ID NO: 168) derived from the coding sequence of SEQ ID NO: 167 shown in FIG. 167.
- FIG. 169 shows a nucleotide sequence (SEQ ID NO:169) of a native sequence PRO4347 cDNA, wherein SEQ ID NO: 169 is a clone designated herein as “DNA92288-2588”.
- FIG. 170 shows the amino acid sequence (SEQ ID NO: 170) derived from the coding sequence of SEQ ID NO: 169 shown in FIG. 169.
- FIG. 171 shows a nucleotide sequence (SEQ ID NO: 171) of a native sequence PRO3743 cDNA, wherein SEQ ID NO: 171 is a clone designated herein as “DNA92290-2550”.
- FIG. 172 shows the amino acid sequence (SEQ ID NO: 172) derived from the coding sequence of SEQ ID NO:171 shown in FIG. 171.
- FIG. 173 shows a nucleotide sequence (SEQ ID NO:173) of a native sequence PRO4426 cDNA, wherein SEQ ID NO: 173 is a clone designated herein as “DNA93012-2622”.
- FIG. 174 shows the amino acid sequence (SEQ ID NO:174) derived from the coding sequence of SEQ ID NO: 173 shown in FIG. 173.
- FIG. 175 shows a nucleotide sequence (SEQ ID NO:175) of a native sequence PRO4500 cDNA, wherein SEQ ID NO: 175 is a clone designated herein as “DNA93020-2642”.
- FIG. 176 shows the amino acid sequence (SEQ ID NO: 176) derived from the coding sequence of SEQ ID NO:175 shown in FIG. 175.
- FIG. 177 shows a nucleotide sequence (SEQ ID NO: 177) of a native sequence PRO4389 cDNA, wherein SEQ ID NO: 177 is a clone designated herein as “DNA94830-2604”.
- FIG. 178 shows the amino acid sequence (SEQ ID NO: 178) derived from the coding sequence of SEQ ID NO:177 shown in FIG. 177.
- FIG. 179 shows a nucleotide sequence (SEQ ID NO: 179) of a native sequence PRO4337 cDNA, wherein SEQ ID NO: 179 is a clone designated herein as “DNA94833-2579”.
- FIG. 180 shows the amino acid sequence (SEQ ID NO: 180) derived from the coding sequence of SEQ ID NO: 179 shown in FIG. 179.
- FIG. 181 shows a nucleotide sequence (SEQ ID NO: 181) of a native sequence PRO4992 cDNA, wherein SEQ ID NO: 181 is a clone designated herein as “DNA94838-2658”.
- FIG. 182 shows the amino acid sequence (SEQ ID NO: 182) derived from the coding sequence of SEQ ID NO:181 shown in FIG. 181.
- FIG. 183 shows a nucleotide sequence (SEQ ID NO: 183) of a native sequence PRO5996 cDNA, wherein SEQ ID NO: 183 is a clone designated herein as “DNA94844-2686”.
- FIG. 184 shows the amino acid sequence (SEQ ID NO: 184) derived from the coding sequence of SEQ ID NO: 183 shown in FIG. 183.
- FIG. 185 shows a nucleotide sequence (SEQ ID NO: 185) of a native sequence PRO4345 cDNA, wherein SEQ ID NO: 185 is a clone designated herein as “DNA94854-2586”.
- FIG. 186 shows the amino acid sequence (SEQ ID NO: 186) derived from the coding sequence of SEQ ID NO: 185 shown in FIG. 185.
- FIG. 187 shows a nucleotide sequence (SEQ ID NO: 187) of a native sequence PRO4978 cDNA, wherein SEQ ID NO: 187 is a clone designated herein as “DNA95930”.
- FIG. 188 shows the amino acid sequence (SEQ ID NO: 188) derived from the coding sequence of SEQ ID NO: 187 shown in FIG. 187.
- FIG. 189 shows a nucleotide sequence (SEQ ID NO: 189) of a native sequence PRO5780 cDNA, wherein SEQ ID NO: 189 is a clone designated herein as “DNA96868-2677”.
- FIG. 190 shows the amino acid sequence (SEQ ID NO: 190) derived from the coding sequence of SEQ ID NO:189 shown in FIG. 189.
- FIG. 191 shows a nucleotide sequence (SEQ ID NO: 191) of a native sequence PRO5992 cDNA, wherein SEQ ID NO: 191 is a clone designated herein as “DNA96871-2683”.
- FIG. 192 shows the amino acid sequence (SEQ ID NO: 192) derived from the coding sequence of SEQ ID NO: 191 shown in FIG. 191.
- FIG. 193 shows a nucleotide sequence (SEQ ID NO: 193) of a native sequence PRO4428 cDNA, wherein SEQ ID NO: 193 is a clone designated herein as “DNA96880-2624”.
- FIG. 194 shows the amino acid sequence (SEQ ID NO: 194) derived from the coding sequence of SEQ ID NO: 193 shown in FIG. 193.
- FIG. 195 shows a nucleotide sequence (SEQ ID NO: 195) of a native sequence PRO4994 cDNA, wherein SEQ ID NO: 195 is a clone designated herein as “DNA96986-2660”.
- FIG. 196 shows the amino acid sequence (SEQ ID NO:196) derived from the coding sequence of SEQ ID NO: 195 shown in FIG. 195.
- FIG. 197 shows a nucleotide sequence (SEQ ID NO: 197) of a native sequence PRO5995 cDNA, wherein SEQ ID NO: 197 is a clone designated herein as “DNA96988-2685”.
- FIG. 198 shows the amino acid sequence (SEQ ID NO:198) derived from the coding sequence of SEQ ID NO: 197 shown in FIG. 197.
- FIG. 199 shows a nucleotide sequence (SEQ ID NO:199) of a native sequence PRO6094 cDNA, wherein SEQ ID NO: 199 is a clone designated herein as “DNA96995-2709”.
- FIG. 200 shows the amino acid sequence (SEQ ID NO:200) derived from the coding sequence of SEQ ID NO: 199 shown in FIG. 199.
- FIG. 201 shows a nucleotide sequence (SEQ ID NO:201) of a native sequence PRO4317 cDNA, wherein SEQ ID NO:201 is a clone designated herein as “DNA97004-2562”.
- FIG. 202 shows the amino acid sequence (SEQ ID NO:202) derived from the coding sequence of SEQ ID NO:201 shown in FIG. 201.
- FIG. 203 shows a nucleotide sequence (SEQ ID NO:203) of a native sequence PRO5997 cDNA, wherein SEQ ID NO:203 is a clone designated herein as “DNA97005-2687”.
- FIG. 204 shows the amino acid sequence (SEQ ID NO:204) derived from the coding sequence of SEQ ID NO:203 shown in FIG. 203.
- FIG. 205 shows a nucleotide sequence (SEQ ID NO:205) of a native sequence PRO5005 cDNA, wherein SEQ ID NO:205 is a clone designated herein as “DNA97009-2668”.
- FIG. 206 shows the amino acid sequence (SEQ ID NO:206) derived from the coding sequence of SEQ ID NO:205 shown in FIG. 205.
- FIG. 207 shows a nucleotide sequence (SEQ ID NO:207) of a native sequence PRO5004 cDNA, wherein SEQ ID NO:207 is a clone designated herein as “DNA97013-2667”.
- FIG. 208 shows the amino acid sequence (SEQ ID NO:208) derived from the coding sequence of SEQ ID NO:207 shown in FIG. 207.
- FIG. 209 shows a nucleotide sequence (SEQ ID NO:209) of a native sequence PRO6001 cDNA, wherein SEQ ID NO:209 is a clone designated herein as “DNA98380-2690”.
- FIG. 210 shows the amino acid sequence (SEQ ID NO:210) derived from the coding sequence of SEQ ID NO:209 shown in FIG. 209.
- FIG. 211 shows a nucleotide sequence (SEQ ID NO:211) of a native sequence PRO6013 cDNA, wherein SEQ ID NO:211 is a clone designated herein as “DNA98561-2696”.
- FIG. 212 shows the amino acid sequence (SEQ ID NO:212) derived from the coding sequence of SEQ ID NO:211 shown in FIG. 211.
- FIG. 213 shows a nucleotide sequence (SEQ ID NO:213) of a native sequence PRO4502 cDNA, wherein SEQ ID NO:213 is a clone designated herein as “DNA98575-2644”.
- FIG. 214 shows the amino acid sequence (SEQ ID NO:214) derived from the coding sequence of SEQ ID NO:213 shown in FIG. 213.
- FIG. 215 shows a nucleotide sequence (SEQ ID NO:215) of a native sequence PRO6007 cDNA, wherein SEQ ID NO:215 is a clone designated herein as “DNA98593-2694”.
- FIG. 216 shows the amino acid sequence (SEQ ID NO:216) derived from the coding sequence of SEQ ID NO:215 shown in FIG. 215.
- FIG. 217 shows a nucleotide sequence (SEQ ID NO:217) of a native sequence PRO6028 cDNA, wherein SEQ ID NO:217 is a clone designated herein as “DNA98600-2703”.
- FIG. 218 shows the amino acid sequence (SEQ ID NO:218) derived from the coding sequence of SEQ ID NO:217 shown in FIG. 217.
- FIG. 219 shows a nucleotide sequence (SEQ ID NO:219) of a native sequence PRO100 cDNA, wherein SEQ ID NO:219 is a clone designated herein as “DNA99333”.
- FIG. 220 shows the amino acid sequence (SEQ ID NO:220) derived from the coding sequence of SEQ ID NO:219 shown in FIG. 219.
- FIG. 221 shows a nucleotide sequence (SEQ ID NO:221) of a native sequence PRO4327 cDNA, wherein SEQ ID NO:221 is a clone designated herein as “DNA99391-2572”.
- FIG. 222 shows the amino acid sequence (SEQ ID NO:222) derived from the coding sequence of SEQ ID NO:221 shown in FIG. 221.
- FIG. 223 shows a nucleotide sequence (SEQ ID NO:223) of a native sequence PRO4315 cDNA, wherein SEQ ID NO:223 is a clone designated herein as “DNA99393-2560”.
- FIG. 224 shows the amino acid sequence (SEQ ID NO:224) derived from the coding sequence of SEQ ID NO:223 shown in FIG. 223.
- FIG. 225 shows a nucleotide sequence (SEQ ID NO:225) of a native sequence PRO5993 cDNA, wherein SEQ ID NO:225 is a clone designated herein as “DNA100276-2684”.
- FIG. 226 shows the amino acid sequence (SEQ ID NO:226) derived from the coding sequence of SEQ ID NO:225 shown in FIG. 225.
- FIG. 227 shows a nucleotide sequence (SEQ ID NO:227) of a native sequence PRO4503 cDNA, wherein SEQ ID NO:227 is a clone designated herein as “DNA100312-2645”.
- FIG. 228 shows the amino acid sequence (SEQ ID NO:228) derived from the coding sequence of SEQ ID NO:227 shown in FIG. 227.
- FIG. 229 shows a nucleotide sequence (SEQ ID NO:229) of a native sequence PRO4976 cDNA, wherein SEQ ID NO:229 is a clone designated herein as “DNA100902-2646”.
- FIG. 230 shows the amino acid sequence (SEQ ID NO:230) derived from the coding sequence of SEQ ID NO:229 shown in FIG. 229.
- FIG. 231 shows a nucleotide sequence (SEQ ID NO:231) of a native sequence PRO5798 cDNA, wherein SEQ ID NO:231 is a clone designated herein as “DNA102899-2679”.
- FIG. 232 shows the amino acid sequence (SEQ ID NO:232) derived from the coding sequence of SEQ ID NO:231 shown in FIG. 231.
- FIG. 233 shows a nucleotide sequence (SEQ ID NO:233) of a native sequence PRO6242 cDNA, wherein SEQ ID NO:233 is a clone designated herein as “DNA104875-2720”.
- FIG. 234 shows the amino acid sequence (SEQ ID NO:234) derived from the coding sequence of SEQ ID NO:233 shown in FIG. 233.
- FIG. 235 shows a nucleotide sequence (SEQ ID NO:235) of a native sequence PRO6095 cDNA, wherein SEQ ID NO:235 is a clone designated herein as “DNA105680-2710”.
- FIG. 236 shows the amino acid sequence (SEQ ID NO:236) derived from the coding sequence of SEQ ID NO:235 shown in FIG. 235.
- FIG. 237 shows a nucleotide sequence (SEQ ID NO:237) of a native sequence PRO6093 cDNA, wherein SEQ ID NO:237 is a clone designated herein as “DNA105779-2708”.
- FIG. 238 shows the amino acid sequence (SEQ ID NO:238) derived from the coding sequence of SEQ ID NO:237 shown in FIG. 237.
- FIG. 239 shows a nucleotide sequence (SEQ ID NO:239) of a native sequence PRO6012 cDNA, wherein SEQ ID NO:239 is a clone designated herein as “DNA105794-2695”.
- FIG. 240 shows the amino acid sequence (SEQ ID NO:240) derived from the coding sequence of SEQ ID NO:239 shown in FIG. 239.
- FIG. 241 shows a nucleotide sequence (SEQ ID NO:241) of a native sequence PRO6027 cDNA, wherein SEQ ID NO:241 is a clone designated herein as “DNA105838-2702”.
- FIG. 242 shows the amino acid sequence (SEQ ID NO:242) derived from the coding sequence of SEQ ID NO:241 shown in FIG. 241.
- FIG. 243 shows a nucleotide sequence (SEQ ID NO:243) of a native sequence PRO6181 cDNA, wherein SEQ ID NO:243 is a clone designated herein as “DNA107698-2715”.
- FIG. 244 shows the amino acid sequence (SEQ ID NO:244) derived from the coding sequence of SEQ ID NO:243 shown in FIG. 243.
- FIG. 245 shows a nucleotide sequence (SEQ ID NO:245) of a native sequence PRO6097 cDNA, wherein SEQ ID NO:245 is a clone designated herein as “DNA107701-2711”.
- FIG. 246 shows the amino acid sequence (SEQ ID NO:246) derived from the coding sequence of SEQ ID NO:245 shown in FIG. 245.
- FIG. 247 shows a nucleotide sequence (SEQ ID NO:247) of a native sequence PRO6090 cDNA, wherein SEQ ID NO:247 is a clone designated herein as “DNA107781-2707”.
- FIG. 248 shows the amino acid sequence (SEQ ID NO:248) derived from the coding sequence of SEQ ID NO:247 shown in FIG. 247.
- FIG. 249 shows a nucleotide sequence (SEQ ID NO:249) of a native sequence PRO7171 cDNA, wherein SEQ ID NO:249 is a clone designated herein as “DNA108670-2744”.
- FIG. 250 shows the amino acid sequence (SEQ ID NO:250) derived from the coding sequence of SEQ ID NO:249 shown in FIG. 249.
- FIG. 251 shows a nucleotide sequence (SEQ ID NO:251) of a native sequence PRO6258 cDNA, wherein SEQ ID NO:251 is a clone designated herein as “DNA108688-2725”.
- FIG. 252 shows the amino acid sequence (SEQ ID NO:252) derived from the coding sequence of SEQ ID NO:251 shown in FIG. 251.
- FIG. 253 shows a nucleotide sequence (SEQ ID NO:253) of a native sequence PRO9820 cDNA, wherein SEQ ID NO:253 is a clone designated herein as “DNA108769-2765”.
- FIG. 254 shows the amino acid sequence (SEQ ID NO:254) derived from the coding sequence of SEQ ID NO:253 shown in FIG. 253.
- FIG. 255 shows a nucleotide sequence (SEQ ID NO:255) of a native sequence PRO6243 cDNA, wherein SEQ ID NO:255 is a clone designated herein as “DNA108935-2721”.
- FIG. 256 shows the amino acid sequence (SEQ ID NO:256) derived from the coding sequence of SEQ ID NO:255 shown in FIG. 255.
- FIG. 257 shows a nucleotide sequence (SEQ ID NO:257) of a native sequence PRO6182 cDNA, wherein SEQ ID NO:257 is a clone designated herein as “DNA110700-2716”.
- FIG. 258 shows the amino acid sequence (SEQ ID NO:258) derived from the coding sequence of SEQ ID NO:257 shown in FIG. 257.
- FIG. 259 shows a nucleotide sequence (SEQ ID NO:259) of a native sequence PRO6079 cDNA, wherein SEQ ID NO:259 is a clone designated herein as “DNA111750-2706”.
- FIG. 260 shows the amino acid sequence (SEQ ID NO:260) derived from the coding sequence of SEQ ID NO:259 shown in FIG. 259.
- FIG. 261 shows a nucleotide sequence (SEQ ID NO:261) of a native sequence PRO7434 cDNA, wherein SEQ ID NO:261 is a clone designated herein as “DNA123430-2755”.
- FIG. 262 shows the amino acid sequence (SEQ ID NO:262) derived from the coding sequence of SEQ ID NO:261 shown in FIG. 261.
- FIG. 263 shows a nucleotide sequence (SEQ ID NO:263) of a native sequence PRO9865 cDNA, wherein SEQ ID NO:263 is a clone designated herein as “DNA125154-2785”.
- FIG. 264 shows the amino acid sequence (SEQ ID NO:264) derived from the coding sequence of SEQ ID NO:263 shown in FIG. 263.
- FIG. 265 shows a nucleotide sequence (SEQ ID NO:265) of a native sequence PRO9828 cDNA, wherein SEQ ID NO:265 is a clone designated herein as “DNA142238-2768”.
- FIG. 266 shows the amino acid sequence (SEQ ID NO:266) derived from the coding sequence of SEQ ID NO:265 shown in FIG. 265.
- FIG. 267 shows a nucleotide sequence (SEQ ID NO:267) of a native sequence PRO196 cDNA, wherein SEQ ID NO:267 is a clone designated herein as “DNA22779-1130”.
- FIG. 268 shows the amino acid sequence (SEQ ID NO:268) derived from the coding sequence of SEQ ID NO:267 shown in FIG. 267.
- FIG. 269 shows a nucleotide sequence (SEQ ID NO:269) of a native sequence PRO197 cDNA, wherein SEQ ID NO:269 is a clone designated herein as “DNA22780-1078”.
- FIG. 270 shows the amino acid sequence (SEQ ID NO:270) derived from the coding sequence of SEQ ID NO:269 shown in FIG. 269.
- FIG. 271 shows a nucleotide sequence (SEQ ID NO:271) of a native sequence PRO195 cDNA, wherein SEQ ID NO:271 is a clone designated herein as “DNA26847-1395”.
- FIG. 272 shows the amino acid sequence (SEQ ID NO:272) derived from the coding sequence of SEQ ID NO:271 shown in FIG. 271.
- FIG. 273 shows a nucleotide sequence (SEQ ID NO:273) of a native sequence PRO187 cDNA, wherein SEQ ID NO:273 is a clone designated herein as “DNA27864-1155”.
- FIG. 274 shows the amino acid sequence (SEQ ID NO:274) derived from the coding sequence of SEQ ID NO:273 shown in FIG. 273.
- FIG. 275 shows a nucleotide sequence (SEQ ID NO:275) of a native sequence PRO182 cDNA, wherein SEQ ID NO:275 is a clone designated herein as “DNA27865-1091”.
- FIG. 276 shows the amino acid sequence (SEQ ID NO:276) derived from the coding sequence of SEQ ID NO:275 shown in FIG. 275.
- FIG. 277 shows a nucleotide sequence (SEQ ID NO:277) of a native sequence PRO188 cDNA, wherein SEQ ID NO:277 is a clone designated herein as “DNA28497-1130.
- FIG. 278 shows the amino acid sequence (SEQ ID NO:278) derived from the coding sequence of SEQ ID NO:277 shown in FIG. 277.
- FIG. 279 shows a nucleotide sequence (SEQ ID NO:279) of a native sequence PRO183 cDNA, wherein SEQ ID NO:279 is a clone designated herein as “DNA28498”.
- FIG. 280 shows the amino acid sequence (SEQ ID NO:280) derived from the coding sequence of SEQ ID NO:279 shown in FIG. 279.
- FIG. 281 shows a nucleotide sequence (SEQ ID NO:281) of a native sequence PRO184 cDNA, wherein SEQ ID NO:281 is a clone designated herein as “DNA28500”.
- FIG. 282 shows the amino acid sequence (SEQ ID NO:282) derived from the coding sequence of SEQ ID NO: 281 shown in FIG. 281.
- FIG. 283 shows a nucleotide sequence (SEQ ID NO:283) of a native sequence PRO185 cDNA, wherein SEQ ID NO:283 is a clone designated herein as “DNA28503”.
- FIG. 284 shows the amino acid sequence (SEQ ID NO:284) derived from the coding sequence of SEQ ID NO:283 shown in FIG. 283.
- FIG. 285 shows a nucleotide sequence (SEQ ID NO:285) of a native sequence PRO200 cDNA, wherein SEQ ID NO:285 is a clone designated herein as “DNA29101-1122”.
- FIG. 286 shows the amino acid sequence (SEQ ID NO:286) derived from the coding sequence of SEQ ID NO:285 shown in FIG. 285.
- FIG. 287 shows a nucleotide sequence (SEQ ID NO:287) of a native sequence PRO202 cDNA, wherein SEQ ID NO:287 is a clone designated herein as “DNA30869”.
- FIG. 288 shows the amino acid sequence (SEQ ID NO:288) derived from the coding sequence of SEQ ID NO:287 shown in FIG. 287.
- FIG. 289 shows a nucleotide sequence (SEQ ID NO:289) of a native sequence PRO214 cDNA, wherein SEQ ID NO:289 is a clone designated herein as “DNA32286-1191”.
- FIG. 290 shows the amino acid sequence (SEQ ID NO:290) derived from the coding sequence of SEQ ID NO:289 shown in FIG. 289.
- FIG. 291 shows a nucleotide sequence (SEQ ID NO:291) of a native sequence PRO215 cDNA, wherein SEQ ID NO:291 is a clone designated herein as “DNA32288-1132”.
- FIG. 292 shows the amino acid sequence (SEQ ID NO:292) derived from the coding sequence of SEQ ID NO:291 shown in FIG. 291.
- FIG. 293 shows a nucleotide sequence (SEQ ID NO:293) of a native sequence PRO219 cDNA, wherein SEQ ID NO:293 is a clone designated herein as “DNA32290-1164”.
- FIG. 294 shows dh aacid sequence (SEQ ID NO:294) derived from the coding sequence of SEQ ID NO:293 shown in FIG. 293.
- FIG. 295 shows a nucle sqnce (SEQ ID NO:295) of a native sequence PRO211 cDNA, wherein SEQ ID NO:295 is a clone designated herein as “DNA32292-1131”.
- FIG. 296 shows the amino acid sequence (SEQ ID NO:296) derived from f codingsequenceofSEQ ID NO:295 shown in FIG. 295.
- FIG. 297 shows a nucloctde sequence (SEQ ID NO:297) of a native sequence PRO220 cDNA, wherein SEQ ID NO:297 is a cloneded herein as “DNA322981132”.
- FIG. 298 shows the amino add sequence (SEQ ID NO:298) derived from the coding sequence of SEQ ID NO:297 shown in FIG. 297.
- FIG. 299 shows a nucleotide sequence (SEQ ID NO:299) of a native sequence PRO366 cDNA, wherein SEQ ID NO:299 b a clone delegate herein “DNA33085-1110”.
- FIG. 300 shows the acid sequence (SEQ ID NO:300) derived from the coding sequence of SEQ ID NO:299 shown in FIG. 299.
- FIG. 301 shows a nucleotide sequence (SEQ ID NO:301) of a native sequence PRO216 cDNA, wherein SEQ ID NO:301 is a clone designated herein as “DNA33087-1158”.
- FIG. 302 shows the amino acid sequence (SEQ ID NO:302) derived from the coding sequence of SEQ ID NO:301 shown FIG. 301.
- FIG. 303 shows a nucleotide sequence (SEQ ID NO:303) of a native sequence PRO221 cDNA, wherein SEQ ID NO:303 is a clone designated herein as “DNA33089-1132”.
- FIG. 304 shows the amino acid sequence (SEQ ID NO:304) derived from the coding sequence of SEQ ID NO:303 shown in FIG. 303.
- FIG. 305 shows a nucleotide sequence (SEQ ID NO:305) of a native sequence PRO228 cDNA, wherein SEQ ID NO:305 is a clone designated herein as -DNA33092-1202”.
- FIG. 306 shows the amino acid sequence (SEQ ID NO:306) derived from the coding sequence of SEQ ID NO:305 shown in FIG. 305.
- FIG. 307 shows a nucleotide sequence (SEQ ID NO:307) of a native sequence PRO217 cDNA, wherein SEQ ID NO:307 is a clone designated are as “DNA33094-1131”.
- FIG. 308 shows the amino acid sequence (SEQ ID NO:308) derived from the coding sequence of SEQ ID NO:307 shown in FIG. 307.
- FIG. 309 shows a nucleotide sequence (SEQ ID NO:309) of a native sequence PRO222 cDNA, wherein SEQ ID NO:309 is a clone designated herein as “DNA33107-1135”.
- FIG. 310 shows the amino acid sequence (SEQ ID NO:310) derived from the coding sequence of SEQ ID NO:309 shown in FIG. 309.
- FIG. 311 shows a nucleotide sequence (SEQ ID NO:311) of a native sequence PRO224 cDNA, wherein SEQ ID NO:311 is a clone designated herein as “DNA33221-1133”.
- FIG. 312 shows the amino acid sequence (SEQ ID NO:312) derived from the coding sequence of SEQ ID NO:311 shown in FIG. 311.
- FIG. 313 shows a nucleotide sequence (SEQ ID NO:313) of a native sequence PRO230 cDNA, wherein SEQ ID NO:313 is a clone designated herein as “DNA33223-1136”.
- FIG. 314 shows the amino acid sequence (SEQ ID NO:314) derived from the coding sequence of SEQ ID NO:313 shown in FIG. 313.
- FIG. 315 shows a nucleotide sequence (SEQ ID NO:315) of a native sequence PRO198 cDNA, wherein SEQ ID NO:315 is a clone designated herein as “DNA33457-1078”.
- FIG. 316 shows the amino acid sequence (SEQ ID NO:316) derived from the coding sequence of SEQ ID NO:315 shown in FIG. 315.
- FIG. 317 shows a nucleotide sequence (SEQ ID NO:317) of a native sequence PRO226 cDNA, wherein SEQ ID NO:317 is a clone designated herein as “DNA33460-1166”.
- FIG. 318 shows the amino acid sequence (SEQ ID NO:318) derived from the coding sequence of SEQ ID NO:317 shown in FIG. 317.
- FIG. 319 shows a nucleotide sequence (SEQ ID NO:319) of a native sequence PRO261 cDNA, wherein SEQ ID NO:319 is a clone designated herein as “DNA33473-1176”.
- FIG. 320 shows the amino acid sequence (SEQ ID NO:320) derived from the coding sequence of SEQ ID NO:319 shown in FIG. 319.
- FIG. 321 shows a nucleotide sequence (SEQ ID NO:321) of a native sequence PRO242 cDNA, wherein SEQ ID NO:321 is a clone designated herein as “DNA33785-1143”.
- FIG. 322 shows the amino acid sequence (SEQ ID NO:322) derived from the coding sequence of SEQ ID NO:321 shown in FIG. 321.
- FIG. 323 shows a nucleotide sequence (SEQ ID NO:323) of a native sequence PRO227 cDNA, wherein SEQ ID NO:323 is a clone designated herein as “DNA33786-1132”.
- FIG. 324 shows the amino acid sequence (SEQ ID NO:324) derived from the coding sequence of SEQ ID NO:323 shown in FIG. 323.
- FIG. 325 shows a nucleotide sequence (SEQ ID NO:325) of a native sequence PRO237 cDNA, wherein SEQ ID NO:325 is a clone designated herein as “DNA34353-1428”.
- FIG. 326 shows the amino acid sequence (SEQ ID NO:326) derived from the coding sequence of SEQ ID NO:325 shown in FIG. 325.
- FIG. 327 shows a nucleotide sequence (SEQ ID NO:327) of a native sequence PRO241 cDNA, wherein SEQ ID NO:327 is a clone designated herein as “DNA34392-1170”.
- FIG. 328 shows the amino acid sequence (SEQ ID NO:328) derived from the coding sequence of SEQ ID NO:327 shown in FIG. 327.
- FIG. 329 shows a nucleotide sequence (SEQ ID NO:329) of a native sequence PRO231 cDNA, wherein SEQ ID NO:329 is a clone designated herein as “DNA34434-1139”.
- FIG. 330 shows the amino acid sequence (SEQ ID NO:330) derived from the coding sequence of SEQ ID NO:329 shown in FIG. 329.
- FIG. 331 shows a nucleotide sequence (SEQ ID NO:331) of a native sequence PRO235 cDNA, wherein SEQ ID NO:331 is a clone designated herein as “DNA35558-1167”.
- FIG. 332 shows the amino acid sequence (SEQ ID NO:332) derived from the coding sequence of SEQ ID NO:331 shown in FIG. 331.
- FIG. 333 shows a nucleotide sequence (SEQ ID NO:333) of a native sequence PRO323 cDNA, wherein SEQ ID NO:333 is a clone designated herein as “DNA35595-1228”.
- FIG. 334 shows the amino acid sequence (SEQ ID NO:334) derived from the coding sequence of SEQ ID NO:333 shown in FIG. 333.
- FIG. 335 shows a nucleotide sequence (SEQ ID NO:335) of a native sequence PRO245 cDNA, wherein SEQ ID NO:335 is a clone designated herein as “DNA35638-1216”.
- FIG. 336 shows the amino acid sequence (SEQ ID NO:336) derived from the coding sequence of SEQ ID NO:335 shown in FIG. 335.
- FIG. 337 shows a nucleotide sequence (SEQ ID NO:337) of a native sequence PRO246 cDNA, wherein SEQ ID NO:337 is a clone designated herein as “DNA35639-1172”.
- FIG. 338 shows the amino acid sequence (SEQ ID NO:338) derived from the coding sequence of SEQ ID NO:337 shown in FIG. 337.
- FIG. 339 shows a nucleotide sequence (SEQ ID NO:339) of a native sequence PRO288 cDNA, wherein SEQ ID NO:339 is a clone designated herein as “DNA35663-1129”.
- FIG. 340 shows the amino acid sequence (SEQ ID NO:340) derived from the coding sequence of SEQ ID NO:339 shown in FIG. 339.
- FIG. 341 shows a nucleotide sequence (SEQ ID NO:341) of a native sequence PRO248 cDNA, wherein SEQ ID NO:341 is a clone designated herein as “DNA35674-1142”.
- FIG. 342 shows the amino acid sequence (SEQ ID NO:342) derived from the coding sequence of SEQ ID NO:341 shown in FIG. 341.
- FIG. 343 shows a nucleotide sequence (SEQ ID NO:343) of a native sequence PRO257 cDNA, wherein SEQ ID NO:343 is a clone designated herein as “DNA35841-1173”.
- FIG. 344 shows the amino acid sequence (SEQ ID NO:344) derived from the coding sequence of SEQ ID NO:343 shown in FIG. 343.
- FIG. 345 shows a nucleotide sequence (SEQ ID NO:345) of a native sequence PRO172 cDNA, wherein SEQ ID NO:345 is a clone designated herein as “DNA35916-1161 ”.
- FIG. 346 shows the amino acid sequence (SEQ ID NO:346) derived from the coding sequence of SEQ ID NO:345 shown in FIG. 345.
- FIG. 347 shows a nucleotide sequence (SEQ ID NO:347) of a native sequence PRO258 cDNA, wherein SEQ ID NO:347 is a clone designated herein as “DNA35918-1174”.
- FIG. 348 shows the amino acid sequence (SEQ ID NO:348) derived from the coding sequence of SEQ ID NO:347 shown in FIG. 347.
- FIG. 349 shows a nucleotide sequence (SEQ ID NO:349) of a native sequence PRO265 cDNA, wherein SEQ ID NO:349 is a clone designated herein as “DNA36350-1158”.
- FIG. 350 shows the amino acid sequence (SEQ ID NO:350) derived from the coding sequence of SEQ ID NO:349 shown in FIG. 349.
- FIG. 351 shows a nucleotide sequence (SEQ ID NO:351) of a native sequence PRO326 cDNA, wherein SEQ ID NO:351 is a clone designated herein as “DNA37140-1234”.
- FIG. 352 shows the amino acid sequence (SEQ ID NO:352) derived from the coding sequence of SEQ ID NO:351 shown in FIG. 351.
- FIG. 353 shows a nucleotide sequence (SEQ ID NO:353) of a native sequence PRO266 cDNA, wherein SEQ ID NO:353 is a clone designated herein as “DNA37150-1178”.
- FIG. 354 shows the amino acid sequence (SEQ ID NO:354) derived from the coding sequence of SEQ ID NO:353 shown in FIG. 353.
- FIG. 355 shows a nucleotide sequence (SEQ ID NO:355) of a native sequence PRO269 cDNA, wherein SEQ ID NO:355 is a clone designated herein as “DNA38260-1180”.
- FIG. 356 shows the amino acid sequence (SEQ ID NO:356) derived from the coding sequence of SEQ ID NO:355 shown in FIG. 355.
- FIG. 357 shows a nucleotide sequence (SEQ ID NO:357) of a native sequence PRO285 cDNA, wherein SEQ ID NO:357 is a clone designated herein as “DNA40021-1154”.
- FIG. 358 shows the amino acid sequence (SEQ ID NO:358) derived from the coding sequence of SEQ ID NO:357 shown in FIG. 357.
- FIG. 359 shows a nucleotide sequence (SEQ ID NO:359) of a native sequence PRO328 cDNA, wherein SEQ ID NO:359 is a clone designated herein as “DNA40587-1231”.
- FIG. 360 shows the amino acid sequence (SEQ ID NO:360) derived from the coding sequence of SEQ ID NO:359 shown in FIG. 359.
- FIG. 361 shows a nucleotide sequence (SEQ ID NO:361) of a native sequence PRO344 cDNA, wherein SEQ ID NO:361 is a clone designated herein as “DNA40592-1242”.
- FIG. 362 shows the amino acid sequence (SEQ ID NO:362) derived from the coding sequence of SEQ ID NO:361 shown in FIG. 361.
- FIG. 363 shows a nucleotide sequence (SEQ ID NO:363) of a native sequence PRO272 cDNA, wherein SEQ ID NO:363 is a clone designated herein as “DNA40620-1183”.
- FIG. 364 shows the amino acid sequence (SEQ ID NO:364) derived from the coding sequence of SEQ ID NO:363 shown in FIG. 363.
- FIG. 365 shows a nucleotide sequence (SEQ ID NO:365) of a native sequence PRO301 cDNA, wherein SEQ ID NO:365 is a clone designated herein as “DNA40628-1216”.
- FIG. 366 shows the amino acid sequence (SEQ ID NO:366) derived from the coding sequence of SEQ ID NO:365 shown in FIG. 365.
- FIG. 367 shows a nucleotide sequence (SEQ ID NO:367) of a native sequence PRO331 cDNA, wherein SEQ ID NO:367 is a clone designated herein as “DNA40981-1234”.
- FIG. 368 shows the amino acid sequence (SEQ ID NO:368) derived from the coding sequence of SEQ ID NO:367 shown in FIG. 367.
- FIG. 369 shows a nucleotide sequence (SEQ ID NO:369) of a native sequence PRO332 cDNA, wherein SEQ ID NO:369 is a clone designated herein as “DNA40982-1235”.
- FIG. 370 shows the amino acid sequence (SEQ ID NO:370) derived from the coding sequence of SEQ ID NO:369 shown in FIG. 369.
- FIG. 371 shows a nucleotide sequence (SEQ ID NO:371) of a native sequence PRO353 cDNA, wherein SEQ ID NO:371 is a clone designated herein as “DNA41234-1242”.
- FIG. 372 shows the amino acid sequence (SEQ ID NO:372) derived from the coding sequence of SEQ ID NO:371 shown in FIG. 371.
- FIG. 373 shows a nucleotide sequence (SEQ ID NO:373) of a native sequence PRO310 cDNA, wherein SEQ ID NO:373 is a clone designated herein as “DNA43046-1225”.
- FIG. 374 shows the amino acid sequence (SEQ ID NO:374) derived from the coding sequence of SEQ ID NO:373 shown in FIG. 373.
- FIG. 375 shows a nucleotide sequence (SEQ ID NO:375) of a native sequence PRO337 cDNA, wherein SEQ ID NO:375 is a clone designated herein as “DNA43316-1237”.
- FIG. 376 shows the amino acid sequence (SEQ ID NO:376) derived from the coding sequence of SEQ ID NO:375 shown in FIG. 375.
- FIG. 377 shows a nucleotide sequence (SEQ ID NO:377) of a native sequence PRO346 cDNA, wherein SEQ ID NO:377 is a clone designated herein as “DNA44167-1243”.
- FIG. 378 shows the amino acid sequence (SEQ ID NO:378) derived from the coding sequence of SEQ ID NO:377 shown in FIG. 377.
- FIG. 379 shows a nucleotide sequence (SEQ ID NO:379) of a native sequence PRO350 cDNA, wherein SEQ ID NO:379 is a clone designated herein as “DNA44175-1314”.
- FIG. 380 shows the amino acid sequence (SEQ ID NO:380) derived from the coding sequence of SEQ ID NO:379 shown in FIG. 379.
- FIG. 381 shows a nucleotide sequence (SEQ ID NO:381) of a native sequence PRO526 cDNA, wherein SEQ ID NO:381 is a clone designated herein as “DNA44184-1319”.
- FIG. 382 shows the amino acid sequence (SEQ ID NO:382) derived from the coding sequence of SEQ ID NO:381 shown in FIG. 381.
- FIG. 383 shows a nucleotide sequence (SEQ ID NO:383) of a native sequence PRO381 cDNA, wherein SEQ ID NO:383 is a clone designated herein as “DNA44194-1317”.
- FIG. 384 shows the amino acid sequence (SEQ ID NO:384) derived from the coding sequence of SEQ ID NO:383 shown in FIG. 383.
- FIG. 385 shows a nucleotide sequence (SEQ ID NO:385) of a native sequence PRO846 cDNA, wherein SEQ ID NO:385 is a clone designated herein as “DNA44196-1353”.
- FIG. 386 shows the amino acid sequence (SEQ ID NO:386) derived from the coding sequence of SEQ ID NO:385 shown in FIG. 385.
- FIG. 387 shows a nucleotide sequence (SEQ ID NO:387) of a native sequence PRO363 cDNA, wherein SEQ ID NO:387 is a clone designated herein as “DNA45419-1252”.
- FIG. 388 shows the amino acid sequence (SEQ ID NO:388) derived from the coding sequence of SEQ ID NO:387 shown in FIG. 387.
- FIG. 389 shows a nucleotide sequence (SEQ ID NO:389) of a native sequence PRO3,65 cDNA, wherein SEQ ID NO:389 is a clone designated herein as “DNA46777-1253”.
- FIG. 390 shows the amino acid sequence (SEQ ID NO:390) derived from the coding sequence of SEQ ID NO:389 shown in FIG. 389.
- FIG. 391 shows a nucleotide sequence (SEQ ID NO:391) of a native sequence PRO1310 cDNA, wherein SEQ ID NO:391 is a clone designated herein as “DNA47394-1572”.
- FIG. 392 shows the amino acid sequence (SEQ ID NO:392) derived from the coding sequence of SEQ ID NO:391 shown in FIG. 391.
- FIG. 393 shows a nucleotide sequence (SEQ ID NO:393) of a native sequence PRO731 cDNA, wherein SEQ ID NO:393 is a clone designated herein as “DNA48331-1329”.
- FIG. 394 shows the amino acid sequence (SEQ ID NO:394) derived from the coding sequence of SEQ ID NO:393 shown in FIG. 393.
- FIG. 395 shows a nucleotide sequence (SEQ ID NO:395) of a native sequence PRO322 cDNA, wherein SEQ ID NO:395 is a clone designated herein as “DNA48336-1309”.
- FIG. 396 shows the amino acid sequence (SEQ ID NO:396) derived from the coding sequence of SEQ ID NO:395 shown in FIG. 395.
- FIG. 397 shows a nucleotide sequence (SEQ ID NO:397) of a native sequence PRO536 cDNA, wherein SEQ ID NO:397 is a clone designated herein as “DNA49142-1430”.
- FIG. 398 shows the amino acid sequence (SEQ ID NO:398) derived from the coding sequence of SEQ ID NO:397 shown in FIG. 397.
- FIG. 399 shows a nucleotide sequence (SEQ ID NO:399) of a native sequence PRO719 cDNA, wherein SEQ ID NO:399 is a clone designated herein as “DNA49646-1327”.
- FIG. 400 shows the amino acid sequence (SEQ ID NO:400) derived from the coding sequence of SEQ ID NO:399 shown in FIG. 399.
- FIG. 401 shows a nucleotide sequence (SEQ ID NO:401) of a native sequence PRO619 cDNA, wherein SEQ ID NO:401 is a clone designated herein as “DNA49821-1562”.
- FIG. 402 shows the amino acid sequence (SEQ ID NO:402) derived from the coding sequence of SEQ ID NO:401 shown in FIG. 401.
- FIG. 403 shows a nucleotide sequence (SEQ ID NO:403) of a native sequence PRO771 cDNA, wherein SEQ ID NO:403 is a clone designated herein as “DNA49829-1346”.
- FIG. 404 shows the amino acid sequence (SEQ ID NO:404) derived from the coding sequence of SEQ ID NO:403 shown in FIG. 403.
- FIG. 405 shows a nucleotide sequence (SEQ ID NO:405) of a native sequence PRO1083 cDNA, wherein SEQ ID NO:405 is a clone designated herein as “DNA50921-1458”.
- FIG. 406 shows the amino acid sequence (SEQ ID NO:406) derived from the coding sequence of SEQ ID NO:405 shown in FIG. 405.
- FIG. 407 shows a nucleotide sequence (SEQ ID NO:407) of a native sequence PRO862 cDNA, wherein SEQ ID NO:407 is a clone designated herein as “DNA52187-1354”.
- FIG. 408 shows the amino acid sequence (SEQ ID NO:408) derived from the coding sequence of SEQ ID NO:407 shown in FIG. 407.
- FIG. 409 shows a nucleotide sequence (SEQ ID NO:409) of a native sequence PRO733 cDNA, wherein SEQ ID NO:409 is a clone designated herein as “DNA52196-1348”.
- FIG. 410 shows the amino acid sequence (SEQ ID NO:410) derived from the coding sequence of SEQ ID NO:409 shown in FIG. 409.
- FIG. 411 shows a nucleotide sequence (SEQ ID NO:411) of a native sequence PRO1188 cDNA, wherein SEQ ID NO:411 is a clone designated herein as “DNA52598-1518”.
- FIG. 412 shows the amino acid sequence (SEQ ID NO:412) derived from the coding sequence of SEQ ID NO:411 shown in FIG. 411.
- FIG. 413 shows a nucleotide sequence (SEQ ID NO:413) of a native sequence PRO770 cDNA, wherein SEQ ID NO:413 is a clone designated herein as “DNA54228-1366”.
- FIG. 414 shows the amino acid sequence (SEQ ID NO:414) derived from the coding sequence of SEQ ID NO:413 shown in FIG. 413.
- FIG. 415 shows a nucleotide sequence (SEQ ID NO:415) of a native sequence PRO1080 cDNA, wherein SEQ ID NO:415 is a clone designated herein as “DNA56047-1456”.
- FIG. 416 shows the amino acid sequence (SEQ ID NO:416) derived from the coding sequence of SEQ ID NO:415 shown in FIG. 415.
- FIG. 417 shows a nucleotide sequence (SEQ ID NO:417) of a native sequence PRO1017 cDNA, wherein SEQ ID NO:417 is a clone designated herein as “DNA56112-1379”.
- FIG. 418 shows the amino acid sequence (SEQ ID NO:418) derived from the coding sequence of SEQ ID NO:417 shown in FIG. 417.
- FIG. 419 shows a nucleotide sequence (SEQ ID NO:419) of a native sequence PRO1016 cDNA, wherein SEQ ID NO:419 is a clone designated herein as “DNA56113-1378”.
- FIG. 420 shows the amino acid sequence (SEQ ID NO:420) derived from the coding sequence of SEQ ID NO:419 shown in FIG. 419.
- FIG. 421 shows a nucleotide sequence (SEQ ID NO:421) of a native sequence PRO792 cDNA, wherein SEQ ID NO:421 is a clone designated herein as “DNA56352-1358”.
- FIG. 422 shows the amino acid sequence (SEQ ID NO:422) derived from the coding sequence of SEQ ID NO:421 shown in FIG. 421.
- FIG. 423 shows a nucleotide sequence (SEQ ID NO:423) of a native sequence PRO938 cDNA, wherein SEQ ID NO:423 is a clone designated herein as “DNA56433-1406”.
- FIG. 424 shows the amino acid sequence (SEQ ID NO:424) derived from the coding sequence of SEQ ID NO:423 shown in FIG. 423.
- FIG. 425 shows a nucleotide sequence (SEQ ID NO:425) of a native sequence PRO1012 cDNA, wherein SEQ ID NO:425 is a clone designated herein as “DNA56439-1376”.
- FIG. 426 shows the amino acid sequence (SEQ ID NO:426) derived from the coding sequence of SEQ ID NO:425 shown in FIG. 425.
- FIG. 427 shows a nucleotide sequence (SEQ ID NO:427) of a native sequence PRO1008 cDNA, wherein SEQ ID NO:427 is a clone designated herein as “DNA57530-1375”.
- FIG. 428 shows the amino acid sequence (SEQ ID NO:428) derived from the coding sequence of SEQ ID NO:427 shown in FIG. 427.
- FIG. 429 shows a nucleotide sequence (SEQ ID NO:429) of a native sequence PRO1075 cDNA, wherein SEQ ID NO:429 is a clone designated herein as “DNA57689-1385”.
- FIG. 430 shows the amino acid sequence (SEQ ID NO:430) derived from the coding sequence of SEQ ID NO:429 shown in FIG. 429.
- FIG. 431 shows a nucleotide sequence (SEQ ID NO:431) of a native sequence PRO1007 cDNA, wherein SEQ ID NO:431 is a clone designated herein as “DNA57690-1374”.
- FIG. 432 shows the amino acid sequence (SEQ ID NO:432) derived from the coding sequence of SEQ ID NO:431 shown in FIG. 431.
- FIG. 433 shows a nucleotide sequence (SEQ ID NO:433) of a native sequence PRO1056 cDNA, wherein SEQ ID NO:433 is a clone designated herein as “DNA57693-1424”.
- FIG. 434 shows the amino acid sequence (SEQ ID NO:434) derived from the coding sequence of SEQ ID NO:433 shown in FIG. 433.
- FIG. 435 shows a nucleotide sequence (SEQ ID NO:435) of a native sequence PRO791 cDNA, wherein SEQ ID NO:435 is a clone designated herein as “DNA57838-1337”.
- FIG. 436 shows the amino acid sequence (SEQ ID NO:436) derived from the coding sequence of SEQ ID NO:435 shown in FIG. 435.
- FIG. 437 shows a nucleotide sequence (SEQ ID NO:437) of a native sequence PRO111 cDNA, wherein SEQ ID NO:437 is a clone designated herein as “DNA58721-1475”.
- FIG. 438 shows the amino acid sequence (SEQ ID NO:438) derived from the coding sequence of SEQ ID NO:437 shown in FIG. 437.
- FIG. 439 shows a nucleotide sequence (SEQ ID NO:439) of a native sequence PRO812 cDNA, wherein SEQ ID NO:439 is a clone designated herein as “DNA59205-1421”.
- FIG. 440 shows the amino acid sequence (SEQ ID NO:440) derived from the coding sequence of SEQ ID NO:439 shown in FIG. 439.
- FIG. 441 shows a nucleotide sequence (SEQ ID NO:441) of a native sequence PRO1066 cDNA, wherein SEQ ID NO:441 is a clone designated herein as “DNA59215-1425”.
- FIG. 442 shows the amino acid sequence (SEQ ID NO:442) derived from the coding sequence of SEQ ID NO:441 shown in FIG. 441.
- FIG. 443 shows a nucleotide sequence (SEQ ID NO:443) of a native sequence PRO1185 cDNA, wherein SEQ ID NO:443 is a clone designated herein as “DNA59220-1514”.
- FIG. 444 shows the amino acid sequence (SEQ ID NO:444) derived from the coding sequence of SEQ ID NO:443 shown in FIG. 443.
- FIG. 445 shows a nucleotide sequence (SEQ ID NO:445) of a native sequence PRO1031 cDNA, wherein SEQ ID NO:445 is a clone designated herein as “DNA59294-1381”.
- FIG. 446 shows the amino acid sequence (SEQ ID NO:446) derived from the coding sequence of SEQ ID NO:445 shown in FIG. 445.
- FIG. 447 shows a nucleotide sequence (SEQ ID NO:447) of a native sequence PRO1360 cDNA, wherein SEQ ID NO:447 is a clone designated herein as “DNA59488-1603”.
- FIG. 448 shows the amino acid sequence (SEQ ID NO:448) derived from the coding sequence of SEQ ID NO:447 shown in FIG. 447.
- FIG. 449 shows a nucleotide sequence (SEQ ID NO:449) of a native sequence PRO1309 cDNA, wherein SEQ ID NO:449 is a clone designated herein as “DNA59588-1571”.
- FIG. 450 shows the amino acid sequence (SEQ ID NO:450) derived from the coding sequence of SEQ ID NO:449 shown in FIG. 449.
- FIG. 451 shows a nucleotide sequence (SEQ ID NO:451) of a native sequence PRO1107 cDNA, wherein SEQ ID NO:451 is a clone designated herein as “DNA59606-1471”.
- FIG. 452 shows the amino acid sequence (SEQ ID NO:452) derived from the coding sequence of SEQ ID NO:451 shown in FIG. 451.
- FIG. 453 shows a nucleotide sequence (SEQ ID NO:453) of a native sequence PRO836 cDNA, wherein SEQ ID NO:453 is a clone designated herein as “DNA59620-1463 ”.
- FIG. 454 shows the amino acid sequence (SEQ ID NO:454) derived from the coding sequence of SEQ ID NO:453 shown in FIG. 453.
- FIG. 455 shows a nucleotide sequence (SEQ ID NO:455) of a native sequence PROL 132 cDNA, wherein SEQ ID NO:455 is a clone designated herein as “DNA59767-1489”.
- FIG. 456 shows the amino acid sequence (SEQ ID NO:456) derived from the coding sequence of SEQ ID NO:455 shown in FIG. 455.
- FIG. 457 shows a nucleotide sequence (SEQ ID NO:457) of a native sequence PRO1131 cDNA, wherein SEQ ID NO:457 is a clone designated herein as “DNA59777-1480”.
- FIG. 458 shows the amino acid sequence (SEQ ID NO:458) derived from the coding sequence of SEQ ID NO:457 shown in FIG. 457.
- FIG. 459 shows a nucleotide sequence (SEQ ID NO:459) of a native sequence PRO1130 cDNA, wherein SEQ ID NO:459 is a clone designated herein as “DNA59814-1486”.
- FIG. 460 shows the amino acid sequence (SEQ ID NO:460) derived from the coding sequence of SEQ ID NO:459 shown in FIG. 459.
- FIG. 461 shows a nucleotide sequence (SEQ ID NO:461) of a native sequence PRO844 cDNA, wherein SEQ ID NO:461 is a clone designated herein as “DNA59839-1461”.
- FIG. 462 shows the amino acid sequence (SEQ ID NO:462) derived from the coding sequence of SEQ ID NO:461 shown in FIG. 461.
- FIG. 463 shows a nucleotide sequence (SEQ ID NO:463) of a native sequence PRO1154 cDNA, wherein SEQ ID NO:463 is a clone designated herein as “DNA59846-1503”.
- FIG. 464 shows the amino acid sequence (SEQ ID NO:464) derived from the coding sequence of SEQ ID NO:463 shown in FIG. 463.
- FIG. 465 shows a nucleotide sequence (SEQ ID NO:465) of a native sequence PRO1181 cDNA, wherein SEQ ID NO:465 is a clone designated herein as “DNA59847-1511”.
- FIG. 466 shows the amino acid sequence (SEQ ID NO:466) derived from the coding sequence of SEQ ID NO:465 shown in FIG. 465.
- FIG. 467 shows a nucleotide sequence (SEQ ID NO:467) of a native sequence PRO1126 cDNA, wherein SEQ ID NO:467 is a clone designated herein as “DNA60615-1483”.
- FIG. 468 shows the amino acid sequence (SEQ ID NO:468) derived from the coding sequence of SEQ ID NO:467 shown in FIG. 467.
- FIG. 469 shows a nucleotide sequence (SEQ ID NO:469) of a native sequence PRO1186 cDNA, wherein SEQ ID NO:469 is a clone designated herein as “DNA60621-1516”.
- FIG. 470 shows the amino acid sequence (SEQ ID NO:470) derived from the coding sequence of SEQ ID NO:469 shown in FIG. 469.
- FIG. 471 shows a nucleotide sequence (SEQ ID NO:471) of a native sequence PRO1198 cDNA, wherein SEQ ID NO:471 is a clone designated herein as “DNA60622-1525”.
- FIG. 472 shows the amino acid sequence (SEQ ID NO:472) derived from the coding sequence of SEQ ID NO:471 shown in FIG. 471.
- FIG. 473 shows a nucleotide sequence (SEQ ID NO:473) of a native sequence PRO1159 cDNA, wherein SEQ ID NO:473 is a clone designated herein as “DNA60627-1508”.
- FIG. 474 shows the amino acid sequence (SEQ ID NO:474) derived from the coding sequence of SEQ ID NO:473 shown in FIG. 473.
- FIG. 475 shows a nucleotide sequence (SEQ ID NO:475) of a native sequence PRO1265 cDNA, wherein SEQ ID NO:475 is a clone designated herein as “DNA60764-1533”.
- FIG. 476 shows the amino acid sequence (SEQ ID NO:476) derived from the coding sequence of SEQ ID NO:475 shown in FIG. 475.
- FIG. 477 shows a nucleotide sequence (SEQ ID NO:477) of a native sequence PRO1250 cDNA, wherein SEQ ID NO:477 is a clone designated herein as “DNA60775-1532”.
- FIG. 478 shows the amino acid sequence (SEQ ID NO:478) derived from the coding sequence of SEQ ID NO:477 shown in FIG. 477.
- FIG. 479 shows a nucleotide sequence (SEQ ID NO:479) of a native sequence PRO1475 cDNA, wherein SEQ ID NO:479 is a clone designated herein as “DNA61185-1646”.
- FIG. 480 shows the amino acid sequence (SEQ ID NO:480) derived from the coding sequence of SEQ ID NO:479 shown in FIG. 479.
- FIG. 481 shows a nucleotide sequence (SEQ ID NO:481) of a native sequence PRO1312 cDNA, wherein SEQ ID NO:481 is a clone designated herein as “DNA61873-1574”.
- FIG. 482 shows the amino acid sequence (SEQ ID NO:482) derived from the coding sequence of SEQ ID NO:481 shown in FIG. 481.
- FIG. 483 shows a nucleotide sequence (SEQ ID NO:483) of a native sequence PRO1308 cDNA, wherein SEQ ID NO:483 is a clone designated herein as “DNA62306-1570”.
- FIG. 484 shows the amino acid sequence (SEQ ID NO:484) derived from the coding sequence of SEQ ID NO:483 shown in FIG. 483.
- FIG. 485 shows a nucleotide sequence (SEQ ID NO:485) of a native sequence PRO1326 cDNA, wherein SEQ ID NO:485 is a clone designated herein as “DNA62808-1582”.
- FIG. 486 shows the amino acid sequence (SEQ ID NO:486) derived from the coding sequence of SEQ ID NO:485 shown in FIG. 485.
- FIG. 487 shows a nucleotide sequence (SEQ ID NO:487) of a native sequence PRO1192 cDNA, wherein SEQ ID NO:487 is a clone designated herein as “DNA62814-1521 ”.
- FIG. 488 shows the amino acid sequence (SEQ ID NO:488) derived from the coding sequence of SEQ ID NO:487 shown in FIG. 487.
- FIG. 489 shows a nucleotide sequence (SEQ ID NO:489) of a native sequence PRO1246 cDNA, wherein SEQ ID NO:489 is a clone designated herein as “DNA64885-1529”.
- FIG. 490 shows the amino acid sequence (SEQ ID NO:490) derived from the coding sequence of SEQ ID NO:489 shown in FIG. 489.
- FIG. 491 shows a nucleotide sequence (SEQ ID NO:491) of a native sequence PRO1356 cDNA, wherein SEQ ID NO:491 is a clone designated herein as “DNA64886-1601”.
- FIG. 492 shows the amino acid sequence (SEQ ID NO:492) derived from the coding sequence of SEQ ID NO:491 shown in FIG. 491.
- FIG. 493 shows a nucleotide sequence (SEQ ID NO:493) of a native sequence PRO1275 cDNA, wherein SEQ ID NO:493 is a clone designated herein as “DNA64888-1542”.
- FIG. 494 shows the amino acid sequence (SEQ ID NO:494) derived from the coding sequence of SEQ ID NO:493 shown in FIG. 493.
- FIG. 495 shows a nucleotide sequence (SEQ ID NO:495) of a native sequence PRO1274 cDNA, wherein SEQ ID NO:495 is a clone designated herein as “DNA64889-1541”.
- FIG. 496 shows the amino acid sequence (SEQ ID NO:496) derived from the coding sequence of SEQ ID NO:495 shown in FIG. 495.
- FIG. 497 shows a nucleotide sequence (SEQ ID NO:497) of a native sequence PRO1358 cDNA, wherein SEQ ID NO:497 is a clone designated herein as “DNA64890-1612”.
- FIG. 498 shows the amino acid sequence (SEQ ID NO:498) derived from the coding sequence of SEQ ID NO:497 shown in FIG. 497.
- FIG. 499 shows a nucleotide sequence (SEQ ID NO:499) of a native sequence PRO1286 cDNA, wherein SEQ ID NO:499 is a clone designated herein as “DNA64903-1553”.
- FIG. 500 shows the amino acid sequence (SEQ ID NO:500) derived from the coding sequence of SEQ ID NO:499 shown in FIG. 499.
- FIG. 501 shows a nucleotide sequence (SEQ ID NO:501) of a native sequence PRO1294 cDNA, wherein SEQ ID NO:501 is a clone designated herein as “DNA64905-1558”.
- FIG. 502 shows the amino acid sequence (SEQ ID NO:502) derived from the coding sequence of SEQ ID NO:501 shown in FIG. 501.
- FIG. 503 shows a nucleotide sequence (SEQ ID NO:503) of a native sequence PRO1273 cDNA, wherein SEQ ID NO:503 is a clone designated herein as “DNA65402-1540”.
- FIG. 504 shows the amino acid sequence (SEQ ID NO:504) derived from the coding sequence of SEQ ID NO:503 shown in FIG. 503.
- FIG. 505 shows a nucleotide sequence (SEQ ID NO:505) of a native sequence PRO1279 cDNA, wherein SEQ ID NO:505 is a clone designated herein as “DNA65405-1547”.
- FIG. 506 shows the amino acid sequence (SEQ ID NO:506) derived from the coding sequence of SEQ ID NO:505 shown in FIG. 505.
- FIG. 507 shows a nucleotide sequence (SEQ ID NO:507) of a native sequence PRO1195 cDNA, wherein SEQ ID NO:507 is a clone designated herein as “DNA65412-1523 ”.
- FIG. 508 shows the amino acid sequence (SEQ ID NO:508) derived from the coding sequence of SEQ ID NO:507 shown in FIG. 507.
- FIG. 509 shows a nucleotide sequence (SEQ ID NO:509) of a native sequence PRO1271 cDNA, wherein SEQ ID NO:509 is a clone designated herein as “DNA66309-1538”.
- FIG. 510 shows the amino acid sequence (SEQ ID NO:510) derived from the coding sequence of SEQ ID NO:509 shown in FIG. 509.
- FIG. 511 shows a nucleotide sequence (SEQ ID NO:511) of a native sequence PRO1338 cDNA, wherein SEQ ID NO:511 is a clone designated herein as “DNA66667-1596”.
- FIG. 512 shows the amino acid sequence (SEQ ID NO:512) derived from the coding sequence of SEQ ID NO:511 shown in FIG. 511.
- FIG. 513 shows a nucleotide sequence (SEQ ID NO:513) of a native sequence PRO1343 cDNA, wherein SEQ ID NO:513 is a clone designated herein as “DNA66675-1587”.
- FIG. 514 shows the amino acid sequence (SEQ ID NO:514) derived from the coding sequence of SEQ ID NO:513 shown in FIG. 513.
- FIG. 515 shows a nucleotide sequence (SEQ ID NO:515) of a native sequence PRO1434 cDNA, wherein SEQ ID NO:515 is a clone designated herein as “DNA68818-2536”.
- FIG. 516 shows the amino acid sequence (SEQ ID NO:516) derived from the coding sequence of SEQ ID NO:515 shown in FIG. 515.
- FIG. 517 shows a nucleotide sequence (SEQ ID NO:517) of a native sequence PRO1418 cDNA, wherein SEQ ID NO:517 is a clone designated herein as “DNA68864-1629”.
- FIG. 518 shows the amino acid sequence (SEQ ID NO:518) derived from the coding sequence of SEQ ID NO:517 shown in FIG. 517.
- FIG. 519 shows a nucleotide sequence (SEQ ID NO:519) of a native sequence PRO1387 cDNA, wherein SEQ ID NO:519 is a clone designated herein as “DNA68872-1620”.
- FIG. 520 shows the amino acid sequence (SEQ ID NO:520) derived from the coding sequence of SEQ ID NO:519 shown in FIG. 519.
- FIG. 521 shows a nucleotide sequence (SEQ ID NO:521) of a native sequence PRO1384 cDNA, wherein SEQ ID NO:521 is a clone designated herein as “DNA71159-1617”.
- FIG. 522 shows the amino acid sequence (SEQ ID NO:522) derived from the coding sequence of SEQ ID NO:521 shown in FIG. 521.
- FIG. 523 shows a nucleotide sequence (SEQ ID NO:523) of a native sequence PRO1565 cDNA, wherein SEQ ID NO:523 is a clone designated herein as “DNA73727-1673”.
- FIG. 524 shows the amino acid sequence (SEQ ID NO:524) derived from the coding sequence of SEQ ID NO:523 shown in FIG. 523.
- FIG. 525 shows a nucleotide sequence (SEQ ID NO:525) of a native sequence PRO1474 cDNA, wherein SEQ ID NO:525 is a clone designated herein as “DNA73739-1645”.
- FIG. 526 shows the amino acid sequence (SEQ ID NO:526) derived from the coding sequence of SEQ ID NO:525 shown in FIG. 525.
- FIG. 527 shows a nucleotide sequence (SEQ ID NO:527) of a native sequence PRO1917 cDNA, wherein SEQ ID NO:527 is a clone designated herein as “DNA76400-2528”.
- FIG. 528 shows the amino acid sequence (SEQ ID NO:528) derived from the coding sequence of SEQ ID NO:527 shown in FIG. 527.
- FIG. 529 shows a nucleotide sequence (SEQ ID NO:529) of a native sequence PRO1787 cDNA, wherein SEQ ID NO:529 is a clone designated herein as “DNA76510-2504”.
- FIG. 530 shows the amino acid sequence (SEQ ID NO:530) derived from the coding sequence of SEQ ID NO:529 shown in FIG. 529.
- FIG. 531 shows a nucleotide sequence (SEQ ID NO:531) of a native sequence PRO1556 cDNA, wherein SEQ ID NO:531 is a clone designated herein as “DNA76529-1666”.
- FIG. 532 shows the amino acid sequence (SEQ ID NO:532) derived from the coding sequence of SEQ ID NO:531 shown in FIG. 531.
- FIG. 533 shows a nucleotide sequence (SEQ ID NO:533) of a native sequence PRO1561 cDNA, wherein SEQ ID NO:533 is a clone designated herein as “DNA76538-1670”.
- FIG. 534 shows the amino acid sequence (SEQ ID NO:534) derived from the coding sequence of SEQ ID NO:533 shown in FIG. 533.
- FIG. 535 shows a nucleotide sequence (SEQ ID NO:535) of a native sequence PRO1693 cDNA, wherein SEQ ID NO:535 is a clone designated herein as “DNA77301-1708”.
- FIG. 536 shows the amino acid sequence (SEQ ID NO:536) derived from the coding sequence of SEQ ID NO:535 shown in FIG. 535.
- FIG. 537 shows a nucleotide sequence (SEQ ID NO:537) of a native sequence PRO1868 cDNA, wherein SEQ ID NO:537 is a clone designated herein as “DNA77624-2515”.
- FIG. 538 shows the amino acid sequence (SEQ ID NO:538) derived from the coding sequence of SEQ ID NO:537 shown in FIG. 537.
- FIG. 539 shows a nucleotide sequence (SEQ ID NO:539) of a native sequence PRO1890 cDNA, wherein SEQ ID NO:539 is a clone designated herein as “DNA79230-2525”.
- FIG. 540 shows the amino acid sequence (SEQ ID NO:540) derived from the coding sequence of SEQ ID NO:539 shown in FIG. 539.
- FIG. 541 shows a nucleotide sequence (SEQ ID NO:541) of a native sequence PRO1887 cDNA, wherein SEQ ID NO:541 is a clone designated herein as “DNA79862-2522”.
- FIG. 542 shows the amino acid sequence (SEQ ID NO:542) derived from the coding sequence of SEQ ID NO:541 shown in FIG. 541.
- FIG. 543 shows a nucleotide sequence (SEQ ID NO:543) of a native sequence PRO4353 cDNA, wherein SEQ ID NO:543 is a clone designated herein as “DNA80145-2594”.
- FIG. 544 shows the amino acid sequence (SEQ ID NO:544) derived from the coding sequence of SEQ ID NO:543 shown in FIG. 543.
- FIG. 545 shows a nucleotide sequence (SEQ ID NO:545) of a native sequence PRO1801 cDNA, wherein SEQ ID NO:545 is a clone designated herein as “DNA83500-2506”.
- FIG. 546 shows the amino acid sequence (SEQ ID NO:546) derived from the coding sequence of SEQ ID NO:545 shown in FIG. 545.
- FIG. 547 shows a nucleotide sequence (SEQ ID NO:547) of a native sequence PRO4357 cDNA, wherein SEQ ID NO:547 is a clone designated herein as “DNA84917-2597”.
- FIG. 548 shows the amino acid sequence (SEQ ID NO:548) derived from the coding sequence of SEQ ID NO:547 shown in FIG. 547.
- FIG. 549 shows a nucleotide sequence (SEQ ID NO:549) of a native sequence PRO4302 cDNA, wherein SEQ ID NO:549 is a clone designated herein as “DNA92218-2554”.
- FIG. 550 shows the amino acid sequence (SEQ ID NO:550) derived from the coding sequence of SEQ ID NO:549 shown in FIG. 549.
- I. Definitions
- The terms “PRO polypeptide” and “PRO” as used herein and when immediately followed by a numerical designation refer to various polypeptides, wherein the complete designation (i.e., PRO/number) refers to specific polypeptide sequences as described herein. The terms “PRO/number polypeptide” and “PRO/number” wherein the term “number” is provided as an actual numerical designation as used herein encompass native sequence polypeptides and polypeptide variants (which are further defined herein). The PRO polypeptides described herein may be isolated from a variety of sources, such as from human tissue types or from another source, or prepared by recombinant or synthetic methods. The term “PRO polypeptide” refers to each individual PRO/number polypeptide disclosed herein. All disclosures in this specification which refer to the “PRO polypeptide” refer to each of the polypeptides individually as well as jointly. For example, descriptions of the preparation of, purification of, derivation of, formation of antibodies to or against, administration of, compositions containing, treatment of a disease with, etc., pertain to each polypeptide of the invention individually. The term “PRO polypeptide” also includes variants of the PRO/number polypeptides disclosed herein.
- A “native sequence PRO polypeptide” comprises a polypeptide having the same amino acid sequence as the corresponding PRO polypeptide derived from nature. Such native sequence PRO polypeptides can be isolated from nature or can be produced by recombinant or synthetic means. The term “native sequence PRO polypeptide” specifically encompasses naturally-occurring truncated or secreted forms of the specific PRO polypeptide (e.g., an extracellular domain sequence), naturally-occurring variant forms (e.g., alternatively spliced forms) and naturally-occurring allelic variants of the polypeptide. In various embodiments of the invention, the native sequence PRO polypeptides disclosed herein are mature or full-length native sequence polypeptides comprising the full-length amino acids sequences shown in the accompanying figures. Start and stop codons are shown in bold font and underlined in the figures. However, while the PRO polypeptide disclosed in the accompanying figures are shown to begin with methionine residues designated herein as
amino acid position 1 in the figures, it is conceivable and possible that other methionine residues located either upstream or downstream from theamino acid position 1 in the figures may be employed as the starting amino acid residue for the PRO polypeptides. - The PRO polypeptide “extracellular domain” or “ECD” refers to a form of the PRO polypeptide which is essentially free of the transmembrane and cytoplasmic domains. Ordinarily, a PRO polypeptide ECD will have less than 1% of such transmembrane and/or cytoplasmic domains and preferably, will have less than 0.5% of such domains. It will be understood that any transmembrane domains identified for the PRO polypeptides of the present invention are identified pursuant to criteria routinely employed in the art for identifying that type of hydrophobic domain. The exact boundaries of a transmembrane domain may vary but most likely by no more than about 5 amino acids at either end of the domain as initially identified herein. Optionally, therefore, an extracellular domain of a PRO polypeptide may contain from about 5 or fewer amino acids on either side of the transmembrane domain/extracellular domain boundary as identified in the Examples or specification and such polypeptides, with or without the associated signal peptide, and nucleic acid encoding them, are comtemplated by the present invention.
- The approximate location of the “signal peptides” of the various PRO polypeptides disclosed herein are shown in the present specification and/or the accompanying figures. It is noted, however, that the C-terminal boundary of a signal peptide may vary, but most likely by no more than about 5 amino acids on either side of the signal peptide C-termiinal boundary as initially identified herein, wherein the C-terminal boundary of the signal peptide may be identified pursuant to criteria routinely employed in the art for identifying that type of amino acid sequence element (e.g., Nielsen et al.,Prot. Eng. 10:1-6 (1997) and von Heinje et al., Nucl. Acids. Res. 14:4683-4690 (1986)). Moreover, it is also recognized that, in some cases, cleavage of a signal sequence from a secreted polypeptide is not entirely uniform, resulting in more than one secreted species. These mature polypeptides, where the signal peptide is cleaved within no more than about 5 amino acids on either side of the C-terminal boundary of the signal peptide as identified herein, and the polynucleotides encoding them, are contemplated by the present invention.
- “PRO polypeptide variant” means an active PRO polypeptide as defined above or below having at least about 80% amino acid sequence identity with a full-length native sequence PRO polypeptide sequence as disclosed herein, a PRO polypeptide sequence lacking the signal peptide as disclosed herein, an extracellular domain of a PRO polypeptide, with or without the signal peptide, as disclosed herein or any other fragment of a full-length PRO polypeptide sequence as disclosed herein. Such PRO polypeptide variants include, for instance, PRO polypeptides wherein one or more amino acid residues are added, or deleted, at the N- or C-terminus of the full-length native amino acid sequence. Ordinarily, a PRO polypeptide variant will have at least about 80% amino acid sequence identity, alternatively at least about 81% amino acid sequence identity, alternatively at least about 82% amino acid sequence identity, alternatively at least about 83% amino acid sequence identity, alternatively at least about 84% amino acid sequence identity, alternatively at least about 85% amino acid sequence identity, alternatively at least about 86% amino acid sequence identity, alternatively at least about 87% amino acid sequence identity, alternatively at least about 88% amino acid sequence identity, alternatively at least about 89% amino acid sequence identity, alternatively at least about 90% amino acid sequence identity, alternatively at least about 91% amino acid sequence identity, alternatively at least about 92% amino acid sequence identity, alternatively at least about 93% amino acid sequence identity, alternatively at least about 94% amino acid sequence identity, alternatively at least about 95% amino acid sequence identity, alternatively at least about 96% amino acid sequence identity, alternatively at least about 97% amino acid sequence identity, alternatively at least about 98% amino acid sequence identity and alternatively at least about 99% amino acid sequence identity to a full-length native sequence PRO polypeptide sequence as disclosed herein, a PRO polypeptide sequence lacking the signal peptide as disclosed herein, an extracellular domain of a PRO polypeptide, with or without the signal peptide, as disclosed herein or any other specifically defined fragment of a full-length PRO polypeptide sequence as disclosed herein. Ordinarily, PRO variant polypeptides are at least about 10 amino acids in length, alternatively at least about 20 amino acids in length, alternatively at least about 30 amino acids in length, alternatively at least about 40 amino acids in length, alternatively at least about 50 amino acids in length, alternatively at least about 60 amino acids in length, alternatively at least about 70 amino acids in length, alternatively at least about 80 amino acids in length, alternatively at least about 90 amino acids in length, alternatively at least about 100 amino acids in length, alternatively at least about 150 amino acids in length, alternatively at least about 200 amino acids in length, alternatively at least about 300 amino acids in length, or more.
- “Percent (%) amino acid sequence identity” with respect to the PRO polypeptide sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific PRO polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2, wherein the complete source code for the ALIGN-2 program is provided in Table 1 below. The ALIGN-2 sequence comparison computer program was authored by Genentech, Inc. and the source code shown in Table 1 below has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087. The ALIGN-2 program is publicly available through Genentech, Inc., South San Francisco, Calif. or may be compiled from the source code provided in Table 1 below. The ALIGN-2 program should be compiled for use on a UNIX operating system, preferably digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
- In situations where ALIGN-2 is employed for amino acid sequence comparisons, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows:
- 100 times the fraction X/Y
- where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A. As examples of % amino acid sequence identity calculations using this method, Tables 2 and 3 demonstrate how to calculate the % amino acid sequence identity of the amino acid sequence designated “Comparison Protein” to the amino acid sequence designated “PRO”, wherein “PRO” represents the amino acid sequence of a hypothetical PRO polypeptide of interest, “Comparison Protein” represents the amino acid sequence of a polypeptide against which the “PRO” polypeptide of interest is being compared, and “X, “Y” and “Z” each represent different hypothetical amino acid residues.
- Unless specifically stated otherwise, all % amino acid sequence identity values used herein are obtained as described in the immediately preceding paragraph using the ALIGN-2 computer program. However, % amino acid sequence identity values may also be obtained as described below by using the WU-BLAST-2 computer program (Altschul et al.,Methods in Enzymology 266:460-480 (1996)). Most of the WU-BLAST-2 search parameters are set to the default values. Those not set to default values, i.e., the adjustable parameters, are set with the following values: overlap span=1, overlap fraction=0.125, word threshold (MI)=11, and scoring matrix=BLOSUM62. When WU-BLAST-2 is employed, a % amino acid sequence identity value is determined by dividing (a) the number of matching identical amino acid residues between the amino acid sequence of the PRO polypeptide of interest having a sequence derived from the native PRO polypeptide and the comparison amino acid sequence of interest (i.e., the sequence against which the PRO polypeptide of interest is being compared which may be a PRO variant polypeptide) as determined by WU-BLAST-2 by (b) the total number of amino acid residues of the PRO polypeptide of interest. For example, in the statement “a polypeptide comprising an the amino acid sequence A which has or having at least 80% amino acid sequence identity to the amino acid sequence B”, the amino acid sequence A is the comparison amino acid sequence of interest and the amino acid sequence B is the amino acid sequence of the PRO polypeptide of interest.
- Percent amino acid sequence identity may also be determined using the sequence comparison program NCBI-BLAST2 (Altschul et al.,Nucleic Acids Res. 25:3389-3402 (1997)). The NCBI-BLAST2 sequence comparison program may be downloaded from http://www.ncbi.nlm.nih.gov or otherwise obtained from the National Institute of Health, Bethesda, Md. NCBI-BLAST2 uses several search parameters, wherein all of those search parameters are set to default values including, for example, unmask=yes, strand=all, expected occurrences=10, minimum low complexity length=15/5, multi-pass e-value=0.01, constant for multi-pass=25, dropoff for final gapped alignment=25 and scoring matrix=BLOSUM62.
- In situations where NCBI-BLAST2 is employed for amino acid sequence comparisons, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows:
- 100 times the fraction X/Y
- where X is the number of amino acid residues scored as identical matches by the sequence alignment program NCBI-BLAST2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A.
- “PRO variant polynucleotide” or “PRO variant nucleic acid sequence” means a nucleic acid molecule which encodes an active PRO polypeptide as defined below and which has at least about 80% nucleic acid sequence identity with a nucleotide acid sequence encoding a full-length native sequence PRO polypeptide sequence as disclosed herein, a full-length native sequence PRO polypeptide sequence lacking the signal peptide as disclosed herein, an extracellular domain of a PRO polypeptide, with or without the signal peptide, as disclosed herein or any other fragment of a full-length PRO polypeptide sequence as disclosed herein. Ordinarily, a PRO variantpolynucleotide will have at least about 80% nucleic acid sequence identity, alternatively at least about 81% nucleic acid sequence identity, alternatively at least about 82% nucleic acid sequence identity, alternatively at least about 83% nucleic acid sequence identity, alternatively at least about 84% nucleic acid sequence identity, alternatively at least about 85% nucleic acid sequence identity, alternatively at least about 86% nucleic acid sequence identity, alternatively at least about 87% nucleic acid sequence identity, alternatively at least about 88% nucleic acid sequence identity, alternatively at least about 89% nucleic acid sequence identity, alternatively at least about 90% nucleic acid sequence identity, alternatively at least about 91% nucleic acid sequence identity, alternatively at least about 92% nucleic acid sequence identity, alternatively at least about 93% nucleic acid sequence identity, alternatively at least about 94% nucleic acid sequence identity, alternatively at least about 95% nucleic acid sequence identity, alternatively at least about 96% nucleic acid sequence identity, alternatively at least about 97% nucleic acid sequence identity, alternatively at least about 98% nucleic acid sequence identity and alternatively at least about 99% nucleic acid sequence identity with a nucleic acid sequence encoding a full-length native sequence PRO polypeptide sequence as disclosed herein, a full-length native sequence PRO polypeptide sequence lacking the signal peptide as disclosed herein, an extracellular domain of a PROpolypeptide, with or without the signal sequence, as disclosed herein or any other fragment of a full-length PRO polypeptide sequence as disclosed herein. Variants do not encompass the native nucleotide sequence.
- Ordinarily, PRO variant polynucleotides are at least about 30 nucleotides in length, alternatively at least about 60 nucleotides in length, alternatively at least about 90 nucleotides in length, alternatively at least about 120 nucleotides in length, alternatively at least about 150 nucleotides in length, alternatively at least about 180 nucleotides in length, alternatively at least about 210 nucleotides in length, alternatively at least about 240 nucleotides in length, alternatively at least about 270 nucleotides in length, alternatively at least about 300 nucleotides in length, alternatively at least about 450 nucleotides in length, alternatively at least about 600 nucleotides in length, alternatively at least about 900 nucleotides in length, or more.
- “Percent (%) nucleic acid sequence identity” with respect to PRO-encoding nucleic acid sequences identified herein is defined as the percentage of nucleotides in a candidate sequence that are identical with the nucleotides in the PRO nucleic acid sequence of interest, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent nucleic acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. For purposes herein, however, % nucleic acid sequence identity values are generated using the sequence comparison computer program ALIGN-2, wherein the complete source code for the ALIGN-2 program is provided in Table 1 below. The ALIGN-2 sequence comparison computer program was authored by Genentech, Inc. and the source code shown in Table 1 below has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No.
- TXU510087. The ALIGN-2 program is publicly available through Genentech, Inc., South San Francisco, Calif. or may be compiled from the source code provided in Table 1 below. The ALIGN-2 program should be compiled for use on a UNIX operating system, preferably digital UNIX V4.OD. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
- In situations where ALIGN-2 is employed for nucleic acid sequence comparisons, the % nucleic acid sequence identity of a given nucleic acid sequence C to, with, or against a given nucleic acid sequence D (which can alternatively be phrased as a given nucleic acid sequence C that has or comprises a certain % nucleic acid sequence identity to, with, or against a given nucleic acid sequence D) is calculated as follows:
- 100 times the fraction W/Z
- where W is the number of nucleotides scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of C and D, and where Z is the total number of nucleotides in D. It will be appreciated that where the length of nucleic acid sequence C is not equal to the length of nucleic acid sequence D, the % nucleic acid sequence identity of C to D will not equal the % nucleic acid sequence identity of D to C. As examples of % nucleic acid sequence identity calculations, Tables 4 and 5, demonstrate how to calculate the % nucleic acid sequence identity of the nucleic acid sequence designated “Comparison DNA” to the nucleic acid sequence designated “PRO-DNA”, wherein “PRO-DNA” represents a hypothetical PRO-encoding nucleic acid sequence of interest, “Comparison DNA” represents the nucleotide sequence of a nucleic acid molecule against which the “PRO-DNA” nucleic acid molecule of interest is being compared, and “N”, “L” and “V” each represent different hypothetical nucleotides.
- Unless specifically stated otherwise, all % nucleic acid sequence identity values used herein are obtained as described in the immediately preceding paragraph using the ALIGN-2 computer program. However, % nucleic acid sequence identity values may also be obtained as described below by using the WU-BLAST-2 computer program (Altschul et al.,Methods in Enzymology 266:460480 (1996)). Most of the WU-BLAST-2 search parameters are set to the default values. Those not set to default values, i.e., the adjustable parameters, are set with the following values: overlap span=1, overlap fraction=0.125, word threshold (T)=11, and scoring matrix=BLOSUM62. When WU-BLAST-2 is employed, a % nucleic acid sequence identity value is determined by dividing (a) the number of matching identical nucleotides between the nucleic acid sequence of the PRO polypeptide-encoding nucleic acid molecule of interest having a sequence derived from the native sequence PRO polypeptide-encoding nucleic acid and the comparison nucleic acid molecule of interest (i.e., the sequence against which the PRO polypeptide-encoding nucleic acid molecule of interest is being compared which may be a variant PRO polynucleotide) as determined by WU-BLAST-2 by (b) the total number of nucleotides of the PRO polypeptide-encoding nucleic acid molecule of interest. For example, in the statement “an isolated nucleic acid molecule comprising a nucleic acid sequence A which has or having at least 80% nucleic acid sequence identity to the nucleic acid sequence B”, the nucleic acid sequence A is the comparison nucleic acid molecule of interest and the nucleic acid sequence B is the nucleic acid sequence of the PRO polypeptide-encoding nucleic acid molecule of interest.
- Percent nucleic acid sequence identity may also be determined using the sequence comparison program NCBI-BLAST2 (Altschul et al.,Nucleic Acids Res. 25:3389-3402 (1997)). The NCBI-BLAST2 sequence comparison program may be downloaded from http://www.ncbi.nlm.nih.gov or otherwise obtained from the National Institute of Health, Bethesda, MD. NCBI-BLAST2 uses several search parameters, wherein all of those search parameters are set to default values including, for example, unmask=yes, strand=all, expected occurrences=10, minimum low complexity length=15/5, multi-pass e-value=0.01, constant for multi-pass=25, dropoff for final gapped alignment=25 and scoring matrix=BLOSUM62.
- In situations where NCBI-BLAST2 is employed for sequence comparisons, the % nucleic acid sequence identity of a given nucleic acid sequence C to, with, or against a given nucleic acid sequence D (which can alternatively be phrased as a given nucleic acid sequence C that has or comprises a certain % nucleic acid sequence identity to, with, or against a given nucleic acid sequence D) is calculated as follows:
- 100 times the fraction W/Z
- where W is the number of nucleotides scored as identical matches by the sequence alignment program NCBI-BLAST2 in that program's alignment of C and D, and where Z is the total number of nucleotides in D. It will be appreciated that where the length of nucleic acid sequence C is not equal to the length of nucleic acid sequence D, the % nucleic acid sequence identity of C to D will not equal the % nucleic acid sequence identity of D to C.
- In other embodiments, PRO variant polynucleotides are nucleic acid molecules that encode an active PRO polypeptide and which are capable of hybridizing, preferably under stringent hybridization and wash conditions, to nucleotide sequences encoding a full-length PRO polypeptide as disclosed herein. PRO variant polypeptides may be those that are encoded by a PRO variant polynucleofide.
- “Isolated,” when used to describe the various polypeptides disclosed herein, means polypeptide that has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials that would typically interfere with diagnostic or therapeutic uses for the polypeptide, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes. In preferred embodiments, the polypeptide will be purified (1) to a degree sufficient to obtain at least 15 residues of N-terminal orintemal amino acid sequence by use of a spinning cup sequenator, or (2) to homogeneity by SDS-PAGE under non-reducing or reducing conditions using Coomassie blue or, preferably, silver stain. Isolated polypeptide includes polypeptide in situ within recombinant cells, since at least one component of the PRO polypeptide natural environment will not be present. Ordinarily, however, isolated polypeptide will be prepared by at least one purification step.
- An “isolated” PRO polypeptide-encoding nucleic acid or other polypeptide-encoding nucleic acid is a nucleic acid molecule that is identified and separated from at least onecontaminant nucleic acid molecule with which it is ordinarily associated in the natural source of the polypeptide-encoding nucleic acid. An isolated polypeptide-encoding nucleic acid molecule is other than in the form or setting in which it is found in nature. Isolated polypeptide-encoding nucleic acid molecules therefore are distinguished from the specific polypeptide-encoding nucleic acid molecule as it exists in natural cells. However, an isolated polypeptide-encoding nucleic acid molecule includes polypeptide-encoding nucleic acid molecules contained in cells that ordinarily express the polypeptide where, for example, the nucleic acid molecule is in a chromosomal location different from that of natural cells.
- The term “control sequences” refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism. The control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, and a ribosome binding site. Eukaryotic cells are known to utilize promoters, polyadenylation signals, and enhancers.
- Nucleic acid is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, “operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
- The term “antibody” is used in the broadest sense and specifically covers, for example, single anti-PRO monoclonal antibodies (including agonist, antagonist, and neutralizing antibodies), anti-PRO antibody compositions with polyepitopic specificity, single chain anti-PRO antibodies, and fragments of anti-PRO antibodies (see below). The term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally-occurring mutations that may be present in minor amounts.
- “Stringency” of hybridization reactions is readily determinable by one of ordinary skill in the art, and generally is an empirical calculation dependent upon probe length, washing temperature, and salt concentration. In general, longer probes require higher temperatures for proper annealing, while shorter probes need lower temperatures. Hybridization generally depends on the ability of denatured DNA to reanneal when complementary strands are present in an environment below their melting temperature. The higher the degree of desired homology between the probe and hybridizable sequence, the higher the relative temperature which can be used. As a result, it follows that higher relative temperatures would tend to make the reaction conditions more stringent, while lower temperatures less so. For additional details and explanation of stringency of hybridization reactions, see Ausubel et al.,Current Protocols in Molecular Biology, Wiley Interscience Publishers, (1995).
- “Stringent conditions” or “high stringency conditions”, as defined herein, may be identified by those that: (1) employ low ionic strength and high temperature for washing, for example 0.015 M sodium chloride/0.0015 M sodium citrate/0.1% sodium dodecyl sulfate at 50° C.; (2) employ during hybridization a denaturing agent, such as formamide, for example, 50% (v/v) formamide with 0.1% bovine serum albumin/0.1% Ficoll/0.1% polyvinylpyrrolidone/50 mM sodium phosphate buffer at pH 6.5 with 750 mM sodium chloride, 75 mM sodium citrate at 42° C.; or (3) employ 50% formamide, 5×SSC (0.75 M NaCl, 0.075 M sodium citrate), 50 mnM sodium phosphate (pH 6.8), 0.1% sodium pyrophosphate, 5×Denhardt's solution, sonicated salmon sperm DNA (50 μg/ml), 0.1% SDS, and 10% dextran sulfate at 42° C., with washes at 42° C. in 0.2×SSC (sodium chloride/sodium citrate) and 50% formamide at 55° C., followed by a high-stringency wash consisting of 0.1×SSC containing EDTA at 55° C.
- “Moderately stringent conditions” may be identified as described by Sambrook et al.,Molecular Cloning: A Laboratory Manual, New York: Cold Spring Harbor Press, 1989, and include the use of washing solution and hybridization conditions (e.g., temperature, ionic strength and %SDS) less stringent that those described above. An example of moderately stringent conditions is overnight incubation at 37° C. in a solution comprising: 20% formamide, 5×SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5×Denhardt's solution, 10% dextran sulfate, and 20 mg/ml denatured sheared salmon sperm DNA, followed by washing the filters in 1×SSC at about 37-50° C. The skilled artisan will recognize how to adjust the temperature, ionic strength, etc. as necessary to accommodate factors such as probe length and the like.
- The term “epitope tagged” when used herein refers to a chimeric polypeptide comprising a PRO polypeptide fused to a “tag polypeptide”. The tag polypeptide has enough residues to provide an epitope against which an antibody can be made, yet is short enough such that it does not interfere with activity of the polypeptide to which it is fused. The tag polypeptide preferably also is fairly unique so that the antibody does not substantially cross-react with other epitopes. Suitable tag polypeptides generally have at least six amino acid residues and usually between about 8 and 50 amino acid residues (preferably, between about 10 and 20 amino acid residues).
- As used herein, the term “immunoadhesin” designates antibody-like molecules which combine the binding specificity of a heterologous protein (an “adhesin”) with the effector functions of immunoglobulin constant domains. Structurally, the immunoadhesins comprise a fusion of an amino acid sequence with the desired binding specificity which is other than the antigen recognition and binding site of an antibody (i.e., is “heterologous”), and an immunoglobulin constant domain sequence. The adhesin part of an immunoadhesin molecule typically is a contiguous amino acid sequence comprising at least the binding site of a receptor or a ligand. The immunoglobulin constant domain sequence in the immunoadhesin may be obtained from any immunoglobulin, such as IgG-1, IgG-2, IgG-3, or IgG4 subtypes, IgA (including IgA-1 and IgA-2), IgE, IgD or IgM.
- “Active” or “activity” for the purposes herein refers to form(s) of a PRO polypeptide which retain a biological andlor an immunological activity of native or naturally-occurring PRO, wherein “biological” activity refers to a biological function (either inhibitory or stimulatory) caused by a native or naturally-occurring PRO other than the ability to induce the production of an antibody against an antigenic epitope possessed by a native or naturally-occurring PRO and an “immunological” activity refers to the ability to induce the production of an antibody against an antigenic epitope possessed by a native or naturally-occurring PRO.
- The term “antagonist” is used in the broadest sense, and includes any molecule that partially or fully blocks, inhibits, or neutralizes a biological activity of a native PRO polypeptide disclosed herein. In a similar manner, the term “agonist” is used in the broadest sense and includes any molecule that mimics a biological activity of a native PRO polypeptide disclosed herein. Suitable agonist or antagonist molecules specifically include agonist or antagonist antibodies or antibody fragments, fragments or amino acid sequence variants of native PRO polypeptides, peptides, antisense oligonucleotides, small organic molecules, etc. Methods for identifying agonists or antagonists of a PRO polypeptide may comprise contacting a PRO polypeptide with a candidate agonist or antagonist molecule and measuring a detectable change in one or more biological activities normally associated with the PRO polypeptide.
- “Treatment” refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) the targeted pathologic condition or disorder. Those in need of treatment include those already with the disorder as well as those prone to have the disorder or those in whom the disorder is to be prevented.
- “Chronic” administration refers to administration of the agent(s) in a continuous mode as opposed to an acute mode, so as to maintain the initial therapeutic effect (activity) for an extended period of time. “Intermittent” administration is treatment that is not consecutively done without interruption, but rather is cyclic in nature.
- “Mammal” for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, cats, cattle, horses, sheep, pigs, goats, rabbits, etc. Preferably, the mammal is human.
- Administration “in combination with” one or more further therapeutic agents includes simultaneous (concurrent) and consecutive administration in any order.
- “Carriers” as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers which are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution. Examples of physiologically acceptable carriers include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEEN™, polyethylene glycol (PEG), and PLURONICS™.
- “Antibody fragments” comprise aportion of an intact antibody, preferably the antigen binding or variable region of the intact antibody. Examples of antibody fragments include Fab, Fab′, F(ab′)2, and Fv fragments; diabodies; linear antibodies (Zapata et al., Protein Eng. 8(10): 1057-1062[1995]); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
- Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, each with a single antigen-binding site, and a residual “Fc” fragment, a designation reflecting the ability to crystallize readily. Pepsin treatment yields an F(ab′)2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen.
- “Fv” is the minimum antibody fragment which contains a complete antigen-recognition and -binding site. This region consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association. It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer. Collectively, the six CDRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
- The Fab fragment also contains the constant domain of the light chain and the first constant domain (CH1) of the heavy chain. Fab fragments differ from Fab′ fragments by the addition of a few residues at the carboxy terminus of the heavy chain CHI domain including one or more cysteines from the antibody hinge region. Fab′-SH is the designation herein for Fab′ in which the cysteine residue(s) of the constant domains bear a free thiol group. F(ab′)2 antibody fragments originally were produced as pairs of Fab′ fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
- The “light chains” of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their constant domains.
- Depending on the amino acid sequence of the constant domain of their heavy chains, immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgGI, IgG2, IgG3, IgG4, IgA, and IgA2.
- “Single-chain Fv” or “sFv” antibody fragments comprise the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain. Preferably, the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the sFv to form the desired structure for antigen binding. For a review of sFv, see Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994).
- The term “diabodies” refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) in the same polypeptide chain (VH-VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites. Diabodies are described more fully in, for example, EP 404,097; WO 93/11161; and Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
- An “isolated” antibody is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes. In preferred embodiments, the antibody will be purified (1) to greater than 95% by weight of antibody as determined by the Lowry method, and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain. Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
- An antibody that “specifically binds to” or is “specific for” a particular polypeptide or an epitope on a particular polypeptide is one that binds to that particular polypeptide or epitope on a particular polypeptide without substantially binding to any other polypeptide or polypeptide epitope.
- The word “label” when used herein refers to a detectable compound or composition which is conjugated directly or indirectly to the antibody so as to generate a “labeled” antibody. The label may be detectable by itself (e.g. radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition which is detectable.
- By “solid phase” is meant a non-aqueous matrix to which the antibody of the present invention can adhere. Examples of solid phases encompassed herein include those formed partially or entirely of glass (e.g., controlled pore glass), polysaccharides (e.g., agarose), polyacrylamides, polystyrene, polyvinyl alcohol and silicones. In certain embodiments, depending on the context, the solid phase can comprise the well of an assay plate; in others it is a purification column (e.g., an affinity chromatography column). This term also includes a discontinuous solid phase of discrete particles, such as those described in U.S. Pat. No. 4,275,149.
- A “liposome” is a small vesicle composed of various types of lipids, phospholipids and/or surfactant which is useful for delivery of a drug (such as a PRO polypeptide or antibody thereto) to a mammal. The components of the liposome are commonly arranged in a bilayer formation, similar to the lipid arrangement of biological membranes.
- A “small molecule” is defined herein to have a molecular weight below about 500 Daltons.
- An “effective amount” of a polypeptide disclosed herein or an agonist or antagonist thereof is an amount sufficient to carry out a specifically stated purpose. An “effective amount” may be determined empirically and in a routine manner, in relation to the stated purpose.
TABLE 2 PRO XXXXXXXXXXXXXXX (Length = 15 amino acids) Comparison XXXXXYYYYYYY (Length = 12 amino acids) Protein -
TABLE 3 PRO XXXXXXXXXX (Length = 10 amino acids) Comparison XXXXXYYYYYYZZYZ (Length = 15 amino acids) Protein -
TABLE 4 PRO-DNA NNNNNNNNNNNNNN (Length = 14 nucleotides) Comparison NNNNNNLLLLLLLLLL (Length = 16 nucleotides) DNA -
TABLE 5 PRO-DNA NNNNNNNNNNNN (Length = 12 nucleotides) Comparison DNA NNNNLLLVV (Length = 9 nucleotides) - II. Compositions and Methods of the Invention
- A. Full-Length PRO Polypeptides
- The present invention provides newly identified and isolated nucleotide sequences encoding polypeptides referred to in the present application as PRO polypeptides. In particular, cDNAs encoding various PRO polypeptides have been identified and isolated, as disclosed in further detail in the Examples below. It is noted that proteins produced in separate expression rounds may be given different PRO numbers but the UNQ number is unique for any given DNA and the encoded protein, and will not be changed. However, for sake of simplicity, in the present specification the protein encoded by the full length native nucleic acid molecules disclosed herein as well as all further native homologues and variants included in the foregoing definition of PRO, will be referred to as “PRO/number”, regardless of their origin or mode of preparation.
- As disclosed in the Examples below, various cDNA clones have been deposited with the ATCC. The actual nucleotide sequences of those clones can readily be determined by the skilled artisan by sequencing of the deposited clone using routine methods in the art. The predicted amino acid sequence can be determined from the nucleotide sequence using routine skill. For the PRO polypeptides and encoding nucleic acids described herein, Applicants have identified what is believed to be the reading frame best identifiable with the sequence information available at the time.
- B. PRO Polypeptide Variants
- In addition to the full-length native sequence PRO polypeptides described herein, it is contemplated that PRO variants can be prepared. PRO variants can be prepared by introducing appropriate nucleotide changes into the PRO DNA, and/or by synthesis of the desired PRO polypeptide. Those skilled in the art will appreciate that amino acid changes may alter post-translational processes of the PRO, such as changing the number or position of glycosylation sites or altering the membrane anchoring characteristics.
- Variations in the native full-length sequence PRO or in various domains of the PRO described herein, can be made, for example, using any of the techniques and guidelines for conservative and non-conservative mutations set forth, for instance, in U.S. Pat. No. 5,364,934. Variations may be a substitution, deletion or insertion of one or more codons encoding the PRO that results in a change in the amino acid sequence of the PRO as compared with the native sequence PRO. Optionally the variation is by substitution of at least one amino acid with any other amino acid in one or more of the domains of the PRO. Guidance in determining which amino acid residue may be inserted, substituted or deleted without adversely affecting the desired activity may be found by comparing the sequence of the PRO with that of homologous known protein molecules and minimizing the number of amino acid sequence changes made in regions of high homology. Amino acid substitutions can be the result of replacing one amino acid with another amino acid having similar structural and/or chemical properties, such as the replacement of a leucine with a serine, i.e., conservative amino acid replacements. Insertions or deletions may optionally be in the range of about 1 to 5 amino acids. The variation allowed may be determined by systematically making insertions, deletions or substitutions of amino acids in the sequence and testing the resulting variants for activity exhibited by the full-length or mature native sequence.
- PRO polypeptide fragments are provided herein. Such fragments may be truncated at the N-terminus or C-terminus, or may lack internal residues, for example, when compared with a full length native protein. Certain fragments lack amino acid residues that are not essential for a desired biological activity of the PRO polypeptide.
- PRO fragments may be prepared by any of a number of conventional techniques. Desired peptide fragments may be chemically synthesized. An alternative approach involves generating PRO fragments by enzymatic digestion, e.g., by treating the protein with an enzyme known to cleave proteins at sites defined by particular amino acid residues, orby digesting the DNA with suitable restriction enzymes and isolating the desired fragment. Yet another suitable technique involves isolating and amplifying a DNA fragment encoding a desired polypeptide fragment, by polymerase chain reaction (PCR). Oligonucleotides that define the desired termini of the DNA fragment are employed at the 5′ and 3′ primers in the PCR. Preferably, PRO polypeptide fragments share at least one biological and/or immunological activity with the native PRO polypeptide disclosed herein.
- In particular embodiments, conservative substitutions of interest are shown in Table 6 under the heading of preferred substitutions. If such substitutions result in a change in biological activity, then more substantial changes, denominated exemplary substitutions in Table 6, or as further described below in reference to amino acid classes, are introduced and the products screened.
TABLE 6 Original Exemplary Preferred Residue Substitutions Substitutions Ala (A) val; leu; ile val Arg (R) lys; gln; asn lys Asn (N) gln; his; lys; arg gln Asp (D) glu glu Cys (C) ser ser Gln (Q) asn asn Glu (E) asp asp Gly (G) pro; ala ala His (H) asn; gln; lys; arg arg Ile (I) leu; val; met; ala; phe; leu norleucine Leu (L) norleucine; ile; val; ile met; ala; phe Lys (K) arg; gln; asn arg Met (M) leu; phe; ile leu Phe (F) leu; val; ile; ala; tyr leu Pro (P) ala ala Ser (S) thr thr Thr (T) ser ser Trp (W) tyr; phe tyr Tyr (Y) trp; phe; thr; ser phe Val (V) ile; leu; met; phe; leu ala; norleucine - Substantial modifications in function or immunological identity of the PRO polypeptide are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. Naturally occurring residues are divided into groups based on common side-chain properties:
- (1) hydrophobic: norleucine, met, ala, val, leu, ile;
- (2) neutral hydrophilic: cys, ser, thr;
- (3) acidic: asp, glu;
- (4) basic: asn, gln, his, lys, arg;
- (5) residues that influence chain orientation: gly, pro; and
- (6) aromatic: trp, tyr, phe.
- Non-conservative substitutions will entail exchanging a member of one of these classes for another class. Such substituted residues also may be introduced into the conservative substitution sites or, more preferably, into the remaining (non-conserved) sites.
- The variations can be made using methods known in the art such as oligonucleotide-mediated (site-directed) mutagenesis, alanine scanning, and PCR mutagenesis. Site-directed mutagenesis [Carter et al.,Nucl. Acids Res., 13:4331 (1986); Zoller et al., Nucl. Acids Res., 10:6487 (1987)], cassette mutagenesis [Wells et al., Gene, 34:315 (1985)], restriction selection mutagenesis [Wells et al., Philos. Trans. R. Soc. London SerA, 317:415 (1986)] or other known techniques can be performed on the cloned DNA to produce the PRO variant DNA.
- Scanning amino acid analysis can also be employed to identify one or more amino acids along a contiguous sequence. Among the preferred scanning amino acids are relatively small, neutral amino acids. Such amino acids include alanine, glycine, serine, and cysteine. Alanine is typically a preferred scanning amino acid among this group because it eliminates the side-chain beyond the beta-carbon and is less likely to alter the main-chain conformation of the variant [Cunningham and Wells,Science, 244: 1081-1085 (1989)]. Alanine is also typically preferred because it is the most common amino acid. Further, it is frequently found in both buried and exposed positions [Creighton, The Proteins, (W. H. Freeman & Co., N.Y.); Chothia, J. Mol. Biol., 150:1 (1976)]. If alanine substitution does not yield adequate amounts of variant, an isoteric amino acid can be used.
- C. Modifications of PRO
- Covalent modifications of PRO are included within the scope of this invention. One type of covalent modification includes reacting targeted amino acid residues of a PRO polypeptide with an organic derivatizing agent that is capable of reacting with selected side chains or the N- or C- terminal residues of the PRO. Derivatization with bifunctional agents is useful, for instance, for crosslinking PRO to a water-insoluble support matrix or surface for use in the method for purifying anti-PRO antibodies, and vice-versa. Commonly used crosslinking agents include, e.g., 1,1-bis(diazoacetyl)-2-phenylethane, glutaraldehyde, N-hydroxysuccinimide esters, for example, esters with 4-azidosalicylic acid, homobifunctional imidoesters, including disuccinimidyl esters such as 3,3′-dithiobis(succinimidylpropionate), bifunctional maleimides such as bis-N-maleimido-1,8-octane and agents such as methyl-3-[(p-azidophenyl)dithio]propioimidate.
- Other modifications include deamidation of glutaminyl and asparaginyl residues to the corresponding glutamyl and aspartyl residues, respectively, hydroxylation of proline and lysine, phosphorylation of hydroxyl groups of seryl or threonyl residues, methylation of the a-amino groups of lysine, arginine, and histidine side chains [T. E. Creighton,Proteins: Structure and Molecular Properties, W. H. Freeman & Co., San Francisco, pp. 79-86 (1983)], acetylation of the N-terminal amine, and amidation of any C-terminal carboxyl group.
- Another type of covalent modification of the PRO polypeptide included within the scope of this invention comprises altering the native glycosylation pattern of the polypeptide. “Altering the native glycosylation pattern” is intended for purposes herein to mean deleting one or more carbohydrate moieties found in native sequence PRO (either by removing the underlying glycosylation site or by deleting the glycosylation by chemical and/or enzymatic means), and/or adding one or more glycosylation sites that are not present in the native sequence PRO. In addition, the phrase includes qualitative changes in the glycosylation of the native proteins, involving a change in the nature and proportions of the various carbohydrate moieties present.
- Addition of glycosylation sites to the PRO polypeptide may be accomplished by altering the amino acid sequence. The alteration may be made, for example, by the addition of, or substitution by, one or more serine or threonine residues to the native sequence PRO (for O-linked glycosylation sites). The PRO amino acid sequence may optionally be altered through changes at the DNA level, particularly by mutating the DNA encoding the PRO polypeptide at preselected bases such that codons are generated that will translate into the desired amino acids.
- Another means of increasing the number of carbohydrate moieties on the PRO polypeptide is by chemical or enzymatic coupling of glycosides to the polypeptide. Such methods are described in the art, e.g., in WO 87/05330 published Sep. 11, 1987, and in Aplin and Wriston,CRC Crit. Rev. Biochem., pp. 259-306 (1981).
- Removal of carbohydrate moieties present on the PRO polypeptide may be accomplished chemically or enzymatically or by mutational substitution of codons encoding for amino acid residues that serve as targets for glycosylation. Chemical deglycosylation techniques are known in the art and described, for instance, by Hakimuddin, etal.,Arch. Biochem. Biophys.,259:52 (1987) and by Edge et al., Anal. Biochem., 118:131(1981). Enzymatic cleavage of carbohydrate moieties on polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al., Meth. Enzymol., 138:350 (1987).
- Another type of covalent modification of PRO comprises linking the PRO polypeptide to one of a variety of nonproteinaceous polymers, e.g., polyethylene glycol (PEG), polypropylene glycol, or polyoxyalkylenes, in the manner set forth in U.S. Pat. Nos. 4,640,835; 4,496,689; 4,301,144; 4,670,417; 4,791,192 or 4,179,337.
- The PRO of the present invention may also be modified in a way to form a chimeric molecule comprising PRO fused to another, heterologous polypeptide or amino acid sequence.
- In one embodiment, such a chimeric molecule comprises a fusion of the PRO with a tag polypeptide which provides an epitope to which an anti-tag antibody can selectively bind. The epitope tag is generally placed at the amino- or carboxyl- terminus of the PRO. The presence of such epitope-tagged forms of the PRO can be detected using an antibody against the tag polypeptide. Also, provision of the epitope tag enables the PRO to be readily purified by affinity purification using an anti-tag antibody or another type of affinity matrix that binds to the epitope tag. Various tag polypeptides and their respective antibodies are well known in the art. Examples include poly-histidine (poly-his) or poly-histidine-glycine (poly-his-gly) tags; the flu HA tag polypeptide and its antibody 12CA5 [Field et al.,Mol. Cell. Biol., 8:2159-2165 (1988)]; the c-myc tag and the 8F9, 3C7, 6E10, G4, B7 and 9E10 antibodies thereto [Evan et al., Molecular and Cellular Biology, 5:3610-3616 (1985)]; and the Herpes Simplex virus glycoprotein D (gD) tag and its antibody [Paborsky et al., Protein Engineering, 3(6):547-553 (1990)]. Other tag polypeptides include the Flag-peptide [Hopp et al., BioTechnology,6:1204-1210 (1988)]; the KT3 epitope peptide [Martin et al., Science, 255:192-194 (1992)]; an a-tubulin epitope peptide [Skinner et al., J. Biol. Chem., 266:15163-15166 (1991)]; and the
T7 gene 10 protein peptide tag [Lutz-Freyermuth et al., Proc. Natl. Acad. Sci. USA, 87:6393-6397 (1990)]. - In an alternative embodiment, the chimeric molecule may comprise a fusion of the PRO with an immunoglobulin or a particular region of an immirunoglobulin. For a bivalent form of the chimeric molecule (also referred to as an “immunoadhesin”), such a fusion could be to the Fc region of an IgG molecule. The Ig fusions preferably include the substitution of a soluble (transmembrane domain deleted or inactivated) form of a PRO polypeptide in place of at least one variable region within an Ig molecule. In a particularly preferred embodiment, the immunoglobulin fusion includes the hinge, CH2 and CH3, or the hinge, CH1, CH2 and CH3 regions of an IgGI molecule. For the production of immunoglobulin fusions see also U.S. Pat. No. 5,428,130 issued Jun. 27, 1995.
- D. Preparation of PRO
- The description below relates primarily to production of PRO by culturing cells transformed or transfected with a vector containing PRO nucleic acid. It is, of course, contemplated that alternative methods, which are well known in the art, may be employed to prepare PRO. For instance, the PRO sequence, or portions thereof, may be produced by direct peptide synthesis using solid-phase techniques [see, e.g., Stewart et al.,Solid-Phase Peptide Synthesis, W. H. Freeman Co., San Francisco, Calif. (1969); Merrifield, J. Am. Chem. Soc., 85:2149-2154 (1963)]. In vitro protein synthesis may be performed using manual techniques or by automation. Automated synthesis may be accomplished, for instance, using an Applied Biosystems Peptide Synthesizer (Foster City, Calif.) using manufacturer's instructions. Various portions of the PRO may be chemically synthesized separately and combined using chemical or enzymatic methods to produce the full-length PRO.
- 1. Isolation of DNA Encoding PRO
- DNA encoding PRO may be obtained from a cDNA library prepared from tissue believed to possess the PRO mRNA andto express it at a detectable level. Accordingly, human PRO DNA can be conveniently obtained from a cDNA library prepared from human tissue, such as described in the Examples. The PRO-encoding gene may also be obtained from a genomic library or by known synthetic procedures (e.g., automated nucleic acid synthesis).
- Libraries can be screened with probes (such as antibodies to the PRO or oligonucleotides of at least about 20-80 bases) designed to identify the gene of interest or the protein encoded by it. Screening the cDNA or genomic library with the selected probe may be conducted using standard procedures, such as described in Sambrook et al.,Molecular Cloning: A Laboratory Manual (New York: Cold Spring Harbor Laboratory Press, 1989). An alternative means to isolate the gene encoding PRO is to use PCR methodology [Sambrook et al., supra; Dieffenbach et al., PCR Primer: A Laboratory Manual (Cold Spring Harbor Laboratory Press, 1995)].
- The Examples below describe techniques for screening a cDNA library. The oligonucleotide sequences selected as probes should be of sufficient length and sufficiently unambiguous that false positives are minimized. The oligonucleotide is preferably labeled such that it can be detected upon hybridization to DNA in the library being screened. Methods of labeling are well known in the art, and include the use of radiolabels like32P-labeled ATP, biotinylation or enzyme labeling. Hybridization conditions, including moderate stringency and high stringency, are provided in Sambrook et al., supra.
- Sequences identified in such library screening methods can be compared and aligned to other known sequences deposited and available in public databases such as GenBank or other private sequence databases. Sequence identity (at either the amino acid or nucleotide level) within defined regions of the molecule or across the full-length sequence can be determined using methods known in the art and as described herein.
- Nucleic acid having protein coding sequence may be obtained by screening selected cDNA or genomic libraries using the deduced amino acid sequence disclosed herein for the first time, and, if necessary, using conventional primer extension procedures as described in Sambrook et al., supra, to detect precursors and processing intermediates of mRNA that may not have been reverse-transcribed into cDNA.
- 2. Selection and Transformation of Host Cells
- Host cells are transfected or transformed with expression or cloning vectors described herein for PRO production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences. The culture conditions, such as media, temperature, pH and the like, can be selected by the skilled artisan without undue experimentation. In general, principles, protocols, and practical techniques for maximizing the productivity of cell cultures can be found inMammalian Cell Biotechnology: a Practical Approach, M. Butler, ed. (IRL Press, 1991) and Sambrook et al., supra.
- Methods of eukaryotic cell transfection and prokaryotic cell transformation are known to the ordinarily skilled artisan, for example, CaCl2, CaPO4, liposome-mediated and electroporation. Depending on the host cell used, transformation is performed using standard techniques appropriate to such cells. The calcium treatment employing calcium chloride, as described in Sambrook et al., supra, or electroporation is generally used for prokaryotes. Infection with Agrobacterium tumefaciens is used for transformation of certain plant cells, as described by Shaw et al., Gene 23:315 (1983) and WO 89/05859 published Jun. 29, 1989. For mammalian cells without such cell walls, the calcium phosphate precipitation method of Graham and van derEb, Virology, 52:456-457 (1978) can be employed. General aspects of mammalian cell host system transfections have been described in U.S. Pat. No.4,399,216. Transformations into yeast are typically carried out according to the method of Van Solingen et al., J. Bact., 130:946 (1977) and Hsiao et al., Proc. Natl. Acad. Sci. (USA), 76:3829 (1979). However, other methods for introducing DNA into cells, such as by nuclear microinjection, electroporation, bacterial protoplast fusion with intact cells, or polycations, e.g., polybrene, polyornithine, may also be used. For various techniques for transforming mammalian cells, see Keown et al., Methods in Enzymology, 185:527-537 (1990) and Mansour et al., Nature, 336:348-352 (1988).
- Suitable host cells for cloning or expressing the DNA in the vectors herein include prokaryote, yeast, or higher eukaryote cells. Suitable prokaryotes include but are not limited to eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such asE. coli. Various E. coli strains are publicly available, such as E. coli K12 strain MM294 (ATCC 31,446); E. coli X1776 (ATCC 31,537); E. coli strain W3110 (ATCC 27,325) and K5 772 (ATCC 53,635). Other suitable prokaryotic host cells include Enterobacteriaceaesuch as Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g., Salmonella typhimurium, Serratia, e.g., Serratia marcescans, and Shigella, as well as Bacilli such as B. subtilis and B. lichenifornis (e.g., B. lichenifornis 41P disclosed in DD 266,710published Apr. 12, 1989), Pseudomonas such as P. aeruginosa, and Streptomyces. These examples are illustrative rather than limiting. Strain W3110 is one particularly preferred host or parent host because it is a common host strain for recombinant DNA product fermentations. Preferably, the host cell secretes minimal amounts of proteolytic enzymes. For example, strain W3 110 may be modified to effect a genetic mutation in the genes encoding proteins endogenous to the host, with examples of such hosts including E. coli W3 110 strain 1A2, which has the complete genotype tonA; E. coli W3 110 strain 9E4, which has the complete genotype tonA ptr3; E. coli W3 110 strain 27C7 (ATCC 55,244), which has the complete genotype tonA ptr3 phoA E15 (argF-lac)169 degP ompT kanr ; E. coli W3 110 strain 37D6, which has the complete genotype tonA ptr3phoA E15 (argF-lac)169 degP ompT rbs7 ilvG kanr ; E. coli W3110 strain 40B4, which is strain 37D6 with a non-kanamycin resistant degP deletion mutation; and an E. coli strain having mutant periplasmic protease disclosed in U.S. Pat. No. 4,946,783 issued Aug. 7, 1990. Alternatively, in vitro methods of cloning, e.g., PCR or other nucleic acid polymerase reactions, are suitable.
- In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for PRO-encoding vectors.Saccharomyces cerevisiae is a commonly used lower eukaryotic host microorganism. Others include Schizosaccharomyces pombe (Beach and Nurse, Nature, 290:140[1981]; EP 139,383 published May 2, 1985); Kluyveromyces hosts (U.S. Pat. No. 4,943,529; Fleer et al., Bio/Technoloy, 9:968-975 (1991)) such as, e.g., K. lactis (MW98-8C, CBS683, CBS4574; Louvencourt et al., J. Bacteriol., 154(2):737-742[1983]), K. fragilis (ATCC 12,424), K. bulgaricus (ATCC 16,045), K. wickeramii (ATCC 24,178), K. waltii (ATCC 56,500), K. drosophilarum (ATCC 36,906; Van den Berg et al., Bio/Technology, 8:135 (1990)), K. thermotolerans, and K. marxianus; yarrowia (EP 402,226); Pichia pastoris (EP 183,070; Sreekrishna et al., J. Basic Microbiol., 28:265-278[1988]); Candida; Trichoderma reesia (EP 244,234); Neurospora crassa (Case et al., Proc. Natl. Acad. Sci. USA, 76:5259-5263[1979]); Schwanniomyces such as Schwanniomyces occidentalis (EP 394,538 published Oct. 31, 1990); and filamentous fungi such as, e.g., Neurospora, Penicillium, Tolypocladium (WO 91/00357 published Jan. 10, 1991), and Aspergillus hosts such as A. nidulans (Ballance et al., Biochem. Biophys. Res. Commun., 112:284-289[1983]; Tilburn et al., Gene, 26:205-221[1983]; Yelton et al., Proc. Natl. Acad. Sci. USA, 81: 1470-1474[1984]) and A. niger (Kelly and Hynes, EMBO J., 4:475-479[1985]). Methylotropic yeasts are suitable herein and include, but are not limited to, yeast capable of growth on methanol selected from the genera consisting of Hansenula, Candida, Kloeckera, Pichia, Saccharomyces, Torulopsis, and Rhodotorula. A list of specific species that are exemplary of this class of yeasts may be found in C. Anthony, The Biochemistry of Methylotrophs, 269 (1982).
- Suitable host cells for the expression of glycosylated PRO are derived from multicellular organisms. Examples of invertebrate cells include insect cells such as Drosophila S2 and Spodoptera Sf9, as well as plant cells. Examples of useful mammalian host cell lines include Chinese hamster ovary (CHO) and COS cells. More specific examples include monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al.,J. Gen Virol., 36:59 (1977)); Chinese hamster ovary cells/-DHFR (CHO, Urlaub and Chasin, Proc. Natl. Acad. Sci. USA, 77:4216(1980)); mouse sertoli cells (TM4, Mather, Biol. Reprod., 23:243-251 (1980)); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); and mouse mammary tumor (MMT 060562, ATCC CCL51). The selection of the appropriate host cell is deemed to be within the skill in the art.
- 3. Selection and Use of a Replicable Vector
- The nucleic acid (e.g., cDNA or genomic DNA) encoding PRO may be inserted into a replicable vector for cloning (amplification of the DNA) or for expression. Various vectors are publicly available. The vector may, for example, be in the form of a plasmid, cosmid, viral particle, or phage. The appropriate nucleic acid sequence may be inserted into the vector by a variety of procedures. In general, DNA is inserted into an appropriate restriction endonuclease site(s) using techniques known in the art. Vector components generally include, but are not limited to, one or more of a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence. Construction of suitable vectors containing one or more of these components employs standard ligation techniques which are known to the skilled artisan.
- The PRO may be produced recombinantly not only directly, but also as a fusion polypeptide with a heterologous polypeptide, which may be a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide. In general, the signal sequence may be a component of the vector, or it may be a part of the PRO-encoding DNA that is inserted into the vector. The signal sequence may be a prokaryotic signal sequence selected, for example, from the group of the alkaline phosphatase, penicillinase, Ipp, or heat-stable enterotoxin II leaders. For yeast secretion the signal sequence may be, e.g., the yeast invertase leader, alpha factor leader (including Saccharomyces and Kluyveromyces α-factor leaders, the latter described in U.S. Pat. No. 5,010,182), or acid phosphatase leader, theC. albicans glucoamylase leader (EP 362,179 published Apr. 4, 1990), or the signal described in WO 90/13646 published Nov. 15, 1990. In mammalian cell expression, mammalian signal sequences may be used to direct secretion of the protein, such as signal sequences from secreted polypeptides of the same or related species, as well as viral secretory leaders.
- Both expression and cloning vectors contain a nucleic acid sequence that enables the vector to replicate in one or more selected host cells. Such sequences are well known for a variety of bacteria, yeast, and viruses. The origin of replication from the plasmid pBR322 is suitable for most Gram-negative bacteria, the 2μ plasmid origin is suitable for yeast, and various viral origins (SV40, polyoma, adenovirus, VSV or BPV) are useful for cloning vectors in mammalian cells.
- Expression and cloning vectors will typically contain a selection gene, also termed a selectable marker. Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic deficiencies, or (c) supply critical nutrients not available from complex media, e.g., the gene encoding D-alanine racemase forBacilli.
- An example of suitable selectable markers for mammalian cells are those that enable the identification of cells competent to take up the PRO-encoding nucleic acid, such as DHFR or thymidine kinase. An appropriate host cell when wild-type DHFR is employed is the CHO cell line deficient in DHFR activity, prepared and propagated as described by Urlaub et al.,Proc. Natl. Acad. Sci. USA, 77:4216 (1980). A suitable selection gene for use in yeast is the trp1 gene present in the yeast plasmid YRp7 [Stinchcomb et al., Nature, 282:39 (1979); Kingsman et al., Gene,7:141(1979); Tschemper et al., Gene,10:157(1980)]. The trp1 gene provides a selection marker for a mutant strain of yeast lacking the ability to grow in tryptophan, for example, ATCC No. 44076 or PEP4-1 [Jones, Genetics, 85:12 (1977)].
- Expression and cloning vectors usually contain apromoter operably linked to the PRO-encoding nucleic acid sequence to direct mRNA synthesis. Promoters recognized by a variety of potential host cells are well known. Promoters suitable for use with prokaryotic hosts include the P-lactamase and lactose promoter systems [Changetal.,Nature, 275:615 (1978); Goeddeletal., Nature, 281:544 (1979)], alkaline phosphatase, atryptophan (trp) promoter system [Goeddel, Nucleic Acids Res., 8:4057 (1980); EP 36,776], and hybrid promoters such as the tac promoter [deBoer et al., Proc. Natl. Acad. Sci. USA, 80:21-25 (1983)]. Promoters for use in bacterial systems also will contain a Shine-Dalgarno (S.D.) sequence operably linked to the DNA encoding PRO.
- Examples of suitable promoting sequences for use with yeast hosts include the promoters for 3-phosphoglycerate kinase [Hitzeman et al.,J. Biol. Chem., 255:2073 (1980)] or other glycolytic enzymes [Hess et al., J. Adv. Enzvme Reg., 7:149 (1968); Holland, Biochemistry, 17:4900 (1978)], such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3-phosphoglycerate mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isomerase, and glucokinase.
- Other yeast promoters, which are inducible promoters having the additional advantage of transcription controlled by growth conditions, are the promoter regions for
alcohol dehydrogenase 2, isocytochrome C, acid phosphatase, degradative enzymes associated with nitrogen metabolism, metallothionein, glyceraldehyde-3-phosphate dehydrogenase, and enzymes responsible for maltose and galactose utilization. Suitable vectors and promoters for use in yeast expression are further described in EP 73,657. - PRO transcription from vectors in mammalian host cells is controlled, for example, by promoters obtained from the genomes of viruses such as polyoma virus, fowlpox virus (UK 2,211,504 published Jul. 5, 1989), adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and Simian Virus 40 (SV40), fromheterologous mammalianpromoters, e.g., the actin promoter or an immunoglobulin promoter, and from heat-shock promoters, provided such promoters are compatible with the host cell systems.
- Transcription of a DNA encoding the PRO by higher eukaryotes may be increased by inserting an enhancer sequence into the vector. Enhancers are cis-acting elements of DNA, usually about from 10 to 300 bp, that act on a promoter to increase its transcription. Many enhancer sequences are now known from mammalian genes (globin, elastase, albumin, a-fetoprotein, and insulin). Typically, however, one will use an enhancer from a eukaryotic cell virus. Examples include the SV40 enhancer on the late side of the replication origin (bp 100-270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers. The enhancer may be spliced into the vector at a position 5′ or 3′ to the PRO coding sequence, but is preferably located at a site 5′ from the promoter.
- Expression vectors used in eukaryotic host cells (yeast, fungi, insect, plant, animal, human, or nucleated cells from other multicellular organisms) will also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5′ and, occasionally 3′, untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding PRO.
- Still other methods, vectors, and host cells suitable for adaptation to the synthesis of PRO in recombinant vertebrate cell culture are described in Gething et al.,Nature, 293:620-625 (1981); Mantei et al., Nature, 281:40-46 (1979); EP 117,060; and EP 117,058.
- 4. Detecting Gene Amplification/Expression
- Gene amplification and/or expression may be measured in a sample directly, for example, by conventional Southern blotting, Northern blotting to quantitate the transcription of mRNA [Thomas,Proc. Natl. Acad. Sci. USA, 77:5201-5205 (1980)], dot blotting (DNA analysis), or in situ hybridization, using an appropriately labeled probe, based on the sequences provided herein. Alternatively, antibodies may be employed that can recognize specific duplexes, including DNA duplexes, RNA duplexes, and DNA-RNA hybrid duplexes or DNA-protein duplexes. The antibodies in turn may be labeled and the assay may be carried out where the duplex is bound to a surface, so that upon the formation of duplex on the surface, the presence of antibody bound to the duplex can be detected.
- Gene expression, alternatively, may be measured by immunological methods, such as immunohistochemical staining of cells or tissue sections and assay of cell culture or body fluids, to quantitate directly the expression of gene product. Antibodies useful for immunohistochemical staining and/or assay of sample fluids may be either monoclonal or polyclonal, and may be prepared in any mammal. Conveniently, the antibodies may be prepared against a native sequence PRO polypeptide or against a synthetic peptide based on the DNA sequences provided herein or against exogenous sequence fused to PRO DNA and encoding a specific antibody epitope.
- 5. Purification of Polypeptide
- Forms of PRO may be recovered from culture medium or from host cell lysates. If membrane-bound, it can be released from the membrane using a suitable detergent solution (e.g. Triton-X 100) or by enzymatic cleavage. Cells employed in expression of PRO can be disrupted by various physical or chemical means, such as freeze-thaw cycling, sonication, mechanical disruption, or cell lysing agents.
- It may be desired to purify PRO from recombinant cell proteins or polypeptides. The following procedures are exemplary of suitable purification procedures: by fractionation on an ion-exchange column; ethanol precipitation; reverse phase HPLC; chromatography on silica or on a cation-exchange resin such as DEAE; chromatofocusing; SDS-PAGE; ammonium sulfate precipitation; gel filtration using, for example, Sephadex G-75; protein A Sepharose columns to remove contaminants such as IgG; and metal chelating columns to bind epitope-tagged forms of the PRO. Various methods of protein purification may be employed and such methods are known in the art and described for example in Deutscher,Methods in Enzamology, 182 (1990); Scopes, Protein Purification: Principles and Practice, Springer-Verlag, New York (1982). Thepurificationstep(s) selected will depend, for example, on the nature of the production process used and the particular PRO produced.
- E. Uses for PRO
- Nucleotide sequences (or their complement) encoding PRO have various applications in the art of molecular biology, including uses as hybridization probes, in chromosome and gene mapping and in the generation of anti-sense RNA and DNA. PRO nucleic acid will also be useful for the preparation of PRO polypeptides by the recombinant techniques described herein.
- The full-length native sequence PRO gene, or portions thereof, may be used as hybridization probes for a cDNA library to isolate the full-length PRO cDNA or to isolate still other cDNAs (for instance, those encoding naturally-occurring variants of PRO or PRO from other species) which have a desired sequence identity to the native PRO sequence disclosed herein. Optionally, the length of the probes will be about 20 to about 50 bases. The hybridization probes may be derived from at least partially novel regions of the full length native nucleotide sequence wherein those regions may be determined without undue experimentation or from genomic sequences including promoters, enhancer elements and introns of native sequence PRO. By way of example, a screening method will comprise isolating the coding region of the PRO gene using the known DNA sequence to synthesize a selected probe of about 40 bases. Hybridization probes may be labeled by a variety of labels, including radionucleotides such as32P or 35S, or enzymatic labels such as alkaline phosphatase coupled to the probe via avidin/biotin coupling systems. Labeled probes having a sequence complementary to that of the PRO gene of the present invention can be used to screen libraries of human cDNA, genomic DNA or mRNA to determine which members of such libraries the probe hybridizes to. Hybridization techniques are described in further detail in the Examples below.
- Any EST sequences disclosed in the present application may similarly be employed as probes, using the methods disclosed herein.
- Other useful fragments of the PRO nucleic acids include antisense or sense oligonucleotides comprising a singe-stranded nucleic acid sequence (either RNA or DNA) capable of binding to target PRO mRNA (sense) or PRO DNA (antisense) sequences. Antisense or sense oligonucleotides, according to the present invention, comprise a fragment of the coding region of PRO DNA. Such a fragment generally comprises at least about 14 nucleotides, preferably from about 14 to 30 nucleotides. The ability to derive an antisense or a sense oligonucleotide, based upon a cDNA sequence encoding a given protein is described in, for example, Stein and Cohen (Cancer Res. 48:2659, 1988) and van der Krol et al. (BioTechnigues 6:958, 1988).
- Binding of antisense or sense oligonucleotides to target nucleic acid sequences results in the formation of duplexes that block transcription or translation of the target sequence by one of several means, including enhanced degradation of the duplexes, premature termination of transcription or translation, or by other means. The antisense oligonucleotides thus may be used to block expression of PRO proteins. Antisense or sense oligonucleotides further comprise oligonucleotides having modified sugar-phosphodiester backbones (or other sugar linkages, such as those described in WO 91/06629) and wherein such sugar linkages are resistant to endogenous nucleases. Such oligonucleotides with resistant sugar linkages are stable.in vivo (i.e., capable of resisting enzymatic degradation) but retain sequence specificity to be able to bind to target nucleotide sequences.
- Other examples of sense or antisense oligonucleotides include those oligonucleotides which are covalently linked to organic moieties, such as those described in WO 90/10048, and other moieties that increases affinity of the oligonucleotide for a target nucleic acid sequence, such as poly-(L-lysine). Further still, intercalating agents, such as ellipticine, and alkylating agents or metal complexes may be attached to sense or antisense oligonucleotides to modify binding specificities of the antisense or sense oligonucleotide for the target nucleotide sequence.
- Antisense or sense oligonucleotides may be introduced into a cell containing the target nucleic acid sequence by any gene transfer method, including, for example, CaPO4-mediated DNA transfection, electroporation, or by using gene transfer vectors such as Epstein-Barr virus. In a preferred procedure, an antisense or sense oligonucleotide is inserted into a suitable retroviral vector. A cell containing the target nucleic acid sequence is contacted with the recombinant retroviral vector, either in vivo or ex vivo. Suitable retroviral vectors include, but are not limited to, those derived from the murine retrovirus M-MuLV, N2 (a retrovirus derived from M-MuLV), or the double copy vectors designated DCTSA, DCT5B and DCT5C (see WO 90/13641).
- Sense or antisense oligonucleotides also may be introduced into a cell containing the target nucleotide sequence by formation of a conjugate with a ligand binding molecule, as described in WO 91/04753. Suitable ligand binding molecules include, but are not limited to, cell surface receptors, growth factors, other cytokines, or other ligands that bind to cell surface receptors. Preferably, conjugation of the ligand binding molecule does not substantially interfere with the ability of the ligand binding molecule to bind to its corresponding molecule or receptor, or block entry of the sense or antisense oligonucleotide or its conjugated version into the cell.
- Alternatively, a sense or an antisense oligonucleotide may be introduced into a cell containing the target nucleic acid sequence by formation of an oligonucleotide-lipid complex, as described in WO 90/10448. The sense or antisense oligonucleotide-lipid complex is preferably dissociated within the cell by an endogenous lipase.
- Antisense or sense RNA or DNA molecules are generally at least about 5 bases in length, about 10 bases in length, about 15 bases in length, about 20 bases in length, about 25 bases in length, about 30 bases in length, about 35 bases in length, about 40 bases in length, about 45 bases in length, about 50 bases in length, about 55 bases in length, about 60 bases in length, about 65 bases in length, about 70 bases in length, about 75 bases in length, about 80 bases in length, about 85 bases in length, about 90 bases in length, about 95 bases in length, about 100 bases in length, or more.
- The probes may also be employed in PCR techniques to generate a pool of sequences for identification of closely related PRO coding sequences.
- Nucleotide sequences encoding a PRO can also be used to construct hybridization probes for mapping the gene which encodes that PRO and for the genetic analysis of individuals with genetic disorders. The nucleotide sequences provided herein may be mapped to a chromosome and specific regions of a chromosome using known techniques, such as in situ hybridization, linkage analysis against known chromosomal markers, and hybridization screening with libraries.
- When the coding sequences for PRO encode a protein which binds to another protein (example, where the PRO is a receptor), the PRO can be used in assays to identify the other proteins or molecules involved in the binding interaction. By such methods, inhibitors of the receptor/ligand binding interaction can be identified. Proteins involved in such binding interactions can also be used to screen for peptide or small molecule inhibitors or agonists of the binding interaction. Also, the receptor PRO can be used to isolate correlative ligand(s). Screening assays can be designed to find lead compounds that mirnic the biological activity of a native PRO or a receptor for PRO. Such screening assays will include assays amenable to high-throughput screening of chemical libraries, making them particularly suitable for identifying small molecule drug candidates. Small molecules contemplated include synthetic organic or inorganic compounds. The assays can be performed in a variety of formats, including protein-protein binding assays, biochemical screening assays, immunoassays and cell based assays, which are well characterized in the art.
- Nucleic acids which encode PRO or its modified formns can also be used to generate either transgenic animals or “knock out” animals which, in turn, are useful in the development and screening of therapeutically useful reagents. A transgenic animal (e.g., a mouse or rat) is an animal having cells that contain a transgene, which transgene was introduced into the animal or an ancestor of the animal at a prenatal, e.g., an embryonic stage. A transgene is a DNA which is integrated into the genome of a cell from which a transgenic animal develops. In one embodiment, cDNA encoding PRO can be used to clone genomic DNA encoding PRO in accordance with established techniques and the genomic sequences used to generate transgenic animals that contain cells which express DNA encoding PRO. Methods for generating transgenic animals, particularly animals such as mice or rats, have become conventional in the art and are described, for example, in U.S. Pat. Nos. 4,736,866 and 4,870,009. Typically, particular cells would be targeted for PRO transgene incorporation with tissue-specific enhancers. Transgenic animals that include a copy of a transgene encoding PRO introduced into the germ line of the animal at an embryonic stage can be used to examine the effect of increased expression of DNA encoding PRO. Such animals can be used as tester animals for reagents thought to confer protection from, for example, pathological conditions associated with its overexpression. In accordance with this facet of the invention, an animal is treated with the reagent and a reduced incidence of the pathological condition, compared to untreated animals bearing the transgene, would indicate a potential therapeutic intervention for the pathological condition.
- Alternatively, non-human homologues of PRO can be used to construct a PRO “knock out” animal which has a defective or altered gene encoding PRO as a result of homologous recombination between the endogenous gene encoding PRO and altered genomic DNA encoding PRO introduced into an embryonic stem cell of the animal. For example, cDNA encoding PRO can be used to clone genomic DNA encoding PRO in accordance with established techniques. A portion of the genomic DNA encoding PRO can be deleted or replaced with another gene, such as a gene encoding a selectable marker which can be used to monitor integration. Typically, several kilobases of unaltered flanking DNA (both at the 5′ and 3′ ends) are included in the vector [see e.g., Thomas and Capecchi,Cell, 51:503 (1987) for a description of homologous recombination vectors]. The vector is introduced into an embryonic stem cell line (e.g., by electroporation) and cells in which the introduced DNA has homologously recombined with the endogenous DNA are selected [see e.g., Li et al., Cell, 69:915 (1992)]. The selected cells are then injected into a blastocyst of an animal (e.g., a mouse or rat) to form aggregation chimeras [see e.g., Bradley, in Teratocarcinomas and Embryonic Stem Cells: A Practical Approach, E. J. Robertson, ed. (IRL, Oxford, 1987), pp. 113-152]. A chimeric embryo can then be implanted into a suitable pseudopregnant female foster animal and the embryo brought to term to create a “knock out” animal. Progeny harboring the homologously recombined DNA in their germ cells can be identified by standard techniques and used to breed animals in which all cells of the animal contain the homologously recombined DNA. Knockout animals can be characterized for instance, for their ability to defend against certain pathological conditions and for their development of pathological conditions due to absence of the PRO polypeptide.
- Nucleic acid encoding the PRO polypeptides may also be used in gene therapy. In gene therapy applications, genes are introduced into cells in order to achieve in vivo synthesis of a therapeutically effective genetic product, for example for replacement of a defective gene. “Gene therapy” includes both conventional gene therapy where a lasting effect is achieved by a single treatment, and the administration of gene therapeutic agents, which involves the one time or repeated administration of a therapeutically effective DNA or mRNA. Antisense RNAs and DNAs can be used as therapeutic agents for blocking the expression of certain genes in vivo. It has already been shown that short antisense oligonucleotides can be imported into cells where they act as inhibitors, despite their low intracellular concentrations caused by their restricted uptake by the cell membrane. (Zamecnik et al.,Proc. Natl. Acad. Sci. USA 83:4143-4146[1986]). The oligonucleotides can be modified to enhance their uptake, e.g. by substituting their negatively charged phosphodiester groups by uncharged groups.
- There are a variety of techniques available for introducing nucleic acids into viable cells. The techniques vary depending upon whether the nucleic acid is transferred into cultured cells in vitro, or in vivo in the cells of the intended host. Techniques suitable for the transfer of nucleic acid into mammalian cells in vitro include the use of liposomes, electroporation, microinjection, cell fusion, DEAE-dextran, the calcium phosphate precipitation method, etc. The currently preferred in vivo gene transfer techniques include transfection with viral (typically retroviral) vectors and viral coat protein-liposome mediated transfection (Dzau et al.,Trends in Biotechnology 11,205-210[1993]). In some situations it is desirable to provide the nucleic acid source with an agent that targets the target cells, such as an antibody specific for a cell surface membrane protein or the target cell, a ligand for a receptor on the target cell, etc. Where liposomes are employed, proteins which bind to a cell surface membrane protein associated with endocytosis may be used for targeting and/or to facilitate uptake, e.g. capsid proteins or fragments thereof tropic for aparticular cell type, antibodies forproteins which undergo internalization in cycling, proteins that target intracellular localization and enhance intracellular half-life. The technique of receptor-mediated endocytosis is described, for example, by Wu et al., J. Biol. Chem. 262,4429-4432 (1987); and Wagner et al., Proc. Natl. Acad. Sci. USA 87, 3410-3414 (1990). For review of gene marking and gene therapy protocols see Anderson et al., Science 256, 808-813 (1992).
- The PRO polypeptides described herein may also be employed as molecular weight markers for protein electrophoresis purposes and the isolated nucleic acid sequences may be used for recombinantly expressing those markers.
- The nucleic acid molecules encoding the PRO polypeptides or fragments thereof described herein are useful for chromosome identification. In this regard, there exists an ongoing need to identify new chromosome markers, since relatively few chromosome marking reagents, based upon actual sequence data are presently available. Each PRO nucleic acid molecule of the present invention can be used as a chromosome marker.
- The PRO polypeptides and nucleic acid molecules of the present invention may also be used diagnostically for tissue typing, wherein the PRO polypeptides of the present invention may be differentially expressed in one tissue as compared to another, preferably in a diseased tissue as compared to a normal tissue of the same tissue type. PRO nucleic acid molecules will find use for generating probes for PCR, Northern analysis, Southern analysis and Western analysis.
- The PRO polypeptides described herein may also be employed as therapeutic agents. The PRO polypeptides of the present invention can be formulated according to known methods to prepare pharmaceutically useful compositions, whereby the PRO product hereof is combined in admixture with a pharmaceutically acceptable carrier vehicle. Therapeutic formulations are prepared for storage by mixing the active ingredient having the desired degree of purity with optional physiologically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions. Acceptable carriers, excipients or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone, amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEEN™, PLURONICS™ or PEG.
- The formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes, prior to or following lyophilization and reconstitution.
- Therapeutic compositions herein generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
- The route of administration is in accord with known methods, e.g. injection or infusion by intravenous, intraperitoneal, intracerebral, intramuscular, intraocular, intraarterial or intralesional routes, topical administration, or by sustained release systems.
- Dosages and desired drug concentrations of pharmaceutical compositions of the present invention may vary depending on the particular use envisioned. The determination of the appropriate dosage or route of administration is well within the skill of an ordinary physician. Animal experiments provide reliable guidance for the determination of effective doses for human therapy. Interspecies scaling of effective doses can be performed following the principles laid down by Mordenti, J. and Chappell, W. “The use of interspecies scaling in toxicokinetics” In Toxicokinetics and New Drug Development, Yacobi et al., Eds., Pergamon Press, New York 1989, pp. 42-96.
- When in vivo administration of a PRO polypeptide or agonist or antagonist thereof is employed, normal dosage amounts may vary from about 10 nglkg to up to 100 mg/kg of mammal body weight or more per day, preferably about 1 itg/kg/day to 10 mg/kg/day, depending upon the route of administration. Guidance as to particular dosages and methods of delivery is provided in the literature; see, for example, U.S. Pat. Nos. 4,657,760; 5,206,344; or 5,225,212. It is anticipated that different formulations will be effective for different treatment compounds and different disorders, that administration targeting one organ or tissue, for example, may necessitate delivery in a manner different from that to another organ or tissue.
- Where sustained-release administration of a PRO polypeptide is desired in a formulation with release characteristics suitable for the treatment of any disease or disorder requiring administration of the PRO polypeptide, microencapsulation of the PRO polypeptide is contemplated. Microencapsulation of recombinant proteins for sustained release has been successfully performed with human growth hormone (rhGH), interferon-(rhIFN-), interleukin-2, and MN rgp120. Johnson et al.,Nat. Med., 2:795-799 (1996); Yasuda, Biomed. Ther., 27:1221-1223 (1993); Hora et al., Bio/Technology, 8:755-758 (1990); Cleland, “Design and Production of Single Immunization Vaccines Using Polylactide Polyglycolide Microsphere Systems,” in Vaccine Design: The Subunit and Adjuvant Approach, Powell and Newman, eds, (Plenum Press: New York, 1995), pp. 439-462; WO 97/03692, WO 96/40072, WO 96/07399; and U.S. Pat. No. 5,654,010.
- The sustained-release formulations of these proteins were developed using poly-lactic-coglycolic acid (PLGA) polymer due to its biocompatibility and wide range of biodegradable properties. The degradation products of PLGA, lactic and glycolic acids, can be cleared quickly within the human body. Moreover, the degradability of this polymer can be adjusted from months to years depending on its molecular weight and composition. Lewis, “Controlled release of bioactive agents from lactide/glycolide polymer,” in: M. Chasin and R. Langer (Eds.),Biodegradable Polymers as Drug Delivery Systems (Marcel Dekker: New York, 1990), pp. 1-41.
- This invention encompasses methods of screening compounds to identify those that mimic the PRO polypeptide (agonists) or prevent the effect of the PRO polypeptide (antagonists). Screening assays for antagonist drug candidates are designed to identify compounds that bind or complex with the PRO polypeptides encoded by the genes identified herein, or otherwise interfere with the interaction of the encoded polypeptides with other cellular proteins. Such screening assays will include assays amenable to high-throughput screening of chemical libraries, making them particularly suitable for identifying small molecule drug candidates.
- The assays can be performed in a variety of formats, including protein-protein binding assays, biochemical screening assays, immunoassays, and cell-based assays, which are well characterized in the art.
- All assays for antagonists are common in that they call for contacting the drug candidate with a PRO polypeptide encoded by a nucleic acid identified herein under conditions and for a time sufficient to allow these two components to interact.
- In binding assays, the interaction is binding and the complex formed can be isolated or detected in the reaction mixture. In a particular embodiment, the PRO polypeptide encoded by the gene identified herein or the drug candidate is immobilized on a solid phase, e.g., on a microtiter plate, by covalent or non-covalent attachments. Non-covalent attachment generally is accomplished by coating the solid surface with a solution of the PRO polypeptide and drying. Alternatively, an immobilized antibody, e.g., a monoclonal antibody, specific for the PRO polypeptide to be immobilized can be used to anchor it to a solid surface. The assay is performed by adding the non-immobilized component, which may be labeled by a detectable label, to the immobilized component, e.g., the coated surface containing the anchored component. When the reaction is complete, the non-reacted components are removed, e.g., by washing, and complexes anchored on the solid surface are detected. When the originally non-immobilized component carries a detectable label, the detection of label immobilized on the surface indicates that complexing occurred. Where the originally non-immobilized component does not carry a label, complexing can be detected, for example, by using a labeled antibody specifically binding the immobilized complex.
- If the candidate compound interacts with but does not bind to a particular PRO polypeptide encoded by a gene identified herein, its interaction with that polypeptide can be assayed by methods well known for detecting protein-protein interactions. Such assays include traditional approaches, such as, e.g., cross-linking, co-immunoprecipitation, and co-purification through gradients or chromatographic columns. In addition, protein-protein interactions can be monitored by using a yeast-based genetic system described by Fields and co-workers (Fields and Song,Nature (London), 340:245-246 (1989); Chien et al., Proc. Natl. Acad. Sci. USA, 88:9578-9582 (1991)) as disclosed by Chevray and Nathans, Proc. Natl. Acad. Sci. USA, 89: 5789-5793 (1991). Many transcriptional activators, such as yeast GALA, consist of two physically discrete modular domains, one acting as the DNA-binding domain, the other one functioning as the transcription-activation domain. The yeast expression system described in the foregoing publications (generally referred to as the “two-hybrid system”) takes advantage of this property, and employs two hybrid proteins, one in which the target protein is fused to the DNA-binding domain of GALA, and another, in which candidate activating proteins are fused to the activation domain. The expression of a GALl-lacZ reporter gene under control of a GALA-activated promoter depends on reconstitution of GALA activity via protein-protein interaction. Colonies containing interacting polypeptides are detected with a chromogenic substrate for β-galactosidase. A complete kit (MATCHRAKER™) for identifying protein-protein interactions between two specific proteins using the two-hybrid technique is commercially available from Clontech. This system can also be extended to map protein domains involved in specific protein interactions as well as to pinpoint amino acid residues that are crucial for these interactions.
- Compounds that interfere with the interaction of a gene encoding a PRO polypeptide identified herein and other intra- or extracellular components can be tested as follows: usually a reaction mixture is prepared containing the product of the gene and the intra- or extracellular component under conditions and for a time allowing for the interaction and binding of the two products. To test the ability of a candidate compound to inhibit binding, the reaction is run in the absence and in the presence of the test compound. In addition, a placebo may be added to a third reaction mixture, to serve as positive control. The binding (complex formation) between the test compound and the intra- or extracellular component present in the mixture is monitored as described hereinabove. The formation of a complex in the control reaction(s) but not in the reaction mixture containing the test compound indicates that the test compound interferes with the interaction of the test compound and its reaction partner.
- To assay for antagonists, the PRO polypeptide may be added to a cell along with the compound to be screened for a particular activity and the ability of the compound to inhibit the activity of interest in the presence of the PRO polypeptide indicates that the compound is an antagonist to the PRO polypeptide. Alternatively, antagonists may be detected by combining the PRO polypeptide and a potential antagonist with membrane-bound PRO polypeptide receptors or recombinant receptors under appropriate conditions for a competitive inhibition assay. The PRO polypeptide can be labeled, such as by radioactivity, such that the number of PRO polypeptide molecules bound to the receptor can be used to determine the effectiveness of the potential antagonist. The gene encoding the receptor can be identified by numerous methods known to those of skill in the art, for example, ligand panning and FACS sorting. Coligan et al.,Current Protocols in Immun., 1(2): Chapter 5 (1991). Preferably, expression cloning is employed wherein polyadenylated RNA is prepared from a cell responsive to the PRO polypeptide and a cDNA library created from this RNA is divided into pools and used to transfect COS cells or other cells that are not responsive to the PRO polypeptide. Transfected cells that are grown on glass slides are exposed to labeled PRO polypeptide. The PRO polypeptide can be labeled by a variety of means including iodination or inclusion of a recognition site for a site-specific protein kinase. Following fixation and incubation, the slides are subjected to autoradiographic analysis. Positive pools are identified and sub-pools are prepared and re-transfected using an interactive sub-pooling and re-screening process, eventually yielding a single clone that encodes the putative receptor.
- As an alternative approach for receptor identification, labeled PRO polypeptide can be photoaffinity-linked with cell membrane or extract preparations that express the receptor molecule. Cross-linked material is resolved by PAGE and exposed to X-ray film. The labeled complex containing the receptor can be excised, resolved into peptide fragments, and subjected to protein micro-sequencing. The amino acid sequence obtained from micro- sequencing would be used to design a set of degenerate oligonucleotide probes to screen a cDNA library to identify the gene encoding the putative receptor.
- In another assay for antagonists, mammalian cells or a membrane preparation expressing the receptor would be incubated with labeled PRO polypeptide in the presence of the candidate compound. The ability of the compound to enhance or block this interaction could then be measured.
- More specific examples of potential antagonists include an oligonucleotide that binds to the fusions of immunoglobulin with PRO polypeptide, and, in particular, antibodies including, without limitation, poly- and monoclonal antibodies and antibody fragments, single-chain antibodies, anti-idiotypic antibodies, and chimeric or humanized versions of such antibodies or fragments, as well as human antibodies and antibody fragments. Alternatively, a potential antagonist may be a closely related protein, for example, a mutated form of the PRO polypeptide that recognizes the receptor but imparts no effect, thereby competitively inhibiting the action of the PRO polypeptide.
- Another potential PRO polypeptide antagonist is an antisense RNA or DNA construct prepared using antisense technology, where, e.g., an antisense RNA or DNA molecule acts to block directly the translation of mRNA by hybridizing to targeted mRNA and preventing protein translation. Antisense technology can be used to control gene expression through triple-helix formation or antisense DNA or RNA, both of which methods are based on binding of apolynucleotide to DNA or RNA. For example, the 5′coding portion of the polynucleotide sequence, which encodes the mature PRO polypeptides herein, is used to design an antisense RNA oligonucleotide of from about 10 to 40 base pairs in length. A DNA oligonucleotide is designed to be complementary to a region of the gene involved in transcription (triple helix—see Lee et al.,Nucl. Acids Res., 6:3073 (1979); Cooney et al., Science, 241: 456 (1988); Dervan et al., Science, 251:1360 (1991)), thereby preventing transcription and the production of the PRO polypeptide. The antisense RNA oligonucleotide hybridizes to the mRNA in vivo and blocks translation of the mRNA molecule into the PRO polypeptide (antisense—Okano, Neurochem., 56:560 (1991); Oligodeoxynucleotides as Antisense Inhibitors of Gene Expression (CRC Press: Boca Raton, Fla., 1988). The oligonucleotides described above can also be delivered to cells such that the antisense RNA or DNA may be expressed in vivo to inhibit production of the PRO polypeptide. When antisense DNA is used, oligodeoxyribonucleotides derived from the translation-initiation site, e.g., between about −10 and +10 positions of the target gene nucleotide sequence, are preferred.
- Potential antagonists include small molecules that bind to the active site, the receptor binding site, or growth factor or other relevant binding site of the PRO polypeptide, thereby blocking the normal biological activity of the PRO polypeptide. Examples of small molecules include, but are not limited to, small peptides or peptide-like molecules, preferably soluble peptides, and synthetic non-peptidyl organic or inorganic compounds.
- Ribozymes are enzymatic RNA molecules capable of catalyzing the specific cleavage of RNA. Ribozymes act by sequence-specific hybridization to the complementary target RNA, followed by endonucleolytic cleavage. Specific ribozyme cleavage sites within a potential RNA target can be identified by known techniques. For further details see, e.g., Rossi,Current Biology, 4:469471 (1994), and PCT publication No. WO 97/33551 (published Sep. 18, 1997).
- Nucleic acid molecules in triple-helix formation used to inhibit transcription should be single-stranded and composed of deoxynucleotides. The base composition of these oligonucleotides is designed such that it promotes triple-helix formation via Hoogsteen base-pairing rules, which generally require sizeable stretches of purines or pyrimidines on one strand of a duplex. For further details see, e.g., PCT publication No. WO 97/33551, supra.
- These small molecules can be identified by any one or more of the screening assays discussed hereinabove and/or by any other screening techniques well known for those skilled in the art.
- Diagnostic and therapeutic uses of the herein disclosed molecules may also be based upon the positive functional assay hits disclosed and described below.
- F. Anti-PRO Antibodies
- The present invention further provides anti-PRO antibodies. Exemplary antibodies include polyclonal, monoclonal, humanized, bispecific, and heteroconjugate antibodies.
- 1. Polyclonal Antibodies
- The anti-PRO antibodies may comprise polyclonal antibodies. Methods of preparing polyclonal antibodies are known to the skilled artisan. Polyclonal antibodies can be raised in a mammal, for example, by one or more injections of an immunizing agent and, if desired, an adjuvant. Typically, the immunizing agent and/or adjuvant will be injected in the mammal by multiple subcutaneous or intraperitoneal injections. The immunizing agent may include the PRO polypeptide or a fusion protein thereof. It may be useful to conjugate the immunizing agent to aprotein known to be immunogenic in the mammal being immunized. Examples of such immunogenic proteins include but are not limited to keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, and soybean trypsin inhibitor. Examples of adjuvants which may be employed include Freund's complete adjuvant and MPL-TDM adjuvant (monophosphoryl Lipid A, synthetic trehalose dicorynomycolate). The immunization protocol may be selected by one skilled in the art without undue experimentation.
- 2. Monoclonal Antibodies
- The anti-PRO antibodies may, alternatively, be monoclonal antibodies. Monoclonal antibodies may be prepared using hybridoma methods, such as those described by Kohler and Milstein,Nature, 256:495 (1975). In a hybridoma method, a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent. Alternatively, the lymphocytes may be immunized in vitro.
- The immunizing agent will typically include the PRO polypeptide or a fusion protein thereof. Generally, either peripheral blood lymphocytes (“PBLs”) are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell [Goding,Monoclonal Antibodies: Principles and Practice, Academic Press, (1986) pp. 59-103]. Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells may be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells. For example, if the parental cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (“HAT medium”), which substances prevent the growth of HGPRT-deficient cells.
- Preferred immortalized cell lines are those that fuse efficiently, support stable high level expression of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. More preferred immortalized cell lines are murine myeloma lines, which can be obtained, for instance, from the Salk Institute Cell Distribution Center, San Diego, California and the American Type Culture Collection, Manassas, Virginia. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies [Kozbor,J. Immunol., 133:3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, Marcel Dekker, Inc., New York, (1987) pp. 51-63].
- The culture medium in which the hybridoma cells are cultured can then be assayed for the presence of monoclonal antibodies directed against PRO. Preferably, the binding specificity of monoclonal antibodies produced by the hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA). Such techniques and assays are known in the art. The binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson and Pollard,Anal. Biochem., 107:220 (1980).
- After the desired hybridoma cells are identified, the clones may be subdloned by limiting dilution procedures and grown by standard methods [Goding, supra]. Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium and RPMI-1640 medium. Alternatively, the hybridoma cells may be grown in vivo as ascites in a mammal.
- The monoclonal antibodies secreted by the subclones may be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
- The monoclonal antibodies may also be made by recombinant DNA methods, such as those described in U.S. Pat. No. 4,816,567. DNA encoding the monoclonal antibodies of the invention can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). The hybridoma cells of the invention serve as a preferred source of such DNA. Once isolated, the DNA may be placed into expression vectors, which are then transfected into host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. The DNA also may be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences [U.S. Pat. No. 4,816,567; Morrison et al., u or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. Such a non-immunoglobulin polypeptide can be substituted for the constant domains of an antibody of the invention, or can be substituted for the variable domains of one antigen-combining site of an antibody of the invention to create a chimeric bivalent antibody.
- The antibodies may be monovalent antibodies. Methods for preparing monovalent antibodies are well known in the art. For example, one method involves recombinant expression of immunoglobulin light chain and modified heavy chain. The heavy chain is truncated generally at any point in the Fc region so as to prevent heavy chain crosslinking. Alternatively, the relevant cysteine residues are substituted with another amino acid residue or are deleted so as to prevent crosslinking.
- In vitro methods are also suitable for preparing monovalent antibodies. Digestion of antibodies to produce fragments thereof, particularly, Fab fragments, can be accomplished using routine techniques known in the art.
- 3. Human and Humanized Antibodies
- The anti-PRO antibodies of the invention may further comprise humanized antibodies or human antibodies. Humanized forms of non-human (e.g., murine) antibodies are chimeric inununoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab′, F(ab′)2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human inmuunoglobulin. Humanized antibodies include human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity. In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin [Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol., 2:593-596(1992)].
- Methods for humanizing non-human antibodies are well known in the art. Generally, a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as “import” residues, which are typically taken from an “import” variable domain. Humanization can be essentially performed following the method of Winter and co-workers [Jones et al.,Nature, 321:522-525 (1986); Riechmann et al., Nature 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)], by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. Accordingly, such “humanized” antibodies are chimeric antibodies (U.S. Pat. No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
- Human antibodies can also be produced using various techniques known in the art, including phage display libraries [Hoogenboom and Winter,J. Mol. Biol. 227:381 (1991); Marks et al., J. Mol. Biol. 222:581 (1991)]. The techniques of Cole et al. and Boerner et al. are also available for the preparation of human monoclonal antibodies (Cole et al., Monoclonal Antibodies and Cancer Therany, Alan R. Liss, p.77 (1985) and Boerner et al., J. Immunol., 147(1):86-95 (1991)]. Similarly, human antibodies can be made by introducing of human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,016, and in the following scientific publications: Marks etal, Bio/
Technology 10, 779-783 (1992); Lonberg et al., Nature 368 856-859 (1994); Morrison, Nature 368, 812-13 (1994); Fishwild et al., Nature Biotechnology 14, 845-51 (1996); Neuberger, Nature Biotechnology 14, 826 (1996); Lonberg and Huszar, Intern. Rev. Immunol. 13 65-93 (1995). - The antibodies may also be affinity matured using known selection and/or mutagenesis methods as described above. Preferred affinity matured antibodies have an affinity which is five times, more preferably 10 times, even more preferably 20 or 30 times greater than the starting antibody (generally murine, humanized or human) from which the matured antibody is prepared.
- 4. Bispecific Antibodies
- Bispecific antibodies are monoclonal, preferably human or humanized, antibodies that have binding specificities for at least two different antigens. In the present case, one of the binding specificities is for the PRO, the other one is for any other antigen, and preferably for a cell-surface protein or receptor or receptor subunit.
- Methods for making bispecific antibodies are known in the art. Traditionally, the recombinant production of bispecific antibodies is based on the co-expression of two immunoglobulin heavy-chain/light-chain pairs, where the two heavy chains have different specificities [Milstein and Cuello,Nature 305:537-539 (1983)]. Because of the random assortment of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture of ten different antibody molecules, of which only one has the correct bispecific structure. The purification of the correct molecule is usually accomplished by affinity chromatography steps. Similar procedures are disclosed in WO 93/08829, published 13 May 1993, and in Traunecker et al., EMBO J., 10:3655-3659 (1991).
- Antibody variable domains with the desired binding specificities (antibody-antigen combining sites) can be fused to immunoglobulin constant domain sequences. The fusion preferably is with an immunoglobulin heavy-chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is preferred to have the first heavy-chain constant region (CHI) containing the site necessary for light-chain binding present in at least one of the fusions. DNAs encoding the immunoglobulin heavy-chain fusions and, if desired, the immunoglobulin light chain, are inserted into separate expression vectors, and are co-transfected into a suitable host organism. For further details of generating bispecific antibodies see, for example, Suresh et al.,Methods in Enzymology, 121:210 (1986).
- According to another approach described in WO 96/27011, the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers which are recovered from recombinant cell culture. The preferred interface comprises at least a part of the CH3 region of an antibody constant domain. In this method, one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g. tyrosine or tryptophan). Compensatory “cavities” of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine). This provides a mechanism for increasing the yield of the heterodimer over other unwanted end-products such as homodimers.
- Bispecific antibodies can be prepared as full length antibodies or antibody fragments (e.g. F(ab′)2 bispecific antibodies). Techniques for generating bispecific antibodies from antibody fragments have been described in the literature. For example, bispecific antibodies can be prepared can be prepared using chemical linkage. Brennan et al., Science 229:81 (1985) describe a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab′)2 fragments. These fragments are reduced in the presence of the dithiol complexing agent sodium arsenite to stabilize vicinal dithiols and prevent intermolecular disulfide formation. The Fab′ fragments generated are then converted to thionitrobenzoate (TNB) derivatives. One of the Fab′-TNB derivatives is then reconverted to the Fab′-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab′-TNB derivative to form the bispecific antibody. The bispecific antibodies produced can be used as agents for the selective immobilization of enzymes.
- Fab′ fragments may be directly recovered fromE. coli and chemically coupled to form bispecific antibodies. Shalaby et al., J. Exp. Med. 175:217-225 (1992) describe the production of a fully humanized bispecific antibody F(ab′)2 molecule. Each Fab′ fragment was separately secreted from E. coli and subjected to directed chemical coupling in vitro to form the bispecific antibody. The bispecific antibody thus formed was able to bind to cells overexpressing the ErbB2 receptor and normal human T cells, as well as trigger the lytic activity of human cytotoxic lymphocytes against human breast tumor targets.
- Various technique for making and isolating bispecific antibody fragments directly from recombinant cell culture have also been described. For example, bispecific antibodies have been produced using leucine zippers. Kostelny etal,J. Immunol. 148(5):1547-1553 (1992). The leucine zipper peptides from the Fos and Jun proteins were linked to the Fab′ portions of two different antibodies by gene fusion. The antibody homodimers were reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers. This method can also be utilized for the production of antibody homodimers. The “diabody” technology described by Hollinger et al., Proc. Natl. Acad. Sci. USA 90:6444-6448 (1993) has provided an alternative mechanism for making bispecific antibody fragments. The fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the VH and VL domains of one fragment are forced to pair with the complementary VL and VH domains of another fragment, thereby forming two antigen-binding sites. Another strategy for making bispecific antibody fragments by the use of single-chain Fv (sFv) dimers has also been reported. See, Gruber et al., J. Immunol. 152:5368 (1994).
- Antibodies with more than two valencies are contemplated. For example, trispecific antibodies can be prepared. Tutt et al.,J. Immunol. 147:60 (1991).
- Exemplary bispecific antibodies may bind to two different epitopes on a given PRO polypeptide herein. Alternatively, an anti-PRO polypeptide arm may be combined with an arm which binds to a triggering molecule on a leukocyte such as a T-cell receptor molecule (e.g. CD2, CD3, CD28, or B7), or Fc receptors for IgG (FcγR), such as FcγRI (CD64), FcγRII (CD32) and FcγRIII (CD16) so as to focus cellular defense mechanisms to the cell expressing the particular PRO polypeptide. Bispecific antibodies may also be used to localize cytotoxic agents to cells which express a particular PRO polypeptide. These antibodies possess a PRO-binding arm and an arm which binds a cytotoxic agent or a radionuclide chelator, such as EOTUBE, DPTA, DOTA, or TETA. Another bispecific antibody of interest binds the PRO polypeptide and further binds tissue factor (Th).
- 5. Heteroconjugate Antibodies
- Heteroconjugate antibodies are also within the scope of the present invention. Heteroconjugate antibodies are composed of two covalently joined antibodies. Such antibodies have, for example, been proposed to target immune system cells to unwanted cells [U.S. Pat. No.4,676,980], and for treatment of HIV infection [WO 91/00360; WO 92/200373; EP 03089]. It is contemplated that the antibodies may be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents. For example, immunotoxins may be constructed using a disulfide exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include irninothiolate and methyl-4-mercaptobutyrimidate and those disclosed, for example, in U.S. Pat. No. 4,676,980.
- 6. Effector Function Engineering
- It may be desirable to modify the antibody of the invention with respect to effector function, so as to enhance, e.g., the effectiveness of the antibody in treating cancer. For example, cysteine residue(s) may be introduced into the Fc region, thereby allowing interchain disulfide bond formation in this region. The homodimeric antibody thus generated may have improved internalization capability and/or increased complement-mediated cell killing and antibody-dependent cellular cytotoxicity (ADCC). See Caron et al.,J. Exp Med., 176:
-
- 7. Immunoconjugates
- The invention also pertains to immunoconjugates comprising an antibody conjugated to a cytotoxic agent 20 such as a chemotherapeutic agent, toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
- Chemotherapeutic agents useful in the generation of such immunoconjugates have been described above. Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (fromPseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes. A variety of radionuclides are available for the production of radioconjugated antibodies. Examples include 212Bi, 131I, 131In, 90Y, and 186Re. Conjugates of the antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as his (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as
tolyene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et al., Science, 238: 1098 (1987). Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See WO94/11026. - In another embodiment, the antibody may be conjugated to a “receptor” (such streptavidin) for utilization in tumor pretargeting wherein the antibody-receptor conjugate is administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and then administration of a “ligand” (e.g., avidin) that is conjugated to a cytotoxic agent (e.g., a radionucleotide).
- 8. Immunoliposomes
- The antibodies disclosed herein may also be formulated as immunoliposomes. Liposomes containing the antibody are prepared by methods known in the art, such as described in Epstein et al.,Proc. Natl. Acad. Sci. USA, 82: 3688 (1985); Hwang et al., Proc. Natl Acad. Sci. USA, 77: 4030 (1980); and U.S. Pat. Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Pat. No. 5,013,556.
- Particularly useful liposomes can be generated by the reverse-phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter. Fab′ fragments of the antibody of the present invention can be conjugated to the liposomes as described in Martin et al.,J. Biol. Chem. 257: 286-288 (1982) via adisulfide-interchange reaction. A chemotherapeutic agent (such as Doxorubicin) is optionally contained within the liposome. See Gabizon et al., J. National Cancer Inst.,81(19): 1484 (1989).
- 9. Pharmaceutical Compositions of Antibodies
- Antibodies specifically binding a PRO polypeptide identified herein, as well as other molecules identified by the screening assays disclosed hereinbefore, can be administered for the treatment of various disorders in the form of pharmaceutical compositions.
- If the PRO polypeptide is intracellular and whole antibodies are used as inhibitors, internalizing antibodies are preferred. However, lipofections or liposomes can also be used to deliver the antibody, or an antibody fragment, into cells. Where antibody fragments are used, the smallest inhibitory fragment that specifically binds to the binding domain of the target protein is preferred. For example, based upon the variable-region sequences of an antibody, peptide molecules can be designed that retain the ability to bind the target protein sequence. Such peptides can be synthesized chemically and/or produced by recombinant DNA technology. See, e.g., Marasco et al.,Proc. Natl. Acad. Sci. USA, 90:7889-7893 (1993). The formulation herein may also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other. Alternatively, or in addition, the composition may comprise an agent that enhances its function, such as, for example, a cytotoxic agent, cytokine, chemotherapeutic agent, or growth-inhibitory agent. Such molecules are suitably present in combination in amounts that are effective for the purpose intended.
- The active ingredients may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington'sPharmaceutical Sciences, supra.
- The formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.
- Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), orpoly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutarnic acid and γ ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT™ (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(−)-3-hydroxybutyric acid. While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods. When encapsulated antibodies remain in the body for a long time, they may denature or aggregate as a result of exposure to moisture at 37 ° C., resulting in a loss of biological activity and possible changes in immunogenicity. Rational strategies can be devised for stabilization depending on the mechanism involved. For example, if the aggregation mechanism is discovered to be intermolecular S-S bond formation through thio-disulfide interchange, stabilization may be achieved by modifying sulfhydryl residues, lyophilizing from acidic solutions, controlling moisture content, using appropriate additives, and developing specific polymer matrix compositions.
- G. Uses for anti-PRO Antibodies
- The anti-PRO antibodies of the invention have various utilities. For example, anti-PRO antibodies may be used in diagnostic assays for PRO, e.g., detecting its expression (and in some cases, differential expression) in specific cells, tissues, or serum. Various diagnostic assay techniques known in the art may be used, such as competitive binding assays, direct or indirect sandwich assays and inmunoprecipitation assays conducted in either heterogeneous or homogeneous phases [Zola,Monoclonal Antibodies: A Manual of Techniques, CRC Press, Inc. (1987) pp. 147-158]. The antibodies used in the diagnostic assays can be labeled with a detectable moiety. The detectable moiety should be capable of producing, either directly or indirectly, a detectable signal. For example, the detectable moiety may be a radioisotope, such as 3H, 14C, 32P, 35S, or 125I, a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate, rhodamine, or luciferin, or an enzyme, such as alkaline phosphatase, beta-galactosidase or horseradish peroxidase. Any method known in the art for conjugating the antibody to the detectable moiety may be employed, including those methods described by Hunter et al., Nature, 144:945 (1962); David et al., Biochemistry, 13:1014 (1974); Pain et al., J. Immunol. Meth., 40:219 (1981); and Nygren, J. Histochem and Cytochem., 30:407 (1982).
- Anti-PRO antibodies also are useful for the affinity purification of PRO from recombinant cell culture or natural sources. In this process, the antibodies against PRO are immobilized on a suitable support, such a Sephadex resin or filter paper, using methods well known in the art. The immobilized antibody then is contacted with a sample containing the PRO to be purified, and thereafter the support is washed with a suitable solvent that will remove substantially all the material in the sample except the PRO, which is bound to the immobilized antibody. Finally, the support is washed with another suitable solvent that will release the PRO from the antibody.
- The following examples are offered for illustrative purposes only, and are not intended to limit the scope of the present invention in any way.
- All patent and literature references cited in the present specification are hereby incorporated by reference in their entirety.
- Commercially available reagents referred to in the examples were used according to manufacturer's instructions unless otherwise indicated. The source of those cells identified in the following examples, and throughout the specification, by ATCC accession numbers is the American Type Culture Collection, Manassas, Va.
- Extracellular Domain Homology Screening to Identify Novel Polypeptides and cDNA Encoding Therefor
- The extracellular domain (ECD) sequences (including the secretion signal sequence, if any) from about 950 known secreted proteins from the Swiss-Prot public database were used to search EST databases. The EST databases included public databases (e.g., Dayhoff, GenBank), and proprietary databases (e.g. LIFESEQ™, Incyte Pharmaceuticals, Palo Alto, Calif.). The search was performed using the computer program BLAST or BLAST-2 (Altschul et al.,Methods in Enzvmology 266:460-480 (1996)) as a comparison of the ECD protein sequences to a 6 frame translation of the EST sequences. Those comparisons with a BLAST score of 70 (or in some cases 90) or greater that did not encode known proteins were clustered and assembled into consensus DNA sequences with the program “phrap” (Phil Green, University of Washington, Seattle, Wash.).
- Using this extracellular domain homology screen, consensus DNA sequences were assembled relative to the other identified EST sequences using phrap. In addition, the consensus DNA sequences obtained were often (but not always) extended using repeated cycles of BLAST or BLAST-2 and phrap to extend the consensus sequence as far as possible using the sources of EST sequences discussed above.
- Based upon the consensus sequences obtained as described above, oligonucleotides were then synthesized and used to identify by PCR a cDNA library that contained the sequence of interest and for use as probes to isolate a clone of the full-length coding sequence for a PRO polypeptide. Forward and reverse PCR primers generally range from 20 to 30 nucleotides and are often designed to give a PCR product of about 100-1000 bp in length. The probe sequences are typically 40-55 bp in length. In some cases, additional oligonucleotides are synthesized when the consensus sequence is greater than about 1-1.5 kbp. In order to screen several libraries for a full-length clone, DNA from the libraries was screened by PCR amplification, as per Ausubel et al.,Current Protocols in Molecular Biology, with the PCR primer pair. A positive library was then used to isolate clones encoding the gene of interest using the probe oligonucleotide and one of the primer pairs.
- The cDNA libraries used to isolate the cDNA clones were constructed by standard methods using commercially available reagents such as those from Invitrogen, San Diego, CA. The cDNA was primed with oligo dT containing a NotI site, linked with blunt to SalI hemikinased adaptors, cleaved with NotI, sized appropriately by gel electrophoresis, and cloned in a defined orientation into a suitable cloning vector (such as pRKB or pRKD; pRK5B is a precursor of pRK5D that does not contain the SfiI site; see, Holmes et al.,Science, 253:1278-1280 (1991)) in the unique XhoI and Noti sites.
- Isolation of cDNA clones by Amylase Screening
- 1. Preparation of Oligo dT Primed cDNA Library
- mRNA was isolated from a human tissue of interest using reagents and protocols from Invitrogen, San Diego, CA (Fast Track 2). This RNA was used to generate an oligo dT primed cDNA library in the vector pRK5D using reagents and protocols from Life Technologies, Gaithersburg, MD (Super Script Plasmid System). In this procedure, the double stranded cDNA was sized to greater than 1000 bp and the SalIINotl linkered cDNA was cloned into Xhol/Notl cleaved vector. pRK5D is a cloning vector that has an sp6 transcription initiation site followed by an SfiI restriction enzyme site preceding the XhoILNotI cDNA cloning sites.
- 2. Preparation of Random Primed cDNA Library
- A secondary cDNA library was generated in order to preferentially represent the 5′ ends of the primary cDNA clones. Sp6 RNA was generated from the primary library (described above), and this RNA was used to generate a random primed cDNA library in the vector pSST-AMY.0 using reagents and protocols from Life Technologies (Super Script Plasmid System, referenced above). In this procedure the double stranded cDNA was sized to 500-1000 bp, linkered with blunt to NotI adaptors, cleaved with SfiI, and cloned into SfiI/NotI cleaved vector. pSST-AMY.0 is a cloning vector that has a yeast alcohol dehydrogenase promoter preceding the cDNA cloning sites and the mouse amylase sequence (the mature sequence without the secretion signal) followed by the yeast alcohol dehydrogenase terminator, after the cloning sites. Thus, cDNAs cloned into this vector that are fused in frame with amylase sequence will lead to the secretion of amylase from appropriately transfected yeast colonies.
- 3. Transformation and Detection
- DNA from the library described in
paragraph 2 above was chilled on ice to which was added electrocompetent DH1OB bacteria (Life Technologies, 20 ml). The bacteria and vector mixture was then electroporated as recommended by the manufacturer. Subsequently, SOC media (Life Technologies, 1 ml) was added and the mixture was incubated at 37° C. for 30 minutes. The transformants were then plated onto 20 standard 150 mm LB plates containing ampicillin and incubated for 16 hours (37° C.). Positive colonies were scraped off the plates and the DNA was isolated from the bacterial pellet using standard protocols, e.g. CsCl-gradient. The purified DNA was then carried on to the yeast protocols below. - The yeast methods were divided into three categories: (1) Transformation of yeast with the plasmid/cDNA combined vector; (2) Detection and isolation of yeast clones secreting amylase; and (3) PCR amplification of the insert directly from the yeast colony and purification of the DNA for sequencing and further analysis.
- The yeast strain used was HD56-5A (ATCC-90785). This strain has the following genotype: MAT alpha, ura3-52, leu2-3, leu2-112, his3-11, his3-15, MAL+, SUC+, GAL+. Preferably, yeast mutants can be employed that have deficient post-translational pathways. Such mutants may have translocation deficient alleles in sec71, sec72, sec62, with truncated sec71 being most preferred. Alternatively, antagonists (including antisense nucleotides and/or ligands) which interfere with the normal operation of these genes, other proteins implicated in this post translation pathway (e.g., SEC61p, SEC72p, SEC62p, SEC63p, TDJ1p or SSA1p-4p) or the complex formation of these proteins may also be preferably employed in combination with the amylase-expressing yeast.
- Transformation was performed based on the protocol outlined by Gietz et al.,Nucl. Acid. Res., 20:1425 (1992). Transformed cells were then inoculated from agar into YEPD complex media broth (100 ml) and grown overnight at 30° C. The YEPD broth was prepared as described in Kaiser et al., Methods in Yeast Genetics, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., p. 207 (1994). The overnight culture was then diluted to about 2×106 cells/nlm (approx. OD600=0.1) into fresh YEPD broth (500 ml) and regrown to 1×107 cells/ml (approx. OD600=0.4-0.5).
- The cells were then harvested and prepared for transformation by transfer into GS3 rotor bottles in a Sorval GS3 rotor at 5,000 rpm for 5 minutes, the supernatant discarded, and then resuspended into sterile water, and centrifuged again in 50 ml falcon tubes at 3,500 rpm in a Beckman GS-6KR centrifuge. The supernatant was discarded and the cells were subsequently washed with LiAc/TE (10 ml, 10 mM Tris—HCl, 1 mM EDTA pH 7.5, 100 mM Li2OOCCH3), and resuspended into LiAc/TE (2.5 ml).
- Transformation took place by mixing the prepared cells (100 μl) with freshly denatured single stranded salmon testes DNA (Lofstrand Labs, Gaithersburg, Md.) and transforming DNA (1 μg, vol. <10 μl) in microfuge tubes. The mixture was mixed briefly by vortexing, then 40% PEG/TE (600 μl , 40% polyethylene glycol-4000, 10 mM Tris—HCl, 1 mM EDTA, 100 mM Li2OOCCH3, pH 7.5) was added. This mixture was gently mixed and incubated at 30° C. while agitating for 30 minutes. The cells were then heat shocked at 42° C. for 15 minutes, and the reaction vessel centrifuged in a microfuge at 12,000 rpm for 5-10 seconds, decanted and resuspended into TE (500 μl, 10 mM Tris—HCl, 1 mM EDTA pH 7.5) followed by recentrifugation. The cells were then diluted into TE (1 ml) and aliquots (200 μl) were spread onto the selective media previously prepared in 150 mm growth plates (VWR).
- Alternatively, instead of multiple small reactions, the transformation was performed using a single, large scale reaction, wherein reagent amounts were scaled up accordingly.
- The selective media used was a synthetic complete dextrose agar lacking uracil (SCD-Ura) prepared as described in Kaiser et al.,Methods in Yeast Genetics, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., p.208-210 (1994). Transformants were grown at 30° C. for 2-3 days.
- The detection of colonies secreting amylase was performed by including red starch in the selective growth media. Starch was coupled to the red dye (Reactive Red-120, Sigrna) as per the procedure described by Biely et al.,Anal. Biochem. 172:176-179 (1988). The coupled starch was incorporated into the SCD-Ura agar plates atafinal concentration of 0.15% (w/v), and was buffered withpotassiumphosphateto apH of 7.0 (50-100 mM final concentration).
- The positive colonies were picked and streaked across fresh selective media (onto 150 mm plates) in order to obtain well isolated and identifiable single colonies. Well isolated single colonies positive for amylase secretion were detected by direct incorporation of red starch into buffered SCD-Ura agar. Positive colonies were determined by their ability to break down starch resulting in a clear halo around the positive colony visualized directly.
- 4. Isolation of DNA by PCR Amplification
- When a positive colony was isolated, a portion of it was picked by a toothpick and diluted into sterile water (30 μl) in a 96 well plate. At this time, the positive colonies were either frozen and stored for subsequent analysis or immediately amplified. An aliquot of cells (5 μl) was used as a template for the PCR reaction in a 25 ul volume containing: 0.5 μl Klentaq (Clontech, Palo Alto, Calif.); 4.0 μl 10 mM dNfP's (Perkin Elmer-Cetus); 2.5 μl Kentaq buffer (Clontech); 0.25 μl
forward oligo 1; 0.25 μlreverse oligo 2; 12.5 μl distilled water. The sequence of theforward oligonucleotide 1 was: - 5′-TGTAAAACGACGGCCAGTTAAATAGACCTGCAATTATTAATCT-3′ (SEQ ID NO:553) The sequence of
reverse oligonucleotide 2 was: - 5′-CAGGAAACAGCTATGACCACCTGCACACCTGCAAATCCATT-3′ (SEQ ID NO:554)
- PCR was then performed as follows:
a. Denature 92° C., 5 minutes b. 3 cycles of: Denature 92° C., 30 seconds Anneal 59° C., 30 seconds Extend 72° C., 60 seconds c. 3 cycles of: Denature 92° C., 30 seconds Anneal 57° C., 30 seconds Extend 72° C., 60 seconds d. 25 cycles of: Denature 92° C., 30 seconds Anneal 55° C., 30 seconds Extend 72° C., 60 seconds e. Hold 4° C. - The underlined regions of the oligonucleotides annealed to the ADH promoter region and the amylase region, respectively, and amplified a 307 bp region from vector pSST-AMY.0 when no insert was present. Typically, the first 18 nucleotides of the 5′ end of these oligonucleotides contained annealing sites for the sequencing primers. Thus, the total product of the PCR reaction from an empty vector was 343 bp. However, signal sequence-fused cDNA resulted in considerably longer nucleotide sequences.
- Following the PCR, an aliquot of the reaction (5 μl) was examined by agarose gel electrophoresis in a 1% agarose gel using a Tris-Borate-EDTA (THE) buffering system as described by Sambrook et al., supra. Clones resulting in a single strong PCR product larger than 400 bp were further analyzed by DNA sequencing after purification with a 96 Qiaquick PCR clean-up column (Qiagen Inc., Chatsworth, Calif.).
- Isolation of cDNA Clones Using Signal Algorithm Analysis
- Various polypeptide-encoding nucleic acid sequences were identified by applying a proprietary signal sequence finding algorithm developed by Genentech, Inc. (South San Francisco, Calif.) upon ESTs as well as clustered and assembled EST fragments from public (e.g., GenBank) and/or private (LIFESEQ®, Incyte Pharmaceuticals, Inc., Palo Alto, Calif.) databases. The signal sequence algorithm computes a secretion signal score based on the character of the DNA nucleotides surrounding the first and optionally the second methionine codon(s) (ATG) at the 5′-end of the sequence or sequence fragment under consideration. The nucleotides following the first ATG must code for at least 35 unambiguous amino acids without any stop codons. If the first ATG has the required amnino acids, the second is not examined. If neither meets the requirement, the candidate sequence is not scored. In order to determine whether the EST sequence contains an authentic signal sequence, the DNA and corresponding amino acid sequences surrounding the ATG codon are scored using a set of seven sensors (evaluation parameters) known to be associated with secretion signals. Use of this algorithm resulted in the identification of numerous polypeptide-encoding nucleic acid sequences.
- Isolation of cDNA Clones Encoding Human PRO Polypeptides
- Using the techniques described in Examples 1 to 3 above, numerous full-length cDNA clones were identified as encoding PRO polypeptides as disclosed herein. These cDNAs were then deposited under the terms of the Budapest Treaty with the American Type Culture Collection, 10801 University Blvd., Manassas, Va. 20110-2209, USA (ATCC) as shown in Table 7 below.
TABLE 7 Material ATCC Dep. No. Deposit Date DNA16438-1387 209771 Apr. 14, 1998 DNA19360-2552 203654 Feb. 9, 1999 DNA33455-1548 PTA-127 May 25, 1999 DNA37155-2651 PTA-429 Jul. 27, 1999 DNA38269-2654 PTA-432 Jul. 27, 1999 DNA40619-1220 209525 Dec. 10, 1997 DNA44174-2513 203577 Jan. 12, 1999 DNA44675-2662 PTA-430 Jul. 27, 1999 DNA45408-2615 PTA-203 Jun. 8, 1999 DNA48606-1479 203040 Jul. 1, 1998 DNA52753-2656 PTA-611 Aug. 31, 1999 DNA53915-1258 209593 Jan. 21, 1998 DNA53991-2553 203649 Feb. 9, 1999 DNA54009-2517 203574 Jan. 12, 1999 DNA56055-1643 PTA-129 May 25, 1999 DNA57033-1403 209905 May 27, 1998 DNA57252-1453 203585 Jan. 12, 1999 DNA58799-1652 203665 Feb. 9, 1999 DNA59770-2652 PTA-427 Jul. 27, 1999 DNA59774-2665 PTA-615 Aug. 31, 1999 DNA60281-2518 203582 Jan. 12, 1999 DNA60736-2559 203838 Mar. 9, 1999 DNA61875-2653 PTA-428 Jul. 27, 1999 DNA62312-2558 203836 Mar. 9, 1999 DNA62849-1604 PTA-205 Jun. 8, 1999 DNA66307-2661 PTA-431 Jul. 27, 1999 DNA66677-2535 203659 Feb. 9, 1999 DNA71235-1706 203584 Jan. 12, 1999 DNA71289-2547 PTA-126 May 25, 1999 DNA73775-1707 PTA-128 May 25, 1999 DNA76385-1692 203664 Feb. 9, 1999 DNA76395-2527 203578 Jan. 12, 1999 DNA77622-2516 203554 Dec. 22, 1998 DNA77629-2573 203850 Mar. 16, 1999 DNA77645-2648 PTA-45 May 11, 1999 DNA79302-2521 203545 Dec. 22, 1998 DNA79865-2519 203544 Dec. 22, 1998 DNA80135-2655 PTA-234 Jun. 15, 1999 DNA80794-2568 203848 Mar. 16, 1999 DNA80796-2523 203555 Dec. 22, 1998 DNA80840-2605 203949 Apr. 20, 1999 DNA80899-2501 203539 Dec. 15, 1998 DNA81228-2580 203871 Mar. 23, 1999 DNA81761-2583 203862 Mar. 23, 1999 DNA82358-2738 PTA-510 Aug. 10, 1999 DNA82364-2538 203603 Jan. 20, 1999 DNA82424-2566 203813 Mar. 2, 1999 DNA82430-2557 203812 Mar. 2, 1999 DNA83500-2506 203391 Oct. 29, 1998 DNA83509-2612 203965 Apr. 27, 1999 DNA83560-2569 203816 Mar. 2, 1999 DNA84139-2555 203814 Mar. 2, 1999 DNA84141-2556 203810 Mar. 2, 1999 DNA84142-2613 PTA-22 May 4, 1999 DNA84318-2520 203580 Jan. 12, 1999 DNA84909-2590 203889 Mar. 30, 1999 DNA84912-2610 203964 Apr. 27, 1999 DNA84925-2514 203548 Dec. 22, 1998 DNA84928-2564 203817 Mar. 2, 1999 DNA84932-2657 PTA-235 Jun. 15, 1999 DNA86592-2607 203968 Apr. 27, 1999 DNA86594-2587 203894 Mar. 30, 1999 DNA86647-2591 203893 Mar. 30, 1999 DNA87185-2563 203811 Mar. 2, 1999 DNA87656-2582 203867 Mar. 23, 1999 DNA87974-2609 203963 Apr. 27, 1999 DNA88001-2565 203815 Mar. 2, 1999 DNA88004-2575 203890 Mar. 30, 1999 DNA89220-2608 PTA-130 May 25, 1999 DNA89947-2618 203970 Apr. 27, 1999 DNA90842-2574 203845 Mar. 16, 1999 DNA91775-2581 203861 Mar. 23, 1999 DNA91779-2571 203844 Mar. 16, 1999 DNA92217-2697 PTA-513 Aug. 10, 1999 DNA92219-2541 203663 Feb. 9, 1999 DNA92223-2567 203851 Mar. 16, 1999 DNA92225-2603 203950 Apr. 20, 1999 DNA92232-2589 203895 Mar. 30, 1999 DNA92233-2599 PTA-134 May 25, 1999 DNA92243-2549 203852 Mar. 16, 1999 DNA92253-2671 PTA-258 Jun. 22, 1999 DNA92254-2672 PTA-259 Jun. 22, 1999 DNA92255-2584 203866 Mar. 23, 1999 DNA92269-2570 203853 Mar. 16, 1999 DNA92288-2588 203892 Mar. 30, 1999 DNA92290-2550 203847 Mar. 16, 1999 DNA93012-2622 PTA-21 May 4, 1999 DNA93020-2642 PTA-121 May 25, 1999 DNA94830-2604 203951 Apr. 20, 1999 DNA94833-2579 203869 Mar. 23, 1999 DNA94838-2658 PTA-232 Jun. 15, 1999 DNA94844-2686 PTA-385 Jul. 20, 1999 DNA94854-2586 203864 Mar. 23, 1999 DNA96868-2677 PTA-262 Jun. 22, 1999 DNA96871-2683 PTA-381 Jul. 20, 1999 DNA96880-2624 PTA-15 May 4, 1999 DNA96986-2660 PTA-239 Jun. 15, 1999 DNA96988-2685 PTA-384 Jul. 20, 1999 DNA96995-2709 PTA-475 Aug. 3, 1999 DNA97004-2562 203854 Mar. 16, 1999 DNA97005-2687 PTA-378 Jul. 20, 1999 DNA97009-2668 PTA-257 Jun. 22, 1999 DNA97013-2667 PTA-231 Jun. 15, 1999 DNA98380-2690 PTA-388 Jul. 20, 1999 DNA98561-2696 PTA-620 Aug. 31, 1999 DNA98575-2644 PTA-118 May 25, 1999 DNA98593-2694 PTA-477 Aug. 3, 1999 DNA98600-2703 PTA-488 Aug. 3, 1999 DNA99391-2572 203849 Mar. 16, 1999 DNA99393-2560 203837 Mar. 9, 1999 DNA100276-2684 PTA-380 Jul. 20, 1999 DNA100312-2645 PTA-44 May 11, 1999 DNA100902-2646 PTA-42 May 11, 1999 DNA102899-2679 PTA-123 May 25, 1999 DNA104875-2720 PTA-482 Aug. 3, 1999 DNA105680-2710 PTA-483 Aug. 3, 1999 DNA105779-2708 PTA-485 Aug. 3, 1999 DNA105794-2695 PTA-480 Aug. 3, 1999 DNA105838-2702 PTA-476 Aug. 3, 1999 DNA107698-2715 PTA-472 Aug. 3, 1999 DNA107701-2711 PTA-487 Aug. 3, 1999 DNA107781-2707 PTA-484 Aug. 3, 1999 DNA108670-2744 PTA-546 Aug. 17, 1999 DNA108688-2725 PTA-515 Aug. 10, 1999 DNA108769-2765 PTA-861 Oct. 19, 1999 DNA108935-2721 PTA-518 Aug. 10, 1999 DNA110700-2716 PTA-512 Aug. 10, 1999 DNA111750-2706 PTA-489 Aug. 3, 1999 DNA123430-2755 PTA-614 Aug. 31, 1999 DNA125154-2785 PTA-957 Nov. 16, 1999 DNA142238-2768 PTA-819 Oct. 5, 1999 DNA22779-1130 209280 Sept. 18, 1997 DNA26847-1395 209772 Apr. 14, 1998 DNA27864-1155 209375 Oct. 16, 1997 DNA27865-1091 209296 Sept. 23, 1997 DNA28497-1130 209279 Sept. 18, 1997 DNA29101-1122 209653 Mar. 5, 1998 DNA32286-1191 209385 Oct. 16, 1997 DNA32288-1132 209261 Sept. 16, 1997 DNA32290-1164 209384 Oct. 16, 1997 DNA32292-1131 209258 Sept. 16, 1997 DNA32298-1132 209257 Sept. 16, 1997 DNA33085-1110 209087 May 30, 1997 DNA33087-1158 209381 Oct. 16, 1997 DNA33089-1132 209262 Sept. 16, 1997 DNA33092-1202 209420 Oct. 28, 1997 DNA33094-1131 209256 Sept. 16, 1997 DNA33107-1135 209251 Sept. 16, 1997 DNA33221-1133 209263 Sept. 16, 1997 DNA33223-1136 209264 Sept. 16, 1997 DNA33460-1166 209376 Oct. 16, 1997 DNA33473-1176 209391 Oct. 17, 1997 DNA33785-1143 209417 Oct. 28, 1997 DNA33786-1132 209253 Sept. 16, 1997 DNA34353-1428 209855 May 12, 1998 DNA34392-1170 209526 Dec. 10, 1997 DNA34434-1139 209252 Sept. 16, 1997 DNA35558-1167 209374 Oct. 16, 1997 DNA35595-1228 209528 Dec. 10, 1997 DNA35638-1216 209265 Sept. 16, 1997 DNA35639-1172 209396 Oct. 17, 1997 DNA35663-1129 209201 Aug. 18, 1997 DNA35674-1142 209416 Oct. 28, 1997 DNA35841-1173 209403 Oct. 17, 1997 DNA35916-1161 209419 Oct. 28, 1997 DNA35918-1174 209402 Oct. 17, 1997 DNA36350-1158 209378 Oct. 16, 1997 DNA37140-1234 209489 Nov. 21, 1997 DNA37150-1178 209401 Oct. 17, 1997 DNA38260-1180 209397 Oct. 17, 1997 DNA40021-1154 209389 Oct. 17, 1997 DNA40587-1231 209438 Nov. 7, 1997 DNA40592-1242 209492 Nov. 21, 1997 DNA40620-1183 209388 Oct. 17, 1997 DNA40628-1216 209432 Nov. 7, 1997 DNA40981-1234 209439 Nov. 7, 1997 DNA40982-1235 209433 Nov. 7, 1997 DNA41234-1242 209618 Feb. 5, 1998 DNA43046-1225 209484 Nov. 21, 1997 DNA43316-1237 209487 Nov. 21, 1997 DNA44167-1243 209434 Nov. 7, 1997 DNA44184-1319 209704 Mar. 26, 1998 DNA44194-1317 209808 Apr. 28, 1998 DNA44196-1353 209847 May 6, 1998 DNA45419-1252 209616 Feb. 5, 1998 DNA46777-1253 209619 Feb. 5, 1998 DNA47394-1572 203109 Aug. 11, 1998 DNA48331-1329 209715 Mar. 31, 1998 DNA48336-1309 209669 Mar. 11, 1998 DNA49142-1430 203002 Jun. 23, 1998 DNA49646-1327 209705 Mar. 26, 1998 DNA49821-1562 209981 Jun. 16, 1998 DNA49829-1346 209749 Apr. 7, 1998 DNA50921-1458 209859 May 12, 1998 DNA52187-1354 209845 May 6, 1998 DNA52196-1348 209748 Apr. 7, 1998 DNA52598-1518 203107 Aug. 11, 1998 DNA54228-1366 209801 Apr. 23, 1998 DNA56047-1456 209948 Jun. 9, 1998 DNA56112-1379 209883 May 20, 1998 DNA56113-1378 203049 Jul. 1, 1998 DNA56352-1358 209846 May 6, 1998 DNA56433-1406 209857 May 12, 1998 DNA56439-1376 209864 May 14, 1998 DNA57530-1375 209880 May 20, 1998 DNA57689-1385 209869 May 14, 1998 DNA57690-1374 209950 Jun. 9, 1998 DNA57693-1424 203008 Jun. 23, 1998 DNA57838-1337 203014 Jun. 23, 1998 DNA58721-1475 203110 Aug. 11, 1998 DNA59205-1421 203009 Jun. 23, 1998 DNA59215-1425 209961 Jun. 9, 1998 DNA59220-1514 209962 Jun. 9, 1998 DNA59294-1381 209866 May 14, 1998 DNA59488-1603 203157 Aug. 25, 1998 DNA59588-1571 203106 Aug. 11, 1998 DNA59606-1471 209945 Jun. 9, 1998 DNA59620-1463 209989 Jun. 16, 1998 DNA59767-1489 203108 Aug. 11, 1998 DNA59777-1480 203111 Aug. 11, 1998 DNA59814-1486 203359 Oct. 20, 1998 DNA59839-1461 209988 Jun. 16, 1998 DNA59846-1503 209978 Jun. 16, 1998 DNA59847-1511 203098 Aug. 4, 1998 DNA60615-1483 209980 Jun. 16, 1998 DNA60621-1516 203091 Aug. 4, 1998 DNA60622-1525 203090 Aug. 4, 1998 DNA60627-1508 203092 Aug. 4, 1998 DNA60764-1533 203452 Nov. 10, 1998 DNA60775-1532 203173 Sept. 1, 1998 DNA61185-1646 203464 Nov. 17, 1998 DNA61873-1574 203132 Aug. 18, 1998 DNA62306-1570 203254 Sept. 9, 1998 DNA62808-1582 203358 Oct. 20, 1998 DNA62814-1521 203093 Aug. 4, 1998 DNA64885-1529 203457 Nov. 3, 1998 DNA64886-1601 203241 Sept. 9, 1998 DNA64888-1542 203249 Sept. 9, 1998 DNA64889-1541 203250 Sept. 9, 1998 DNA64890-1612 203131 Aug. 18, 1998 DNA64903-1553 203223 Sept. 15, 1998 DNA64905-1558 203233 Sept. 15, 1998 DNA65402-1540 203252 Sept. 9, 1998 DNA65405-1547 203476 Nov. 17, 1998 DNA65412-1523 203094 Aug. 4, 1998 DNA66309-1538 203235 Sept. 15, 1998 DNA66667-1596 203267 Sept. 22, 1998 DNA66675-1587 203282 Sept. 22, 1998 DNA68818-2536 203657 Feb. 9, 1999 DNA68864-1629 203276 Sept. 22, 1998 DNA68872-1620 203160 Aug. 25, 1998 DNA71159-1617 203135 Aug. 18, 1998 DNA73727-1673 203459 Nov. 3, 1998 DNA73739-1645 203270 Sept. 22, 1998 DNA76400-2528 203573 Jan. 12, 1999 DNA76510-2504 203477 Nov. 17, 1998 DNA76529-1666 203315 Oct. 6, 1998 DNA76538-1670 203313 Oct. 6, 1998 DNA77301-1708 203407 Oct. 27, 1998 DNA77624-2515 203553 Dec. 22, 1998 DNA79230-2525 203549 Dec. 22, 1998 DNA79862-2522 203550 Dec. 22, 1998 DNA80145-2594 PTA-204 Jun. 8, 1999 DNA83500-2506 203391 Oct. 29, 1998 DNA84917-2597 203863 Mar. 23, 1999 DNA92218-2554 203834 Mar. 9, 1999 DNA96042-2682 PTA-382 Jul. 20, 1999 - These deposits were made under the provisions of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purpose of Patent Procedure and the Regulations thereunder (Budapest Treaty). This assures maintenance of a viable culture of the deposit for 30 years from the date of deposit. The deposits will be made available by ATCC under the terms of the Budapest Treaty, and subject to an agreement between Genentech, Inc. and ATCC, which assures permanent and unrestricted availability of the progeny of the culture of the deposit to the public upon issuance of the pertinent U.S. patent or upon laying open to the public of any U.S. or foreign patent application, whichever comes first, and assures availability of the progeny to one determined by the U.S. Commissioner of Patents and Trademarks to be entitled thereto according to 35 USC § 122 and the Commissioner's rules pursuant thereto (including 37 CFR § 1.14 with particular reference to 886 OG 638).
- The assignee of the present application has agreed that if a culture of the materials on deposit should die or be lost or destroyed when cultivated under suitable conditions, the materials will be promptly replaced on notification with another of the same. Availability of the deposited material is not to be construed as a license to practice the invention in contravention of the rights granted under the authority of any government in accordance with its patent laws.
- Use of PRO as a hybridization probe
- The following method describes use of a nucleotide sequence encoding PRO as a hybridization probe.
- DNA comprising the coding sequence of full-length or mature PRO as disclosed herein is employed as a probe to screen for homologous DNAs (such as those encoding naturally-occurring variants of PRO) in human tissue cDNA libraries or human tissue genomic libraries.
- Hybridization and washing of filters containing either library DNAs is performed under the following high stringency conditions. Hybridization of radiolabeled PRO-derived probe to the filters is performed in a solution of 50% formamide, 5×SSC, 0.1% SDS, 0.1% sodium pyrophosphate, 50 mM sodiumphosphate, pH 6.8, 2×Denhardt's solution, and 10% dextran sulfate at 42° C. for 20 hours. Washing of the filters is performed in an aqueous solution of O. lx SSC and 0.1% SDS at 42° C.
- DNAs having a desired sequence identity with the DNA encoding full-length native sequence PRO can then be identified using standard techniques known in the art.
- Expression of PRO inE. coli
- This example illustrates preparation of an unglycosylated form of PRO by recombinant expression inE. coli.
- The DNA sequence encoding PRO is initially amplified using selected PCR primers. The primers should contain restriction enzyme sites which correspond to the restriction enzyme sites on the selected expression vector. A variety of expression vectors may be employed. An example of a suitable vector is pBR322 (derived fromE. coli; see Bolivar et al., Gene, 2:95 (1977)) which contains genes for ampicillin and tetracycline resistance. The vector is digested with restriction enzyme and dephosphorylated. The PCR amplified sequences are then ligated into the vector. The vector will preferably include sequences which encode for an antibiotic resistance gene, a trp promoter, a polyhis leader (including the first six STh codons, polyhis sequence, and enterokinase cleavage site), the PRO coding region, lambda transcriptional terminator, and an argU gene.
- The ligation mixture is then used to transform a selected E. coli strain using the methods described in Sambrook et al., supra. Transformants are identified by their ability to grow on LB plates and antibiotic resistant colonies are then selected. Plasmid DNA can be isolated and confirmed by restriction analysis and DNA sequencing.
- Selected clones can be grown overnight in liquid culture medium such as LB broth supplemented with antibiotics. The overnight culture may subsequently be used to inoculate a larger scale culture. The cells are then grown to a desired optical density, during which the expression promoter is turned on.
- After culturing the cells for several more hours, the cells can be harvested by centrifugation. The cell pellet obtained by the centrifugation can be solubilized using various agents known in the art, and the solubilized PRO protein can then be purified using a metal chelating column under conditions that allow tight binding of the protein.
- PRO may be expressed inE. coli in a poly-His tagged form, using the following procedure. The DNA encoding PRO is initially amplified using selected PCR primers. The primers will contain restriction enzyme sites which correspond to the restriction enzyme sites on the selected expression vector, and other useful sequences providing for efficient and reliable translation initiation, rapid purification on a metal chelation column, and proteolytic removal with enterokinase. The PCR-amplified, poly-His tagged sequences are then ligated into an expression vector, which is used to transform an E. coli host based on strain 52 (W3 110 fuhA(tonA) lon galE rpoHts(htpRts) clpP(laclq). Transformants are first grown in LB containing 50 mg/ml carbenicillin at 30° C. with shaking until an O.D.600 of 3-5 is reached. Cultures are then diluted 50-100 fold into CRAP media (prepared by mixing 3.57 g (NH4)2SO4, 0.71 g sodium citrate •2H20, 1.07 g KCl, 5.36 g Difco yeast extract, 5.36 g Sheffield hycase SF in 500 mL water, as well as 110 mM MPOS, pH 7.3, 0.55% (w/v) glucose and 7 mM MgSO4) and grown for approximately 20-30 hours at 30° C. with shaking. Samples are removed to verify expression by SDS-PAGE analysis, and the bulk culture is centrifuged to pellet the cells. Cell pellets are frozen until purification and refolding.
-
- The proteins are refolded by diluting the sample slowly into freshly prepared refolding buffer consisting of: 20 mM Tris, pH 8.6, 0.3 M NaCl, 2.5 M urea, 5 mM cysteine, 20 mM glycine and 1 mM EDTA. Refolding volumes are chosen so that the final protein concentration is between 50 to 100 micrograms/ml. The refolding solution is stirred gently at 4° C. for 12-36 hours. The refolding reaction is quenched by the addition of TFA to a final concentration of 0.4% (pH of approximately 3). Before further purification of the protein, the solution is filtered through a 0.22 micron filter and acetonitrile is added to 2-10% final concentration. The refolded protein is chromatographed on a Poros Ri/H reversed phase column using a mobile buffer of 0.1% TFA with elution with a gradient of acetonitrile from 10 to 80%. Aliquots of fractions with A280 absorbance are analyzed on SDS polyacrylamide gels and fractions containing homogeneous refolded protein are pooled. Generally, the properly refolded species of most proteins are eluted at the lowest concentrations of acetonitrile since those species are the most compact with their hydrophobic interiors shielded from interaction with the reversed phase resin. Aggregated species are usually eluted at higher acetonitrile concentrations. In addition to resolving misfolded forms of proteins from the desired formn, the reversed phase step also removes endotoxin from the samples.
- Fractions containing the desired folded PRO polypeptide are pooled and the acetonitrile removed using a gentle stream of nitrogen directed at the solution. Proteins are formulated into 20 mM Hepes, pH 6.8 with 0.14 M sodium chloride and 4% mannitol by dialysis or by gel filtration using G25 Superfine (Pharmacia) resins equilibrated in the formulation buffer and sterile filtered.
- Many of the PRO polypeptides disclosed herein were successfully expressed as described above.
- Expression of PRO in Mammalian Cells
- This example illustrates preparation of a potentially glycosylated form of PRO by recombinant expression in mammalian cells.
- The vector, pRK5 (see EP 307,247, published March 15, 1989), is employed as the expression vector. Optionally, the PRO DNA is ligated into pRK5 with selected restriction enzymes to allow insertion of the PRO DNA using ligation methods such as described in Sambrook et al., supra. The resulting vector is called pRK5-PRO.
- In one embodiment, the selected host cells may be 293 cells. Human 293 cells (ATCC CCL 1573) are grown to confluence in tissue culture plates in medium such as DMEM supplemented with fetal calf serum and optionally, nutrient components and/or antibiotics. About 10 Ig pRK5-PRO DNA is mixed with about 1 μg DNA encoding the VA RNA gene [Thimmappaya et al., Cell, 31:543 (1982)] and dissolved in 500 μl of 1 mnM Tris—HCl, 0.1 mM EDTA, 0.227 M CaCl2. To this mixture is added, dropwise, 500 μl of 50 mM HEPES (pH 7.35), 280 mM NaCl, 1.5 mM NAPO4, and a precipitate is allowed to form for 10 minutes at 25° C. The precipitate is suspended and added to the 293 cells and allowed to settle for about four hours at 37° C. The culture medium is aspirated off and 2 ml of 20% glycerol in PBS is added for 30 seconds. The 293 cells are then washed with serum free medium, fresh medium is added and the cells are incubated for about 5 days.
- Approximately 24 hours after the transfections, the culture medium is removed and replaced with culture medium (alone) or culture medium containing 200 μCi/mn35S-cysteine and 200 μCi/ml 35S-methionine. After a 12 hour incubation, the conditioned medium is collected, concentrated on a spin filter, and loaded onto a 15% SDS gel. The processed gel may be dried and exposed to film for a selected period of time to reveal the presence of PRO polypeptide. The cultures containing transfected cells may undergo further incubation (in serum free medium) and the medium is tested in selected bioassays.
- In an alternative technique, PRO may be introduced into 293 cells transiently using the dextran sulfate method described by Somparyrac et al.,Proc. Natl. Acad. Sci., 12:7575 (1981). 293 cells are grown to maximal density in a spinner flask and 700 ug pRK5-PRO DNA is added. The cells are first concentrated from the spinner flask by centrifugation and washed with PBS. The DNA-dextran precipitate is incubated on the cell pellet for four hours. The cells are treated with 20% glycerol for 90 seconds, washed with tissue culture medium, and re-introduced into the spinner flask containing tissue culture medium, 5 μg/ml bovine insulin and 0.1 μg/ml bovine transferrin. After about four days, the conditioned media is centrifuged and filtered to remove cells and debris. The sample containing expressed PRO can then be concentrated and purified by any selected method, such as dialysis and/or column chromatography.
- In another embodiment, PRO can be expressed in CHO cells. The pRK5-PRO can be transfected into CHO cells using known reagents such as CaPO4 or DEAE-dextran. As described above, the cell cultures can be incubated, and the medium replaced with culture medium (alone) or medium containing a radiolabel such as 35S-methionine. After determining the presence of PRO polypeptide, the culture medium may be replaced with serum free medium. Preferably, the cultures are incubated for about 6 days, and then the conditioned medium is harvested. The medium containing the expressed PRO can then be concentrated and purified by any selected method.
- Epitope-tagged PRO may also be expressed in host CHO cells. The PRO may be subcloned out of the pRK5 vector. The subclone insert can undergo PCR to fuse in frame with a selected epitope tag such as a poly-his tag into a Baculovirus expression vector. The poly-his tagged PRO insert can then be subcloned into a SV40 driven vector containing a selection marker such as DHFR for selection of stable clones. Finally, the CHO cells can be transfected (as described above) with the SV40 driven vector. Labeling may be performed, as described above, to verify expression. The culture medium containing the expressed poly-His tagged PRO can then be concentrated and purified by any selected method, such as by Ni2+-chelate affinity chromatography.
- PRO may also be expressed in CHO and/or COS cells by a transient expression procedure or in CHO cells by another stable expression procedure.
- Stable expression in CHO cells is performed using the following procedure. The proteins are expressed as an IgG construct (immunoadhesin), in which the coding sequences for the soluble forms (e.g. extracellular domains) of the respective proteins are fused to an IgGI constant region sequence containing the hinge, CH2 and CH2 domains and/or is a poly-His tagged form.
- Following PCR amplification, the respective DNAs are subcloned in a CHO expression vector using standard techniques as described in Ausubel et al.,Current Protocols of Molecular Biology, Unit 3.16, John Wiley and Sons (1997). CHO expression vectors are constructed to have compatible restriction sites 5′ and 3′ of the DNA of interest to allow the convenient shuttling of cDNA's. The vector used expression in CHO cells is as described in Lucas et al., Nucl. Acids Res. 24:9 (1774-1779 (1996), and uses the SV40 early promoter/enhancer to drive expression of the cDNA of interest and dihydrofolate reductase (DHFR). DHFR expression permits selection for stable maintenance of the plasmid following transfection.
- Twelve micrograms of the desired plasmid DNA is introduced into approximately 10 million CHO cells using commercially available transfection reagents Superfect® (Quiagen), Dosper® or Fugene® (Boehringer Mannheim). The cells are grown as described in Lucas et al., supra Approximately 3×10−7 cells are frozen in an ampule for further growth and production as described below.
- The ampules containing the plasmid DNA are thawed by placement into water bath and mixed by vortexing. The contents are pipetted into a centrifuge tube containing 10 niLs of media and centrifuged at 1000 rpm for 5 minutes. The supernatant is aspirated and the cells are resuspended in 10 mL of selective media (0.2 μm filtered PS20 with 5% 0.2 μm diafiltered fetal bovine serum). The cells are then aliquoted into a 100 mL spinner containing 90 mL of selective media. After 1-2 days, the cells are transferred into a 250 mL spinner filled with 150 mL selective growth medium and incubated at 37° C. After another 2-3 days, 250 mL, 500 mL and 2000 mL spinners are seeded with 3×105 cells/mL. The cell media is exchanged with fresh media by centrifugation and resuspension in production medium. Although any suitable CHO media may be employed, a production medium described in U.S. Pat. No. 5,122,469, issued June 16, 1992 may actually be used. A 3L production spinner is seeded at 1.2×106 cells/mL. On day 0, the cell number pH ie determined. On
day 1, the spinner is sampled and sparging with filtered air is commenced. Onday 2, the spinner is sampled, the temperature shifted to 33° C., and 30 mL of 500 μg/L glucose and 0.6 mL of 10% antifoam (e.g., 35% polydimethylsiloxane emulsion, Dow Corning 365 Medical Grade Emulsion) taken. Throughout the production, the pH is adjusted as necessary to keep it at around 7.2. After 10 days, or until the viability dropped below 70%, the cell culture is harvested by centrifugation and filtering through a 0.22 μm filter. The filtrate was either stored at 4° C. or immediately loaded onto columns for purification. - For the poly-His tagged constructs, the proteins are purified using a Ni-NTA column (Qiagen). Before purification, imidazole is added to the conditioned media to a concentration of 5 mM. The conditioned media is pumped onto a 6 ml Ni-NTA column equilibrated in 20 mM Hepes, pH 7.4, buffer containing 0.3 M NaCl and 5 mM imidazole at a flow rate of 4-5 ml/min. at 4° C. After loading, the column is washed with additional equilibration buffer and the protein eluted with equilibration buffer containing 0.25 M imidazole. The highly purified protein is subsequently desalted into a storage buffer containing 10 mM Hepes, 0.14 M NaCl and 4% mannitol, pH 6.8, with a 25 ml G25 Superfine (Pharmacia) column and stored at −80° C.
- Immunoadhesin (Fc-containing) constructs are purified from the conditioned media as follows. The conditioned medium is pumped onto a 5 ml Protein A column (Pharmacia) which had been equilibrated in 20 mM Na phosphate buffer, pH 6.8. After loading, the column is washed extensively with equilibration buffer before elution with 100 mM citric acid, pH 3.5. The eluted protein is immediately neutralized by collecting 1 ml fractions into tubes containing 275 μL of 1 M Tris buffer, pH 9. The highly purified protein is subsequently desalted into storage buffer as described above for the poly-His tagged proteins. The homogeneity is assessed by SDS polyacrylamide gels and by N-terminal amino acid sequencing by Edman degradation.
- Many of the PRO polypeptides disclosed herein were successfully expressed as described above.
- Expression of PRO in Yeast
- The following method describes recombinant expression of PRO in yeast.
- First, yeast expression vectors are constructed for intracellular production or secretion of PRO from the ADH2/GAPDH promoter. DNA encoding PRO and the promoter is inserted into suitable restriction enzyme sites in the selected plasmid to direct intracellular expression of PRO. For secretion, DNA encoding PRO can be cloned into the selected plasmid, together with DNA encoding the ADH2/GAPDH promoter, a native PRO signal peptide or other mammalian signal peptide, or, for example, a yeast alpha-factor or invertase secretory signal/leader sequence, and linker sequences (if needed) for expression of PRO.
- Yeast cells, such as yeast strain AB 110, can then be transformed with the expression plasmids described above and cultured in selected fermentation media. The transformed yeast supernatants can be analyzed by precipitation with 10% trichloroacetic acid and separation by SDS-PAGE, followed by staining of the gels with Coomassie Blue stain.
- Recombinant PRO can subsequently be isolated and purified by removing the yeast cells from the fermentation medium by centrifugation and then concentrating the medium using selected cartridge filters. The concentrate containing PRO may further be purified using selected column chromatography resins.
- Many of the PRO polypeptides disclosed herein were successfully expressed as described above.
- Expression of PRO in Baculovirus-Infected Insect Cells
- The following method describes recombinant expression of PRO in Baculovirus-infected insect cells.
- The sequence coding for PRO is fused upstream of an epitope tag contained within a baculovirus expression vector. Such epitope tags include poly-his tags and immunoglobulin tags (like Fc regions of IgG). A variety of plasmids may be employed, including plasmids derived from commercially available plasmids such as pVL1393 (Novagen). Briefly, the sequence encoding PRO or the desired portion of the coding sequence of PRO such as the sequence encoding the extracellular domain of a transmembrane protein or the sequence encoding the mature protein if the protein is extracellular is amplified by PCR with primers complementary to the 5′ and 3′ regions. The 5′ primer may incorporate flanking (selected) restriction enzyme sites. The product is then digested with those selected restriction enzymes and subcloned into the expression vector.
- Recombinant baculovirus is generated by co-transfecting the above plasmid and BaculoGold™ virus DNA (Pharmingen) intoSpodoptera frugiperda (“Sf9”) cells (ATCC CRL 1711) using lipofectin (commercially available from GIBCO-BRL). After 4-5 days of incubation at 28° C., the released viruses are harvested and used for further amplifications. Viral infection and protein expression are performed as described by O'Reilley et al., Baculovirus expression vectors: A Laboratory Manual, Oxford: Oxford University Press (1994).
- Expressed poly-his tagged PRO can then be purified, for example, by Ni2+-chelate affinity chromatography as follows. Extracts are prepared from recombinant virus-infected Sf9 cells as described by Rupert et al., Nature, 362:175-179 (1993). Briefly, Sf9 cells are washed, resuspended in sonication buffer (25 mL Hepes, pH 7.9; 12.5 mM MgCl2; 0.1 mM EDTA; 10% glycerol; 0.1% NP40; 0.4 M KCl), and sonicated twice for 20 seconds on ice. The sonicates are cleared by centrifugation, and the supernatant is diluted 50-fold in loading buffer (50 mM phosphate, 300 mM NaCl, 10% glycerol, pH 7.8) and filtered through a 0.45 μm filter. A Ni2+-NTA agarose column (comrnercially available from Qiagen) is prepared with a bed volume of 5 mL, washed with 25 rnL of water and equilibrated with 25 mL of loading buffer. The filtered cell extract is loaded onto the column at 0.5 mL per minute. The column is washed to baseline A280 with loading buffer, at which point fraction collection is started. Next, the column is washed with a secondary wash buffer (50 mM phosphate; 300 mM NaCl, 10% glycerol, pH 6.0), which elutes nonspecifically bound protein. After reaching A280 baseline again, the column is developed with a 0 to 500 mM Irnidazole gradient in the secondary wash buffer. One mL fractions are collected and analyzed by SDS-PAGE and silver staining or Western blot with Ni2+-NTA-conjugated to alkaline phosphatase (Qiagen). Fractions containing the eluted His10-tagged PRO are pooled and dialyzed against loading buffer.
- Alternatively, purification of the IgG tagged (or Fc tagged) PRO can be performed using known chromatography techniques, including for instance, Protein A or protein G column chromatography.
- Many of the PRO polypeptides disclosed herein were successfully expressed as described above.
- Preptaration of Antibodies that Bind PRO
- This example illustrates preparation of monoclonal antibodies which can specifically bind PRO.
- Techniques for producing the monoclonal antibodies are known in the art and are described, for instance, in Goding, supra. Immunogens that may be employed include purified PRO, fusion proteins containing PRO, and cells expressing recombinant PRO on the cell surface. Selection of the immunogen can be made by the skilled artisan without undue experimentation.
- Mice, such as Balb/c, are immunized with the PRO immunogen emulsified in complete Freund's adjuvant and injected subcutaneously or intraperitoneally in an amount from 1-100 micrograms. Alternatively, the immunogen is emulsified in MPL-TDM adjuvant (Ribi Immunochemical Research, Hamilton, Mont.) and injected into the animal's hind foot pads. The immunized mice are then boosted 10 to 12 days later with additional immunogen emulsified in the selected adjuvant. Thereafter, for several weeks, the mice may also be boosted with additional immunization injections. Serum samples may be periodically obtained from the mice by retro-orbital bleeding for testing in ELISA assays to detect anti-PRO antibodies.
- After a suitable antibody titer has been detected, the animals “positive” for antibodies canbe injected with a final intravenous injection of PRO. Three to four days later, the mice are sacrificed and the spleen cells are harvested. The spleen cells are then fused (using 35% polyethylene glycol) to a selected murine myeloma cell line such as P3X63AgU.1, available from ATCC, No. CRL 1597. The fusions generate hybridoma cells which can then be plated in 96 well tissue culture plates containing HAT (hypoxanthine, aminopterin, and thymidine) medium to inhibit proliferation of non-fused cells, myeloma hybrids, and spleen cell hybrids.
- The hybridoma cells will be screened in an ELISA for reactivity against PRO. Determination of “positive” hybridoma cells secreting the desired monoclonal antibodies against PRO is within the skill in the art.
- The positive hybridoma cells can be injected intraperitoneally into syngeneic Balb/c mice to produce ascites containing the anti-PRO monoclonal antibodies. Alternatively, the hybridoma cells can be grown in tissue culture flasks or roller bottles. Purification of the monoclonal antibodies produced in the ascites can be accomplished using ammonium sulfate precipitation, followed by gel exclusion chromatography. Alternatively, affinity chromatography based upon binding of antibody to protein A or protein G can be employed.
- Purification of PRO Polypeptides Using Specific Antibodies
- Native or recombinant PRO polypeptides may be purified by a variety of standard techniques in the art of protein purification. For example, pro-PRO polypeptide, mature PRO polypeptide, or pre-PRO polypeptide is purified by immunoaffinity chromatography using antibodies specific for the PRO polypeptide of interest. In general, an immunoaffinity column is constructed by covalently coupling the anti-PRO polypeptide antibody to an activated chromatographic resin.
- Polyclonal immunoglobulins are prepared from immune sera either by precipitation with ammonium sulfate or by purification on immobilizedProtein A (Pharmacial.KB Biotechnology, Piscataway, N.J.). Likewise, monoclonal antibodies are prepared from mouse ascites fluid by ammonium sulfate precipitation or chromatography on immobilized Protein A. Partially purified immunoglobulin is covalently attached to a chromatographic resin such as CnBr-acfivated SEPHAROSE™ (Pharmacia LKB Biotechnology). The antibody is coupled to the resin, the resin is blocked, and the derivative resin is washed according to the manufacturer's instructions.
- Such an immunoaffinity column is utilized in the purification of PRO polypeptide by preparing a fraction from cells containing PRO polypeptide in a soluble form. This preparation is derived by solubilization of the whole cell or of a subcellular fraction obtained via differential centrifugation by the addition of detergent or by other methods well known in the art. Alternatively, soluble PRO polypeptide containing a signal sequence may be secreted in useful quantity into the medium in which the cells are grown.
- A soluble PRO polypeptide-containing preparation is passed over the immunoaffinity column, and the column is washed under conditions that allow the preferential absorbance of PRO polypeptide (e.g., high ionic strength buffers in the presence of detergent). Then, the column is eluted under conditions that disrupt antibody/PRO polypeptide binding (e.g., a low pH buffer such as approximately pH 2-3, or a high concentration of a chaotrope such as urea or thiocyanate ion), and PRO polypeptide is collected.
- Drug Screening
- This invention is particularly useful for screening compounds by using PRO polypeptides or binding fragment thereof in any of a variety of drug screening techniques. The PRO polypeptide or fragment employed in such a test may either be free in solution, affixed to a solid support, borne on a cell surface, or located intracellularly. One method of drug screening utilizes eukaryotic or prokaryotic host cells which are stably transformed with recombinant nucleic acids expressing the PRO polypeptide or fragment. Drugs are screened against such transformed cells in competitive binding assays. Such cells, either in viable or fixed form, can be used for standard binding assays. One may measure, for example, the formation of complexes between PRO polypeptide or a fragment and the agent being tested. Alternatively, one can examine the diminution in complex formation between the PRO polypeptide and its target cell or target receptors caused by the agent being tested.
- Thus, the present invention provides methods of screening for drugs or any other agents which can affect a PRO polypeptide-associated disease or disorder. These methods comprise contacting such an agent with an PRO polypeptide or fragment thereof and assaying (1) for the presence of a complex between the agent and the PRO polypeptide or fragment, or (ii) for the presence of a complex between the PRO polypeptide or fragment and the cell, by methods well known in the art. In such competitive binding assays, the PRO polypeptide or fragment is typically labeled. After suitable incubation, free PRO polypeptide or fragment is separated from that present in bound form, and the amount of free or uncomplexed label is a measure of the ability of the particular agent to bind to PRO polypeptide or to interfere with the PRO polypeptide/cell complex.
- Another technique for drug screening provides high throughput screening for compounds having suitable binding affinity to a polypeptide and is described in detail in WO 84/03564, published on Sep. 13, 1984. Briefly stated, large numbers of different small peptide test compounds are synthesized on a solid substrate, such as plastic pins or some other surface. As applied to a PRO polypeptide, the peptide test compounds are reacted with PRO polypeptide and washed. Bound PRO polypeptide is detected by methods well known in the art. Purified PRO polypeptide can also be coated directly onto plates for use in the aforementioned drug screening techniques. In addition, non-neutralizing antibodies can be used to capture the peptide and immobilize it on the solid support.
- This invention also contemplates the use of competitive drug screening assays in which neutralizing antibodies capable of binding PRO polypeptide specifically compete with a test compound for binding to PRO polypeptide or fragments thereof. In this manner, the antibodies can be used to detect the presence of any peptide which shares one or more antigenic determinants with PRO polypeptide.
- Rational Drug Design
- The goal of rational drug design is to produce structural analogs of biologically active polypeptide of interest (i.e., a PRO polypeptide) or of small molecules with which they interact, e.g., agonists, antagonists, or inhibitors. Any of these examples can be used to fashion drugs which are more active or stable forms of the PRO polypeptide or which enhance or interfere with the function of the PRO polypeptide in vivo (c.f., Hodgson,Bio/Technology, 9: 19-21 (1991)).
- In one approach, the three-dimensional structure of the PRO polypeptide, or of an PRO polypeptide-inhibitor complex, is determined by x-ray crystallography, by computer modeling or, most typically, by a combination of the two approaches. Both the shape and charges of the PRO polypeptide must be ascertained to elucidate the structure and to determine active site(s) of the molecule. Less often, useful information regarding the structure of the PRO polypeptide may be gained by modeling based on the structure of homologous proteins. In both cases, relevant structural information is used to design analogous PRO polypeptide-like molecules or to identify efficient inhibitors. Useful examples of rational drug design may include molecules which have improved activity or stability as shown by Braxton and Wells,Biochemistry, 31:7796-7801 (1992) or which act as inhibitors, agonists, or antagonists of native peptides as shown by Athauda et al., J. Biochem., 113:742-746 (1993).
- It is also possible to isolate a target-specific antibody, selected by functional assay, as described above, and then to solve its crystal structure. This approach, in principle, yields a pharmacore upon which subsequent drug design can be based. It is possible to bypass protein crystallography altogether by generating anti-idiotypic antibodies (anti-ids) to a functional, pharmacologically active antibody. As a mirror image of a mirror image, the binding site of the anti-ids would be expected to be an analog of the original receptor. The anti-id could then be used to identify and isolate peptides from banks of chemically or biologically produced peptides. The isolated peptides would then act as the pharmacore.
- By virtue of the present invention, sufficient amounts of the PRO polypeptide may be made available to perform such analytical studies as X-ray crystallography. In addition, knowledge of the PRO polypeptide amino acid sequence provided herein will provide guidance to those employing computer modeling techniques in place of or in addition to x-ray crystallography.
- Identification of PRO Polypeptides That Stimulate TNF-α Release In Human Blood (Assay 128)
- This assay shows that certain PRO polypeptides of the present invention act to stimulate the release of TNF-α in human blood. PRO polypeptides testing positive in this assay are useful for, among other things, research purposes where stimulation of the release of TNF-α would be desired and for the therapeutic treatment of conditions wherein enhanced TNF-α release would be beneficial. Specifically, 200 μl of human blood supplemented with 50 mM Hepes buffer (pH 7.2) is aliquoted per well in a 96 well test plate. To each well is then added 300 μl of either the test PRO polypeptide in 50 mM Hepes buffer (at various concentrations) or 50 mM Hepes buffer alone (negative control) and the plates are incubated at 37° C. for 6 hours. The samples are then centrifuged and 50 μl of plasma is collected from each well and tested for the presence of TNF-α by ELISA assay. A positive in the assay is a higher amount of TNF-α in the PRO polypeptide treated samples as compared to the negative control samples.
- The following PRO polypeptides tested positive in this assay: PRO195, PRO202, PRO215, PRO221, PRO217, PRO222, PRO198, PRO245, PRO172, PRO265, PRO266, PRO344, PRO337, PRO322, PRO1286, PRO1279, PRO1338 and PRO1343.
- Detection of Polypeptides That Affect Glucose or FFA Uptake in Skeletal Muscle (Assay 106)
- This assay is designed to determine whether PRO polypeptides show the ability to affect glucose or FFA uptake by skeletal muscle cells. PRO polypeptides testing positive in this assay would be expected to be useful for the therapeutic treatment of disorders where either the stimulation or inhibition of glucose uptake by skeletal muscle would be beneficial including, for example, diabetes or hyper- or hypo-insulinemia.
- In a 96 well format, PRO polypeptides to be assayed are added to primary rat differentiated skeletal muscle, and allowed to incubate overnight. Then fresh media with the PRO polypeptide and +/− insulin are added to the wells. The sample media is then monitored to determine glucose and FFA uptake by the skeletal muscle cells. The insulin will stimulate glucose and FFA uptake by the skeletal muscle, and insulin in media without the PRO polypeptide is used as a positive control, and a limit for scoring. As the PRO polypeptide being tested may either stimulate or inhibit glucose and FFA uptake, results are scored as positive in the assay if greater than 1.5 times or less than 0.5 times the insulin control.
- The following PRO polypeptides tested positive as being capable of affecting glucose and/or FFA uptake by skeletal muscle in this assay: PRO182, PRO366, PRO198, PRO172 and PRO719.
- Chondrocyte Re-differentiation Assay (Assay 110)
- This assay shows that certain polypeptides of the invention act to induce redifferentiation of chondrocytes, therefore, are expected to be useful for the treatment of various bone and/or cartilage disorders such as, for example, sports injuries and arthritis. The assay is performed as follows. Porcine chondrocytes are isolated by overnight collagenase digestion of articulary cartilage of metacarpophalangealjoints of 4-6 month old female pigs. The isolated cells are then seeded at 25,000 cells/cm2 in Ham F-12 containing 10% FBS and 4 μg/ml gentamycin. The culture media is changed every third day and the cells are then seeded in 96 well plates at 5,000 cells/well in 100 μl of the same media without serum and 100 μl of the test PRO polypeptide, 5 nM staurosporin (positive control) or medium alone (negative control) is added to give a final volume of 200 μl/well. After 5 days of incubation at 37° C., a picture of each well is taken and the differentiation state of the chondrocytes is determined. A positive result in the assay occurs when the redifferentiation of the chondrocytes is determined to be more similar to the positive control than the negative control.
- The following polypeptide tested positive in this assay: PRO182, PRO366, PRO198 and PRO1868.
- Chondrocyte Proliferation Assay (Assay 111)
- This assay is designed to determine whether PRO polypeptides of the present invention show the ability to induce the proliferation and/or redifferentiation of chondrocytes in culture. PRO polypeptides testing positive in this assay would be expected to be useful for the therapeutic treatment of various bone and/or cartilage disorders such as, for example, sports injuries and arthritis.
- Porcine chondrocytes are isolated by overnight collagenase digestion of articular cartilage of the metacarpophalangeal joint of 4-6 month old female pigs. The isolated cells are then seeded at 25,000 cells/cm2 in Ham F-12 containing 10% FBS and 4 [Lg/mnl gentamycin. The culture media is changed every third day and the cells are reseeded to 25,000 cells/cm2 every five days. On day 12, the cells are seeded in 96 well plates at 5,000 cells/well in 100 μl of the same media without serum and 100 μl of either serum-free medium (negative control), staurosporin (final concentration of 5 nM; positive control) or the test PRO polypeptide are added to give a final volume of 200 μl/well. After 5 days at 37° C., 20 μl of Alamar blue is added to each well and the plates are incubated for an additional 3 hours at 37° C. The fluorescence is then measured in each well (Ex:530 nm; Em: 590 nm). The fluorescence of a plate containing 200 μl of the serum-free medium is measured to obtain the background. A positive result in the assay is obtained when the fluorescence of the PRO polypeptide treated sample is more like that of the positive control than the negative control.
- The following PRO polypeptides tested positive in this assay: PRO202, PRO224, PRO172 and PRO1312.
- Detection of PRO Polypeptides That Affect Glucose or FFA Uptake by Primary Rat Adipocytes (Assay 94)
- This assay is designed to determine whether PRO polypeptides show the ability to affect glucose or FFA uptake by adipocyte cells. PRO polypeptides testing positive in this assay would be expected to be useful for the therapeutic treatrnent of disorders where either the stimulation or inhibition of glucose uptake by adipocytes would be beneficial including, for example, obesity, diabetes or hyper- or hypo-insulinemia.
- In a 96 well format, PRO polypeptides to be assayed are added to primary rat adipocytes, and allowed to incubate overnight. Samples are taken at 4 and 16 hours and assayed for glycerol, glucose and FFA uptake. After the 16 hour incubation, insulin is added to the media and allowed to incubate for 4 hours. At this time, a sample is taken and glycerol, glucose and FFA uptake is measured. Media containing insulin without the PRO polypeptide is used as a positive reference control. As the PRO polypeptide being tested may either stimulate or inhibit glucose and FFA uptake, results are scored as positive in the assay if greater than 1.5 times or less than 0.5 times the insulin control.
- The following PRO polypeptides tested positive as being capable of affecting glucose and/or FFA uptake in this assay: PRO202, PRO211, PRO344 and PRO1338.
- Gene Expression in Bovine Pericytes (Assay 105)
- This assay is designed to identify PRO polypeptides which activate gene expression in pericytes. Such polypeptides would be expected to be useful as growth factors and/or for situations where the activation of gene expression is desired or beneficial. Bovine pericytes are plated on 60mm culture dishes in growth media forl week. On
day 1, various PRO polypeptides are diluted (1%) and incubated with the pericytes for 1,4 and 24 hr. Iimepoints. The cells are harvested and the RNA isolated using TRI-Reagent following the included instructions. The RNA is then quantified by reading the 260/280 OD using a spectrophotometer. The gene expression analysis is done by TaqMan reactions using Perkin Elmer reagents and specially designed bovine probes and primers. Expression of the following genes is analyzed: GAPDH, beta-integrin, connective tissue growth factor (CTGF), ICAM-1, monocyte chemoattractant protein-1 (MCP-1), osteopontin, transforming growth factor-beta (TGF-beta), TGF-beta receptor, tissue inhibitor of metalloproteinase (TIMP), tissue factor (TF), VEGF-α, thrombospondin, VEGF-β, angiopoeitin-2, and collagenase. Replicates are then averaged and the SD determined. The gene expression levels are then normalized to GAPDH. These are then normalized to the expression levels obtained with a protein (PIN32) which does not significantly induce gene expression in bovine pericytes when compared to untreated controls. Any PRO polypeptide that gives a gene expression level 2-fold or higher over the PIN32 control is considered a positive hit. - The following PRO polypeptides tested positive in this assay: PRO366.
- Identification of PRO Polypeptides That Activate Pericytes (Assay 125)
- This assay shows that certain polypeptides of the invention act to activate proliferation of pericyte cells and, therefore, are useful not only as diagnostic markers for particular types of pericyte-associated tumors but also for giving rise to antagonists which would be expected to be useful for the therapeutic treatment of pericyte-associated tumors. Such PRO polypeptides also would be expected to be useful as growth factors and/or for situations where the induction of cell proliferation is desired or beneficial. Activation of pericyte proliferation also correlates with the induction of angiogenesis and, as such, PRO polypeptides capable of inducing pericyte proliferation would be expected to be useful for the treatment of conditions where induced angiogenesis would be beneficial including, for example, wound healing, and the like. Specifically, on
day 1, pericytes are received from VEC Technologies, and all but 5 ml media is removed from the flask. Onday 2, the pericytes are trypsinized, washed, spun and plated on 96 well plates. On day 7, the media is removed and the pericytes are treated with 100 μl of either the specific PRO polypeptide or control treatments (positive control=DME+5%+/− PDGF @ 500 ng/μl; negative control=PIN32, a polypeptide determined to have no significant effect on pericyte proliferation). C-fos and GAPDH gene expression levels are then determined and the replicates are averaged and the SD is determined. The c-fos values are normalized to GAPDH and the results are expressed as fold increase over PIN32. Anything providing at least a 2-fold or higher response as compared to the negative control is considered positive for the assay. - The following polypeptides tested positive in this assay: PRO366.
- Ability of PRO Polyyeptides to Stimulate the Release of Proteoglvcans from Cartilage (Assay 97)
- The ability of various PRO polypeptides to stimulate the release of proteoglycans from cartilage tissue was tested as follows.
- The metacarphophalangeal joint of 4-6 month old pigs was aseptically dissected, and articular cartilage was removed by free hand slicing being careful to avoid the underlying bone. The cartilage was minced and cultured in bulk for 24 hours in a humidified atmosphere of 95% air,5% CO2 in serum free (SF) media (DME/F12 1:1) with 0.1% BSA and 100U/ml penicillin and 100 μg/ml streptomycin. After washing three times, approximately 100 mg of articular cartilage was aliquoted into micronics tubes and incubated for an additional 24 hours in the above SF media. PRO polypeptides were then added at 1% either alone or in combination with 18 ng/nlm interleukin-la, a known stimulator of proteoglycan release from cartilage tissue. The supernatant was then harvested and assayed for the amount of proteoglycans using the 1,9-dimethyl-methylene blue (DMB) colorimetric assay (Farndale and Buttle, Biochem. Biophys. Acta 883:173-177 (1985)). A positive result in this assay indicates that the test polypeptide will find use, for example, in the treatment of sports-related joint problems, articular cartilage defects, osteoarthritis or rheumatoid arthritis.
- When various PRO polypeptides were tested in the above assay, the polypeptides demonstrated amarked ability to stimulate release of proteoglycans from cartilage tissue both basally and after stimulation with interleukin-la and at 24 and 72 hours after treatment, thereby indicating that these PRO polypeptides are useful for stimulating proteoglycan release from cartilage tissue. As such, these PRO polypeptides are useful for the treatment of sports-related joint problems, articular cartilage defects, osteoarthritis or rheumatoid arthritis. The polypeptides testing positive in this assay are: PRO216.
- Proliferation of Rat Utricular Supporting Cells (Assay 54)
- This assay shows that certain polypeptides of the invention act as potent mitogens for inner ear supporting cells which are auditory hair cell progenitors and, therefore, are useful for inducing the regeneration of auditory hair cells and treating hearing loss in mammals. The assay is performed as follows. Rat UEC-4 utricular epithelial cells are aliquoted into 96 well plates with a density of 3000 cells/well in 200 μl of serum-containing medium at 33° C. The cells are cultured overnight and are then switched to serum-free medium at 37° C. Various dilutions of PRO polypeptides (or nothing for a control) are then added to the cultures and the cells are incubated for 24 hours. After the 24 hour incubation,3H-thymidine (1 μCi/well) is added and the cells are then cultured for an additional 24 hours. The cultures are then washed to remove unincorporated radiolabel, the cells harvested and Cpm per well determined. Cpm of at least 30% or greater in the PRO polypeptide treated cultures as compared to the control cultures is considered a positive in the assay.
- The following polypeptides tested positive in this assay: PRO172.
- Stimulatory Activity in Mixed Lymphocyte Reaction (MLR) Assay (Assay 24)
- This example shows that certain polypeptides of the invention are active as a stimulator of the proliferation of stimulated T-lymphocytes. Compounds which stimulate proliferation of lymphocytes are useful therapeutically where enhancement of an immune response is beneficial. A therapeutic agent may take the form of antagonists of the polypeptide of the invention, for example, murine-human chimeric, humanized or human antibodies against the polypeptide.
- The basic protocol for this assay is described in Current Protocols in Immunology, unit 3.12; edited by J E Coligan, A M Kruisbeek, D H Marglies, E M Shevach, W Strober, National Institutes of Health, Published by John Wiley & Sons, Inc.
- More specifically, in one assay variant, peripheral blood mononuclear cells (PBMC) are isolated from mammalian individuals, for example a human volunteer, by leukopheresis (one donor will supply stimulator PBMCs, the other donor will supply responder PBMCs). If desired, the cells are frozen in fetal bovine serum and DMSO after isolation. Frozen cells may be thawed overnight in assay media (37° C., 5% CO2) and then washed and resuspended to 3×106 cells/mil of assay media (RPMI; 10% fetal bovine serum, 1% penicillin/streptomycin, 1% glutamnine, 1% HEPES, 1% non-essential amino acids, 1% pyruvate). The stimulator PBMCs are prepared by irradiating the cells (about 3000 Rads).
- The assay is prepared by plating in triplicate wells a mixture of:
- 100:1 of test sample diluted to 1% or to 0.1%,
- 50:1 of irradiated stimulator cells, and
- 50:1 of responder PBMC cells.
- 100 microliters of cell culture media or 100 microliter of CD4-IgG is used as the control. The wells are then incubated at 37° C., 5% CO2 for 4 days. On day 5, each well is pulsed with tritiated thymidine (1.0 mC/well; Amersham). After 6 hours the cells are washed 3 times and then the uptake of the label is evaluated.
- In another variant of this assay, PBMCs are isolated from the spleens of Balb/c mice and C57B6 mice. The cells are teased from freshly harvested spleens in assay media (RPMI; 10% fetal bovine serum, 1% penicillin/streptomycin, 1% glutamine, 1% HEPES, 1% non-essential amino acids, 1% pyruvate) and the PBMCs are isolated by overlaying these cells over Lympholyte M (Organon Teknika), centrifuging at 2000 rpm for 20 minutes, collecting and washing the mononuclear cell layer inassay media and resuspending the cells to 1×107 cells/ml of assay media. The assay is then conducted as described above.
- Positive increases over control are considered positive with increases of greater than or equal to 180% being preferred. However, any value greater than control indicates a stimulatory effect for the test protein.
- The following PRO polypeptides tested positive in this assay: PRO344.
- Pericyte c-Fos Induction (Assay 93)
- This assay shows that certain polypeptides of the invention act to induce the expression of c-fos in pericyte cells and, therefore, are useful not only as diagnostic markers for particular types of pericyte-associated tumors but also for giving rise to antagonists which would be expected to be useful for the therapeutic treatment of pericyte-associated tumors. Induction of c-fos expression in pericytes is also indicative of the induction of angiogenesis and, as such, PRO polypeptides capable of inducing the expression of c-fos would be expected to be useful for the treatment of conditions where induced angiogenesis would be beneficial including, for example, wound healing, and the like. Specifically, on
day 1, pericytes are received from VEC Technologies and all but 5 ml of media is removed from flask. Onday 2, the pericytes are trypsinized, washed, spun and then plated onto 96 well plates. On day 7, the media is removed and the pericytes are treated with 100 μl of PRO polypeptide test samples and controls (positive control=DME+5% serum +/−PDGF at 500 ng/ml; negative control=protein 32). Replicates are averaged and SD/CV are determined. Fold increase over Protein 32 (buffer control) value indicated by chemiluminescence units (RLU) luminometer reading verses frequency is plotted on a histogram. Two-fold above Protein 32 value is considered positive for the assay. ASY Matrix: Growth media=low glucose DMEM=20% FBS +1X pen strep +1X fungizone. Assay Media=low glucose DMEM +5% FBS. - The following polypeptides tested positive in this assay: PRO301, PRO619, PRO1066 and PRO1265.
- Cytokine Release Assay (Assay 120)
- This assay is designed to determine whether PRO polypeptides of the present invention are capable of inducing the release of cytokines from peripheral blood mononuclear cells (PBMCs). PRO polypeptides capable of inducing the release of cytokines from PBMCs are useful from the treatment of conditions which would benefit from enhanced cytokine release and will be readily evident to those of ordinary skill in thie art. Specifically, 1×106 cells/ml of peripheral blood mononuclear cells (PBMC) are cultured with 1% of a PRO polypeptide for 3 days in complete RPMI media. The supernatant is then harvested and tested for increased concentrations of various cytokines by ELISA as compared to a human IgG treated control. A positive in the assay is a 10-fold or greater increase in cytokine concentration in the PRO polypeptide treated sample as compared to the human IgG treated control.
- The following polypeptides tested positive in this assay: PRO526 and PRO1343.
- Inhibition of A-Peptide Binding to Factor VIIA (Assay 118)
- This assay is designed to identify PRO polypeptides which are capable of inhibiting the binding of A-peptide to factor VIIA, thereby affecting the blood coagulation cascade. PRO polypeptides testing positive in this assay are expected to be useful for the treatment of conditions where alteration of the blood coagulation cascade would be beneficial including, for example, stroke, heart attack and various coagulation disorders. These PRO polypeptides are also useful for the identification of agonist and antagonist molecules which would also be useful for treatment of those conditions.
- Specifically,384 well plates are coated with soluble factor VIIA and are incubated overnight at 4° C. The wells are then decanted and are blocked by the addition of 0.5% BSA for 1 hour. The wells are then washed and 2011l of biotinylated A-peptide and either various concentration of the PRO polypeptide (test) or nothing (negative control) are added to each well. The plates are then incubated for 1 hour at room temperature. The wells are again washed and then 40 μl of streptavidin-europium is added to each well. The plates are then incubated for 30 minutes at room temperature and then washed. 40 μl of a fluorescence enhancement solution is then added to each well, the plates incubated for 5 minutes at room temperature and each well is then read on Wallac Victor reader under europium delayed fluorescence settings. Percent inhibition of binding of the A-peptide to the factor VIIA is then determined (as compared to the negative control), wherein a positive in the assay is a percent inhibition of 30% or greater.
- The following PRO polypeptides tested positive in this assay: PRO182.
- Inhibition of Adipocyte Differentiation Assay (Assay 66)
- This assay is designed to identify PRO polypeptides which are capable of inhibiting insulin-induced differentiation of adipocytes. PRO polypeptides testing positive in this assay would be expected to be useful for the treatment of conditions associated with obesity, diabetes, etc.
- Specifically, 3T3-L1 cells are seeded into the wells of 96 well plates at 6×104 cells/well and allowed to grow to confluency for 7 days. At day 7, the cells are treated with various concentrations of the PRO polypeptide (or nothing for the negative control) in the presence of 1 μg/ml insulin, 0.25×10−6 M dexamethasone and 0.5 mM IBMX. The samples are then incubated at 37° C. in 7% CO2 for 2 days. After the incubation, the media is removed by aspiration and the cells are washed with PBS and re-exposed to the PRO polypeptide (or nothing for the negative control) and 1 μg/ml insulin. After 5 days, the media is removed and replaced with fresh PRO polypeptide (or nothing for the negative control) and insulin. After 5 days, the cells are lysed and the cell lysate is assayed using Sigma's Triglyceride [INT] kit (Sigma procedure #336). A positive in the assay is 20% greater inhibition of adipocyte differentiation in the PRO polypeptide treated samples as compared to the negative control.
- The following PRO polypeptides tested positive in this assay: PRO185 and PRO198.
- HUVEC Stimulation by PRO Polypeptides (Assay 131)
- This assay is designed to identify PRO polypeptides which are capable of stimulating the proliferation of HUVEC cells. PRO polypeptides testing positive in this assay would be expected to be useful for inducing angiogenesis for the treatmnent of conditions where angiogenesis would be beneficial including, for example, wound healing, and the like. Antagonists of these PRO polypeptides would be expected to be useful for inhibiting angiogenesis for the treatment of, for example, tumors, and the like.
- Specifically, COSTAR® flat bottom black plates are treated with fibronectin for 20 minutes and then washed twice with PBS. HUVEC cells are then plated at 2000 cells/well in an appropriate growth medium. The plates are then incubated overnight and then the PRO polypeptide (1% final concentration), nothing (negative control) or IL1β (3.3 ng/ml final concentration; positive control) is added. The plates are again incubated overnight, stained with ICAMI-Cy5 and read on FMAT. A positive in the assay is a 2-fold or greater increase in fluorescence as compared to the positive control.
- The following PRO polypeptides tested positive in this assay: PRO222.
- Promotion of Chondrocyte Redifferentiation (Assay 129)
- This assay is designed to determine whether PRO polypeptides of the present invention show the ability to induce the proliferation and/or redifferentiation of chondrocytes in culture. PRO polypeptides testing positive in this assay would be expected to be useful for the therapeutic treatment of various bone and/or cartilage disorders such as, for example, sports injuries and arthritis.
- Porcine chondrocytes are isolated by overnight collagenase digestion of articular cartilage of the metacarpophalangealjoint of 4-6 month old female pigs. The isolated cells are then seeded at 25,000 cells/cm2 in Ham F-12 containing 10% FBS and 4 μg/ml gentamycin. The culture media is changed every third day. On day 12, the cells are seeded in 96 well plates at 5,000 cells/well in 100 μl of the same media without serum and 100 μl of either serum-free medium (negative control), staurosporin (final concentration of 5 nM; positive control) or the test PRO polypeptide are added to give a final volume of 200 μl/well. After 5 days at 37° C., 22 μl of media comtaining 100 μg/ml Hoechst 33342 and 50 μg/ml 5-CFDA is added to each well and incubated for an additional 10 minutes at 37° C. A picture of the green fluorescence is taken for each well and the differentiation state of the chondrocytes is calculated by morphometric analysis. A positive result in the assay is obtained when the >50% of the PRO polypeptide treated cells are differentiated (compared to the background obtained by the negative control).
- The following PRO polypeptides tested positive in this assay: PRO301.
- Microarray Analysis to Detect Overexpression of PRO Polypelptides in Cancerous Tumors
- Nucleic acid microarrays, often containing thousands of gene sequences, are useful for identifying differentially expressed genes in diseased tissues as compared to their normal counterparts. Using nucleic acid nicroarrays, test and control mRNA samples from test and control tissue samples are reverse transcribed and labeled to generate cDNA probes. The cDNA probes are then hybridized to an array of nucleic acids immobilized on a solid support. The array is configured such that the sequence and position of each member of the array is known. For example, a selection of genes known to be expressed in certain disease states may be arrayed on a solid support. Hybridization of a labeled probe with a particular array member indicates that the sample from which the probe was derived expresses that gene. If the hybridization signal of a probe from a test (disease tissue) sample is greater than hybridization signal of a probe from a control (normal tissue) sample, the gene or genes overexpressed in the disease tissue are identified. The implication of this result is that an overexpressed protein in a diseased tissue is useful not only as a diagnostic marker for the presence of the disease condition, but also as a therapeutic target for treatment of the disease condition.
- The methodology of hybridization of nucleic acids and microarray technology is well known in the art. In the present example, the specific preparation of nucleic acids for hybridization and probes, slides, and hybridization conditions are all detailed in U.S. Provisional Patent Application Serial No. 60/193,767, filed on Mar. 31, 2000 and which is herein incorporated by reference.
- In the present example, cancerous tumors derived from various human tissues were studied for PRO polypeptide-encoding gene expression relative to non-cancerous human tissue in an attempt to identify those PRO polypeptides which are overexpressed in cancerous tumors. Two sets of experimental data were generated. In one set, cancerous human colon tumor tissue and matched non-cancerous human colon tumor tissue from the same patient (“matched colon control”) were obtained and analyzed for PRO polypeptide expression using the above described microarray technology. In the second set of data, cancerous human tumor tissue from any of a variety of different human tumors was obtained and compared to a “universal” epithelial control sample which was prepared by pooling non-cancerous human tissues of epithelial origin, including liver, kidney, and lung. mRNA isolated from the pooled tissues represents a mixture of expressed gene products from these different tissues. Microarray hybridization experiments using the pooled control samples generated a linear plot in a 2-color analysis. The slope of the line generated in a 2-color analysis was then used to normalize the ratios of (test:control detection) within each experiment. The normalized ratios from various experiments were then compared and used to identify clustering of gene expression. Thus, the pooled “universal control” sample not only allowed effective relative gene expression determinations in a simple 2-sample comparison, it also allowed multi-sample comparisons across several experiments.
- In the present experiments, nucleic acid probes derived from the herein described PRO polypeptide-encoding nucleic acid sequences were used in the creation of the microarray and RNA from the tumor tissues listed above were used for the hybridization thereto. A value based upon the normalized ratio:experimental ratio was designated as a “cutoff ratio”. Only values that were above this cutoff ratio were determined to be significant. Table 8 below shows the results of these experiments, demonstrating that various PRO polypeptides of the preent invention are significantly overexpressed in various human tumor tissues as compared to a non-cancerous human tissue control. As described above, these data demonstrate that the PRO polypeptides of the present invention are useful not only as diagnostic markers for the presence of one or more cancerous tumors, but also serve as therapeutic targets for the treatment of those tumors.
TABLE 8 Molecule is overexpressed in: as compared to: PRO177 breast tumor universal normal control PRO177 liver tumor universal normal control PRO177 lung tumor universal normal control PRO3574 breast tumor universal normal control PRO3574 colon tumor matched normal colon control PRO1280 breast tumor universal normal control PRO1280 lung tumor universal normal control PRO4984 lung tumor universal normal control PRO4988 colon tumor universal normal control PRO4988 lung tumor universal normal control PRO305 lung tumor universal normal control PRO305 colon tumor universal normal control PRO1866 prostate tumor universal normal control PRO1866 lung tumor universal normal control PRO1866 colon tumor universal normal control PRO4996 breast tumor universal normal control PRO4996 lung tumor universal normal control PRO4406 lung tumor universal normal control PRO4406 colon tumor universal normal control PRO1120 colon tumor universal normal control PRO1120 breast tumor universal normal control PRO1120 rectal tumor universal normal control PRO4990 lung tumor universal normal control PRO738 cervical tumor universal normal control PRO738 lung tumor universal normal control PRO738 breast tumor universal normal control PRO3577 lung tumor universal normal control PRO1879 breast tumor universal normal control PRO1879 lung tumor universal normal control PRO1879 colon tumor universal normal control PRO1471 lung tumor universal normal control PRO1076 prostate tumor universal normal control PRO1483 lung tumor universal normal control PRO4985 rectal tumor universal normal control PRO4985 colon tumor universal normal control PRO4985 breast tumor universal normal control PRO4985 lung tumor universal normal control PRO5000 lung tumor universal normal control PRO1881 liver tumor universal normal control PRO1881 lung tumor universal normal control PRO1881 breast tumor universal normal control PRO4314 lung tumor universal normal control PRO4314 breast tumor universal normal control PRO4987 lung tumor universal normal control PRO4313 lung tumor universal normal control PRO4313 breast tumor universal normal control PRO4799 colon tumor universal normal control PRO4995 liver tumor universal normal control PRO4995 colon tumor universal normal control PRO4995 colon tumor matched normal colon control PRO1341 prostate tumor universal normal control PRO1341 lung tumor universal normal control PRO1341 colon tumor universal normal control PRO1341 colon tumor matched normal colon control PRO1777 lung tumor universal normal control PRO1777 colon tumor matched normal colon control PRO3580 lung tumor universal normal control PRO3580 prostate tumor universal normal control PRO1779 lung tumor universal normal control PRO1779 colon tumor universal normal control PRO1779 cervical tumor universal normal control PRO1754 breast tumor universal normal control PRO1754 lung tumor universal normal control PRO1906 breast tumor universal normal control PRO1906 colon tumor universal normal control PRO1906 prostate tumor universal normal control PRO1870 breast tumor universal normal control PRO4329 lung tumor universal normal control PRO4979 colon tumor universal normal control PRO1885 rectal tumor universal normal control PRO1885 colon tumor universal normal control PRO1885 colon tumor matched normal colon control PRO1882 prostate tumor universal normal control PRO1882 lung tumor universal normal control PRO1882 colon tumor universal normal control PRO1882 breast tumor universal normal control PRO1882 cervical tumor universal normal control PRO4989 rectal tumor universal normal control PRO4989 breast tumor universal normal control PRO4989 colon tumor matched normal colon control PRO4989 colon tumor universal normal control PRO4323 lung tumor universal normal control PRO4323 liver tumor universal normal control PRO1886 breast tumor universal normal control PRO1886 lung tumor universal normal control PRO1886 rectal tumor universal normal control PRO4395 colon tumor universal normal control PRO4395 prostate tumor universal normal control PRO4395 lung tumor universal normal control PRO4395 cervical tumor universal normal control PRO1782 colon tumor universal normal control PRO1782 lung tumor universal normal control PRO4388 lung tumor universal normal control PRO4341 breast tumor universal normal control PRO4341 lung tumor universal normal control PRO3438 lung tumor universal normal control PRO4321 breast tumor universal normal control PRO4321 lung tumor universal normal control PRO4321 colon tumor universal normal control PRO4304 breast tumor universal normal control PRO4304 lung tumor universal normal control PRO4403 colon tumor universal normal control PRO4403 breast tumor universal normal control PRO4403 lung tumor universal normal control PRO4324 lung tumor universal normal control PRO4324 breast tumor universal normal control PRO4303 cervical tumor universal normal control PRO4303 lung tumor universal normal control PRO4303 breast tumor universal normal control PRO4303 colon tumor universal normal control PRO4303 prostate tumor universal normal control PRO4305 breast tumor universal normal control PRO4305 lung tumor universal normal control PRO4305 colon tumor universal normal control PRO4305 liver tumor universal normal control PRO4404 lung tumor universal normal control PRO4404 breast tumor universal normal control PRO4404 rectal tumor universal normal control PRO1884 lung tumor universal normal control PRO4349 colon tumor universal normal control PRO4349 lung tumor universal normal control PRO4401 colon tumor universal normal control PRO4401 lung tumor universal normal control PRO1867 lung tumor universal normal control PRO1867 liver tumor universal normal control PRO4319 breast tumor universal normal control PRO4319 lung tumor universal normal control PRO4991 lung tumor universal normal control PRO4991 colon tumor universal normal control PRO4398 lung tumor universal normal control PRO4346 lung tumor universal normal control PRO4350 colon tumor universal normal control PRO4350 prostate tumor universal normal control PRO4350 lung tumor universal normal control PRO4318 prostate tumor universal normal control PRO4318 lung tumor universal normal control PRO4340 breast tumor universal normal control PRO4340 lung tumor universal normal control PRO4400 breast tumor universal normal control PRO4400 lung tumor universal normal control PRO4320 lung tumor universal normal control PRO4409 lung tumor universal normal control PRO4409 cervical tumor universal normal control PRO4409 colon tumor universal normal control PRO4399 lung tumor universal normal control PRO4399 breast tumor universal normal control PRO4418 lung tumor universal normal control PRO4418 breast tumor universal normal control PRO4330 cervical tumor universal normal control PRO4330 colon tumor matched normal colon control PRO4339 breast tumor universal normal control PRO4339 colon tumor universal normal control PRO4326 lung tumor universal normal control PRO4326 colon tumor universal normal control PRO6014 breast tumor universal normal control PRO3446 colon tumor universal normal control PRO3446 lung tumor universal normal control PRO4322 lung tumor universal normal control PRO4322 rectal tumor universal normal control PRO4322 colon tumor matched normal colon control PRO4381 breast tumor universal normal control PRO4381 lung tumor universal normal control PRO4381 colon tumor universal normal control PRO4348 lung tumor universal normal control PRO4348 prostate tumor universal normal control PRO4371 breast tumor universal normal control PRO3742 colon tumor universal normal control PRO3742 lung tumor universal normal control PRO5773 lung tumor universal normal control PRO5773 colon tumor universal normal control PRO5773 prostate tumor universal normal control PRO5774 colon tumor universal normal control PRO4343 colon tumor universal normal control PRO4325 lung tumor universal normal control PRO4347 lung tumor universal normal control PRO4347 colon tumor universal normal control PRO4347 rectal tumor universal normal control PRO3743 colon tumor universal normal control PRO3743 lung tumor universal normal control PRO3743 prostate tumor universal normal control PRO4426 colon tumor universal normal control PRO4500 colon tumor universal normal control PRO4389 breast tumor universal normal control PRO4389 lung tumor universal normal control PRO4337 colon tumor universal normal control PRO4337 breast tumor universal normal control PRO4337 lung tumor universal normal control PRO4992 lung tumor universal normal control PRO5996 lung tumor universal normal control PRO4345 lung tumor universal normal control PRO4345 colon tumor universal normal control PRO5780 lung tumor universal normal control PRO5780 breast tumor universal normal control PRO5992 lung tumor universal normal control PRO5992 colon tumor universal normal control PRO5992 breast tumor universal normal control PRO4428 prostate tumor universal normal control PRO4994 lung tumor universal normal control PRO5995 lung tumor universal normal control PRO5995 colon tumor universal normal control PRO6094 lung tumor universal normal control PRO6094 colon tumor universal normal control PRO4317 lung tumor universal normal control PRO4317 colon tumor universal normal control PRO4317 liver tumor universal normal control PRO4317 colon tumor matched normal colon control PRO5997 colon tumor universal normal control PRO5997 lung tumor universal normal control PRO5005 lung tumor universal normal control PRO5005 colon tumor universal normal control PRO5004 colon tumor universal normal control PRO6001 breast tumor universal normal control PRO6013 colon tumor universal normal control PRO4502 lung tumor universal normal control PRO4502 colon tumor universal normal control PRO6007 breast tumor universal normal control PRO6028 breast tumor universal normal control PRO6028 colon tumor universal normal control PRO4327 prostate tumor universal normal control PRO4315 colon tumor universal normal control PRO5993 lung tumor universal normal control PRO5993 colon tumor universal normal control PRO4503 colon tumor universal normal control PRO4976 lung tumor universal normal control PRO5798 lung tumor universal normal control PRO5798 colon tumor universal normal control PRO6242 colon tumor universal normal control PRO6242 colon tumor matched normal colon control PRO6242 breast tumor universal normal control PRO6242 liver tumor universal normal control PRO6242 rectal tumor universal normal control PRO6095 breast tumor universal normal control PRO6095 lung tumor universal normal control PRO6093 colon tumor universal normal control PRO6093 breast tumor universal normal control PRO6093 lung tumor universal normal control PRO6093 colon tumor matched normal colon control PRO6012 colon tumor universal normal control PRO6027 lung tumor universal normal control PRO6027 colon tumor universal normal control PRO6027 rectal tumor universal normal control PRO6181 prostate tumor universal normal control PRO6181 lung tumor universal normal control PRO6181 colon tumor universal normal control PRO6097 colon tumor universal normal control PRO6097 lung tumor universal normal control PRO6090 lung tumor universal normal control PRO7171 lung tumor universal normal control PRO7171 colon tumor universal normal control PRO7171 breast tumor universal normal control PRO6258 prostate tumor universal normal control PRO6258 breast tumor universal normal control PRO6258 cervical tumor universal normal control PRO6258 liver tumor universal normal control PRO6258 colon tumor universal normal control PRO9820 prostate tumor universal normal control PRO6243 lung tumor universal normal control PRO6182 lung tumor universal normal control PRO6079 lung tumor universal normal control PRO6079 colon tumor universal normal control PRO6079 breast tumor universal normal control PRO6079 prostate tumor universal normal control PRO7434 lung tumor universal normal control PRO9865 colon tumor universal normal control PRO9828 colon tumor universal normal control PRO196 colon tumor universal normal control PRO196 lung tumor universal normal control PRO196 breast tumor universal normal control PRO197 colon tumor universal normal control PRO197 lung tumor universal normal control PRO197 breast tumor universal normal control PRO195 colon tumor universal normal control PRO195 lung tumor universal normal control PRO195 breast tumor universal normal control PRO187 lung tumor universal normal control PRO187 liver tumor universal normal control PRO182 colon tumor universal normal control PRO182 lung tumor universal normal control PRO182 breast tumor universal normal control PRO188 rectal tumor universal normal control PRO183 colon tumor universal normal control PRO183 lung tumor universal normal control PRO183 breast tumor universal normal control PRO183 rectal tumor universal normal control PRO184 lung tumor universal normal control PRO184 breast tumor universal normal control PRO185 lung tumor universal normal control PRO200 colon tumor universal normal control PRO200 lung tumor universal normal control PRO200 breast tumor universal normal control PRO200 rectal tumor universal normal control PRO202 colon tumor universal normal control PRO202 lung tumor universal normal control PRO202 breast tumor universal normal control PRO202 rectal tumor universal normal control PRO202 liver tumor universal normal control PRO214 colon tumor universal normal control PRO214 lung tumor universal normal control PRO215 colon tumor universal normal control PRO215 lung tumor universal normal control PRO215 breast tumor universal normal control PRO219 colon tumor universal normal control PRO219 lung tumor universal normal control PRO219 breast tumor universal normal control PRO219 liver tumor universal normal control PRO211 lung tumor universal normal control PRO211 breast tumor universal normal control PRO220 colon tumor universal normal control PRO220 lung tumor universal normal control PRO220 breast tumor universal normal control PRO366 colon tumor universal normal control PRO366 lung tumor universal normal control PRO366 breast tumor universal normal control PRO216 lung tumor universal normal control PRO221 colon tumor universal normal control PRO221 lung tumor universal normal control PRO221 breast tumor universal normal control PRO228 lung tumor universal normal control PRO228 breast tumor universal normal control PRO217 lung tumor universal normal control PRO217 breast tumor universal normal control PRO222 colon tumor universal normal control PRO222 lung tumor universal normal control PRO222 breast tumor universal normal control PRO224 colon tumor universal normal control PRO224 lung tumor universal normal control PRO224 breast tumor universal normal control PRO224 prostate tumor universal normal control PRO224 rectal tumor universal normal control PRO230 colon tumor universal normal control PRO230 lung tumor universal normal control PRO230 breast tumor universal normal control PRO230 prostate tumor universal normal control PRO198 colon tumor universal normal control PRO198 lung tumor universal normal control PRO198 breast tumor universal normal control PRO198 liver tumor universal normal control PRO226 lung tumor universal normal control PRO226 breast tumor universal normal control PRO261 lung tumor universal normal control PRO242 colon tumor universal normal control PRO242 lung tumor universal normal control PRO242 breast tumor universal normal control PRO227 colon tumor universal normal control PRO227 lung tumor universal normal control PRO237 colon tumor universal normal control PRO237 lung tumor universal normal control PRO237 breast tumor universal normal control PRO237 prostate tumor universal normal control PRO241 colon tumor universal normal control PRO241 lung tumor universal normal control PRO241 breast tumor universal normal control PRO231 colon tumor universal normal control PRO231 lung tumor universal normal control PRO231 breast tumor universal normal control PRO231 rectal tumor universal normal control PRO235 colon tumor universal normal control PRO235 lung tumor universal normal control PRO235 breast tumor universal normal control PRO235 liver tumor universal normal control PRO323 lung tumor universal normal control PRO323 breast tumor universal normal control PRO323 rectal tumor universal normal control PRO245 colon tumor universal normal control PRO245 lung tumor universal normal control PRO245 breast tumor universal normal control PRO245 cervical tumor universal normal control PRO245 liver tumor universal normal control PRO246 colon tumor universal normal control PRO246 lung tumor universal normal control PRO246 breast tumor universal normal control PRO288 lung tumor universal normal control PRO288 breast tumor universal normal control PRO248 lung tumor universal normal control PRO248 rectal tumor universal normal control PRO257 colon tumor universal normal control PRO257 lung tumor universal normal control PRO257 prostate tumor universal normal control PRO172 colon tumor universal normal control PRO172 lung tumor universal normal control PRO172 breast tumor universal normal control PRO258 colon tumor universal normal control PRO258 lung tumor universal normal control PRO258 breast tumor universal normal control PRO265 lung tumor universal normal control PRO265 breast tumor universal normal control PRO265 rectal tumor universal normal control PRO326 colon tumor universal normal control PRO326 lung tumor universal normal control PRO326 breast tumor universal normal control PRO326 liver tumor universal normal control PRO266 colon tumor universal normal control PRO266 lung tumor universal normal control PRO266 breast tumor universal normal control PRO269 lung tumor universal normal control PRO269 rectal tumor universal normal control PRO285 colon tumor universal normal control PRO285 lung tumor universal normal control PRO285 breast tumor universal normal control PRO328 colon tumor universal normal control PRO328 lung tumor universal normal control PRO328 breast tumor universal normal control PRO344 breast tumor universal normal control PRO272 lung tumor universal normal control PRO301 colon tumor universal normal control PRO301 lung tumor universal normal control PRO301 breast tumor universal normal control PRO331 colon tumor universal normal control PRO331 lung tumor universal normal control PRO331 breast tumor universal normal control PRO332 colon tumor universal normal control PRO332 lung tumor universal normal control PRO332 breast tumor universal normal control PRO353 colon tumor universal normal control PRO353 lung tumor universal normal control PRO353 breast tumor universal normal control PRO310 colon tumor universal normal control PRO310 lung tumor universal normal control PRO310 breast tumor universal normal control PRO310 rectal tumor universal normal control PRO337 colon tumor universal normal control PRO337 lung tumor universal normal control PRO337 breast tumor universal normal control PRO346 lung tumor universal normal control PRO350 lung tumor universal normal control PRO350 breast tumor universal normal control PRO526 colon tumor universal normal control PRO526 lung tumor universal normal control PRO526 breast tumor universal normal control PRO381 colon tumor universal normal control PRO381 lung tumor universal normal control PRO381 breast tumor universal normal control PRO381 prostate tumor universal normal control PRO846 colon tumor universal normal control PRO846 lung tumor universal normal control PRO363 colon tumor universal normal control PRO363 lung tumor universal normal control PRO365 lung tumor universal normal control PRO365 breast tumor universal normal control PRO1310 breast tumor universal normal control PRO731 colon tumor universal normal control PRO731 lung tumor universal normal control PRO731 breast tumor universal normal control PRO322 colon tumor universal normal control PRO322 lung tumor universal normal control PRO322 breast tumor universal normal control PRO322 rectal tumor universal normal control PRO322 liver tumor universal normal control PRO536 lung tumor universal normal control PRO536 breast tumor universal normal control PRO536 liver tumor universal normal control PRO719 colon tumor universal normal control PRO719 lung tumor universal normal control PRO719 breast tumor universal normal control PRO619 colon tumor universal normal control PRO619 lung tumor universal normal control PRO619 breast tumor universal normal control PRO771 colon tumor universal normal control PRO771 lung tumor universal normal control PRO771 breast tumor universal normal control PRO1083 colon tumor universal normal control PRO1083 lung tumor universal normal control PRO1083 breast tumor universal normal control PRO1083 prostate tumor universal normal control PRO862 colon tumor universal normal control PRO862 lung tumor universal normal control PRO862 breast tumor universal normal control PRO733 colon tumor universal normal control PRO733 lung tumor universal normal control PRO733 breast tumor universal normal control PRO733 liver tumor universal normal control PRO1188 lung tumor universal normal control PRO1188 breast tumor universal normal control PRO1188 rectal tumor universal normal control PRO770 lung tumor universal normal control PRO770 breast tumor universal normal control PRO1080 colon tumor universal normal control PRO1080 lung tumor universal normal control PRO1080 breast tumor universal normal control PRO1017 colon tumor universal normal control PRO1017 lung tumor universal normal control PRO1017 breast tumor universal normal control PRO1016 colon tumor universal normal control PRO1016 lung tumor universal normal control PRO1016 breast tumor universal normal control PRO1016 rectal tumor universal normal control PRO792 lung tumor universal normal control PRO938 colon tumor universal normal control PRO938 lung tumor universal normal control PRO938 breast tumor universal normal control PRO1012 colon tumor universal normal control PRO1012 lung tumor universal normal control PRO1012 rectal tumor universal normal control PRO1012 liver tumor universal normal control PRO1008 lung tumor universal normal control PRO1075 colon tumor universal normal control PRO1075 lung tumor universal normal control PRO1007 colon tumor universal normal control PRO1007 lung tumor universal normal control PRO1007 breast tumor universal normal control PRO1007 rectal tumor universal normal control PRO1056 colon tumor universal normal control PRO1056 lung tumor universal normal control PRO1056 breast tumor universal normal control PRO791 colon tumor universal normal control PRO791 lung tumor universal normal control PRO791 breast tumor universal normal control PRO791 rectal tumor universal normal control PRO1111 colon tumor universal normal control PRO1111 lung tumor universal normal control PRO1111 breast tumor universal normal control PRO812 lung tumor universal normal control PRO812 breast tumor universal normal control PRO812 rectal tumor universal normal control PRO1066 lung tumor universal normal control PRO1185 colon tumor universal normal control PRO1185 lung tumor universal normal control PRO1185 breast tumor universal normal control PRO1031 lung tumor universal normal control PRO1360 lung tumor universal normal control PRO1360 breast tumor universal normal control PRO1309 lung tumor universal normal control PRO1309 breast tumor universal normal control PRO1107 lung tumor universal normal control PRO1107 breast tumor universal normal control PRO836 colon tumor universal normal control PRO836 lung tumor universal normal control PRO1132 lung tumor universal normal control PRO1132 breast tumor universal normal control PRO1131 colon tumor universal normal control PRO1131 lung tumor universal normal control PRO1131 breast tumor universal normal control PRO1131 liver tumor universal normal control PRO1130 colon tumor universal normal control PRO1130 lung tumor universal normal control PRO1130 breast tumor universal normal control PRO844 colon tumor universal normal control PRO844 lung tumor universal normal control PRO844 breast tumor universal normal control PRO844 rectal tumor universal normal control PRO1154 colon tumor universal normal control PRO1154 lung tumor universal normal control PRO1154 rectal tumor universal normal control PRO1154 liver tumor universal normal control PRO1181 lung tumor universal normal control PRO1181 breast tumor universal normal control PRO1126 colon tumor universal normal control PRO1126 lung tumor universal normal control PRO1126 breast tumor universal normal control PRO1126 adrenal tumor universal normal control PRO1186 colon tumor universal normal control PRO1186 lung tumor universal normal control PRO1186 breast tumor universal normal control PRO1186 liver tumor universal normal control PRO1198 colon tumor universal normal control PRO1198 lung tumor universal normal control PRO1159 lung tumor universal normal control PRO1159 breast tumor universal normal control PRO1159 liver tumor universal normal control PRO1265 colon tumor universal normal control PRO1265 breast tumor universal normal control PRO1250 colon tumor universal normal control PRO1250 lung tumor universal normal control PRO1250 breast tumor universal normal control PRO1475 colon tumor universal normal control PRO1475 breast tumor universal normal control PRO1312 colon tumor universal normal control PRO1312 lung tumor universal normal control PRO1312 breast tumor universal normal control PRO1308 colon tumor universal normal control PRO1308 lung tumor universal normal control PRO1308 liver tumor universal normal control PRO1326 colon tumor universal normal control PRO1325 lung tumor universal normal control PRO1326 breast tumor universal normal control PRO1192 colon tumor universal normal control PRO1192 lung tumor universal normal control PRO1192 breast tumor universal normal control PRO1246 colon tumor universal normal control PRO1246 lung tumor universal normal control PRO1246 breast tumor universal normal control PRO1246 prostate tumor universal normal control PRO1356 colon tumor universal normal control PRO1356 lung tumor universal normal control PRO1356 breast tumor universal normal control PRO1275 lung tumor universal normal control PRO1275 breast tumor universal normal control PRO1274 lung tumor universal normal control PRO1358 colon tumor universal normal control PRO1358 lung tumor universal normal control PRO1358 prostate tumor universal normal control PRO1286 colon tumor universal normal control PRO1286 lung tumor universal normal control PRO1286 prostate tumor universal normal control PRO1286 rectal tumor universal normal control PRO1294 colon tumor universal normal control PRO1294 lung tumor universal normal control PRO1294 breast tumor universal normal control PRO1294 rectal tumor universal normal control PRO1273 lung tumor universal normal control PRO1273 rectal tumor universal normal control PRO1279 colon tumor universal normal control PRO1279 lung tumor universal normal control PRO1195 lung tumor universal normal control PRO1195 breast tumor universal normal control PRO1271 lung tumor universal normal control PRO1271 breast tumor universal normal control PRO1271 liver tumor universal normal control PRO1338 colon tumor universal normal control PRO1338 lung tumor universal normal control PRO1338 breast tumor universal normal control PRO1343 colon tumor universal normal control PRO1343 lung tumor universal normal control PRO1343 breast tumor universal normal control PRO1343 rectal tumor universal normal control PRO1434 lung tumor universal normal control PRO1418 lung tumor universal normal control PRO1418 liver tumor universal normal control PRO1387 colon tumor universal normal control PRO1387 lung tumor universal normal control PRO1387 prostate tumor universal normal control PRO1387 rectal tumor universal normal control PRO1384 colon tumor universal normal control PRO1384 lung tumor universal normal control PRO1565 colon tumor universal normal control PRO1565 lung tumor universal normal control PRO1565 prostate tumor universal normal control PRO1474 colon tumor universal normal control PRO1474 lung tumor universal normal control PRO1474 breast tumor universal normal control PRO1474 rectal tumor universal normal control PRO1917 colon tumor universal normal control PRO1917 lung tumor universal normal control PRO1917 breast tumor universal normal control PRO1787 colon tumor universal normal control PRO1787 lung tumor universal normal control PRO1787 breast tumor universal normal control PRO1556 lung tumor universal normal control PRO1556 breast tumor universal normal control PRO1561 colon tumor universal normal control PRO1561 lung tumor universal normal control PRO1561 rectal tumor universal normal control PRO1693 colon tumor universal normal control PRO1693 lung tumor universal normal control PRO1693 breast tumor universal normal control PRO1868 lung tumor universal normal control PRO1868 breast tumor universal normal control PRO1890 colon tumor universal normal control PRO1890 lung tumor universal normal control PRO1890 breast tumor universal normal control PRO1890 prostate tumor universal normal control PRO1887 colon tumor universal normal control PRO1887 breast tumor universal normal control PRO4353 lung tumor universal normal control PRO4353 breast tumor universal normal control PRO1801 colon tumor universal normal control PRO1801 lung tumor universal normal control PRO4357 lung tumor universal normal control PRO4357 breast tumor universal normal control PRO4302 colon tumor universal normal control PRO4302 lung tumor universal normal control PRO4302 breast tumor universal normal control PRO4302 prostate tumor universal normal control PRO5990 colon tumor universal normal control PRO5990 lung tumor universal normal control PRO5990 breast tumor universal normal control - Identification of Recentor/Ligand Interactions
- In this assay, various PRO polypeptides are tested for ability to bind to a panel of potential receptor or ligand molecules for the purpose of identifying receptor/ligand interactions. The identification of a ligand for a known receptor, a receptor for a known ligand or a novel receptor/ligand pair is useful for a variety of indications including, for example, targeting bioactive molecules (linked to the ligand or receptor) to a cell known to express the receptor or ligand, use of the receptor or ligand as a reagent to detect the presence of the ligand or receptor in a composition suspected of containing the same, wherein the composition may comprise cells suspected of expressing the ligand or receptor, modulating the growth of or another biological or immunological activity of a cell known to express or respond to the receptor or ligand, modulating the immune response of cells or toward cells that express the receptor or ligand, allowing the preparaion of agonists, antagonists and/or antibodies directed against the receptor or ligand which will modulate the growth of or a biological or immunological activity of a cell expressing the receptor or ligand, and various other indications which will be readily apparent to the ordinarily skilled artisan.
- The assay is performed as follows. A PRO polypeptide of the present invention suspected of being a ligand for a receptor is expressed as a fusion protein containing the Fc domain of human IgG (an immunoadhesin). Receptor-ligand binding is detected by allowing interaction of the immunoadhesin polypeptide with cells (e.g. Cos cells) expressing candidate PRO polypeptide receptors and visualization of bound immunoadhesin with fluorescent reagents directed toward the Fc fusion domain and examination by microscope. Cells expressing candidate receptors are produced by transient transfection, in parallel, of defined subsets of a library of cDNA expression vectors encoding PRO polypeptides that may function as receptor molecules. Cells are then incubated for 1 hour in the presence of the PRO polypeptide immunoadhesin being tested for possible receptor binding. The cells are then washed and fixed with paraformaldehyde. The cells are then incubated with fluorescent conjugated antibody directed against the Fc portion of the PRO polypeptide immunoadhesin (e.g. FlTC conjugated goat anti-human-Fc antibody). The cells are then washed again and examined by microscope. A positive interaction is judged by the presence of fluorescent labeling of cells transfected with cDNA encoding a particular PRO polypeptide receptor or pool of receptors and an absence of similar fluorescent labeling of similarly prepared cells that have been transfected with other cDNA or pools of cDNA. If a defined pool of cDNA expression vectors is judged to be positive for interaction with a PRO polypeptide immunoadhesin, the individual cDNA species that comprise the pool are tested individually (the pool is “broken down”) to determine the specific cDNA that encodes a receptor able to interact with the PRO polypeptide immunoadhesin.
- In another embodiment of this assay, an epitope-tagged potential ligand PRO polypeptide (e.g. 8 histidine “His” tag) is allowed to interact with a panel of potential receptor PRO polypeptide molecules that have been expressed as fusions with the Fc domain of human IgG (immunoadhesins). Following a 1 hour co-incubation with the epitope tagged PRO polypeptide, the candidate receptors are each immunoprecipitated with protein A beads and the beads are washed. Potential ligand interaction is determined by western blot analysis of the immunoprecipitated complexes with antibody directed towards the epitope tag. An interaction is judged to occur if a band of the anticipated molecular weight of the epitope tagged protein is observed in the western blot analysis with a candidate receptor, but is not observed to occur with the other members of the panel of potential receptors.
- Using these assays, the following receptor/ligand interactions have been herein identified:
- (1) PRO1801 binds to PRO1114 and PRO4978.
- (2) PRO100 binds to PRO1114.
- The foregoing written specification is considered to be sufficient to enable one skilled in the art to practice the invention. The present invention is not to be limited in scope by the construct deposited, since the deposited embodiment is intended as a single illustration of certain aspects of the invention and any constructs that are functionally equivalent are within the scope of this invention. The deposit of material herein does not constitute an admission that the written description herein contained is inadequate to enable the practice of any aspect of the invention, including the best mode thereof, nor is it to be construed as limiting the scope of the claims to the specific illustrations that it represents. Indeed, various modifications of the invention in addition to those shown and described herein will become apparent to those skilled in the art from the foregoing description and fall within the scope of the appended claims.
- FIG. 13 GGCGGCGTCATGTGATCCGCTTCCCTGCTCCTTTAAGCGTCCACAGGCGGCGGAGCGGCCAC AATCACAGCTCCGTGCAATGGGGGAACCCGAGCCGGCTGCGCCGGGGGAATCCGTGCGGGCG CCTTCCGTCCCGGTCCCAAATCCTCGCCGCTCCAGCACCTCTGAAGTTTTGCAGCGCCCAGA AAGGAGGCGAGGAAGGAGGGAGTGTGTGAGAGGAGGGAGCAAAAAGCTCACCCTAAAACATT TATTTCAAGGAGAAAAGAAAAAGGGGGGGGCGCAAAAATGGCTGGGCAATTATAGAAAACAT GAGCACCAAGAAGCTGTGCATTGTTGGTGGGATTCTGCTCGTGTTCCAAATCATCGCCTTTC TGGTGGGAGGCTTGATTGCTCCAGGGCCCACAACGGCAGTGTCCTACATGTCGGTGAAATGT GTGGATGCCCGTAAGAACCATCACAAGACAAAATGGTTCGTGCCTTGGGGACCCAATCATTG TGACAAGATCCGAGACATTGAAGAGGCAATTCCAAGGGAAATTGAAGCCAATGACATCGTGT TTTCTGTTCACATTCCCCTCCCCCACATGGAGATGAGTCCTTGGTTCCAATTCATGCTGTTT ATCCTGCAGCTGGACATTGCCTTCAAGCTAAACAACCAAATCAGAGAAAATGCAGAAGTCTC CATGGACGTTTCCCTGGCTTACCGTGATGACGCATTTGCTGAGTGGACTGAAATGGCCCATG AAAGAGTACCACGGAAACTCAAATGCACCTTCACATCTCCCAAGACTCCAGAGCATGAGGGC CGTTACTATGAATGTGATGTCCTTCCTTTCATGGAAATTGGGTCTGTGGCCCATAAGTTTTA CCTTTTAAACATCCGGCTGCCTGTGAATGAGAAGAAGAAAATCAATGTGGGAATTGGGGAGA TAAAGGATATCCGGTTGGTGGGGATCCACCAAAATGGAGGCTTCACCAAGGTGTGGTTTGCC ATGAAGACCTTCCTTACGCCCAAAGCATCTTCATCATTATGGTGTGGTATTGGGAGGATCAC CATGATGTCCCGACCCCCAGTGCTTCTGGAAAAAGTCATCTTTGCCCTTGGGATTTCCATGA CCTTTATCAATATCCCAGTGGAATGGTTTTCCATCGGGTTTGACTGGACCTGGATGCTGCTG TTTGGTGACATCCGACAGGGCATCTTCTATGCGATGCTTCTGTCCTTCTOGATCATCTTCTG TGGCGAGCACATGATGGATCAGCACGAGCGGAACCACATCGCAGGGTATTGGAAGCAAGTCG GACCCATTGCCGTTGGCTCCTTCTGCCTCTTCATATTTAACATGTGTGAGAGAGGGGTACAA CTCACGAATCCCTTCTACAGTTATCTGGACTACGACATTGGAACAGAGCTGGCCATGGCCTT CATCATCGTGGCTGGAATCTGCCTCTGCCTCTACTTCCTGTTTCTATGCTTCATGGTATTTC AGGTGTTTCGGAAACATCAGTGGGAAGCAGTCCAGCCTCCAGCTATGAGCAAAGTCCGGCGG CTACACTATGAGGGGCTAATTTTTAGGTTCAAGTTCCTCATGCTTATCACCTTGGCCTGCGC TGCCATGACTGTCATCTTCTTCATCGTTAGTCAGGTAACGGAAGGCCATTGGAAATGGGGCG GCGTCACAGTCCAAGTGAACAGTGCCTTTTTCACAGGCATCTATGGGATGTGGAATCTGTAT GTCTTTGCTCTGATGTTCTTGTATGCACCATCCCATAAAAACTATGGAGAAGACCAGTCCAA TGGCGATCTGGGTGTCCATAGTGGGGAAGAACTCCAGCTCACCACCACTATCACCCATGTGG ACGGACCCACTGAGATCTACAAGTTGACCCGCAAGGAGGCCCAGGAGTAGGAGGCTGCAGCG CCCGGCTGGGACGGTCTCTCCATACCCCAAAGCCCCTCTAACTAGAGTGGGGCATGCCAGAG AGAGCTCAATGTACAAATGAATGCCTCATGGCTCTTAGCTGTGGTTTCTTGGACCAGCGGCA TGGACATTTGTCAGTTTGCCTTCTGAACGGTAGCTTTTGGAGGAAGTTCCTGCAGCCACTAA TGCATTGTGTATGATAACAAAAACTCTGGTATGACACATTTTCTGTGATCATTGTTAATTAG TGACATAGTAACATCTGTAGCAGCTGGTTAGTAAACCTCATGTGGGGGTGGGGTGGGGGTGT ATTCCTTGGGGGATGGTTTGGGCCGAATGGGGAGTGGAATATTTGACATTTTTCCTGTTTTA AATTCTAGGATAGATTTTAACATCCTTTGCGGTCCCAGTCCAAGGTAGGCTGGTGTCATAGT CTTCTCACTCCTAATCCATGACCACTGTTTTTTTCCTATTTATATCACCAGGTAGCCTACTG AGTTAATATTTAAGTTGTCAATAGATAAGTGTCCCTGTTTTGTGGCATAATATAACTGAATT TCATGAGAAGATTTATTCCACCAGGGGTATTTCAGCTTTGAAACCAAATCTGTGTATCTAAT ACTAACCAATCTGTTGGATGTGGATTTTAAAAAATGTTTGCTAAACTACCCAAGTAAGATTT ACTGTATTAAATGGCCTTCGGGTCTGAAAAGCTTTTTTTAACCTCTTGCTTAAAAGCGTTTT ATTTTGATAAGATACTTCAAATAGCCTCCAAAAGTGTAGATCCAATCACTTAAATAAACCTG TATGTATATGCAAAAAAAAAAAAAAAAAAAAAAA
- FIG. 14 MAGAIIENMSTKKLCIVGGILLVFQIIAFLVGGLIAPGPTTAVSYMSVKCVDARKNHHKTKW FVPWGPNHCDKIRDIEERAIPREIANDIVFSVHIPLPHMEMSPWFQFMLFILQLDIAFKLNN QIRENAEVSMDVSLAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFME IGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTFLTPSIFII MVWYWRRITMMSRPPVLLEKVIFALGISMTFINIPVEWFSIGFDWTWMLLFGDIRQGIFYAM LLSFWIIFCGEHMMDQHERNHIAGYWKQVGPIAVGSFCLFIFDMCERGVQLTNPFYSIWTTD IGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKVRRLHYEGLIFRFKF LMLITLACAAMTVIFFIVSQVTEGHWKWGGVTVQVNSAFFTGIYGMWNLYVFALMFLYAPSH KNYGEDQSNGDLGVHSGEELQLTTTITHVDGPTEIYKLTRKEAQE
- Important features of the protein:
- Signal peptide:
- amino acids 1-42
- Tranamembrane domains:
- amino acids 239-253, 269-284, 302-318, 338-352, 377-399, 434-452, 471-488
- N-glycosylation sites.
- amino acids 8-12, 406-410
- cAMP- and cGMP-dependent protein kinase phosphorylation site.
- amino acids 254-258
- N-myristoylation sites.
- amino acids 223-229, 274-280, 305-311, 358-364, 374-380, 386-392, 509-515
- FIG. 15 GTGAGGGGAACAGCTGATCCGTCTGTTGGGAGGACAGATATCTCAAGGCCAGGATGGAAGAA TCACCACTAAGCCGGGCACCATCCCGTGGTGGAGTCAACTTTCTCAATGTAGCCCGGACCTA CATCCCCAACACCAAGGTGGAATGTCACTACACCCTTCCCCCAGGCACCATGCCCAGTGCCA GTGACTGGATTGGAATCTTCAAGGTGGAGGCTGCCTGTGTTCGGGATTACCACACATTTGTG TGGTCTTCCGTGCCTGAAAGTACAACTGATGGTTCCCCCATTCQCQCCQGTGTCCQGTTCCG AGCCAGCTACCTGCCCAAACCAGGAGCTCAGCTCTACCAGTTCCGATATGTGAACCGCCAGG GCCAGGTGTGTGGGCAGAGCCCCCCTTTCCAGTTCCGAGAGCCAAGGCCCQTGGATGAACTG GTGACCCTGGAGGAGGCTGATGGGGGCTCTGACATCCTGCTGGTTGTCCCCAAGGCAACTGT GTTACAGAACCAGCTCGATGAGAGCCAGCAAGAACGGAATGACCTGATGCAGCTGAAGCTAC AGCTGGAGGGACAGGTGACAGAGCTGAGGAGCCGAGTGCAGGAGCTCGAGAGGGCTCTGGCA ACTGCCAGGCAGGAAGCAQCGGAGCTGATGGAACAGTACAAGGGGATTTCCCGGTCCCATGG GGAGATCACAAGAGAGGGGAACATCCTGAGCCGGCAACAGGGAGACCATGTGGCACGCATCC TGGAGCTAGAGGATGACATCCAGACCATCAGTGAGAAAGTGCTGACGAAGGAAGTGGAGCTG GACAGGCTTAGAGACACAGTGAAGGCCCTGACTCGGGAACAAGAGAAGCTCCTTGGGCAACT GAAAGAAGTACAAGGGAGGAGGAGCAAAAAGTGGGCTGAGCTCCAAGTGGCACAACAGGAGA ACCATCACTTAAATTTGGACCTGAAGGAGGCGAAGAGCTGGCAAGAGGAGCAGAGTGCTCAG GCTCAGCGACTGAAAGACAAGGTGGCCCAGATGAAGGACACCCTAGGCCAGGCCCAGCAGCG GGTGGCCGAGCTGGAAGCCCTTGAAGGAGCAGCTTCGAGGGCCCAGGAGCTTGCAGCCTCAA GCCAGCAGAAAGCCACCCTTCTTGGGGAGGAGTTGGCCAGTGCAGCAGCAGCCAGGGACCGC ACCATAGCCGAAACTACCGCAGCCGCCTGGAAAGTGGCTGAAGTTAACGGCAGGCTGGCTGA GCTCGGTTTGCACTTGAAGGAAGAAAAATGCCAATGGAGCAAGGAGCGGGCAGGCCTGCTGC AGAGTGTGGAGGCAGAGAAGGACAAGATCCTGAAGCTGAGTGCAGAGATACTTCGATTGGAG AAGGCAGTTCAGGAGGAGAGGACCCAAAACCAAGTGTTCAAGACTGAGCTGGCCCGGGAGAA GGATTCTAGCCTGGTACAGTTGTCAGAAAGTAAGCGGGAGCTGACAGAGCTGCGGTCAGCCC TGCGTGTGCTCCAGAAGGAAAAGGAGCAGTTACAGGAGGAGAAACAGGAATTGCTAGAGTAC ATGAGAAAGCTAGAAGGCCCGCCTGGAAGAAGGTGGAGATGAGAAGTGGAATAGGATGCCAC CACGAGGATGAGGAGGCCGCTGTGGGGCTGAAGCTGCCCGGCAGCTCTGACAGACTCAGAGG ACGAGTCCCCAGAAGACATGAGGCTCCCACCCTATGGCCTTTGTGAGCGTGGAGACCCAGGC TCCTCTCCTGCTGGGCCTCGAGAGGCTTCTCCCCTTGTTGTCATCAGCCAGCCGGCTCCCAT TTCTCCTCACCTCTCTGGGCCAGCTGAGGACAGTAGCTCTGACTCGGAGGCTGAAGATGAGA AGTCAGTCCTGATGGCAGCTGTGCAGAGTGaGGGTGAGGAGGCCAACTTACTGCTTCCTGAA CTGGGCAGTGCCTTCTATGACATGGCCAGTGGCTTTACAGTGGGTACCCTGTCAGAAACCAG CACTGGGGGCCCTGCCACCCCCACATGGAAGGAGTGTCCTATCTGTAAGGAGCGCTTTCCTG CTGAGAGTGACAAGGATGCCCTGGAGGACCACATGAATGGACACTTCTTTTTCAGCACCCAG GACCCCTTCACCTTTGAGTGATCTTACTCCCTCGTACATGCACAAATACACACTCATGCACA CACACACTCACACACATGCATACACTTAGGTTTCATGCCCATTTTCTATCACACTGGGCTCC ATGATATTCTGTTCCCTAAGAACTGCTTCTGTGTGCCCTGTTTTCATCCCAAGATTTCTCAC TTCATCCTCTCCTACCTGGCTCTTTTGTCCCAGGGAGGGGTCCTGTTCGGAAGCAGTGGCTG AATTTATCCCCTGAAAGTGGTTTTGGAGGAACCGGGATGGAGGAGGCCTTCCCCTGTGGGAA TAGAATCGTCCACTCCTAGCCCTGGTTGCTTCTGATACACAGCCACTGCACACACACACTCA CACTCACACTCCCTTGTCTGATGCCCCAAAGCCAATTCCTGGGGCACCCTACCCTCTCTTAT TTGGAGTTTCCGTTGGTTTACCTGAGTTTTCTCTGGGGTCTGCACAGAGGCAGCAGCATGGA CATCATGGCCTCTCAGGTCCCTTTTGGTTCTCAGTTTCATTGGTTCCTCTTTCTGTTCCCCC ATTGACTTCTGTGCCCCACCCTAGCCTTTTCCATAACCTTAGGTATTCAGTTTGGAGGGGTT TTTTGTATTTTTGAGGATTCCTGTATTCTGTATCCTCTCCTCGCATCTCCTCACATGGAAAG AAATAATGTATTTGTGCCTTCTGTGAGGAATGGGGGGAACAAGTGGTCCCAGGTATCCCCAT TTCCAAGGCCCCCCTCCCTCTCCAGGTCCCCCCACAGCAATAAAAGCTTCCCCCTGATATCC ATCCCTTTGTAGTTTGAACAAATATATTTATATGATATGTAA
- FIG. 16 MEESPLSRAPSRGGVNFLNVARTYIPNTKVECHYTLPPGTMPSASDWIGIFKVEAACVRDYH TFVWSSVPESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFREPRPM DELVTLEEADGGSDILLWVPKATVLQNQLDESQQERNDLMQLKLQLEGQVTELRSRVQELER ALATARQEHTELMEQYKGISRSHGEITEERDILSRQQGDHVARILELEDDIQTISEKVLTKE VELDRLRDTVKALTREQEKLLGQLKEVQADKEQSEAELQVAQQENHHLNLDLKEAKSWQEEQ SAQAQRLKDKVAQMKDTLGQAQQRVAELEPLKEQLRGAQELAASSQQKATLLGEELASAAAA RDRTIAELHRSRLEVAEVNGRLAELGLHLKEEKCQWSKERAGLLQSVEAEKDKILKLSAEIL RLEKAVQEERTQNQVFKTELAREKDSSLVQLSESKRELTELRSALRVLQKEKEQLQEEKQEL LEYMRKLEARLEKVADEKWNEDATTEDEEAAVGLSCPAALTDSEDESPEDMRLPPYGLCERG DPGSSPAGPREASPLVVISQPAPISPHLSGPAEDSSSDSEAEDEKSVLMAAVQSGGEEANLL LPELGSAFYDMASGFTVGTLSETSTGGPATPTWKECPICKERFPAESDKDALEDHMDGHFFF STQDPFTFE
- Iortant features:
- Casein kinase II phosphorylation sites:
- amino acids 28-31, 43-46, 68-71, 72-75, 129-132, 156-159, 208-211, 239-242, 282-285, 305-308, 376-379, 383-383, 468-471, 520-523, 521-524, 537-540, 539-542, 543-546, 593-596, 595-598, 597-600, 612-615, 639-642, 652-655, 667-670, 683-686
- N-myristoylation sites:
- amino acids 39-44, 107-112, 204-209, 414-419, 561-566, 613-618
- Cell attachment sequence:
- amino acids 557-559
- Leucine zipper pattern seqence:
- amino acids 163-184, 475-496, 482-503
-
0 SEQUENCE LISTING The patent application contains a lengthy “Sequence Listing” section. A copy of the “Sequence Listing” is available in electronic form from the USPTO web site (http://seqdata.uspto.gov/sequence.html?DocID=20040033559). An electronic copy of the “Sequence Listing” will also be available from the USPTO upon request and payment of the fee set forth in 37 CFR 1.19(b)(3).
Claims (71)
1. Isolated nucleic acid having at least 80% nucleic acid sequence identity to a nucleotide sequence that encodes an amino acid sequence selected from the group consisting of the amino acid sequence shown in FIG. 2 (SEQ ID NO:2), FIG. 4 (SEQ ID NO:4), FIG. 6 (SEQ ID NO:6), FIG. 8 (SEQ ID NO:8), FIG. 10 (SEQ ID NO: 10), FIG. 12 (SEQ ID NO: 12), FIG. 14 (SEQ ID NO: 14), FIG. 16 (SEQ ID NO: 16), FIG. 18 (SEQ ID NO: 18), FIG. 20 (SEQ ID NO:20), FIG. 22 (SEQ ID NO:22), FIG. 24 (SEQ ID NO:24), FIG. 26 (SEQ ID NO:26), FIG. 28 (SEQ ID NO:28), FIG. 30 (SEQ ID NO:30), FIG. 32 (SEQ ID NO:32), FIG. 34 (SEQ ID NO:34), FIG. 36 (SEQ ID NO:36), FIG. 38 (SEQ ID NO:38), FIG. 40 (SEQ ID NO:40), FIG. 42 (SEQ ID NO:42), FIG. 44 (SEQ ID NO:44), FIG. 46 (SEQ ID NO:46), FIG. 48 (SEQ ID NO:48), FIG. 50 (SEQ ID NO:50), FIG. 52 (SEQ ID NO:52), FIG. 54 (SEQ ID NO:54), FIG. 56 (SEQ ID NO:56), FIG. 58 (SEQ ID NO:58), FIG. 60 (SEQ ID NO:60), FIG. 62 (SEQ ID NO:62), FIG. 64 (SEQ ID NO:64), FIG. 66 (SEQ ID NO:66), FIG. 68 (SEQ ID NO:68), FIG. 70 (SEQ ID NO:70), FIG. 72 (SEQ ID NO:72), FIG. 74 (SEQ ID NO:74), FIG. 76 (SEQ ID NO:76), FIG. 78 (SEQ ID NO:78), FIG. 80 (SEQ ID NO:80), FIG. 82 (SEQ ID NO:82), FIG. 84 (SEQ ID NO:84), FIG. 86 (SEQ ID NO:86), FIG. 88 (SEQ ID NO:88), FIG. 90 (SEQ ID NO:90), FIG. 92 (SEQ ID NO:92), FIG. 94 (SEQ ID NO:94), FIG. 96 (SEQ ID NO:96), FIG. 98 (SEQ ID NO:98), FIG. 100 (SEQ ID NO:100), FIG. 102 (SEQ ID NO: 102), FIG. 104 (SEQ ID NO: 104), FIG. 106 (SEQ ID NO: 106), FIG. 108 (SEQ ID NO: 108), FIG. 110 (SEQ ID NO: 110), FIG. 112 (SEQ ID NO:112), FIG. 114 (SEQ ID NO:114), FIG. 116 (SEQ ID NO:116), FIG. 118 (SEQ ID NO:118), FIG. 120 (SEQ ID NO:120), FIG. 122 (SEQ ID NO:122), FIG. 124 (SEQ ID NO:124), FIG. 126 (SEQ ID NO:126), FIG. 128 (SEQ ID NO:128), FIG. 130 (SEQ ID NO:130), FIG. 132 (SEQ ID NO:132), FIG. 134 (SEQ ID NO:134), FIG. 136 (SEQ ID NO:136), FIG. 138 (SEQ ID NO:138), FIG. 140 (SEQ ID NO: 140), FIG. 142 (SEQ ID NO: 142), FIG. 144 (SEQ ID NO: 144), FIG. 146 (SEQ ID NO:146), FIG. 148 (SEQ ID NO: 148), FIG. 150 (SEQ ID NO:150), FIG. 152 (SEQ ID NO:152), FIG. 154 (SEQ ID NO:154), FIG. 156 (SEQ ID NO:156), FIG. 158 (SEQ ID NO:158), FIG. 160 (SEQ ID NO:160), FIG. 162 (SEQ ID NO:162), FIG. 164 (SEQ ID NO: 164), FIG. 166 (SEQ ID NO:166), FIG. 168 (SEQ ID NO:168), FIG. 170 (SEQ ID NO:170), FIG. 172 (SEQ ID NO:172), FIG. 174 (SEQ ID NO:174), FIG. 176 (SEQ ID NO:176), FIG. 178 (SEQ ID NO:178), FIG. 180 (SEQ ID NO:180), FIG. 182 (SEQ ID NO:182), FIG. 184 (SEQ ID NO:184), FIG. 186 (SEQ ID NO:186), FIG. 188 (SEQ ID NO:188), FIG. 190 (SEQ ID NO:190), FIG. 192 (SEQ ID NO: 192), FIG. 194 (SEQ ID NO: 194), FIG. 196 (SEQ ID NO:196), FIG. 198 (SEQ ID NO:198), FIG. 200 (SEQ ID NO:200), FIG. 202 (SEQ ID NO:202), FIG. 204 (SEQ ID NO:204), FIG. 206 (SEQ ID NO:206), FIG. 208 (SEQ ID NO:208), FIG. 210 (SEQ ID NO:210), FIG. 212 (SEQ ID NO:212), FIG. 214 (SEQ ID NO:214), FIG. 216 (SEQ ID NO:216), FIG. 218 (SEQ ID NO:218), FIG. 220 (SEQ ID NO:220), FIG. 222 (SEQ ID NO:222), FIG. 224 (SEQ ID NO:224), FIG. 226 (SEQ ID NO:226), FIG. 228 (SEQ ID NO:228), FIG. 230 (SEQ ID NO:230), FIG. 232 (SEQ ID NO:232), FIG. 234 (SEQ ID NO:234), FIG. 236 (SEQ ID NO:236), FIG. 238 (SEQ ID NO:238), FIG. 240 (SEQ ID NO:240), FIG. 242 (SEQ ID NO:242), FIG. 244 (SEQ ID NO:244), FIG. 246 (SEQ ID NO:246), FIG. 248 (SEQ ID NO:248), FIG. 250 (SEQ ID NO:250), FIG. 252 (SEQ ID NO:252), FIG. 254 (SEQ ID NO:254), FIG. 256 (SEQ ID NO:256), FIG. 258 (SEQ ID NO:258), FIG. 260 (SEQ ID NO:260), FIG. 262 (SEQ ID NO:262), FIG. 264 (SEQ ID NO:264), FIG. 266 (SEQ ID NO:266), FIG. 268 (SEQ ID NO:268), FIG. 270 (SEQ ID NO:270), FIG. 272 (SEQ ID NO:272), FIG. 274 (SEQ ID NO:274), FIG. 276 (SEQ ID NO:276), FIG. 278 (SEQ ID NO:278), FIG. 280 (SEQ ID NO:280), FIG. 282 (SEQ ID NO:282), FIG. 284 (SEQ ID NO:284), FIG. 286 (SEQ ID NO:286), FIG. 288 (SEQ ID NO:288), FIG. 290 (SEQ ID NO:290), FIG. 292 (SEQ ID NO:292), FIG. 294 (SEQ ID NO:294), FIG. 296 (SEQ ID NO:296), FIG. 298 (SEQ ID NO:298), FIG. 300 (SEQ ID NO:300), FIG. 302 (SEQ ID NO:302), FIG. 304 (SEQ ID NO:304), FIG. 306 (SEQ ID NO:306), FIG. 308 (SEQ ID NO:308), FIG. 310 (SEQ ID NO:310), FIG. 312 (SEQ ID NO:312), FIG. 314 (SEQ ID NO:314), FIG. 316 (SEQ ID NO:316), FIG. 318 (SEQ ID NO:318), FIG. 320 (SEQ ID NO:320), FIG. 322 (SEQ ID NO:322), FIG. 324 (SEQ ID NO:324), FIG. 326 (SEQ ID NO:326), FIG. 328 (SEQ ID NO:328), FIG. 330 (SEQ ID NO:330), FIG. 332 (SEQ ID NO:332), FIG. 334 (SEQ ID NO:334), FIG. 336 (SEQ ID NO:336), FIG. 338 (SEQ ID NO:338), FIG. 340 (SEQ ID NO:340), FIG. 342 (SEQ ID NO:342), FIG. 344 (SEQ ID NO:344), FIG. 346 (SEQ ID NO:346), FIG. 348 (SEQ ID NO:348), FIG. 350 (SEQ ID NO:350), FIG. 352 (SEQ ID NO:352), FIG. 354 (SEQ ID NO:354), FIG. 356 (SEQ ID NO:356), FIG. 358 (SEQ ID NO:358), FIG. 360 (SEQ ID NO:360), FIG. 362 (SEQ ID NO:362), FIG. 364 (SEQ ID NO:364), FIG. 366 (SEQ ID NO:366), FIG. 368 (SEQ ID NO:368), FIG. 370 (SEQ ID NO:370), FIG. 372 (SEQ ID NO:372), FIG. 374 (SEQ ID NO:374), FIG. 376 (SEQ ID NO:376), FIG. 378 (SEQ ID NO:378), FIG. 380 (SEQ ID NO:380), FIG. 382 (SEQ ID NO:382), FIG. 384 (SEQ ID NO:384), FIG. 386 (SEQ ID NO:386), FIG. 388 (SEQ ID NO:388), FIG. 390 (SEQ ID NO:390), FIG. 392 (SEQ ID NO:392), FIG. 394 (SEQ ID NO:394), FIG. 396 (SEQ ID NO:396), FIG. 398 (SEQ ID NO:398), FIG. 400 (SEQ ID NO:400), FIG. 402 (SEQ ID NO:402), FIG. 404 (SEQ ID NO:404), FIG. 406 (SEQ ID NO:406), FIG. 408 (SEQ ID NO:408), FIG. 410 (SEQ ID NO:410), FIG. 412 (SEQ ID NO:412), FIG. 414 (SEQ ID NO:414), FIG. 416 (SEQ ID NO:416), FIG. 418 (SEQ ID NO:418), FIG. 420 (SEQ ID NO:420), FIG. 422 (SEQ ID NO:422), FIG. 424 (SEQ ID NO:424), FIG. 426 (SEQ ID NO:426), FIG. 428 (SEQ ID NO:428), FIG. 430 (SEQ ID NO:430), FIG. 432 (SEQ ID NO:432), FIG. 434 (SEQ ID NO:434), FIG. 436 (SEQ ID NO:436), FIG. 438 (SEQ ID NO:438), FIG. 440 (SEQ ID NO:440), FIG. 442 (SEQ ID NO:442), FIG. 444 (SEQ ID NO:444), FIG. 446 (SEQ ID NO:446), FIG. 448 (SEQ ID NO:448), FIG. 450 (SEQ ID NO:450), FIG. 452 (SEQ ID NO:452), FIG. 454 (SEQ ID NO:454), FIG. 456 (SEQ ID NO:456), FIG. 458 (SEQ ID NO:458), FIG. 460 (SEQ ID NO:460), FIG. 462 (SEQ ID NO:462), FIG. 464 (SEQ ID NO:464), FIG. 466 (SEQ ID NO:466), FIG. 468 (SEQ ID NO:468), FIG. 470 (SEQ ID NO:470), FIG. 472 (SEQ ID NO:472), FIG. 474 (SEQ ID NO:474), FIG. 476 (SEQ ID NO:476), FIG. 478 (SEQ ID NO:478), FIG. 480 (SEQ ID NO:480), FIG. 482 (SEQ ID NO:482), FIG. 484 (SEQ ID NO:484), FIG. 486 (SEQ ID NO:486), FIG. 488 (SEQ ID NO:488), FIG. 490 (SEQ ID NO:490), FIG. 492 (SEQ ID NO:492), FIG. 494 (SEQ ID NO:494), FIG. 496 (SEQ ID NO:496), FIG. 498 (SEQ ID NO:498), FIG. 500 (SEQ ID NO:500), FIG. 502 (SEQ ID NO:502), FIG. 504 (SEQ ID NO:504), FIG. 506 (SEQ ID NO:506), FIG. 508 (SEQ ID NO:508), FIG. 510 (SEQ ID NO:510), FIG. 512 (SEQ ID NO:512), FIG. 514 (SEQ ID NO:514), FIG. 516 (SEQ ID NO:516), FIG. 518 (SEQ ID NO:518), FIG. 520 (SEQ ID NO:520), FIG. 522 (SEQ ID NO:522), FIG. 524 (SEQ ID NO:524), FIG. 526 (SEQ ID NO:526), FIG. 528 (SEQ ID NO:528), FIG. 530 (SEQ ID NO:530), FIG. 532 (SEQ ID NO:532), FIG. 534 (SEQ ID NO:534), FIG. 536 (SEQ ID NO:536), FIG. 538 (SEQ ID NO:538), FIG. 540 (SEQ ID NO:540), FIG. 542 (SEQ ID NO:542), FIG. 544 (SEQ ID NO:544), FIG. 546 (SEQ ID NO:546), FIG. 548 (SEQ ID NO:548) and FIG. 550 (SEQ ID NO:550).
2. Isolated nucleic acid having at least 80% nucleic acid sequence identity to a nucleotide sequence selected from the group consisting of the nucleotide sequence shown in FIG. 1 (SEQ ID NO:1), FIG. 3 (SEQ ID NO:3), FIG. 5 (SEQ ID NO:5), FIG. 7 (SEQ ID NO:7), FIG. 9 (SEQ ID NO:9), FIG. 11 (SEQ ID NO:11), FIG. 13 (SEQ ID NO:13), FIG. 15 (SEQ ID NO: 15), FIG. 17 (SEQ ID NO: 17), FIG. 19 (SEQ ID NO: 19), FIG. 21 (SEQ ID NO:21), FIG. 23 (SEQ ID NO:23), FIG. 25 (SEQ ID NO:25), FIG. 27 (SEQ ID NO:27), FIG. 29 (SEQ ID NO:29), FIG. 31 (SEQ ID NO:3 1), FIG. 33 (SEQ ID NO:33), FIG. 35 (SEQ ID NO:35), FIG. 37 (SEQ ID NO:37), FIG. 39 (SEQ ID NO:39), FIG. 41 (SEQ ID NO:41), FIG. 43 (SEQ ID NO:43), FIG. 45 (SEQ ID NO:45), FIG. 47 (SEQ ID NO:47), FIG. 49 (SEQ ID NO:49), FIG. 51 (SEQ ID NO:5 1), FIG. 53 (SEQ ID NO:53), FIG. 55 (SEQ ID NO:55), FIG. 57 (SEQ ID NO:57), FIG. 59 (SEQ ID NO:59), FIG. 61 (SEQ ID NO:61), FIG. 63 (SEQ ID NO:63), FIG. 65 (SEQ ID NO:65), FIG. 67 (SEQ ID NO:67), FIG. 69 (SEQ ID NO:69), FIG. 71 (SEQ ID NO:7 1), FIG. 73 (SEQ ID NO:73), FIG. 75 (SEQ ID NO:75), FIG. 77 (SEQ ID NO:77), FIG. 79 (SEQ ID NO:79), FIG. 81 (SEQ ID NO:81), FIG. 83 (SEQ ID NO:83), FIG. 85 (SEQ ID NO:85), FIG. 87 (SEQ ID NO:87), FIG. 89 (SEQ ID NO:89), FIG. 91 (SEQ ID NO:91), FIG. 93 (SEQ ID NO:93), FIG. 95 (SEQ ID NO:95), FIG. 97 (SEQ ID NO:97), FIG. 99 (SEQ ID NO:99), FIG. 101 (SEQ ID NO: 101), FIG. 103 (SEQ ID NO: 103), FIG. 105 (SEQ ID NO: 105), FIG. 107 (SEQ ID NO:107), FIG. 109 (SEQ ID NO:109), FIG. 111 (SEQ ID NO:111), FIG. 113 (SEQ ID NO: 113), FIG. 115 (SEQ ID NO: 115), FIG. 117 (SEQ ID NO: 117), FIG. 119 (SEQ ID NO: 119), FIG. 121 (SEQ ID NO:121), FIG. 123 (SEQ ID NO:123), FIG. 125 (SEQ ID NO:125), FIG. 127 (SEQ ID NO:127), FIG. 129 (SEQ ID NO:129), FIG. 131 (SEQ ID NO:131), FIG. 133 (SEQ ID NO:133), FIG. 135 (SEQ ID NO:135), FIG. 137 (SEQ ID NO:137), FIG. 139 (SEQ ID NO:1390), FIG. 141 (SEQ ID NO: 141), FIG. 143 (SEQ ID NO: 143), FIG. 145 (SEQ ID NO: 145), FIG. 147 (SEQ ID NO: 147), FIG. 149 (SEQ ID NO:149), FIG. 151 (SEQ ID NO:151), FIG. 153 (SEQ ID NO:153), FIG. 155 (SEQ ID NO: 155), FIG. 157 (SEQ ID NO:157), FIG. 159 (SEQ ID NO:159), FIG. 161 (SEQ ID NO:161), FIG. 163 (SEQ ID NO:163), FIG. 165 (SEQ ID NO:165), FIG. 167 (SEQ ID NO:167), FIG. 169 (SEQ ID NO:169), FIG. 171 (SEQ ID NO:171), FIG. 173 (SEQ ID NO: 173), FIG. 175 (SEQ ID NO:175), FIG. 177 (SEQ ID NO:177), FIG. 179 (SEQ ID NO:179), FIG. 181 (SEQ ID NO:181), FIG. 183 (SEQ ID NO:183), FIG. 185 (SEQ ID NO:185), FIG. 187 (SEQ ID NO:187), FIG. 189 (SEQ ID NO:189), FIG. 191 (SEQ ID NO:191), FIG. 193 (SEQ ID NO:193), FIG. 195 (SEQ ID NO:195), FIG. 197 (SEQ ID NO:197), FIG. 199 (SEQ ID NO: 199), FIG. 201 (SEQ ID NO:201), FIG. 203 (SEQ ID NO:203), FIG. 205 (SEQ ID NO:205), FIG. 207 (SEQ ID NO:207), FIG. 209 (SEQ ID NO:209), FIG. 211 (SEQ ID NO:211), FIG. 213 (SEQ ID NO:213), FIG. 215 (SEQ ID NO:215), FIG. 217 (SEQ ID NO:217), FIG. 219 (SEQ ID NO:219), FIG. 221 (SEQ ID NO:221), FIG. 223 (SEQ ID NO:223), FIG. 225 (SEQ ID NO:225), FIG. 227 (SEQ ID NO:227), FIG. 229 (SEQ ID NO:229), FIG. 231 (SEQ ID NO:231), FIG. 233 (SEQ ID NO:233), FIG. 235 (SEQ ID NO:235), FIG. 237 (SEQ ID NO:237), FIG. 239 (SEQ ID NO:239), FIG. 241 (SEQ ID NO:241), FIG. 243 (SEQ ID NO:243), FIG. 245 (SEQ ID NO:245), FIG. 247 (SEQ ID NO:247), FIG. 249 (SEQ ID NO:249), FIG. 251 (SEQ ID NO:251), FIG. 253 (SEQ ID NO:253), FIG. 255 (SEQ ID NO:255), FIG. 257 (SEQ ID NO:257), FIG. 259 (SEQ ID NO:259), FIG. 261 (SEQ ID NO:261), FIG. 263 (SEQ ID NO:263), FIG. 265 (SEQ ID NO:265), FIG. 267 (SEQ ID NO:267), FIG. 269 (SEQ ID NO:269), FIG. 271 (SEQ ID NO:271), FIG. 273 (SEQ ID NO:273), FIG. 275 (SEQ ID NO:275), FIG. 277 (SEQ ID NO:277), FIG. 279 (SEQ ID NO:279), FIG. 281 (SEQ ID NO:281), FIG. 283 (SEQ ID NO:283), FIG. 285 (SEQ ID NO:285), FIG. 287 (SEQ ID NO:287), FIG. 289 (SEQ ID NO:289), FIG. 291 (SEQ ID NO:291), FIG. 293 (SEQ ID NO:293), FIG. 295 (SEQ ID NO:295), FIG. 297 (SEQ ID NO:297), FIG. 299 (SEQ ID NO:299), FIG. 301 (SEQ ID NO:301), FIG. 303 (SEQ ID NO:303), FIG. 305 (SEQ ID NO:305), FIG. 307 (SEQ ID NO:307), FIG. 309 (SEQ ID NO:309), FIG. 311 (SEQ ID NO:311), FIG. 313 (SEQ ID NO:313), FIG. 315 (SEQ ID NO:315), FIG. 317 (SEQ ID NO:317), FIG. 319 (SEQ ID NO:319), FIG. 321 (SEQ ID NO:321), FIG. 323 (SEQ ID NO:323), FIG. 325 (SEQ ID NO:325), FIG. 327 (SEQ ID NO:327), FIG. 329 (SEQ ID NO:329), FIG. 331 (SEQ ID NO:331), FIG. 333 (SEQ ID NO:333), FIG. 335 (SEQ ID NO:335), FIG. 337 (SEQ ID NO:337), FIG. 339 (SEQ ID NO:339), FIG. 341 (SEQ ID NO:341), FIG. 343 (SEQ ID NO:343), FIG. 345 (SEQ ID NO:345), FIG. 347 (SEQ ID NO:347), FIG. 349 (SEQ ID NO:349), FIG. 351 (SEQ ID NO:351), FIG. 353 (SEQ ID NO:353), FIG. 355 (SEQ ID NO:355), FIG. 357 (SEQ ID NO:357), FIG. 359 (SEQ ID NO:359), FIG. 361 (SEQ ID NO:361), FIG. 363 (SEQ ID NO:363), FIG. 365 (SEQ ID NO:365), FIG. 367 (SEQ ID NO:367), FIG. 369 (SEQ ID NO:369), FIG. 371 (SEQ ID NO:371), FIG. 373 (SEQ ID NO:373), FIG. 375 (SEQ ID NO:375), FIG. 377 (SEQ ID NO:377), FIG. 379 (SEQ ID NO:379), FIG. 381 (SEQ ID NO:381), FIG. 383 (SEQ ID NO:383), FIG. 385 (SEQ ID NO:385), FIG. 387 (SEQ ID NO:387), FIG. 389 (SEQ ID NO:389), FIG. 391 (SEQ ID NO:391), FIG. 393 (SEQ ID NO:393), FIG. 395 (SEQ ID NO:395), FIG. 397 (SEQ ID NO:397), FIG. 399 (SEQ ID NO:399), FIG. 401 (SEQ ID NO:401), FIG. 403 (SEQ ID NO:403), FIG. 405 (SEQ ID NO:405), FIG. 407 (SEQ ID NO:407), FIG. 409 (SEQ ID NO:409), FIG. 411 (SEQ ID NO:411), FIG. 413 (SEQ ID NO:413), FIG. 415 (SEQ ID NO:415), FIG. 417 (SEQ ID NO:417), FIG. 419 (SEQ ID NO:419), FIG. 421 (SEQ ID NO:421), FIG. 423 (SEQ ID NO:423), FIG. 425 (SEQ ID NO:425), FIG. 427 (SEQ ID NO:427), FIG. 429 (SEQ ID NO:429), FIG. 431 (SEQ ID NO:431), FIG. 433 (SEQ ID NO:433), FIG. 435 (SEQ ID NO:435), FIG. 437 (SEQ ID NO:437), FIG. 439 (SEQ ID NO:439), FIG. 441 (SEQ ID NO:441), FIG. 443 (SEQ ID NO:443), FIG. 445 (SEQ ID NO:445), FIG. 447 (SEQ ID NO:447), FIG. 449 (SEQ ID NO:449), FIG. 451 (SEQ ID NO:451), FIG. 453 (SEQ ID NO:453), FIG. 455 (SEQ ID NO:455), FIG. 457 (SEQ ID NO:457), FIG. 459 (SEQ ID NO:459), FIG. 461 (SEQ ID NO:461), FIG. 463 (SEQ ID NO:463), FIG. 465 (SEQ ID NO:465), FIG. 467 (SEQ ID NO:467), FIG. 469 (SEQ ID NO:469), FIG. 471 (SEQ ID NO:471), FIG. 473 (SEQ ID NO:473), FIG. 475 (SEQ ID NO:475), FIG. 477 (SEQ ID NO:477), FIG. 479 (SEQ ID NO:479), FIG. 481 (SEQ ID NO:481), FIG. 483 (SEQ ID NO:483), FIG. 485 (SEQ ID NO:485), FIG. 487 (SEQ ID NO:487), FIG. 489 (SEQ ID NO:489), FIG. 491 (SEQ ID NO:491), FIG. 493 (SEQ ID NO:493), FIG. 495 (SEQ ID NO:495), FIG. 497 (SEQ ID NO:497), FIG. 499 (SEQ ID NO:499), FIG. 501 (SEQ ID NO:501), FIG. 503 (SEQ ID NO:503), FIG. 505 (SEQ ID NO:505), FIG. 507 (SEQ ID NO:507), FIG. 509 (SEQ ID NO:509), FIG. 511 (SEQ ID NO:511), FIG. 513 (SEQ ID NO:513), FIG. 515 (SEQ ID NO:515), FIG. 517 (SEQ ID NO:517), FIG. 519 (SEQ ID NO:519), FIG. 521 (SEQ ID NO:521), FIG. 523 (SEQ ID NO:523), FIG. 525 (SEQ ID NO:525), FIG. 527 (SEQ ID NO:527), FIG. 529 (SEQ ID NO:529), FIG. 531 (SEQ ID NO:531), FIG. 533 (SEQ ID NO:533), FIG. 535 (SEQ ID NO:535), FIG. 537 (SEQ ID NO:537), FIG. 539 (SEQ ID NO:539), FIG. 541 (SEQ ID NO:541), FIG. 543 (SEQ ID NO:543), FIG. 545 (SEQ ID NO:545), FIG. 547 (SEQ ID NO:547) and FIG. 549 (SEQ ID NO:549).
3. Isolated nucleic acid having at least 80% nucleic acid sequence identity to a nucleotide sequence selected from the group consisting of the full-length coding sequence of the nucleotide sequence shown in FIG. 1 (SEQ ID NO:1), FIG. 3 (SEQ ID NO:3), FIG. 5 (SEQ ID NO:5), FIG. 7 (SEQ ID NO:7), FIG. 9 (SEQ ID NO:9), FIG. 11 (SEQ ID NO: 11), FIG. 13 (SEQ ID NO: 13), FIG. 15 (SEQ ID NO: 15), FIG. 17 (SEQ ID NO: 17), FIG. 19 (SEQ ID NO: 19), FIG. 21 (SEQ ID NO:21), FIG. 23 (SEQ ID NO:23), FIG. 25 (SEQ ID NO:25), FIG. 27 (SEQ ID NO:27), FIG. 29 (SEQ ID NO:29), FIG. 31 (SEQ ID NO:3 1), FIG. 33 (SEQ ID NO:33), FIG. 35 (SEQ ID NO:35), FIG. 37 (SEQ ID NO:37), FIG. 39 (SEQ ID NO:39), FIG. 41 (SEQ ID NO:41), FIG. 43 (SEQ ID NO:43), FIG. 45 (SEQ ID NO:45), FIG. 47 (SEQ ID NO:47), FIG. 49 (SEQ ID NO:49), FIG. 51 (SEQ ID NO:5 1), FIG. 53 (SEQ ID NO:53), FIG. 55 (SEQ ID NO:55), FIG. 57 (SEQ ID NO:57), FIG. 59 (SEQ ID NO:59), FIG. 61 (SEQ ID NO:61), FIG. 63 (SEQ ID NO:63), FIG. 65 (SEQ ID NO:65), FIG. 67 (SEQ ID NO:67), FIG. 69 (SEQ ID NO:69), FIG. 71 (SEQ ID NO:71), FIG. 73 (SEQ ID NO:73), FIG. 75 (SEQ ID NO:75), FIG. 77 (SEQ ID NO:77), FIG. 79 (SEQ ID NO:79), FIG. 81 (SEQ ID NO:81), FIG. 83 (SEQ ID NO:83), FIG. 85 (SEQ ID NO:85), FIG. 87 (SEQ ID NO:87), FIG. 89 (SEQ ID NO:89), FIG. 91 (SEQ ID NO:91), FIG. 93 (SEQ ID NO:93), FIG. 95 (SEQ ID NO:95), FIG. 97 (SEQ ID NO:97), FIG. 99 (SEQ ID NO:99), FIG. 101 (SEQ ID NO:101), FIG. 103 (SEQ ID NO:103), FIG. 105 (SEQ ID NO:105), FIG. 107 (SEQ ID NO: 107), FIG. 109 (SEQ ID NO:109), FIG. 111 (SEQ ID NO: 111), FIG. 113 (SEQ ID NO: 113), FIG. 115 (SEQ ID NO: 115), FIG. 117 (SEQ ID NO: 117), FIG. 119 (SEQ ID NO:119), FIG. 121 (SEQ ID NO:121), FIG. 123 (SEQ ID NO:123), FIG. 125 (SEQ ID NO: 125), FIG. 127 (SEQ ID NO: 127), FIG. 129 (SEQ ID NO: 129), FIG. 131 (SEQ ID NO: 131), FIG. 133 (SEQ ID NO:133), FIG. 135 (SEQ ID NO:135), FIG. 137 (SEQ ID NO:137), FIG. 139 (SEQ ID NO: 1390), FIG. 141 (SEQ ID NO: 141), FIG. 143 (SEQ ID NO: 143), FIG. 145 (SEQ ID NO: 145), FIG. 147 (SEQ ID NO:147), FIG. 149 (SEQ ID NO:149), FIG. 151 (SEQ ID NO:151), FIG. 153 (SEQ ID NO:153), FIG. 155 (SEQ ID NO:155), FIG. 157 (SEQ ID NO:157), FIG. 159 (SEQ ID NO: 159), FIG. 161 (SEQ ID NO:161), FIG. 163 (SEQ ID NO:163), FIG. 165 (SEQ ID NO:165), FIG. 167 (SEQ ID NO:167), FIG. 169 (SEQ ID NO:169), FIG. 171 (SEQ ID NO:171), FIG. 173 (SEQ ID NO:173), FIG. 175 (SEQ ID NO:175), FIG. 177 (SEQ ID NO: 177), FIG. 179 (SEQ ID NO:179), FIG. 181 (SEQ ID NO:181), FIG. 183 (SEQ ID NO:183), FIG. 185 (SEQ ID NO:185), FIG. 187 (SEQ ID NO:187), FIG. 189 (SEQ ID NO:189), FIG. 191 (SEQ ID NO:191), FIG. 193 (SEQ ID NO:193), FIG. 195 (SEQ ID NO: 195), FIG. 197 (SEQ ID NO:197), FIG. 199 (SEQ ID NO:199), FIG. 201 (SEQ ID NO:201), FIG. 203 (SEQ ID NO:203), FIG. 205 (SEQ ID NO:205), FIG. 207 (SEQ ID NO:207), FIG. 209 (SEQ ID NO:209), FIG. 211 (SEQ ID NO:211), FIG. 213 (SEQ ID NO:213), FIG. 215 (SEQ ID NO:215), FIG. 217 (SEQ ID NO:217), FIG. 219 (SEQ ID NO:219), FIG. 221 (SEQ ID NO:221), FIG. 223 (SEQ ID NO:223), FIG. 225 (SEQ ID NO:225), FIG. 227 (SEQ ID NO:227), FIG. 229 (SEQ ID NO:229), FIG. 231 (SEQ ID NO:231), FIG. 233 (SEQ ID NO:233), FIG. 235 (SEQ ID NO:235), FIG. 237 (SEQ ID NO:237), FIG. 239 (SEQ ID NO:239), FIG. 241 (SEQ ID NO:241), FIG. 243 (SEQ ID NO:243), FIG. 245 (SEQ ID NO:245), FIG. 247 (SEQ ID NO:247), FIG. 249 (SEQ ID NO:249), FIG. 251 (SEQ ID NO:251), FIG. 253 (SEQ ID NO:253), FIG. 255 (SEQ ID NO:255), FIG. 257 (SEQ ID NO:257), FIG. 259 (SEQ ID NO:259), FIG. 261 (SEQ ID NO:261), FIG. 263 (SEQ ID NO:263), FIG. 265 (SEQ ID NO:265), FIG. 267 (SEQ ID NO:267), FIG. 269 (SEQ ID NO:269), FIG. 271 (SEQ ID NO:271), FIG. 273 (SEQ ID NO:273), FIG. 275 (SEQ ID NO:275), FIG. 277 (SEQ ID NO:277), FIG. 279 (SEQ ID NO:279), FIG. 281 (SEQ ID NO:281), FIG. 283 (SEQ ID NO:283), FIG. 285 (SEQ ID NO:285), FIG. 287 (SEQ ID NO:287), FIG. 289 (SEQ ID NO:289), FIG. 291 (SEQ ID NO:291), FIG. 293 (SEQ ID NO:293), FIG. 295 (SEQ ID NO:295), FIG. 297 (SEQ ID NO:297), FIG. 299 (SEQ ID NO:299), FIG. 301 (SEQ ID NO:301), FIG. 303 (SEQ ID NO:303), FIG. 305 (SEQ ID NO:305), FIG. 307 (SEQ ID NO:307), FIG. 309 (SEQ ID NO:309), FIG. 311 (SEQ ID NO:311), FIG. 313 (SEQ ID NO:313), FIG. 315 (SEQ ID NO:315), FIG. 317 (SEQ ID NO:317), FIG. 319 (SEQ ID NO:319), FIG. 321 (SEQ ID NO:321), FIG. 323 (SEQ ID NO:323), FIG. 325 (SEQ ID NO:325), FIG. 327 (SEQ ID NO:327), FIG. 329 (SEQ ID NO:329), FIG. 331 (SEQ ID NO:331), FIG. 333 (SEQ ID NO:333), FIG. 335 (SEQ ID NO:335), FIG. 337 (SEQ ID NO:337), FIG. 339 (SEQ ID NO:339), FIG. 341 (SEQ ID NO:341), FIG. 343 (SEQ ID NO:343), FIG. 345 (SEQ ID NO:345), FIG. 347 (SEQ ID NO:347), FIG. 349 (SEQ ID NO:349), FIG. 351 (SEQ ID NO:351), FIG. 353 (SEQ ID NO:353), FIG. 355 (SEQ ID NO:355), FIG. 357 (SEQ ID NO:357), FIG. 359 (SEQ ID NO:359), FIG. 361 (SEQ ID NO:361), FIG. 363 (SEQ ID NO:363), FIG. 365 (SEQ ID NO:365), FIG. 367 (SEQ ID NO:367), FIG. 369 (SEQ ID NO:369), FIG. 371 (SEQ ID NO:371), FIG. 373 (SEQ ID NO:373), FIG. 375 (SEQ ID NO:375), FIG. 377 (SEQ ID NO:377), FIG. 379 (SEQ ID NO:379), FIG. 381 (SEQ ID NO:381), FIG. 383 (SEQ ID NO:383), FIG. 385 (SEQ ID NO:385), FIG. 387 (SEQ ID NO:387), FIG. 389 (SEQ ID NO:389), FIG. 391 (SEQ ID NO:391), FIG. 393 (SEQ ID NO:393), FIG. 395 (SEQ ID NO:395), FIG. 397 (SEQ ID NO:397), FIG. 399 (SEQ ID NO:399), FIG. 401 (SEQ ID NO:401), FIG. 403 (SEQ ID NO:403), FIG. 405 (SEQ ID NO:405), FIG. 407 (SEQ ID NO:407), FIG. 409 (SEQ ID NO:409), FIG. 411 (SEQ ID NO:411), FIG. 413 (SEQ ID NO:413), FIG. 415 (SEQ ID NO:415), FIG. 417 (SEQ ID NO:417), FIG. 419 (SEQ ID NO:419), FIG. 421 (SEQ ID NO:421), FIG. 423 (SEQ ID NO:423), FIG. 425 (SEQ ID NO:425), FIG. 427 (SEQ ID NO:427), FIG. 429 (SEQ ID NO:429), FIG. 431 (SEQ ID NO:431), FIG. 433 (SEQ ID NO:433), FIG. 435 (SEQ ID NO:435), FIG. 437 (SEQ ID NO:437), FIG. 439 (SEQ ID NO:439), FIG. 441 (SEQ ID NO:441), FIG. 443 (SEQ ID NO:443), FIG. 445 (SEQ ID NO:445), FIG. 447 (SEQ ID NO:447), FIG. 449 (SEQ ID NO:449), FIG. 451 (SEQ ID NO:451), FIG. 453 (SEQ ID NO:453), FIG. 455 (SEQ ID NO:455), FIG. 457 (SEQ ID NO:457), FIG. 459 (SEQ ID NO:459), FIG. 461 (SEQ ID NO:461), FIG. 463 (SEQ ID NO:463), FIG. 465 (SEQ ID NO:465), FIG. 467 (SEQ ID NO:467), FIG. 469 (SEQ ID NO:469), FIG. 471 (SEQ ID NO:471), FIG. 473 (SEQ ID NO:473), FIG. 475 (SEQ ID NO:475), FIG. 477 (SEQ ID NO:477), FIG. 479 (SEQ ID NO:479), FIG. 481 (SEQ ID NO:481), FIG. 483 (SEQ ID NO:483), FIG. 485 (SEQ ID NO:485), FIG. 487 (SEQ ID NO:487), FIG. 489 (SEQ ID NO:489), FIG. 491 (SEQ ID NO:491), FIG. 493 (SEQ ID NO:493), FIG. 495 (SEQ ID NO:495), FIG. 497 (SEQ ID NO:497), FIG. 499 (SEQ ID NO:499), FIG. 501 (SEQ ID NO:501), FIG. 503 (SEQ ID NO:503), FIG. 505 (SEQ ID NO:505), FIG. 507 (SEQ ID NO:507), FIG. 509 (SEQ ID NO:509), FIG. 511 (SEQ ID NO:511), FIG. 513 (SEQ ID NO:513), FIG. 515 (SEQ ID NO:515), FIG. 517 (SEQ ID NO:517), FIG. 519 (SEQ ID NO:519), FIG. 521 (SEQ ID NO:521), FIG. 523 (SEQ ID NO:523), FIG. 525 (SEQ ID NO:525), FIG. 527 (SEQ ID NO:527), FIG. 529 (SEQ ID NO:529), FIG. 531 (SEQ ID NO:531), FIG. 533 (SEQ ID NO:533), FIG. 535 (SEQ ID NO:535), FIG. 537 (SEQ ID NO:537), FIG. 539 (SEQ ID NO:539), FIG. 541 (SEQ ID NO:541), FIG. 543 (SEQ ID NO:543), FIG. 545 (SEQ ID NO:545), FIG. 547 (SEQ ID NO:547) and FIG. 549 (SEQ ID NO:549).
4. Isolated nucleic acid having at least 80% nucleic acid sequence identity to the full-length coding sequence of the DNA deposited under any ATCC accession number shown in Table 7.
5. A vector comprising the nucleic acid of claim 1 .
6. The vector of claim 5 operably linked to control sequences recognized by a host cell transformed with the vector.
7. A host cell comprising the vector of claim 5 .
8. The host cell of claim 7 , wherein said cell is a CHO cell.
9. The host cell of claim 7 , wherein said cell is an E. coli.
10. The host cell of claim 7 , wherein said cell is a yeast cell.
11. A process forproducing aPRO polypeptides comprising culturing the host cell of claim 7 under conditions suitable for expression of said PRO polypeptide and recovering said PRO polypeptide from the cell culture.
12. An isolated polypeptide having at least 80% arnino acid sequence identity to an amino acid sequence selected from the group consisting of the amino acid sequence shown in FIG. 2 (SEQ ID NO:2), FIG. 4 (SEQ ID NO:4), FIG. 6 (SEQ ID NO:6), FIG. 8 (SEQ ID NO:8), FIG. 10 (SEQ ID NO:10), FIG. 12 (SEQ ID NO: 12), FIG. 14 (SEQ ID NO: 14), FIG. 16 (SEQ ID NO: 16), FIG. 18 (SEQ ID NO: 18), FIG. 20 (SEQ ID NO:20), FIG. 22 (SEQ ID NO:22), FIG. 24 (SEQ ID NO:24), FIG. 26 (SEQ ID NO:26), FIG. 28 (SEQ ID NO:28), FIG. 30 (SEQ ID NO:30), FIG. 32 (SEQ ID NO:32), FIG. 34 (SEQ ID NO:34), FIG. 36 (SEQ ID NO:36), FIG. 38 (SEQ ID NO:38), FIG. 40 (SEQ ID NO:40), FIG. 42 (SEQ ID NO:42), FIG. 44 (SEQ ID NO:44), FIG. 46 (SEQ ID NO:46), FIG. 48 (SEQ ID NO:48), FIG. 50 (SEQ ID NO:50), FIG. 52 (SEQ ID NO:52), FIG. 54 (SEQ ID NO:54), FIG. 56 (SEQ ID NO:56), FIG. 58 (SEQ ID NO:58), FIG. 60 (SEQ ID NO:60), FIG. 62 (SEQ ID NO:62), FIG. 64 (SEQ ID NO:64), FIG. 66 (SEQ ID NO:66), FIG. 68 (SEQ ID NO:68), FIG. 70 (SEQ ID NO:70), FIG. 72 (SEQ ID NO:72), FIG. 74 (SEQ ID NO:74), FIG. 76 (SEQ ID NO:76), FIG. 78 (SEQ ID NO:78), FIG. 80 (SEQ ID NO:80), FIG. 82 (SEQ ID NO:82), FIG. 84 (SEQ ID NO:84), FIG. 86 (SEQ ID NO:86), FIG. 88 (SEQ ID NO:88), FIG. 90 (SEQ ID NO:90), FIG. 92 (SEQ ID NO:92), FIG. 94 (SEQ ID NO:94), FIG. 96 (SEQ ID NO:96), FIG. 98 (SEQ ID NO:98), FIG. 100 (SEQ ID NO: 100), FIG. 102 (SEQ ID NO: 102), FIG. 104 (SEQ ID NO: 104), FIG. 106 (SEQ ID NO: 106), FIG. 108 (SEQ ID NO: 108), FIG. 110 (SEQ ID NO: 10), FIG. 112 (SEQ ID NO: 112), FIG. 114 (SEQ ID NO:114), FIG. 116 (SEQ ID NO:116), FIG. 118 (SEQ ID NO:118), FIG. 120 (SEQ ID NO:120), FIG. 122 (SEQ ID NO:122), FIG. 124 (SEQ ID NO:124), FIG. 126 (SEQ ID NO: 126), FIG. 128 (SEQ ID NO:128), FIG. 130 (SEQ ID NO:130), FIG. 132 (SEQ ID NO:132), FIG. 134 (SEQ ID NO:134), FIG. 136 (SEQ ID NO:136), FIG. 138 (SEQ ID NO:138), FIG. 140 (SEQ ID NO: 140), FIG. 142 (SEQ ID NO:142), FIG. 144 (SEQ ID NO:144), FIG. 146 (SEQ ID NO: 146), FIG. 148 (SEQ ID NO:148), FIG. 150 (SEQ ID NO:150), FIG. 152 (SEQ ID NO: 152), FIG. 154 (SEQ ID NO: 154), FIG. 156 (SEQ ID NO:156), FIG. 158 (SEQ ID NO:158), FIG. 160 (SEQ ID NO:160), FIG. 162 (SEQ ID NO:162), FIG. 164 (SEQ ID NO:164), FIG. 166 (SEQ ID NO:166), FIG. 168 (SEQ ID NO:168), FIG. 170 (SEQ ID NO:170), FIG. 172 (SEQ ID NO:172), FIG. 174 (SEQ ID NO:174), FIG. 176 (SEQ ID NO:176), FIG. 178 (SEQ ID NO:178), FIG. 180 (SEQ ID NO:180), FIG. 182 (SEQ ID NO:182), FIG. 184 (SEQ ID NO:184), FIG. 186 (SEQ ID NO:186), FIG. 188 (SEQ ID NO:188), FIG. 190 (SEQ ID NO:190), FIG. 192 (SEQ ID NO:192), FIG. 194 (SEQ ID NO: 194), FIG. 196 (SEQ ID NO:196), FIG. 198 (SEQ ID NO: 198), FIG. 200 (SEQ ID NO:200), FIG. 202 (SEQ ID NO:202), FIG. 204 (SEQ ID NO:204), FIG. 206 (SEQ ID NO:206), FIG. 208 (SEQ ID NO:208), FIG. 210 (SEQ ID NO:210), FIG. 212 (SEQ ID NO:212), FIG. 214 (SEQ ID NO:214), FIG. 216 (SEQ ID NO:216), FIG. 218 (SEQ ID NO:218), FIG. 220 (SEQ ID NO:220), FIG. 222 (SEQ ID NO:222), FIG. 224 (SEQ ID NO:224), FIG. 226 (SEQ ID NO:226), FIG. 228 (SEQ ID NO:228), FIG. 230 (SEQ ID NO:230), FIG. 232 (SEQ ID NO:232), FIG. 234 (SEQ ID NO:234), FIG. 236 (SEQ ID NO:236), FIG. 238 (SEQ ID NO:238), FIG. 240 (SEQ ID NO:240), FIG. 242 (SEQ ID NO:242), FIG. 244 (SEQ ID NO:244), FIG. 246 (SEQ ID NO:246), FIG. 248 (SEQ ID NO:248), FIG. 250 (SEQ ID NO:250), FIG. 252 (SEQ ID NO:252), FIG. 254 (SEQ ID NO:254), FIG. 256 (SEQ ID NO:256), FIG. 258 (SEQ ID NO:258), FIG. 260 (SEQ ID NO:260), FIG. 262 (SEQ ID NO:262), FIG. 264 (SEQ ID NO:264), FIG. 266 (SEQ ID NO:266), FIG. 268 (SEQ ID NO:268), FIG. 270 (SEQ ID NO:270), FIG. 272 (SEQ ID NO:272), FIG. 274 (SEQ ID NO:274), FIG. 276 (SEQ ID NO:276), FIG. 278 (SEQ ID NO:278), FIG. 280 (SEQ ID NO:280), FIG. 282 (SEQ ID NO:282), FIG. 284 (SEQ ID NO:284), FIG. 286 (SEQ ID NO:286), FIG. 288 (SEQ ID NO:288), FIG. 290 (SEQ ID NO:290), FIG. 292 (SEQ ID NO:292), FIG. 294 (SEQ ID NO:294), FIG. 296 (SEQ ID NO:296), FIG. 298 (SEQ ID NO:298), FIG. 300 (SEQ ID NO:300), FIG. 302 (SEQ ID NO:302), FIG. 304 (SEQ ID NO:304), FIG. 306 (SEQ ID NO:306), FIG. 308 (SEQ ID NO:308), FIG. 310 (SEQ ID NO:310), FIG. 312 (SEQ ID NO:312), FIG. 314 (SEQ ID NO:314), FIG. 316 (SEQ ID NO:316), FIG. 318 (SEQ ID NO:318), FIG. 320 (SEQ ID NO:320), FIG. 322 (SEQ ID NO:322), FIG. 324 (SEQ ID NO:324), FIG. 326 (SEQ ID NO:326), FIG. 328 (SEQ ID NO:328), FIG. 330 (SEQ ID NO:330), FIG. 332 (SEQ ID NO:332), FIG. 334 (SEQ ID NO:334), FIG. 336 (SEQ ID NO:336), FIG. 338 (SEQ ID NO:338), FIG. 340 (SEQ ID NO:340), FIG. 342 (SEQ ID NO:342), FIG. 344 (SEQ ID NO:344), FIG. 346 (SEQ ID NO:346), FIG. 348 (SEQ ID NO:348), FIG. 350 (SEQ ID NO:350), FIG. 352 (SEQ ID NO:352), FIG. 354 (SEQ ID NO:354), FIG. 356 (SEQ ID NO:356), FIG. 358 (SEQ ID NO:358), FIG. 360 (SEQ ID NO:360), FIG. 362 (SEQ ID NO:362), FIG. 364 (SEQ ID NO:364), FIG. 366 (SEQ ID NO:366), FIG. 368 (SEQ ID NO:368), FIG. 370 (SEQ ID NO:370), FIG. 372 (SEQ ID NO:372), FIG. 374 (SEQ ID NO:374), FIG. 376 (SEQ ID NO:376), FIG. 378 (SEQ ID NO:378), FIG. 380 (SEQ ID NO:380), FIG. 382 (SEQ ID NO:382), FIG. 384 (SEQ ID NO:384), FIG. 386 (SEQ ID NO:386), FIG. 388 (SEQ ID NO:388), FIG. 390 (SEQ ID NO:390), FIG. 392 (SEQ ID NO:392), FIG. 394 (SEQ ID NO:394), FIG. 396 (SEQ ID NO:396), FIG. 398 (SEQ ID NO:398), FIG. 400 (SEQ ID NO:400), FIG. 402 (SEQ ID NO:402), FIG. 404 (SEQ ID NO:404), FIG. 406 (SEQ ID NO:406), FIG. 408 (SEQ ID NO:408), FIG. 410 (SEQ ID NO:410), FIG. 412 (SEQ ID NO:412), FIG. 414 (SEQ ID NO:414), FIG. 416 (SEQ ID NO:416), FIG. 418 (SEQ ID NO:418), FIG. 420 (SEQ ID NO:420), FIG. 422 (SEQ ID NO:422), FIG. 424 (SEQ ID NO:424), FIG. 426 (SEQ ID NO:426), FIG. 428 (SEQ ID NO:428), FIG. 430 (SEQ ID NO:430), FIG. 432 (SEQ ID NO:432), FIG. 434 (SEQ ID NO:434), FIG. 436 (SEQ ID NO:436), FIG. 438 (SEQ ID NO:438), FIG. 440 (SEQ ID NO:440), FIG. 442 (SEQ ID NO:442), FIG. 444 (SEQ ID NO:444), FIG. 446 (SEQ ID NO:446), FIG. 448 (SEQ ID NO:448), FIG. 450 (SEQ ID NO:450), FIG. 452 (SEQ ID NO:452), FIG. 454 (SEQ ID NO:454), FIG. 456 (SEQ ID NO:456), FIG. 458 (SEQ ID NO:458), FIG. 460 (SEQ ID NO:460), FIG. 462 (SEQ ID NO:462), FIG. 464 (SEQ ID NO:464), FIG. 466 (SEQ ID NO:466), FIG. 468 (SEQ ID NO:468), FIG. 470 (SEQ ID NO:470), FIG. 472 (SEQ ID NO:472), FIG. 474 (SEQ ID NO:474), FIG. 476 (SEQ ID NO:476), FIG. 478 (SEQ ID NO:478), FIG. 480 (SEQ ID NO:480), FIG. 482 (SEQ ID NO:482), FIG. 484 (SEQ ID NO:484), FIG. 486 (SEQ ID NO:486), FIG. 488 (SEQ ID NO:488), FIG. 490 (SEQ ID NO:490), FIG. 492 (SEQ ID NO:492), FIG. 494 (SEQ ID NO:494), FIG. 496 (SEQ ID NO:496), FIG. 498 (SEQ ID NO:498), FIG. 500 (SEQ ID NO:500), FIG. 502 (SEQ ID NO:502), FIG. 504 (SEQ ID NO:504), FIG. 506 (SEQ ID NO:506), FIG. 508 (SEQ ID NO:508), FIG. 510 (SEQ ID NO:510), FIG. 512 (SEQ ID NO:512), FIG. 514 (SEQ ID NO:514), FIG. 516 (SEQ ID NO:516), FIG. 518 (SEQ ID NO:518), FIG. 520 (SEQ ID NO:520), FIG. 522 (SEQ ID NO:522), FIG. 524 (SEQ ID NO:524), FIG. 526 (SEQ ID NO:526), FIG. 528 (SEQ ID NO:528), FIG. 530 (SEQ ID NO:530), FIG. 532 (SEQ ID NO:532), FIG. 534 (SEQ ID NO:534), FIG. 536 (SEQ ID NO:536), FIG. 538 (SEQ ID NO:538), FIG. 540 (SEQ ID NO:540), FIG. 542 (SEQ ID NO:542), FIG. 544 (SEQ ID NO:544), FIG. 546 (SEQ ID NO:546), FIG. 548 (SEQ ID NO:548) and FIG. 550 (SEQ ID NO:550).
13. An isolated polypeptide having at least 80% amino acid sequence identity to an amino acid sequence encoded by the full-length coding sequence of the DNA deposited under any ATCC accession number shown in Table 7.
14. A chimeric molecule comprising a polypeptide according to claim 12 fused to a heterologous amino acid sequence.
15. The chimeric molecule of claim 14 , wherein said heterologous amino acid sequence is an epitope tag sequence.
16. The chimeric molecule of claim 14 , wherein said heterologous amino acid sequence is a Fc region of an immunoglobulin.
17. An antibody which specifically binds to a polypeptide according to claim 12 .
18. The antibody of claim 17 , wherein said antibody is a monoclonal antibody, a humanized antibody or a single-chain antibody.
19. Isolated nucleic acid having at least 80% nucleic acid sequence identity to:
(a) a nucleotide sequence encoding the polypeptide shown in FIG. 2 (SEQ ID NO:2), FIG. 4 (SEQ ID NO:4), FIG. 6 (SEQ ID NO:6), FIG. 8 (SEQ ID NO:8), FIG. 10 (SEQ ID NO: 10), FIG. 12 (SEQ ID NO: 12), FIG. 14 (SEQ ID NO: 14), FIG. 16 (SEQ ID NO: 16), FIG. 18 (SEQ ID NO: 18), FIG. 20 (SEQ ID NO:20), FIG. 22 (SEQ ID NO:22), FIG. 24 (SEQ ID NO:24), FIG. 26 (SEQ ID NO:26), FIG. 28 (SEQ ID NO:28), FIG. 30 (SEQ ID NO:30), FIG. 32 (SEQ ID NO:32), FIG. 34 (SEQ ID NO:34), FIG. 36 (SEQ ID NO:36), FIG. 38 (SEQ ID NO:38), FIG. 40 (SEQ ID NO:40), FIG. 42 (SEQ ID NO:42), FIG. 44 (SEQ ID NO:44), FIG. 46 (SEQ ID NO:46), FIG. 48 (SEQ ID NO:48), FIG. 50 (SEQ ID NO:50), FIG. 52 (SEQ ID NO:52), FIG. 54 (SEQ ID NO:54), FIG. 56 (SEQ ID NO:56), FIG. 58 (SEQ ID NO:58), FIG. 60 (SEQ ID NO:60), FIG. 62 (SEQ ID NO:62), FIG. 64 (SEQ ID NO:64), FIG. 66 (SEQ ID NO:66), FIG. 68 (SEQ ID NO:68), FIG. 70 (SEQ ID NO:70), FIG. 72 (SEQ ID NO:72), FIG. 74 (SEQ ID NO:74), FIG. 76 (SEQ ID NO:76), FIG. 78 (SEQ ID NO:78), FIG. 80 (SEQ ID NO:80), FIG. 82 (SEQ ID NO:82), FIG. 84 (SEQ ID NO:84), FIG. 86 (SEQ ID NO:86), FIG. 88 (SEQ ID NO:88), FIG. 90 (SEQ ID NO:90), FIG. 92 (SEQ ID NO:92), FIG. 94 (SEQ ID NO:94), FIG. 96 (SEQ ID NO:96), FIG. 98 (SEQ ID NO:98), FIG. 100 (SEQ ID NO:100), FIG. 102 (SEQ ID NO:102), FIG. 104 (SEQ ID NO:104), FIG. 106 (SEQ ID NO:106), FIG. 108 (SEQ ID NO:108), FIG. 110 (SEQ ID NO:l10), FIG. 112 (SEQ ID NO:112), FIG. 114 (SEQ ID NO:114), FIG. 116 (SEQ ID NO:116), FIG. 118 (SEQ ID NO:118), FIG. 120 (SEQ ID NO:120), FIG. 122 (SEQ ID NO:122), FIG. 124 (SEQ ID NO: 124), FIG. 126 (SEQ ID NO:126), FIG. 128 (SEQ ID NO:128), FIG. 130 (SEQ ID NO:130), FIG. 132 (SEQ ID NO:132), FIG. 134 (SEQ ID NO:134), FIG. 136 (SEQ ID NO:136), FIG. 138 (SEQ ID NO:138), FIG. 140 (SEQ ID NO:140), FIG. 142 (SEQ ID NO: 142), FIG. 144 (SEQ ID NO: 144), FIG. 146 (SEQ ID NO: 146), FIG. 148 (SEQ ID NO:148), FIG. 150 (SEQ ID NO:150), FIG. 152 (SEQ ID NO:152), FIG. 154 (SEQ ID NO:154), FIG. 156 (SEQ ID NO:156), FIG. 158 (SEQ ID NO:158), FIG. 160 (SEQ ID NO:160), FIG. 162 (SEQ ID NO:162), FIG. 164 (SEQ ID NO: 164), FIG. 166 (SEQ ID NO:166), FIG. 168 (SEQ ID NO:168), FIG. 170 (SEQ ID NO:170), FIG. 172 (SEQ ID NO:172), FIG. 174 (SEQ ID NO:174), FIG. 176 (SEQ ID NO: 176), FIG. 178 (SEQ ID NO:178), FIG. 180 (SEQ ID NO:180), FIG. 182 (SEQ ID NO:182), FIG. 184 (SEQ ID NO:184), FIG. 186 (SEQ ID NO:186), FIG. 188 (SEQ ID NO:188), FIG. 190 (SEQ ID NO: 190), FIG. 192 (SEQ ID NO: 192), FIG. 194 (SEQ ID NO: 194), FIG. 196 (SEQ ID NO:196), FIG. 198 (SEQ ID NO:198), FIG. 200 (SEQ ID NO:200), FIG. 202 (SEQ ID NO:202), FIG. 204 (SEQ ID NO:204), FIG. 206 (SEQ ID NO:206), FIG. 208 (SEQ ID NO:208), FIG. 210 (SEQ ID NO:210), FIG. 212 (SEQ ID NO:212), FIG. 214 (SEQ ID NO:214), FIG. 216 (SEQ ID NO:216), FIG. 218 (SEQ ID NO:218), FIG. 220 (SEQ ID NO:220), FIG. 222 (SEQ ID NO:222), FIG. 224 (SEQ ID NO:224), FIG. 226 (SEQ ID NO:226), FIG. 228 (SEQ ID NO:228), FIG. 230 (SEQ ID NO:230), FIG. 232 (SEQ ID NO:232), FIG. 234 (SEQ ID NO:234), FIG. 236 (SEQ ID NO:236), FIG. 238 (SEQ ID NO:238), FIG. 240 (SEQ ID NO:240), FIG. 242 (SEQ ID NO:242), FIG. 244 (SEQ ID NO:244), FIG. 246 (SEQ ID NO:246), FIG. 248 (SEQ ID NO:248), FIG. 250 (SEQ ID NO:250), FIG. 252 (SEQ ID NO:252), FIG. 254 (SEQ ID NO:254), FIG. 256 (SEQ ID NO:256), FIG. 258 (SEQ ID NO:258), FIG. 260 (SEQ ID NO:260), FIG. 262 (SEQ ID NO:262), FIG. 264 (SEQ ID NO:264), FIG. 266 (SEQ ID NO:266), FIG. 268 (SEQ ID NO:268), FIG. 270 (SEQ ID NO:270), FIG. 272 (SEQ ID NO:272), FIG. 274 (SEQ ID NO:274), FIG. 276 (SEQ ID NO:276), FIG. 278 (SEQ ID NO:278), FIG. 280 (SEQ ID NO:280), FIG. 282 (SEQ ID NO:282), FIG. 284 (SEQ ID NO:284), FIG. 286 (SEQ ID NO:286), FIG. 288 (SEQ ID NO:288), FIG. 290 (SEQ ID NO:290), FIG. 292 (SEQ ID NO:292), FIG. 294 (SEQ ID NO:294), FIG. 296 (SEQ ID NO:296), FIG. 298 (SEQ ID NO:298), FIG. 300 (SEQ ID NO:300), FIG. 302 (SEQ ID NO:302), FIG. 304 (SEQ ID NO:304), FIG. 306 (SEQ ID NO:306), FIG. 308 (SEQ ID NO:308), FIG. 310 (SEQ ID NO:310), FIG. 312 (SEQ ID NO:312), FIG. 314 (SEQ ID NO:314), FIG. 316 (SEQ ID NO:316), FIG. 318 (SEQ ID NO:318), FIG. 320 (SEQ ID NO:320), FIG. 322 (SEQ ID NO:322), FIG. 324 (SEQ ID NO:324), FIG. 326 (SEQ ID NO:326), FIG. 328 (SEQ ID NO:328), FIG. 330 (SEQ ID NO:330), FIG. 332 (SEQ ID NO:332), FIG. 334 (SEQ ID NO:334), FIG. 336 (SEQ ID NO:336), FIG. 338 (SEQ ID NO:338), FIG. 340 (SEQ ID NO:340), FIG. 342 (SEQ ID NO:342), FIG. 344 (SEQ ID NO:344), FIG. 346 (SEQ ID NO:346), FIG. 348 (SEQ ID NO:348), FIG. 350 (SEQ ID NO:350), FIG. 352 (SEQ ID NO:352), FIG. 354 (SEQ ID NO:354), FIG. 356 (SEQ ID NO:356), FIG. 358 (SEQ ID NO:358), FIG. 360 (SEQ ID NO:360), FIG. 362 (SEQ ID NO:362), FIG. 364 (SEQ ID NO:364), FIG. 366 (SEQ ID NO:366), FIG. 368 (SEQ ID NO:368), FIG. 370 (SEQ ID NO:370), FIG. 372 (SEQ ID NO:372), FIG. 374 (SEQ ID NO:374), FIG. 376 (SEQ ID NO:376), FIG. 378 (SEQ ID NO:378), FIG. 380 (SEQ ID NO:380), FIG. 382 (SEQ ID NO:382), FIG. 384 (SEQ ID NO:384), FIG. 386 (SEQ ID NO:386), FIG. 388 (SEQ ID NO:388), FIG. 390 (SEQ ID NO:390), FIG. 392 (SEQ ID NO:392), FIG. 394 (SEQ ID NO:394), FIG. 396 (SEQ ID NO:396), FIG. 398 (SEQ ID NO:398), FIG. 400 (SEQ ID NO:400), FIG. 402 (SEQ ID NO:402), FIG. 404 (SEQ ID NO:404), FIG. 406 (SEQ ID NO:406), FIG. 408 (SEQ ID NO:408), FIG. 410 (SEQ ID NO:410), FIG. 412 (SEQ ID NO:412), FIG. 414 (SEQ ID NO:414), FIG. 416 (SEQ ID NO:416), FIG. 418 (SEQ ID NO:418), FIG. 420 (SEQ ID NO:420), FIG. 422 (SEQ ID NO:422), FIG. 424 (SEQ ID NO:424), FIG. 426 (SEQ ID NO:426), FIG. 428 (SEQ ID NO:428), FIG. 430 (SEQ ID NO:430), FIG. 432 (SEQ ID NO:432), FIG. 434 (SEQ ID NO:434), FIG. 436 (SEQ ID NO:436), FIG. 438 (SEQ ID NO:438), FIG. 440 (SEQ ID NO:440), FIG. 442 (SEQ ID NO:442), FIG. 444 (SEQ ID NO:444), FIG. 446 (SEQ ID NO:446), FIG. 448 (SEQ ID NO:448), FIG. 450 (SEQ ID NO:450), FIG. 452 (SEQ ID NO:452), FIG. 454 (SEQ ID NO:454), FIG. 456 (SEQ ID NO:456), FIG. 458 (SEQ ID NO:458), FIG. 460 (SEQ ID NO:460), FIG. 462 (SEQ ID NO:462), FIG. 464 (SEQ ID NO:464), FIG. 466 (SEQ ID NO:466), FIG. 468 (SEQ ID NO:468), FIG. 470 (SEQ ID NO:470), FIG. 472 (SEQ ID NO:472), FIG. 474 (SEQ ID NO:474), FIG. 476 (SEQ ID NO:476), FIG. 478 (SEQ ID NO:478), FIG. 480 (SEQ ID NO:480), FIG. 482 (SEQ ID NO:482), FIG. 484 (SEQ ID NO:484), FIG. 486 (SEQ ID NO:486), FIG. 488 (SEQ ID NO:488), FIG. 490 (SEQ ID NO:490), FIG. 492 (SEQ ID NO:492), FIG. 494 (SEQ ID NO:494), FIG. 496 (SEQ ID NO:496), FIG. 498 (SEQ ID NO:498), FIG. 500 (SEQ ID NO:500), FIG. 502 (SEQ ID NO:502), FIG. 504 (SEQ ID NO:504), FIG. 506 (SEQ ID NO:506), FIG. 508 (SEQ ID NO:508), FIG. 510 (SEQ ID NO:510), FIG. 512 (SEQ ID NO:512), FIG. 514 (SEQ ID NO:514), FIG. 516 (SEQ ID NO:516), FIG. 518 (SEQ ID NO:518), FIG. 520 (SEQ ID NO:520), FIG. 522 (SEQ ID NO:522), FIG. 524 (SEQ ID NO:524), FIG. 526 (SEQ ID NO:526), FIG. 528 (SEQ ID NO:528), FIG. 530 (SEQ ID NO:530), FIG. 532 (SEQ ID NO:532), FIG. 534 (SEQ ID NO:534), FIG. 536 (SEQ ID NO:536), FIG. 538 (SEQ ID NO:538), FIG. 540 (SEQ ID NO:540), FIG. 542 (SEQ ID NO:542), FIG. 544 (SEQ ID NO:544), FIG. 546 (SEQ ID NO:546), FIG. 548 (SEQ ID NO:548) or FIG. 550 (SEQ ID NO:550), lacking its associated signal peptide;
(b) a nucleotide sequence encoding an extracellular domain of the polypeptide shown in FIG. 2 (SEQ ID NO:2), FIG. 4 (SEQ ID NO:4), FIG. 6 (SEQ ID NO:6), FIG. 8 (SEQ ID NO:8), FIG. 10 (SEQ ID NO: 10), FIG. 12 (SEQ ID NO: 12), FIG. 14 (SEQ ID NO: 14), FIG. 16 (SEQ ID NO: 16), FIG. 18 (SEQ ID NO: 18), FIG. 20 (SEQ ID NO:20), FIG. 22 (SEQ ID NO:22), FIG. 24 (SEQ ID NO:24), FIG. 26 (SEQ ID NO:26), FIG. 28 (SEQ ID NO:28), FIG. 30 (SEQ ID NO:30), FIG. 32 (SEQ ID NO:32), FIG. 34 (SEQ ID NO:34), FIG. 36 (SEQ ID NO:36), FIG. 38 (SEQ ID NO:38), FIG. 40 (SEQ ID NO:40), FIG. 42 (SEQ ID NO:42), FIG. 44 (SEQ ID NO:44), FIG. 46 (SEQ ID NO:46), FIG. 48 (SEQ ID NO:48), FIG. 50 (SEQ ID NO:50), FIG. 52 (SEQ ID NO:52), FIG. 54 (SEQ ID NO:54), FIG. 56 (SEQ ID NO:56), FIG. 58 (SEQ ID NO:58), FIG. 60 (SEQ ID NO:60), FIG. 62 (SEQ ID NO:62), FIG. 64 (SEQ ID NO:64), FIG. 66 (SEQ ID NO:66), FIG. 68 (SEQ ID NO:68), FIG. 70 (SEQ ID NO:70), FIG. 72 (SEQ ID NO:72), FIG. 74 (SEQ ID NO:74), FIG. 76 (SEQ ID NO:76), FIG. 78 (SEQ ID NO:78), FIG. 80 (SEQ ID NO:80), FIG. 82 (SEQ ID NO:82), FIG. 84 (SEQ ID NO:84), FIG. 86 (SEQ ID NO:86), FIG. 88 (SEQ ID NO:88), FIG. 90 (SEQ ID NO:90), FIG. 92 (SEQ ID NO:92), FIG. 94 (SEQ ID NO:94), FIG. 96 (SEQ ID NO:96), FIG. 98 (SEQ ID NO:98), FIG. 100 (SEQ ID NO: 100), FIG. 102 (SEQ ID NO: 102), FIG. 104 (SEQ ID NO: 104), FIG. 106 (SEQ ID NO: 106), FIG. 108 (SEQ ID NO: 108), FIG. 110 (SEQ ID NO: 110), FIG. 112 (SEQ ID NO: 112), FIG. 114 (SEQ ID NO: 114), FIG. 116 (SEQ ID NO:116), FIG. 118 (SEQ ID NO:118), FIG. 120 (SEQ ID NO:120), FIG. 122 (SEQ ID NO:122), FIG. 124 (SEQ ID NO:124), FIG. 126 (SEQ ID NO:126), FIG. 128 (SEQ ID NO:128), FIG. 130 (SEQ ID NO:130), FIG. 132 (SEQ ID NO:132), FIG. 134 (SEQ ID NO:134), FIG. 136 (SEQ ID.NO:136), FIG. 138 (SEQ ID NO:138), FIG. 140 (SEQ ID NO: 140), FIG. 142 (SEQ ID NO: 142), FIG. 144 (SEQ ID NO: 144), FIG. 146 (SEQ ID NO: 146), FIG. 148 (SEQ ID NO: 148), FIG. 150 (SEQ ID NO:150), FIG. 152 (SEQ ID NO:152), FIG. 154 (SEQ ID NO:154), FIG. 156 (SEQ ID NO:156), FIG. 158 (SEQ ID NO:158), FIG. 160 (SEQ ID NO:160), FIG. 162 (SEQ ID NO:162), FIG. 164 (SEQ ID NO:164), FIG. 166 (SEQ ID NO:166), FIG. 168 (SEQ ID NO:168), FIG. 170 (SEQ ID NO:170), FIG. 172 (SEQ ID NO:172), FIG. 174 (SEQ ID NO: 174), FIG. 176 (SEQ ID NO:176), FIG. 178 (SEQ ID NO:178), FIG. 180 (SEQ ID NO:180), FIG. 182 (SEQ ID NO:182), FIG. 184 (SEQ ID NO:184), FIG. 186 (SEQ ID NO:186), FIG. 188 (SEQ ID NO:188), FIG. 190 (SEQ ID NO:190), FIG. 192 (SEQ ID NO: 192), FIG. 194 (SEQ ID NO:194), FIG. 196 (SEQ ID NO: 196), FIG. 198 (SEQ ID NO: 198), FIG. 200 (SEQ ID NO:200), FIG. 202 (SEQ ID NO:202), FIG. 204 (SEQ ID NO:204), FIG. 206 (SEQ ID NO:206), FIG. 208 (SEQ ID NO:208), FIG. 210 (SEQ ID NO:210), FIG. 212 (SEQ ID NO:212), FIG. 214 (SEQ ID NO:214), FIG. 216 (SEQ ID NO:216), FIG. 218 (SEQ ID NO:218), FIG. 220 (SEQ ID NO:220), FIG. 222 (SEQ ID NO:222), FIG. 224 (SEQ ID NO:224), FIG. 226 (SEQ ID NO:226), FIG. 228 (SEQ ID NO:228), FIG. 230 (SEQ ID NO:230), FIG. 232 (SEQ ID NO:232), FIG. 234 (SEQ ID NO:234), FIG. 236 (SEQ ID NO:236), FIG. 238 (SEQ ID NO:238), FIG. 240 (SEQ ID NO:240), FIG. 242 (SEQ ID NO:242), FIG. 244 (SEQ ID NO:244), FIG. 246 (SEQ ID NO:246), FIG. 248 (SEQ ID NO:248), FIG. 250 (SEQ ID NO:250), FIG. 252 (SEQ ID NO:252), FIG. 254 (SEQ ID NO:254), FIG. 256 (SEQ ID NO:256), FIG. 258 (SEQ ID NO:258), FIG. 260 (SEQ ID NO:260), FIG. 262 (SEQ ID NO:262), FIG. 264 (SEQ ID NO:264), FIG. 266 (SEQ ID NO:266), FIG. 268 (SEQ ID NO:268), FIG. 270 (SEQ ID NO:270), FIG. 272 (SEQ ID NO:272), FIG. 274 (SEQ ID NO:274), FIG. 276 (SEQ ID NO:276), FIG. 278 (SEQ ID NO:278), FIG. 280 (SEQ ID NO:280), FIG. 282 (SEQ ID NO:282), FIG. 284 (SEQ ID NO:284), FIG. 286 (SEQ ID NO:286), FIG. 288 (SEQ ID NO:288), FIG. 290 (SEQ ID NO:290), FIG. 292 (SEQ ID NO:292), FIG. 294 (SEQ ID NO:294), FIG. 296 (SEQ ID NO:296), FIG. 298 (SEQ ID NO:298), FIG. 300 (SEQ ID NO:300), FIG. 302 (SEQ ID NO:302), FIG. 304 (SEQ ID NO:304), FIG. 306 (SEQ ID NO:306), FIG. 308 (SEQ ID NO:308), FIG. 310 (SEQ ID NO:310), FIG. 312 (SEQ ID NO:312), FIG. 314 (SEQ ID NO:314), FIG. 316 (SEQ ID NO:316), FIG. 318 (SEQ ID NO:318), FIG. 320 (SEQ ID NO:320), FIG. 322 (SEQ ID NO:322), FIG. 324 (SEQ ID NO:324), FIG. 326 (SEQ ID NO:326), FIG. 328 (SEQ ID NO:328), FIG. 330 (SEQ ID NO:330), FIG. 332 (SEQ ID NO:332), FIG. 334 (SEQ ID NO:334), FIG. 336 (SEQ ID NO:336), FIG. 338 (SEQ ID NO:338), FIG. 340 (SEQ ID NO:340), FIG. 342 (SEQ ID NO:342), FIG. 344 (SEQ ID NO:344), FIG. 346 (SEQ ID NO:346), FIG. 348 (SEQ ID NO:348), FIG. 350 (SEQ ID NO:350), FIG. 352 (SEQ ID NO:352), FIG. 354 (SEQ ID NO:354), FIG. 356 (SEQ ID NO:356), FIG. 358 (SEQ ID NO:358), FIG. 360 (SEQ ID NO:360), FIG. 362 (SEQ ID NO:362), FIG. 364 (SEQ ID NO:364), FIG. 366 (SEQ ID NO:366), FIG. 368 (SEQ ID NO:368), FIG. 370 (SEQ ID NO:370), FIG. 372 (SEQ ID NO:372), FIG. 374 (SEQ ID NO:374), FIG. 376 (SEQ ID NO:376), FIG. 378 (SEQ ID NO:378), FIG. 380 (SEQ ID NO:380), FIG. 382 (SEQ ID NO:382), FIG. 384 (SEQ ID NO:384), FIG. 386 (SEQ ID NO:386), FIG. 388 (SEQ ID NO:388), FIG. 390 (SEQ ID NO:390), FIG. 392 (SEQ ID NO:392), FIG. 394 (SEQ ID NO:394), FIG. 396 (SEQ ID NO:396), FIG. 398 (SEQ ID NO:398), FIG. 400 (SEQ ID NO:400), FIG. 402 (SEQ ID NO:402), FIG. 404 (SEQ ID NO:404), FIG. 406 (SEQ ID NO:406), FIG. 408 (SEQ ID NO:408), FIG. 410 (SEQ ID NO:410), FIG. 412 (SEQ ID NO:412), FIG. 414 (SEQ ID NO:414), FIG. 416 (SEQ ID NO:416), FIG. 418 (SEQ ID NO:418), FIG. 420 (SEQ ID NO:420), FIG. 422 (SEQ ID NO:422), FIG. 424 (SEQ ID NO:424), FIG. 426 (SEQ ID NO:426), FIG. 428 (SEQ ID NO:428), FIG. 430 (SEQ ID NO:430), FIG. 432 (SEQ ID NO:432), FIG. 434 (SEQ ID NO:434), FIG. 436 (SEQ ID NO:436), FIG. 438 (SEQ ID NO:438), FIG. 440 (SEQ ID NO:440), FIG. 442 (SEQ ID NO:442), FIG. 444 (SEQ ID NO:444), FIG. 446 (SEQ ID NO:446), FIG. 448 (SEQ ID NO:448), FIG. 450 (SEQ ID NO:450), FIG. 452 (SEQ ID NO:452), FIG. 454 (SEQ ID NO:454), FIG. 456 (SEQ ID NO:456), FIG. 458 (SEQ ID NO:458), FIG. 460 (SEQ ID NO:460), FIG. 462 (SEQ ID NO:462), FIG. 464 (SEQ ID NO:464), FIG. 466 (SEQ ID NO:466), FIG. 468 (SEQ ID NO:468), FIG. 470 (SEQ ID NO:470), FIG. 472 (SEQ ID NO:472), FIG. 474 (SEQ ID NO:474), FIG. 476 (SEQ ID NO:476), FIG. 478 (SEQ ID NO:478), FIG. 480 (SEQ ID NO:480), FIG. 482 (SEQ ID NO:482), FIG. 484 (SEQ ID NO:484), FIG. 486 (SEQ ID NO:486), FIG. 488 (SEQ ID NO:488), FIG. 490 (SEQ ID NO:490), FIG. 492 (SEQ ID NO:492), FIG. 494 (SEQ ID NO:494), FIG. 496 (SEQ ID NO:496), FIG. 498 (SEQ ID NO:498), FIG. 500 (SEQ ID NO:500), FIG. 502 (SEQ ID NO:502), FIG. 504 (SEQ ID NO:504), FIG. 506 (SEQ ID NO:506), FIG. 508 (SEQ ID NO:508), FIG. 510 (SEQ ID NO:510), FIG. 512 (SEQ ID NO:512), FIG. 514 (SEQ ID NO:514), FIG. 516 (SEQ ID NO:516), FIG. 518 (SEQ ID NO:518), FIG. 520 (SEQ ID NO:520), FIG. 522 (SEQ ID NO:522), FIG. 524 (SEQ ID NO:524), FIG. 526 (SEQ ID NO:526), FIG. 528 (SEQ ID NO:528), FIG. 530 (SEQ ID NO:530), FIG. 532 (SEQ ID NO:532), FIG. 534 (SEQ ID NO:534), FIG. 536 (SEQ ID NO:536), FIG. 538 (SEQ ID NO:538), FIG. 540 (SEQ ID NO:540), FIG. 542 (SEQ ID NO:542), FIG. 544 (SEQ ID NO:544), FIG. 546 (SEQ ID NO:546), FIG. 548 (SEQ ID NO:548) or FIG. 550 (SEQ ID NO:550), with its associated signal peptide; or
(c) a nucleotide sequence encoding an extracellular domain of the polypeptide shown in FIG. 2 (SEQ ID NO:2), FIG. 4 (SEQ ID NO:4), FIG. 6 (SEQ ID NO:6), FIG. 8 (SEQ ID NO:8), FIG. 10 (SEQ ID NO: 10), FIG. 12 (SEQ ID NO: 12), FIG. 14 (SEQ ID NO:14), FIG. 16 (SEQ ID NO: 16), FIG. 18 (SEQ ID NO: 18), FIG. 20 (SEQ ID NO:20), FIG. 22 (SEQ ID NO:22), FIG. 24 (SEQ ID NO:24), FIG. 26 (SEQ ID NO:26), FIG. 28 (SEQ ID NO:28), FIG. 30 (SEQ ID NO:30), FIG. 32 (SEQ ID NO:32), FIG. 34 (SEQ ID NO:34), FIG. 36 (SEQ ID NO:36), FIG. 38 (SEQ ID NO:38), FIG. 40 (SEQ ID NO:40), FIG. 42 (SEQ ID NO:42), FIG. 44 (SEQ ID NO:44), FIG. 46 (SEQ ID NO:46), FIG. 48 (SEQ ID NO:48), FIG. 50 (SEQ ID NO:50), FIG. 52 (SEQ ID NO:52), FIG. 54 (SEQ ID NO:54), FIG. 56 (SEQ ID NO:56), FIG. 58 (SEQ ID NO:58), FIG. 60 (SEQ ID NO:60), FIG. 62 (SEQ ID NO:62), FIG. 64 (SEQ ID NO:64), FIG. 66 (SEQ ID NO:66), FIG. 68 (SEQ ID NO:68), FIG. 70 (SEQ ID NO:70), FIG. 72 (SEQ ID NO:72), FIG. 74 (SEQ ID NO:74), FIG. 76 (SEQ ID NO:76), FIG. 78 (SEQ ID NO:78), FIG. 80 (SEQ ID NO:80), FIG. 82 (SEQ ID NO:82), FIG. 84 (SEQ ID NO:84), FIG. 86 (SEQ ID NO:86), FIG. 88 (SEQ ID NO:88), FIG. 90 (SEQ ID NO:90), FIG. 92 (SEQ ID NO:92), FIG. 94 (SEQ ID NO:94), FIG. 96 (SEQ ID NO:96), FIG. 98 (SEQ ID NO:98), FIG. 100 (SEQ ID NO: 100), FIG. 102 (SEQ ID NO: 102), FIG. 104 (SEQ ID NO: 104), FIG. 106 (SEQ ID NO:106), FIG. 108 (SEQ ID NO:108), FIG. 110 (SEQ ID NO:110), FIG. 112 (SEQ ID NO: 112), FIG. 114 (SEQ ID NO: 114), FIG. 116 (SEQ ID NO: 116), FIG. 118 (SEQ ID NO: 118), FIG. 120 (SEQ ID NO:120), FIG. 122 (SEQ ID NO:122), FIG. 124 (SEQ ID NO:124), FIG. 126 (SEQ ID NO:126), FIG. 128 (SEQ ID NO:128), FIG. 130 (SEQ ID NO:130), FIG. 132 (SEQ ID NO:132), FIG. 134 (SEQ ID NO:134), FIG. 136 (SEQ ID NO:136), FIG. 138 (SEQ ID NO:138), FIG. 140 (SEQ ID NO: 140), FIG. 142 (SEQ ID NO:142), FIG. 144 (SEQ ID NO: 144), FIG. 146 (SEQ ID NO: 146), FIG. 148 (SEQ ID NO: 148), FIG. 150 (SEQ ID NO: 150), FIG. 152 (SEQ ID NO:152), FIG. 154 (SEQ ID NO:154), FIG. 156 (SEQ ID NO:156), FIG. 158 (SEQ ID NO:158), FIG. 160 (SEQ ID NO:160), FIG. 162 (SEQ ID NO:162), FIG. 164 (SEQ ID NO:164), FIG. 166 (SEQ ID NO:166), FIG. 168 (SEQ ID NO:168), FIG. 170 (SEQ ID NO:170), FIG. 172 (SEQ ID NO:172), FIG. 174 (SEQ ID NO:174), FIG. 176 (SEQ ID NO:176), FIG. 178 (SEQ ID NO: 178), FIG. 180 (SEQ ID NO:180), FIG. 182 (SEQ ID NO:182), FIG. 184 (SEQ ID NO:184), FIG. 186 (SEQ ID NO:186), FIG. 188 (SEQ ID NO:188), FIG. 190 (SEQ ID NO:190), FIG. 192 (SEQ ID NO: 192), FIG. 194 (SEQ ID NO:194), FIG. 196 (SEQ ID NO:196), FIG. 198 (SEQ ID NO:198), FIG. 200 (SEQ ID NO:200), FIG. 202 (SEQ ID NO:202), FIG. 204 (SEQ ID NO:204), FIG. 206 (SEQ ID NO:206), FIG. 208 (SEQ ID NO:208), FIG. 210 (SEQ ID NO:210), FIG. 212 (SEQ ID NO:212), FIG. 214 (SEQ ID NO:214), FIG. 216 (SEQ ID NO:216), FIG. 218 (SEQ ID NO:218), FIG. 220 (SEQ ID NO:220), FIG. 222 (SEQ ID NO:222), FIG. 224 (SEQ ID NO:224), FIG. 226 (SEQ ID NO:226), FIG. 228 (SEQ ID NO:228), FIG. 230 (SEQ ID NO:230), FIG. 232 (SEQ ID NO:232), FIG. 234 (SEQ ID NO:234), FIG. 236 (SEQ ID NO:236), FIG. 238 (SEQ ID NO:238), FIG. 240 (SEQ ID NO:240), FIG. 242 (SEQ ID NO:242), FIG. 244 (SEQ ID NO:244), FIG. 246 (SEQ ID NO:246), FIG. 248 (SEQ ID NO:248), FIG. 250 (SEQ ID NO:250), FIG. 252 (SEQ ID NO:252), FIG. 254 (SEQ ID NO:254), FIG. 256 (SEQ ID NO:256), FIG. 258 (SEQ ID NO:258), FIG. 260 (SEQ ID NO:260), FIG. 262 (SEQ ID NO:262), FIG. 264 (SEQ ID NO:264), FIG. 266 (SEQ ID NO:266), FIG. 268 (SEQ ID NO:268), FIG. 270 (SEQ ID NO:270), FIG. 272 (SEQ ID NO:272), FIG. 274 (SEQ ID NO:274), FIG. 276 (SEQ ID NO:276), FIG. 278 (SEQ ID NO:278), FIG. 280 (SEQ ID NO:280), FIG. 282 (SEQ ID NO:282), FIG. 284 (SEQ ID NO:284), FIG. 286 (SEQ ID NO:286), FIG. 288 (SEQ ID NO:288), FIG. 290 (SEQ ID NO:290), FIG. 292 (SEQ ID NO:292), FIG. 294 (SEQ ID NO:294), FIG. 296 (SEQ ID NO:296), FIG. 298 (SEQ ID NO:298), FIG. 300 (SEQ ID NO:300), FIG. 302 (SEQ ID NO:302), FIG. 304 (SEQ ID NO:304), FIG. 306 (SEQ ID NO:306), FIG. 308 (SEQ ID NO:308), FIG. 310 (SEQ ID NO:310), FIG. 312 (SEQ ID NO:312), FIG. 314 (SEQ ID NO:314), FIG. 316 (SEQ ID NO:316), FIG. 318 (SEQ ID NO:318), FIG. 320 (SEQ ID NO:320), FIG. 322 (SEQ ID NO:322), FIG. 324 (SEQ ID NO:324), FIG. 326 (SEQ ID NO:326), FIG. 328 (SEQ ID NO:328), FIG. 330 (SEQ ID NO:330), FIG. 332 (SEQ ID NO:332), FIG. 334 (SEQ ID NO:334), FIG. 336 (SEQ ID NO:336), FIG. 338 (SEQ ID NO:338), FIG. 340 (SEQ ID NO:340), FIG. 342 (SEQ ID NO:342), FIG. 344 (SEQ ID NO:344), FIG. 346 (SEQ ID NO:346), FIG. 348 (SEQ ID NO:348), FIG. 350 (SEQ ID NO:350), FIG. 352 (SEQ ID NO:352), FIG. 354 (SEQ ID NO:354), FIG. 356 (SEQ ID NO:356), FIG. 358 (SEQ ID NO:358), FIG. 360 (SEQ ID NO:360), FIG. 362 (SEQ ID NO:362), FIG. 364 (SEQ ID NO:364), FIG. 366 (SEQ ID NO:366), FIG. 368 (SEQ ID NO:368), FIG. 370 (SEQ ID NO:370), FIG. 372 (SEQ ID NO:372), FIG. 374 (SEQ ID NO:374), FIG. 376 (SEQ ID NO:376), FIG. 378 (SEQ ID NO:378), FIG. 380 (SEQ ID NO:380), FIG. 382 (SEQ ID NO:382), FIG. 384 (SEQ ID NO:384), FIG. 386 (SEQ ID NO:386), FIG. 388 (SEQ ID NO:388), FIG. 390 (SEQ ID NO:390), FIG. 392 (SEQ ID NO:392), FIG. 394 (SEQ ID NO:394), FIG. 396 (SEQ ID NO:396), FIG. 398 (SEQ ID NO:398), FIG. 400 (SEQ ID NO:400), FIG. 402 (SEQ ID NO:402), FIG. 404 (SEQ ID NO:404), FIG. 406 (SEQ ID NO:406), FIG. 408 (SEQ ID NO:408), FIG. 410 (SEQ ID NO:410), FIG. 412 (SEQ ID NO:412), FIG. 414 (SEQ ID NO:414), FIG. 416 (SEQ ID NO:416), FIG. 418 (SEQ ID NO:418), FIG. 420 (SEQ ID NO:420), FIG. 422 (SEQ ID NO:422), FIG. 424 (SEQ ID NO:424), FIG. 426 (SEQ ID NO:426), FIG. 428 (SEQ ID NO:428), FIG. 430 (SEQ ID NO:430), FIG. 432 (SEQ ID NO:432), FIG. 434 (SEQ ID NO:434), FIG. 436 (SEQ ID NO:436), FIG. 438 (SEQ ID NO:438), FIG. 440 (SEQ ID NO:440), FIG. 442 (SEQ ID NO:442), FIG. 444 (SEQ ID NO:444), FIG. 446 (SEQ ID NO:446), FIG. 448 (SEQ ID NO:448), FIG. 450 (SEQ ID NO:450), FIG. 452 (SEQ ID NO:452), FIG. 454 (SEQ ID NO:454), FIG. 456 (SEQ ID NO:456), FIG. 458 (SEQ ID NO:458), FIG. 460 (SEQ ID NO:460), FIG. 462 (SEQ ID NO:462), FIG. 464 (SEQ ID NO:464), FIG. 466 (SEQ ID NO:466), FIG. 468 (SEQ ID NO:468), FIG. 470 (SEQ ID NO:470), FIG. 472 (SEQ ID NO:472), FIG. 474 (SEQ ID NO:474), FIG. 476 (SEQ ID NO:476), FIG. 478 (SEQ ID NO:478), FIG. 480 (SEQ ID NO:480), FIG. 482 (SEQ ID NO:482), FIG. 484 (SEQ ID NO:484), FIG. 486 (SEQ ID NO:486), FIG. 488 (SEQ ID NO:488), FIG. 490 (SEQ ID NO:490), FIG. 492 (SEQ ID NO:492), FIG. 494 (SEQ ID NO:494), FIG. 496 (SEQ ID NO:496), FIG. 498 (SEQ ID NO:498), FIG. 500 (SEQ ID NO:500), FIG. 502 (SEQ ID NO:502), FIG. 504 (SEQ ID NO:504), FIG. 506 (SEQ ID NO:506), FIG. 508 (SEQ ID NO:508), FIG. 510 (SEQ ID NO:510), FIG. 512 (SEQ ID NO:512), FIG. 514 (SEQ ID NO:514), FIG. 516 (SEQ ID NO:516), FIG. 518 (SEQ ID NO:518), FIG. 520 (SEQ ID NO:520), FIG. 522 (SEQ ID NO:522), FIG. 524 (SEQ ID NO:524), FIG. 526 (SEQ ID NO:526), FIG. 528 (SEQ ID NO:528), FIG. 530 (SEQ ID NO:530), FIG. 532 (SEQ ID NO:532), FIG. 534 (SEQ ID NO:534), FIG. 536 (SEQ ID NO:536), FIG. 538 (SEQ ID NO:538), FIG. 540 (SEQ ID NO:540), FIG. 542 (SEQ ID NO:542), FIG. 544 (SEQ ID NO:544), FIG. 546 (SEQ ID NO:546), FIG. 548 (SEQ ID NO:548) or FIG. 550 (SEQ ID NO:550), lacking its associated signal peptide.
20. An isolated polypeptide having at least 80% amino acid sequence identity to:
(a) an amino acid sequence of the polypeptide shown in FIG. 2 (SEQ ID NO:2), FIG. 4 (SEQ ID NO:4), FIG. 6 (SEQ ID NO:6), FIG. 8 (SEQ ID NO:8), FIG. 10 (SEQ ID NO: 10), FIG. 12 (SEQ ID NO:12), FIG. 14 (SEQ ID NO:14), FIG. 16 (SEQ ID NO:16), FIG. 18 (SEQ ID NO:18), FIG. 20 (SEQ ]D NO:20), FIG. 22 (SEQ ID NO:22), FIG. 24 (SEQ ID NO:24), FIG. 26 (SEQ ID NO:26), FIG. 28 (SEQ ID NO:28), FIG. 30 (SEQ ID NO:30), FIG. 32 (SEQ ID NO:32), FIG. 34 (SEQ ID NO:34), FIG. 36 (SEQ ID NO:36), FIG. 38 (SEQ ID NO:38), FIG. 40 (SEQ ID NO:40), FIG. 42 (SEQ ID NO:42), FIG. 44 (SEQ ID NO:44), FIG. 46 (SEQ ID NO:46), FIG. 48 (SEQ ID NO:48), FIG. 50 (SEQ ID NO:50), FIG. 52 (SEQ ID NO:52), FIG. 54 (SEQ ID NO:54), FIG. 56 (SEQ ID NO:56), FIG. 58 (SEQ ID NO:58), FIG. 60 (SEQ ID NO:60), FIG. 62 (SEQ ID NO:62), FIG. 64 (SEQ ID NO:64), FIG. 66 (SEQ ID NO:66), FIG. 68 (SEQ ID NO:68), FIG. 70 (SEQ ID NO:70), FIG. 72 (SEQ ID NO:72), FIG. 74 (SEQ ID NO:74), FIG. 76 (SEQ ID NO:76), FIG. 78 (SEQ ID NO:78), FIG. 80 (SEQ ID NO:80), FIG. 82 (SEQ ID NO:82), FIG. 84 (SEQ ID NO:84), FIG. 86 (SEQ ID NO:86), FIG. 88 (SEQ ID NO:88), FIG. 90 (SEQ ID NO:90), FIG. 92 (SEQ ID NO:92), FIG. 94 (SEQ ID NO:94), FIG. 96 (SEQ ID NO:96), FIG. 98 (SEQ ID NO:98), FIG. 100 (SEQ ID NO: 100), FIG. 102 (SEQ ID NO:102), FIG. 104 (SEQ ID NO:104), FIG. 106 (SEQ ID NO:106), FIG. 108 (SEQ ID NO:108), FIG. 110 (SEQ ID NO:110), FIG. 112 (SEQ ID N0:112), FIG. 114 (SEQ ID NO:114), FIG. 116 (SEQ ID NO:116), FIG. 118 (SEQ ID NO:118), FIG. 120 (SEQ ID NO:120), FIG. 122 (SEQ ID NO:122), FIG. 124 (SEQ ID NO:124), FIG. 126 (SEQ ID NO:126), FIG. 128 (SEQ ID NO:128), FIG. 130 (SEQ ID NO:130), FIG. 132 (SEQ ID NO:132), FIG. 134 (SEQ ID NO:134), FIG. 136 (SEQ ID NO:136), FIG. 138 (SEQ ID NO:138), FIG. 140 (SEQ ID NO: 140), FIG. 142 (SEQ ID NO: 142), FIG. 144 (SEQ ID NO:144), FIG. 146 (SEQ ID NO: 146), FIG. 148 (SEQ ID NO: 148), FIG. 150 (SEQ ID NO:150), FIG. 152 (SEQ ID NO:152), FIG. 154 (SEQ ID NO:154), FIG. 156 (SEQ ID NO:156), FIG. 158 (SEQ ID NO:158), FIG. 160 (SEQ ID NO:160), FIG. 162 (SEQ ID NO:162), FIG. 164 (SEQ ID NO:164), FIG. 166 (SEQ ID NO:166), FIG. 168 (SEQ ID NO:168), FIG. 170 (SEQ ID NO:170), FIG. 172 (SEQ ID NO:172), FIG. 174 (SEQ ID NO:174), FIG. 176 (SEQ ID NO:176), FIG. 178 (SEQ ID NO:178), FIG. 180 (SEQ ID NO:180), FIG. 182 (SEQ ID NO:182), FIG. 184 (SEQ ID NO:184), FIG. 186 (SEQ ID NO:186), FIG. 188 (SEQ ID NO:188), FIG. 190 (SEQ ID NO:190), FIG. 192 (SEQ ID NO: 192), FIG. 194 (SEQ ID NO:194), FIG. 196 (SEQ ID NO:196), FIG. 198 (SEQ ID NO: 198), FIG. 200 (SEQ ID NO:200), FIG. 202 (SEQ ID NO:202), FIG. 204 (SEQ ID NO:204), FIG. 206 (SEQ ID NO:206), FIG. 208 (SEQ ID NO:208), FIG. 210 (SEQ ID NO:210), FIG. 212 (SEQ ID NO:212), FIG. 214 (SEQ ID NO:214), FIG. 216 (SEQ ID NO:216), FIG. 218 (SEQ ID NO:218), FIG. 220 (SEQ ID NO:220), FIG. 222 (SEQ ID NO:222), FIG. 224 (SEQ ID NO:224), FIG. 226 (SEQ ID NO:226), FIG. 228 (SEQ ID NO:228), FIG. 230 (SEQ ID NO:230), FIG. 232 (SEQ ID NO:232), FIG. 234 (SEQ ID NO:234), FIG. 236 (SEQ ID NO:236), FIG. 238 (SEQ ID NO:238), FIG. 240 (SEQ ID NO:240), FIG. 242 (SEQ ID NO:242), FIG. 244 (SEQ ID NO:244), FIG. 246 (SEQ ID NO:246), FIG. 248 (SEQ ID NO:248), FIG. 250 (SEQ ID NO:250), FIG. 252 (SEQ ID NO:252), FIG. 254 (SEQ ID NO:254), FIG. 256 (SEQ ID NO:256), FIG. 258 (SEQ ID NO:258), FIG. 260 (SEQ ID NO:260), FIG. 262 (SEQ ID NO 262), FIG. 264 (SEQ ID NO:264), FIG. 266 (SEQ ID NO:266), FIG. 268 (SEQ ID NO:268), FIG. 270 (SEQ ID NO:270), FIG. 272 (SEQ ID NO:272), FIG. 274 (SEQ ID NO:274), FIG. 276 (SEQ ID NO:276), FIG. 278 (SEQ ID NO:278), FIG. 280 (SEQ ID NO:280), FIG. 282 (SEQ ID NO:282), FIG. 284 (SEQ ID NO:284), FIG. 286 (SEQ ID NO:286), FIG. 288 (SEQ ID NO:288), FIG. 290 (SEQ ID NO:290), FIG. 292 (SEQ ID NO:292), FIG. 294 (SEQ ID NO:294), FIG. 296 (SEQ ID NO:296), FIG. 298 (SEQ ID NO:298), FIG. 300 (SEQ ID NO:300), FIG. 302 (SEQ ID NO:302), FIG. 304 (SEQ ID NO:304), FIG. 306 (SEQ ID NO:306), FIG. 308 (SEQ ID NO:308), FIG. 310 (SEQ ID NO:310), FIG. 312 (SEQ ID NO:312), FIG. 314 (SEQ ID NO:314), FIG. 316 (SEQ ID NO:316), FIG. 318 (SEQ ID NO:318), FIG. 320 (SEQ ID NO:320), FIG. 322 (SEQ ID NO:322), FIG. 324 (SEQ ID NO:324), FIG. 326 (SEQ ID NO:326), FIG. 328 (SEQ ID NO:328), FIG. 330 (SEQ ID NO:330), FIG. 332 (SEQ ID NO:332), FIG. 334 (SEQ ID NO:334), FIG. 336 (SEQ ID NO:336), FIG. 338 (SEQ ID NO:338), FIG. 340 (SEQ ID NO:340), FIG. 342 (SEQ ID NO:342), FIG. 344 (SEQ ID NO:344), FIG. 346 (SEQ ID NO:346), FIG. 348 (SEQ ID NO:348), FIG. 350 (SEQ ID NO:350), FIG. 352 (SEQ ID NO:352), FIG. 354 (SEQ ID NO:354), FIG. 356 (SEQ ID NO:356), FIG. 358 (SEQ ID NO:358), FIG. 360 (SEQ ID NO:360), FIG. 362 (SEQ ID NO:362), FIG. 364 (SEQ ID NO:364), FIG. 366 (SEQ ID NO:366), FIG. 368 (SEQ ID NO:368), FIG. 370 (SEQ ID NO:370), FIG. 372 (SEQ ID NO:372), FIG. 374 (SEQ ID NO:374), FIG. 376 (SEQ ID NO:376), FIG. 378 (SEQ ID NO:378), FIG. 380 (SEQ ID NO:380), FIG. 382 (SEQ ID NO:382), FIG. 384 (SEQ ID NO:384), FIG. 386 (SEQ ID NO:386), FIG. 388 (SEQ ID NO:388), FIG. 390 (SEQ ID NO:390), FIG. 392 (SEQ ID NO:392), FIG. 394 (SEQ ID NO:394), FIG. 396 (SEQ ID NO:396), FIG. 398 (SEQ ID NO:398), FIG. 400 (SEQ ID NO:400), FIG. 402 (SEQ ID NO:402), FIG. 404 (SEQ ID NO:404), FIG. 406 (SEQ ID NO:406), FIG. 408 (SEQ ID NO:408), FIG. 410 (SEQ ID NO:410), FIG. 412 (SEQ ID NO:412), FIG. 414 (SEQ ID NO:414), FIG. 416 (SEQ ID NO:416), FIG. 418 (SEQ ID NO:418), FIG. 420 (SEQ ID NO:420), FIG. 422 (SEQ ID NO:422), FIG. 424 (SEQ ID NO:424), FIG. 426 (SEQ ID NO:426), FIG. 428 (SEQ ID NO:428), FIG. 430 (SEQ ID NO:430), FIG. 432 (SEQ ID NO:432), FIG. 434 (SEQ ID NO:434), FIG. 436 (SEQ ID NO:436), FIG. 438 (SEQ ID NO:438), FIG. 440 (SEQ ID NO:440), FIG. 442 (SEQ ID NO:442), FIG. 444 (SEQ ID NO:444), FIG. 446 (SEQ ID NO:446), FIG. 448 (SEQ ID NO:448), FIG. 450 (SEQ ID NO:450), FIG. 452 (SEQ ID NO:452), FIG. 454 (SEQ ID NO:454), FIG. 456 (SEQ ID NO:456), FIG. 458 (SEQ ID NO:458), FIG. 460 (SEQ ID NO:460), FIG. 462 (SEQ ID NO:462), FIG. 464 (SEQ ID NO:464), FIG. 466 (SEQ ID NO:466), FIG. 468 (SEQ ID NO:468), FIG. 470 (SEQ ID NO:470), FIG. 472 (SEQ ID NO:472), FIG. 474 (SEQ ID NO:474), FIG. 476 (SEQ ID NO:476), FIG. 478 (SEQ ID NO:478), FIG. 480 (SEQ ID NO:480), FIG. 482 (SEQ ID NO:482), FIG. 484 (SEQ ID NO:484), FIG. 486 (SEQ ID NO:486), FIG. 488 (SEQ ID NO:488), FIG. 490 (SEQ ID NO:490), FIG. 492 (SEQ ID NO:492), FIG. 494 (SEQ ID NO:494), FIG. 496 (SEQ ID NO:496), FIG. 498 (SEQ ID NO:498), FIG. 500 (SEQ ID NO:500), FIG. 502 (SEQ ID NO:502), FIG. 504 (SEQ ID NO:504), FIG. 506 (SEQ ID NO:506), FIG. 508 (SEQ ID NO:508), FIG. 510 (SEQ ID NO:510), FIG. 512 (SEQ ID NO:512), FIG. 514 (SEQ ID NO:514), FIG. 516 (SEQ ID NO:516), FIG. 518 (SEQ ID NO:518), FIG. 520 (SEQ ID NO:520), FIG. 522 (SEQ ID NO:522), FIG. 524 (SEQ ID NO:524), FIG. 526 (SEQ ID NO:526), FIG. 528 (SEQ ID NO:528), FIG. 530 (SEQ ID NO:530), FIG. 532 (SEQ ID NO:532), FIG. 534 (SEQ ID NO:534), FIG. 536 (SEQ ID NO:536), FIG. 538 (SEQ ID NO:538), FIG. 540 (SEQ ID NO:540), FIG. 542 (SEQ ID NO:542), FIG. 544 (SEQ ID NO:544), FIG. 546 (SEQ ID NO:546), FIG. 548 (SEQ ID NO:548) or FIG. 550 (SEQ ID NO:550), lacking its associated signal peptide;
(b) an amino acid sequence of an extracellular domain of the polypeptide shown in FIG. 2 (SEQ ID NO:2), FIG. 4 (SEQ ID NO:4), FIG. 6 (SEQ ID NO:6), FIG. 8 (SEQ ID NO:8), FIG. 10 (SEQ ID NO:10), FIG. 12 (SEQ ID NO:12), FIG. 14 (SEQ ID NO: 14), FIG. 16 (SEQ ID NO:16), FIG. 18 (SEQ ID NO: 18), FIG. 20 (SEQ ID NO:20), FIG. 22 (SEQ ID NO:22), FIG. 24 (SEQ ID NO:24), FIG. 26 (SEQ ID NO:26), FIG. 28 (SEQ ID NO:28), FIG. 30 (SEQ ID NO:30), FIG. 32 (SEQ ID NO:32), FIG. 34 (SEQ ID NO:34), FIG. 36 (SEQ ID NO:36), FIG. 38 (SEQ ID NO:38), FIG. 40 (SEQ ID NO:40), FIG. 42 (SEQ ID NO:42), FIG. 44 (SEQ ID NO:44), FIG. 46 (SEQ ID NO:46), FIG. 48 (SEQ ID NO:48), FIG. 50 (SEQ ID NO:50), FIG. 52 (SEQ ID NO:52), FIG. 54 (SEQ ID NO:54), FIG. 56 (SEQ ID NO:56), FIG. 58 (SEQ ID NO:58), FIG. 60 (SEQ ID NO:60), FIG. 62 (SEQ ID NO:62), FIG. 64 (SEQ ID NO:64), FIG. 66 (SEQ ID NO:66), FIG. 68 (SEQ ID NO:68), FIG. 70 (SEQ ID NO:70), FIG. 72 (SEQ ID NO:72), FIG. 74 (SEQ ID NO:74), FIG. 76 (SEQ ID NO:76), FIG. 78 (SEQ ID NO:78), FIG. 80 (SEQ ID NO:80), FIG. 82 (SEQ ID NO:82), FIG. 84 (SEQ ID NO:84), FIG. 86 (SEQ ID NO:86), FIG. 88 (SEQ ID NO:88), FIG. 90 (SEQ ID NO:90), FIG. 92 (SEQ ID NO:92), FIG. 94 (SEQ ID NO:94), FIG. 96 (SEQ ID NO:96), FIG. 98 (SEQ ID NO:98), FIG. 100 (SEQ ID NO: 100), FIG. 102 (SEQ ID NO: 102), FIG. 104 (SEQ ID NO: 104), FIG. 106 (SEQ ID NO:106), FIG. 108 (SEQ ID NO:108), FIG. 110 (SEQ ID NO:l0), FIG. 112 (SEQ ID NO: 112), FIG. 114 (SEQ ID NO: 114), FIG. 116 (SEQ ID NO: 116), FIG. 118 (SEQ ID NO: 118), FIG. 120 (SEQ ID NO:120), FIG. 122 (SEQ ID NO:122), FIG. 124 (SEQ ID NO:124), FIG. 126 (SEQ ID NO:126), FIG. 128 (SEQ ID NO:128), FIG. 130 (SEQ ID NO:130), FIG. 132 (SEQ ID NO:132), FIG. 134 (SEQ ID NO:134), FIG. 136 (SEQ ID NO:136), FIG. 138 (SEQ ID NO:138), FIG. 140 (SEQ ID NO: 140), FIG. 142 (SEQ ID NO: 142), FIG. 144 (SEQ ID NO: 144), FIG. 146 (SEQ ID NO: 146), FIG. 148 (SEQ ID NO: 148), FIG. 150 (SEQ ID NO:150), FIG. 152 (SEQ ID NO: 152), FIG. 154 (SEQ ID NO:154), FIG. 156 (SEQ ID NO: 156), FIG. 158 (SEQ ID NO:158), FIG. 160 (SEQ ID NO:160), FIG. 162 (SEQ ID NO:162), FIG. 164 (SEQ ID NO:164), FIG. 166 (SEQ ID NO:166), FIG. 168 (SEQ ID NO:168), FIG. 170 (SEQ ID NO:170), FIG. 172 (SEQ ID NO:172), FIG. 174 (SEQ ID NO: 174), FIG. 176 (SEQ ID NO:176), FIG. 178 (SEQ ID NO:178), FIG. 180 (SEQ ID NO:180), FIG. 182 (SEQ ID NO:182), FIG. 184 (SEQ ID NO:184), FIG. 186 (SEQ ID NO:186), FIG. 188 (SEQ ID NO:188), FIG. 190 (SEQ ID NO: 190), FIG. 192 (SEQ ID NO:192), FIG. 194 (SEQ ID NO:194), FIG. 196 (SEQ ID NO:196), FIG. 198 (SEQ ID NO:198), FIG. 200 (SEQ ID NO:200), FIG. 202 (SEQ ID NO:202), FIG. 204 (SEQ ID NO:204), FIG. 206 (SEQ ID NO:206), FIG. 208 (SEQ ID NO:208), FIG. 210 (SEQ ID NO:210), FIG. 212 (SEQ ID NO:212), FIG. 214 (SEQ ID NO:214), FIG. 216 (SEQ ID NO:216), FIG. 218 (SEQ ID NO:218), FIG. 220 (SEQ ID NO:220), FIG. 222 (SEQ ID NO:222), FIG. 224 (SEQ ID NO:224), FIG. 226 (SEQ ID NO:226), FIG. 228 (SEQ ID NO:228), FIG. 230 (SEQ ID NO:230), FIG. 232 (SEQ ID NO:232), FIG. 234 (SEQ ID NO:234), FIG. 236 (SEQ ID NO:236), FIG. 238 (SEQ ID NO:238), FIG. 240 (SEQ ID NO:240), FIG. 242 (SEQ ID NO:242), FIG. 244 (SEQ ID NO:244), FIG. 246 (SEQ ID NO:246), FIG. 248 (SEQ ID NO:248), FIG. 250 (SEQ ID NO:250), FIG. 252 (SEQ ID NO:252), FIG. 254 (SEQ ID NO:254), FIG. 256 (SEQ ID NO:256), FIG. 258 (SEQ ID NO:258), FIG. 260 (SEQ ID NO:260), FIG. 262 (SEQ ID NO:262), FIG. 264 (SEQ ID NO:264), FIG. 266 (SEQ ID NO:266), FIG. 268 (SEQ ID NO:268), FIG. 270 (SEQ ID NO:270), FIG. 272 (SEQ ID NO:272), FIG. 274 (SEQ ID NO:274), FIG. 276 (SEQ ID NO:276), FIG. 278 (SEQ ID NO:278), FIG. 280 (SEQ ID NO:280), FIG. 282 (SEQ ID NO:282), FIG. 284 (SEQ ID NO:284), FIG. 286 (SEQ ID NO:286), FIG. 288 (SEQ ID NO:288), FIG. 290 (SEQ ID NO:290), FIG. 292 (SEQ ID NO:292), FIG. 294 (SEQ ID NO:294), FIG. 296 (SEQ ID NO:296), FIG. 298 (SEQ ID NO:298), FIG. 300 (SEQ ID NO:300), FIG. 302 (SEQ ID NO:302), FIG. 304 (SEQ ID NO:304), FIG. 306 (SEQ ID NO:306), FIG. 308 (SEQ ID NO:308), FIG. 310 (SEQ ID NO:310), FIG. 312 (SEQ ID NO:312), FIG. 314 (SEQ ID NO:314), FIG. 316 (SEQ ID NO:316), FIG. 318 (SEQ ID NO:318), FIG. 320 (SEQ ID NO:320), FIG. 322 (SEQ ID NO:322), FIG. 324 (SEQ ID NO:324), FIG. 326 (SEQ ID NO:326), FIG. 328 (SEQ ID NO:328), FIG. 330 (SEQ ID NO:330), FIG. 332 (SEQ ID NO:332), FIG. 334 (SEQ ID NO:334), FIG. 336 (SEQ ID NO:336), FIG. 338 (SEQ ID NO:338), FIG. 340 (SEQ ID NO:340), FIG. 342 (SEQ ID NO:342), FIG. 344 (SEQ ID NO:344), FIG. 346 (SEQ ID NO:346), FIG. 348 (SEQ ID NO:348), FIG. 350 (SEQ ID NO:350), FIG. 352 (SEQ ID NO:352), FIG. 354 (SEQ ID NO:354), FIG. 356 (SEQ ID NO:356), FIG. 358 (SEQ ID NO:358), FIG. 360 (SEQ ID NO:360), FIG. 362 (SEQ ID NO:362), FIG. 364 (SEQ ID NO:364), FIG. 366 (SEQ ID NO:366), FIG. 368 (SEQ ID NO:368), FIG. 370 (SEQ ID NO:370), FIG. 372 (SEQ ID NO:372), FIG. 374 (SEQ ID NO:374), FIG. 376 (SEQ ID NO:376), FIG. 378 (SEQ ID NO:378), FIG. 380 (SEQ ID NO:380), FIG. 382 (SEQ ID NO:382), FIG. 384 (SEQ ID NO:384), FIG. 386 (SEQ ID NO:386), FIG. 388 (SEQ ID NO:388), FIG. 390 (SEQ ID NO:390), FIG. 392 (SEQ ID NO:392), FIG. 394 (SEQ ID NO:394), FIG. 396 (SEQ ID NO:396), FIG. 398 (SEQ ID NO:398), FIG. 400 (SEQ ID NO:400), FIG. 402 (SEQ ID NO:402), FIG. 404 (SEQ ID NO:404), FIG. 406 (SEQ ID NO:406), FIG. 408 (SEQ ID NO:408), FIG. 410 (SEQ ID NO:410), FIG. 412 (SEQ ID NO:412), FIG. 414 (SEQ ID NO:414), FIG. 416 (SEQ ID NO:416), FIG. 418 (SEQ ID NO:418), FIG. 420 (SEQ ID NO:420), FIG. 422 (SEQ ID NO:422), FIG. 424 (SEQ ID NO:424), FIG. 426 (SEQ ID NO:426), FIG. 428 (SEQ ID NO:428), FIG. 430 (SEQ ID NO:430), FIG. 432 (SEQ ID NO:432), FIG. 434 (SEQ ID NO:434), FIG. 436 (SEQ ID NO:436), FIG. 438 (SEQ ID NO:438), FIG. 440 (SEQ ID NO:440), FIG. 442 (SEQ ID NO:442), FIG. 444 (SEQ ID NO:444), FIG. 446 (SEQ ID NO:446), FIG. 448 (SEQ ID NO:448), FIG. 450 (SEQ ID NO:450), FIG. 452 (SEQ ID NO:452), FIG. 454 (SEQ ID NO:454), FIG. 456 (SEQ ID NO:456), FIG. 458 (SEQ ID NO:458), FIG. 460 (SEQ ID NO:460), FIG. 462 (SEQ ID NO:462), FIG. 464 (SEQ ID NO:464), FIG. 466 (SEQ ID NO:466), FIG. 468 (SEQ ID NO:468), FIG. 470 (SEQ ID NO:470), FIG. 472 (SEQ ID NO:472), FIG. 474 (SEQ ID NO:474), FIG. 476 (SEQ ID NO:476), FIG. 478 (SEQ ID NO:478), FIG. 480 (SEQ ID NO:480), FIG. 482 (SEQ ID NO:482), FIG. 484 (SEQ ID NO:484), FIG. 486 (SEQ ID NO:486), FIG. 488 (SEQ ID NO:488), FIG. 490 (SEQ ID NO:490), FIG. 492 (SEQ ID NO:492), FIG. 494 (SEQ ID NO:494), FIG. 496 (SEQ ID NO:496), FIG. 498 (SEQ ID NO:498), FIG. 500 (SEQ ID NO:500), FIG. 502 (SEQ ID NO:502), FIG. 504 (SEQ ID NO:504), FIG. 506 (SEQ ID NO:506), FIG. 508 (SEQ ID NO:508), FIG. 510 (SEQ ID NO:510), FIG. 512 (SEQ ID NO:512), FIG. 514 (SEQ ID NO:514), FIG. 516 (SEQ ID NO:516), FIG. 518 (SEQ ID NO:518), FIG. 520 (SEQ ID NO:520), FIG. 522 (SEQ ID NO:522), FIG. 524 (SEQ ID NO:524), FIG. 526 (SEQ ID NO:526), FIG. 528 (SEQ ID NO:528), FIG. 530 (SEQ ID NO:530), FIG. 532 (SEQ ID NO:532), FIG. 534 (SEQ ID NO:534), FIG. 536 (SEQ ID NO:536), FIG. 538 (SEQ ID NO:538), FIG. 540 (SEQ ID NO:540), FIG. 542 (SEQ ID NO:542), FIG. 544 (SEQ ID NO:544), FIG. 546 (SEQ ID NO:546), FIG. 548 (SEQ ID NO:548) or FIG. 550 (SEQ ID NO:550), with its associated signal peptide; or
(c) an amino acid sequence of an extracellular domain of the polypeptide shown in FIG. 2 (SEQ ID NO:2), FIG. 4 (SEQ ID NO:4), FIG. 6 (SEQ ID NO:6), FIG. 8 (SEQ ID NO:8), FIG. 10 (SEQ ID NO: 10), FIG. 12 (SEQ ID NO:12), FIG. 14 (SEQ ID NO: 14), FIG. 16 (SEQ ID NO:16), FIG. 18 (SEQ ID NO: 18), FIG. 20 (SEQ ID NO:20), FIG. 22 (SEQ ID NO:22), FIG. 24 (SEQ ID NO:24), FIG. 26 (SEQ ID NO:26), FIG. 28 (SEQ ID NO:28), FIG. 30 (SEQ ID NO:30), FIG. 32 (SEQ ID NO:32), FIG. 34 (SEQ ID NO:34), FIG. 36 (SEQ ID NO:36), FIG. 38 (SEQ ID NO:38), FIG. 40 (SEQ ID NO:40), FIG. 42 (SEQ ID NO:42), FIG. 44 (SEQ ID NO:44), FIG. 46 (SEQ ID NO:46), FIG. 48 (SEQ ID NO:48), FIG. 50 (SEQ ID NO:50), FIG. 52 (SEQ ID NO:52), FIG. 54 (SEQ ID NO:54), FIG. 56 (SEQ ID NO:56), FIG. 58 (SEQ ID NO:58), FIG. 60 (SEQ ID NO:60), FIG. 62 (SEQ ID NO:62), FIG. 64 (SEQ ID NO:64), FIG. 66 (SEQ ID NO:66), FIG. 68 (SEQ ID NO:68), FIG. 70 (SEQ ID NO:70), FIG. 72 (SEQ ID NO:72), FIG. 74 (SEQ ID NO:74), FIG. 76 (SEQ ID NO:76), FIG. 78 (SEQ ID NO:78), FIG. 80 (SEQ ID NO:80), FIG. 82 (SEQ ID NO:82), FIG. 84 (SEQ ID NO:84), FIG. 86 (SEQ ID NO:86), FIG. 88 (SEQ ID NO:88), FIG. 90 (SEQ ID NO:90), FIG. 92 (SEQ ID NO:92), FIG. 94 (SEQ ID NO:94), FIG. 96 (SEQ ID NO:96), FIG. 98 (SEQ ID NO:98), FIG. 100 (SEQ ID NO: 100), FIG. 102 (SEQ ID NO: 102), FIG. 104 (SEQ ID NO: 104), FIG. 106 (SEQ ID NO:106), FIG. 108 (SEQ ID NO:108), FIG. 110 (SEQ ID NO:110), FIG. 112 (SEQ ID NO: 112), FIG. 114 (SEQ ID NO: 114), FIG. 116 (SEQ ID NO: 116), FIG. 118 (SEQ ID NO: 118), FIG. 120 (SEQ ID NO:120), FIG. 122 (SEQ ID NO:122), FIG. 124 (SEQ ID NO:124), FIG. 126 (SEQ ID NO:126), FIG. 128 (SEQ ID NO:128), FIG. 130 (SEQ ID NO:130), FIG. 132 (SEQ ID NO:132), FIG. 134 (SEQ ID NO:134), FIG. 136 (SEQ ID NO:136), FIG. 138 (SEQ ID NO:138), FIG. 140 (SEQ ID NO: 140), FIG. 142 (SEQ ID NO: 142), FIG. 144 (SEQ ID NO: 144), FIG. 146 (SEQ ID NO: 146), FIG. 148 (SEQ ID NO:148), FIG. 150 (SEQ ID NO:150), FIG. 152 (SEQ ID NO:152), FIG. 154 (SEQ ID NO: 154), FIG. 156 (SEQ ID NO: 156), FIG. 158 (SEQ ID NO: 158), FIG. 160 (SEQ ID NO: 160), FIG. 162 (SEQ ID NO: 162), FIG. 164 (SEQ ID NO:164), FIG. 166 (SEQ ID NO:166), FIG. 168 (SEQ ID NO:168), FIG. 170 (SEQ ID NO:170), FIG. 172 (SEQ ID NO: 172), FIG. 174 (SEQ ID NO:174), FIG. 176 (SEQ ID NO:176), FIG. 178 (SEQ ID NO: 178), FIG. 180 (SEQ ID NO:180), FIG. 182 (SEQ ID NO:182), FIG. 184 (SEQ ID NO:184), FIG. 186 (SEQ ID NO:186), FIG. 188 (SEQ ID NO:188), FIG. 190 (SEQ ID NO: 190), FIG. 192 (SEQ ID NO:192), FIG. 194 (SEQ ID NO: 194), FIG. 196 (SEQ ID NO: 196), FIG. 198 (SEQ ID NO: 198), FIG. 200 (SEQ ID NO:200), FIG. 202 (SEQ ID NO:202), FIG. 204 (SEQ ID NO:204), FIG. 206 (SEQ ID NO:206), FIG. 208 (SEQ ID NO:208), FIG. 210 (SEQ ID NO:210), FIG. 212 (SEQ ID NO:212), FIG. 214 (SEQ ID NO:214), FIG. 216 (SEQ ID NO:216), FIG. 218 (SEQ ID NO:218), FIG. 220 (SEQ ID NO:220), FIG. 222 (SEQ ID NO:222), FIG. 224 (SEQ ID NO:224), FIG. 226 (SEQ ID NO:226), FIG. 228 (SEQ ID NO:228), FIG. 230 (SEQ ID NO:230), FIG. 232 (SEQ ID NO:232), FIG. 234 (SEQ ID NO:234), FIG. 236 (SEQ ID NO:236), FIG. 238 (SEQ ID NO:238), FIG. 240 (SEQ ID NO:240), FIG. 242 (SEQ ID NO:242), FIG. 244 (SEQ ID NO:244), FIG. 246 (SEQ ID NO:246), FIG. 248 (SEQ ID NO:248), FIG. 250 (SEQ ID NO:250), FIG. 252 (SEQ ID NO:252), FIG. 254 (SEQ ID NO:254), FIG. 256 (SEQ ID NO:256), FIG. 258 (SEQ ID NO:258), FIG. 260 (SEQ ID NO:260), FIG. 262 (SEQ ID NO:262), FIG. 264 (SEQ ID NO:264), FIG. 266 (SEQ ID NO:266), FIG. 268 (SEQ ID NO:268), FIG. 270 (SEQ ID NO:270), FIG. 272 (SEQ ID NO:272), FIG. 274 (SEQ ID NO:274), FIG. 276 (SEQ ID NO:276), FIG. 278 (SEQ ID NO:278), FIG. 280 (SEQ ID NO:280), FIG. 282 (SEQ ID NO:282), FIG. 284 (SEQ ID NO:284), FIG. 286 (SEQ ID NO:286), FIG. 288 (SEQ ID NO:288), FIG. 290 (SEQ ID NO:290), FIG. 292 (SEQ ID NO:292), FIG. 294 (SEQ ID NO:294), FIG. 296 (SEQ ID NO:296), FIG. 298 (SEQ ID NO:298), FIG. 300 (SEQ ID NO:300), FIG. 302 (SEQ ID NO:302), FIG. 304 (SEQ ID NO:304), FIG. 306 (SEQ ID NO:306), FIG. 308 (SEQ ID NO:308), FIG. 310 (SEQ ID NO:310), FIG. 312 (SEQ ID NO:312), FIG. 314 (SEQ ID NO:314), FIG. 316 (SEQ ID NO:316), FIG. 318 (SEQ ID NO:318), FIG. 320 (SEQ ID NO:320), FIG. 322 (SEQ ID NO:322), FIG. 324 (SEQ ID NO:324), FIG. 326 (SEQ ID NO:326), FIG. 328 (SEQ ID NO:328), FIG. 330 (SEQ ID NO:330), FIG. 332 (SEQ ID NO:332), FIG. 334 (SEQ ID NO:334), FIG. 336 (SEQ ID NO:336), FIG. 338 (SEQ ID NO:338), FIG. 340 (SEQ ID NO:340), FIG. 342 (SEQ ID NO:342), FIG. 344 (SEQ ID NO:344), FIG. 346 (SEQ ID NO:346), FIG. 348 (SEQ ID NO:348), FIG. 350 (SEQ ID NO:350), FIG. 352 (SEQ ID NO:352), FIG. 354 (SEQ ID NO:354), FIG. 356 (SEQ ID NO:356), FIG. 358 (SEQ ID NO:358), FIG. 360 (SEQ ID NO:360), FIG. 362 (SEQ ID NO:362), FIG. 364 (SEQ ID NO:364), FIG. 366 (SEQ ID NO:366), FIG. 368 (SEQ ID NO:368), FIG. 370 (SEQ ID NO:370), FIG. 372 (SEQ ID NO:372), FIG. 374 (SEQ ID NO:374), FIG. 376 (SEQ ID NO:376), FIG. 378 (SEQ ID NO:378), FIG. 380 (SEQ ID NO:380), FIG. 382 (SEQ ID NO:382), FIG. 384 (SEQ ID NO:384), FIG. 386 (SEQ ID NO:386), FIG. 388 (SEQ ID NO:388), FIG. 390 (SEQ ID NO:390), FIG. 392 (SEQ ID NO:392), FIG. 394 (SEQ ID NO:394), FIG. 396 (SEQ ID NO:396), FIG. 398 (SEQ ID NO:398), FIG. 400 (SEQ ID NO:400), FIG. 402 (SEQ ID NO:402), FIG. 404 (SEQ ID NO:404), FIG. 406 (SEQ ID NO:406), FIG. 408 (SEQ ID NO:408), FIG. 410 (SEQ ID NO:410), FIG. 412 (SEQ ID NO:412), FIG. 414 (SEQ ID NO:414), FIG. 416 (SEQ ID NO:416), FIG. 418 (SEQ ID NO:418), FIG. 420 (SEQ ID NO:420), FIG. 422 (SEQ ID NO:422), FIG. 424 (SEQ ID NO:424), FIG. 426 (SEQ ID NO:426), FIG. 428 (SEQ ID NO:428), FIG. 430 (SEQ ID NO:430), FIG. 432 (SEQ ID NO:432), FIG. 434 (SEQ ID NO:434), FIG. 436 (SEQ ID NO:436), FIG. 438 (SEQ ID NO:438), FIG. 440 (SEQ ID NO:440), FIG. 442 (SEQ ID NO:442), FIG. 444 (SEQ ID NO:444), FIG. 446 (SEQ ID NO:446), FIG. 448 (SEQ ID NO:448), FIG. 450 (SEQ ID NO:450), FIG. 452 (SEQ ID NO:452), FIG. 454 (SEQ ID NO:454), FIG. 456 (SEQ ID NO:456), FIG. 458 (SEQ ID NO:458), FIG. 460 (SEQ ID NO:460), FIG. 462 (SEQ ID NO:462), FIG. 464 (SEQ ID NO:464), FIG. 466 (SEQ ID NO:466), FIG. 468 (SEQ ID NO:468), FIG. 470 (SEQ ID NO:470), FIG. 472 (SEQ ID NO:472), FIG. 474 (SEQ ID NO:474), FIG. 476 (SEQ ID NO:476), FIG. 478 (SEQ ID NO:478), FIG. 480 (SEQ ID NO:480), FIG. 482 (SEQ ID NO:482), FIG. 484 (SEQ ID NO:484), FIG. 486 (SEQ ID NO:486), FIG. 488 (SEQ ID NO:488), FIG. 490 (SEQ ID NO:490), FIG. 492 (SEQ ID NO:492), FIG. 494 (SEQ ID NO:494), FIG. 496 (SEQ ID NO:496), FIG. 498 (SEQ ID NO:498), FIG. 500 (SEQ ID NO:500), FIG. 502 (SEQ ID NO:502), FIG. 504 (SEQ ID NO:504), FIG. 506 (SEQ ID NO:506), FIG. 508 (SEQ ID NO:508), FIG. 510 (SEQ ID NO:510), FIG. 512 (SEQ ID NO:512), FIG. 514 (SEQ ID NO:514), FIG. 516 (SEQ ID NO:516), FIG. 518 (SEQ ID NO:518), FIG. 520 (SEQ ID NO:520), FIG. 522 (SEQ ID NO:522), FIG. 524 (SEQ ID NO:524), FIG. 526 (SEQ ID NO:526), FIG. 528 (SEQ ID NO:528), FIG. 530 (SEQ ID NO:530), FIG. 532 (SEQ ID NO:532), FIG. 534 (SEQ ID NO:534), FIG. 536 (SEQ ID NO:536), FIG. 538 (SEQ ID NO:538), FIG. 540 (SEQ ID NO:540), FIG. 542 (SEQ ID NO:542), FIG. 544 (SEQ ID NO:544), FIG. 546 (SEQ ID NO:546), FIG. 548 (SEQ ID NO:548) or FIG. 550 (SEQ ID NO:550), lacking its associated signal peptide.
21. A method of detecting aPRO1801 polypeptide in a sample suspected of containing a PRO1801 polypeptide, said method comprising contacting said sample with a PRO1114 or PRO4978 polypeptide and determining the formation of aPRO1801/PRO1114 or PRO1801/PRO4978 polypeptide conjugate in said sample, wherein the formation of said conjugate is indicative of the presence of a PRO1801 polypeptide in said sample.
22. The method according to claim 21 , wherein said sample comprises cells suspected of expressing said PRO1801 polypeptide.
23. The method according to claim 21 , wherein said PRO1114 or PRO4978 polypeptide is labeled with a detectable label.
24. The method according to claim 21 , wherein said PRO1114 or PRO4978 polypeptide is attached to a solid support.
25. A method of detecting a PRO1114 or PRO4978 polypeptide in a sample suspected of containing a PRO1114 or PRO4978 polypeptide, said method comprising contacting said sample with a PRO1801 polypeptide and determining the formation of a PRO1801/PRO1114 or PRO1801/PRO4978 polypeptide conjugate in said sample, wherein the formation of said conjugate is indicative of the presence of a PRO1114 or PRO4978 polypeptide in said sample.
26. The method according to claim 25 , wherein said sample comprises cells suspected of expressing said PRO1114 or PRO4978 polypeptide.
27. The method according to claim 25 , wherein said PRO1801 polypeptide is labeled with a detectable label.
28. The method according to claim 25 , wherein said PRO1801 polypeptide is attached to a solid support.
29. A method of linking a bioactive molecule to a cell expressing a PRO1801 polypeptide, said method comprising contacting said cell with aPRO1114 or PRO4978 polypeptide that is bound to said bioactive molecule and allowing said PRO1801 and said PRO1114 or PRO4978 polypeptides to bind to one another, thereby linking said bioactive molecules to said cell.
30. The method according to claim 29 , wherein said bioactive molecule is a toxin, a radiolabel or an antibody.
31. The method according to claim 29 , wherein said bioactive molecule causes the death of said cell.
32. A method of linking a bioactive molecule to a cell expressing a PRO1114 or PRO4978 polypeptide, said method comprising contacting said cell with a PRO1801 polypeptide that is bound to said bioactive molecule and allowing said PRO1801 and said PRO1114 or PRO4978 polypeptides to bind to one another, thereby linking said bioactive molecules to said cell.
33. The method according to claim 32 , wherein said bioactive molecule is a toxin, a radiolabel or an antibody.
34. The method according to claim 32 , wherein said bioactive molecule causes the death of said cell.
35. A method of modulating at least one biological activity of a cell expressing a PRO1801 polypeptide, said method comprising contacting said cell with a PRO1114 or PRO4978 polypeptide or an anti-PRO1801 polypeptide antibody, whereby said PRO1114 or PRO4978 polypeptide or anti-PRO1801 polypeptide antibody binds to said PRO1801 polypeptide, thereby modulating at least one biological activity of said cell.
36. The method according to claim 35 , wherein said cell is killed.
37. A method of modulating at least one biological activity of a cell expressing a PRO1114 or PRO4978 polypeptide, said method comprising contacting said cell with a PRO1801 polypeptide or an anti-PRO1114 or anti-PRO4978 polypeptide antibody, whereby said PRO1801 polypeptide or anti-PRO1114 or anti-PRO4978 polypeptide antibody binds to said PRO1114 or PRO4978 polypeptide, there by modulating at least one biological activity of said cell.
38. The method according to claim 37 , wherein said cell is killed.
39. A method of detecting aPRO1114polypeptide in a sample suspected of containing aPRO1114 polypeptide, said method comprising contacting said sample with a PRO100 polypeptide and determining the formation of a PRO100/PRO1114 polypeptide conjugate in said sample, wherein the formation of said conjugate is indicative of the presence of a PRO1114 polypeptide in said sample.
40. The method according to claim 39 , wherein said sample comprises cells suspected of expressing said PRO1114 polypeptide.
41. The method according to claim 39 , wherein said PRO100 polypeptide is labeled with a detectable label.
42. The method according to claim 39 , wherein said PRO100 polypeptide is attached to a solid support.
43. A method of detecting a PRO100 polypeptide in a sample suspected of containing a PRO100 polypeptide, said method comprising contacting said sample with a PRO1114 polypeptide and determining the formation of a PRO100/PRO1114 polypeptide conjugate in said sample, wherein the formation of said conjugate is indicative of the presence of a PRO100 polypeptide in said sample.
44. The method according to claim 43 , wherein said sample comprises cells suspected of expressing said PRO100 polypeptide.
45. The method according to claim 43 , wherein said PRO1114 polypeptide is labeled with a detectable label.
46. The method according to claim 43 , wherein said PRO1114 polypeptide is attached to a solid support.
47. A method of linking a bioactive molecule to a cell expressing a PRO100 polypeptide, said method comprising contacting said cell with a PRO1114 polypeptide that is bound to said bioactive molecule and allowing said PRO100 and said PRO1114 polypeptides to bind to one another, thereby linking said bioactive molecules to said cell.
48. The method according to claim 47 , wherein said bioactive molecule is a toxin, a radiolabel or an antibody.
49. The method according to claim 47 , wherein said bioactive molecule causes the death of said cell.
50. A method of linking a bioactive molecule to a cell expressing a PRO1114 polypeptide, said method comprising contacting said cell with a PRO100 polypeptide that is bound to said bioactive molecule and allowing said PRO100 and said PRO1114 polypeptides to bind to one another, thereby linking said bioactive molecules to said cell.
51. The method according to claim 50 , wherein said bioactive molecule is a toxin, a radiolabel or an antibody.
52. The method according to claim 50 , wherein said bioactive molecule causes the death of said cell.
53. A method of modulating at least one biological activity of a cell expressing a PRO100 polypeptide, said method comprising contacting said cell with a PRO1114 polypeptide or an anti-PRO100 polypeptide antibody, whereby said PRO1114 polypeptide or anti-PRO100 polypeptide antibody binds to said PRO100 polypeptide, thereby modulating at least one biological activity of said cell.
54. The method according to claim 53 , wherein said cell is killed.
55. A method of modulating at least one biological activity of a cell expressing a PRO1114 polypeptide, said method comprising contacting said cell with a PRO100 polypeptide or an anti-PRO1114 polypeptide antibody, whereby said PRO100 polypeptide or anti-PRO1114 polypeptide antibody binds to said PRO1114 polypeptide, thereby modulating at least one biological activity of said cell.
56. The method according to claim 55 , wherein said cell is killed.
57. A method for stimulating the release of TNF-α from human blood, said method comprising contacting said blood with a PRO195, PRO202, PRO215, PRO221, PRO217, PRO222, PRO198, PRO245, PRO172, PRO265, PRO266, PRO344, PRO337, PRO322, PRO1286, PRO1279, PRO1338 or PRO1343 polypeptide, wherein the release of TNF-α from said blood is stimulated.
58. A method for modulating the uptake of glucose or FFA by skeletal muscle cells, said method comprising contacting said cells with a PRO182, PRO366, PRO198, PRO172 or PRO719 polypeptide, wherein the uptake of glucose or FFA by said cells is modulated.
59. A method for stimulating the proliferation or differentiation of chondrocyte cells, said method comprising contacting said cells with a PRO182, PRO366, PRO198, PRO1868, PRO202, PRO224, PRO172, PRO301 or PRO1312 polypeptide, wherein the proliferation or differentiation of said cells is stimulated.
60. A method for modulating the uptake of glucose or FFA by adipocyte cells, said method comprising contacting said cells with a PRO202, PRO211, PRO344 or PRO1338 polypeptide, wherein the uptake of glucose or FFA by said cells is modulated.
61. A method for stimulating the proliferation of or gene expression in pericyte cells, said method comprising contacting said cells with a PRO366 polypeptide, wherein the proliferation of or gene expression in said cells is stimulated.
62. A method for stimulating the release of proteoglycans from cartilage, said method comprising contacting said cartilage with a PRO216 polypeptide, wherein the release of proteoglycans from said cartilage is stimulated.
63. A method for stimulating the proliferation of inner ear utricular supporting cells, said method comprising contacting said cells with a PRO172 polypeptide, wherein the proliferation of said cells is stimulated.
64. A method for stimulating the proliferation of T-lymphocyte cells, said method comprising contacting said cells with a PRO344 polypeptide, wherein the proliferation of said cells is stimulated.
65. A method for stimulating the release of a cytokine from PBMC cells, said method comprising contacting said cells with a PRO526 or PRO1343 polypeptide, wherein the release of a cytokine from said cells is stimulated.
66. A method for inhibiting the binding of A-peptide to factor VIIA, said method comprising contacting a composition comprising said A-peptide and said factor VIIA with a PRO182 polypeptide, wherein the binding of said A-peptide to said factor VIIA is inhibited.
67. A method for inhibiting the differentiation of adipocyte cells, said method comprising contacting said cells with a PRO185 or PRO198 polypeptide, wherein the differentiation of said cells is inhibited.
68. A method for stimulating the proliferation of endothelial cells, said method comprising contacting said cells with a PRO222 polypeptide, wherein the proliferation of said cells is inhibited.
69. A method for detecting the presence of tumor in an mammal, said method comprising comparing the level of expression of any PRO polypeptide shown in Table 8 in (a) a test sample of cells taken from said mammal and (b) a control sample of normal cells of the same cell type, wherein a higher level of expression of said PRO polypeptide in the test sample as compared to the control sample is indicative of the presence of tumor in said mammal.
70. The method of claim 69 , wherein said tumor is lung tumor, colon tumor, breast tumor, prostate tumor, rectal tumor, cervical tumor or liver tumor.
71. An oligonucleotide probe derived from any of the nucleotide sequences shown in the accompanying figures.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US10/160,503 US20040033559A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US20983200P | 2000-06-05 | 2000-06-05 | |
PCT/US2000/032678 WO2001040466A2 (en) | 1999-12-01 | 2000-12-01 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/028,072 US20030004311A1 (en) | 1997-06-18 | 2001-12-19 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/160,503 US20040033559A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/028,072 Continuation US20030004311A1 (en) | 1997-03-31 | 2001-12-19 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
Publications (1)
Publication Number | Publication Date |
---|---|
US20040033559A1 true US20040033559A1 (en) | 2004-02-19 |
Family
ID=21841414
Family Applications (468)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US09/990,456 Abandoned US20020137890A1 (en) | 1997-03-31 | 2001-11-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,059 Abandoned US20030190721A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,041 Abandoned US20030077776A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,040 Abandoned US20030082759A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,045 Abandoned US20030073210A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,051 Abandoned US20030092147A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,046 Abandoned US20030194791A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,047 Abandoned US20030077778A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,042 Abandoned US20030096386A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,044 Abandoned US20030190717A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,048 Abandoned US20030199051A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,043 Expired - Lifetime US7220831B2 (en) | 1997-03-31 | 2002-04-12 | PRO235 polypeptides |
US10/121,057 Abandoned US20030190719A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,054 Abandoned US20030199054A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,053 Abandoned US20030199053A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,055 Abandoned US20030190718A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,062 Abandoned US20030077779A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,063 Abandoned US20030199055A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,061 Abandoned US20030082761A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,058 Abandoned US20030190720A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,056 Abandoned US20030082760A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,060 Abandoned US20030190722A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,052 Abandoned US20030199052A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,050 Abandoned US20030054516A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,109 Abandoned US20030190723A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,236 Abandoned US20030068795A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,215 Expired - Lifetime US7291329B2 (en) | 1997-03-31 | 2002-04-15 | Antibodies against PRO4406 |
US10/123,108 Expired - Fee Related US7635478B2 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,261 Abandoned US20030068796A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,262 Abandoned US20030049816A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,157 Abandoned US20030190725A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,212 Expired - Lifetime US7276577B2 (en) | 1997-03-31 | 2002-04-15 | PRO1866 polypeptides |
US10/123,322 Expired - Lifetime US7700736B2 (en) | 2000-05-22 | 2002-04-15 | PRO350 antibodies |
US10/123,156 Abandoned US20030194792A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,155 Abandoned US20030068794A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,771 Abandoned US20030199060A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,291 Abandoned US20030199058A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,322 Granted US20030199059A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,213 Granted US20030199057A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,214 Expired - Fee Related US7343721B2 (en) | 1997-03-31 | 2002-04-15 | PRO4406 polypeptide |
US10/123,235 Abandoned US20030082762A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,292 Granted US20030073211A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,154 Abandoned US20030190724A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,911 Expired - Lifetime US7408032B2 (en) | 1997-03-31 | 2002-04-16 | PRO1188 polypeptides |
US10/123,912 Abandoned US20030100087A1 (en) | 1997-03-31 | 2002-04-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,908 Expired - Lifetime US7335728B2 (en) | 1997-03-31 | 2002-04-16 | PRO1310 polypeptides |
US10/123,902 Abandoned US20030077781A1 (en) | 1997-03-31 | 2002-04-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,907 Expired - Fee Related US7084258B2 (en) | 1997-03-31 | 2002-04-16 | Antibodies against the PRO862 polypeptides |
US10/123,903 Abandoned US20030073212A1 (en) | 1997-03-31 | 2002-04-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,913 Abandoned US20030203462A1 (en) | 1997-03-31 | 2002-04-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,909 Expired - Lifetime US7193049B2 (en) | 1997-03-31 | 2002-04-16 | PRO862 polypeptides |
US10/123,906 Abandoned US20030190726A1 (en) | 1997-03-31 | 2002-04-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,904 Abandoned US20030022328A1 (en) | 1997-03-31 | 2002-04-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,910 Expired - Lifetime US7329404B2 (en) | 1997-03-31 | 2002-04-16 | Antibodies against PRO1310 |
US10/124,821 Abandoned US20030199023A1 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/124,818 Abandoned US20030082763A1 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/124,815 Expired - Lifetime US7342096B2 (en) | 1999-12-09 | 2002-04-17 | PRO1879 polypeptide |
US10/124,814 Expired - Lifetime US7105335B2 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/125,805 Abandoned US20030194794A1 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/124,819 Expired - Lifetime US7285626B2 (en) | 1997-03-31 | 2002-04-17 | PRO1076 polypeptides |
US10/124,822 Expired - Lifetime US7109305B2 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/125,704 Expired - Lifetime US7357926B2 (en) | 1997-03-31 | 2002-04-17 | Antibodies against PRO1879 and the use thereof |
US10/124,816 Abandoned US20030190728A1 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/124,824 Abandoned US20030077659A1 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/124,813 Expired - Lifetime US7312307B2 (en) | 1997-03-31 | 2002-04-17 | PRO1056 polypeptides |
US10/124,823 Abandoned US20030199062A1 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/125,795 Expired - Lifetime US7304131B2 (en) | 1997-03-31 | 2002-04-17 | PRO1483 polypeptides |
US10/124,817 Abandoned US20030077786A1 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/124,820 Abandoned US20030190729A1 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/125,921 Expired - Lifetime US7312313B2 (en) | 1998-08-17 | 2002-04-19 | Anti-PRO1309 antibodies |
US10/125,932 Expired - Fee Related US7317079B2 (en) | 1997-03-31 | 2002-04-19 | PRO812 polypeptides |
US10/125,926 Abandoned US20030082686A1 (en) | 2000-06-05 | 2002-04-19 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/125,931 Abandoned US20030199063A1 (en) | 1997-03-31 | 2002-04-19 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/125,924 Expired - Lifetime US7342097B2 (en) | 1997-03-31 | 2002-04-19 | PRO1309 polypeptides |
US10/125,928 Abandoned US20030087349A1 (en) | 1998-06-19 | 2002-04-19 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/125,927 Abandoned US20030190731A1 (en) | 1997-03-31 | 2002-04-19 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/125,930 Expired - Lifetime US7291700B2 (en) | 2000-06-05 | 2002-04-19 | PRO4985 polypeptide |
US10/125,922 Expired - Lifetime US7309762B2 (en) | 1997-03-31 | 2002-04-19 | PRO1360 polypeptides |
US10/125,923 Abandoned US20030087348A1 (en) | 2000-06-05 | 2002-04-19 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,849 Abandoned US20030082697A1 (en) | 1998-10-20 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,841 Abandoned US20030087361A1 (en) | 1997-03-31 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,835 Abandoned US20030077712A1 (en) | 1998-10-20 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,842 Abandoned US20030082692A1 (en) | 2000-03-03 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,824 Abandoned US20030087352A1 (en) | 1998-08-17 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,827 Abandoned US20030087354A1 (en) | 1998-08-17 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,828 Abandoned US20030087355A1 (en) | 2000-03-03 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,834 Abandoned US20030087359A1 (en) | 1998-09-17 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,852 Abandoned US20030203428A1 (en) | 1999-12-09 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,833 Abandoned US20030087358A1 (en) | 1998-09-01 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,838 Abandoned US20030082691A1 (en) | 1998-11-17 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,850 Abandoned US20030082698A1 (en) | 1998-08-20 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,901 Expired - Fee Related US7342098B2 (en) | 1998-06-17 | 2002-04-22 | PRO1154 polypeptide |
US10/127,837 Abandoned US20030082690A1 (en) | 1998-09-01 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,845 Abandoned US20030082694A1 (en) | 2000-03-03 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,848 Abandoned US20030082696A1 (en) | 1998-11-03 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,821 Abandoned US20030087350A1 (en) | 1998-08-04 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,836 Expired - Lifetime US7432345B2 (en) | 1998-11-17 | 2002-04-22 | PRO1475 polypeptide |
US10/127,825 Abandoned US20030077710A1 (en) | 1998-10-22 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,900 Abandoned US20030203429A1 (en) | 2000-06-05 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,840 Abandoned US20030153033A1 (en) | 1998-09-10 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,830 Expired - Lifetime US7351793B2 (en) | 1998-09-15 | 2002-04-22 | PRO1286 polypeptide |
US10/127,832 Abandoned US20030087357A1 (en) | 1997-03-31 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,822 Expired - Lifetime US7371827B2 (en) | 1998-06-17 | 2002-04-22 | Antibodies against the PRO1126 polypeptide |
US10/127,851 Expired - Fee Related US7348414B2 (en) | 1998-06-17 | 2002-04-22 | Antibodies against the PRO1154 polypeptide |
US10/127,831 Abandoned US20030082689A1 (en) | 1997-03-31 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,844 Expired - Lifetime US7566774B2 (en) | 2000-06-05 | 2002-04-22 | PRO4977 polypeptides |
US10/127,826 Expired - Lifetime US7309763B2 (en) | 1998-06-17 | 2002-04-22 | PRO1126 polypeptide |
US10/127,829 Abandoned US20030077711A1 (en) | 1998-10-22 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,839 Expired - Lifetime US7449554B2 (en) | 2000-06-05 | 2002-04-22 | Antibodies against the PRO4977 polypeptides |
US10/127,843 Abandoned US20030082693A1 (en) | 2000-06-05 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,847 Abandoned US20030119103A1 (en) | 1998-08-20 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,846 Abandoned US20030082695A1 (en) | 2000-03-03 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/128,691 Expired - Lifetime US7319135B2 (en) | 1999-12-09 | 2002-04-23 | PRO1341 polypeptides |
US10/128,684 Abandoned US20030082700A1 (en) | 2000-06-05 | 2002-04-23 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/128,685 Abandoned US20030203430A1 (en) | 1998-08-11 | 2002-04-23 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/128,689 Abandoned US20030087365A1 (en) | 1997-03-31 | 2002-04-23 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/128,688 Expired - Fee Related US7323544B2 (en) | 1999-02-09 | 2002-04-23 | PRO1434 polypeptides |
US10/128,692 Active 2024-06-24 US7704496B2 (en) | 1999-12-09 | 2002-04-23 | Antibodies against PRO1341 polypeptide |
US10/128,686 Expired - Fee Related US7345146B2 (en) | 1998-08-31 | 2002-04-23 | PRO1271 Polypeptides |
US10/128,690 Abandoned US20030082702A1 (en) | 2000-03-02 | 2002-04-23 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/128,694 Expired - Lifetime US7189813B2 (en) | 2000-03-02 | 2002-04-23 | PRO1338 polypeptides |
US10/128,687 Abandoned US20030087363A1 (en) | 1998-09-10 | 2002-04-23 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/128,693 Expired - Lifetime US7355006B2 (en) | 1998-08-31 | 2002-04-23 | Antibodies against the PRO1271 polypeptides |
US10/131,825 Expired - Lifetime US7282566B2 (en) | 1997-03-31 | 2002-04-24 | PRO1779 polypeptide |
US10/131,833 Expired - Fee Related US7141652B1 (en) | 1998-10-07 | 2002-04-24 | Antibodies to PRO1561 polypeptide |
US10/131,836 Expired - Lifetime US7351794B2 (en) | 1999-12-09 | 2002-04-24 | PRO1754 polypeptides |
US10/131,813 Expired - Lifetime US7279551B2 (en) | 1998-10-07 | 2002-04-24 | Pro1556 Polypeptide |
US10/131,829 Abandoned US20030082705A1 (en) | 1999-12-09 | 2002-04-24 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/131,822 Expired - Lifetime US7189806B2 (en) | 1998-08-19 | 2002-04-24 | Pro 1384 polypeptides |
US10/131,821 Abandoned US20030092105A1 (en) | 1999-12-09 | 2002-04-24 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/131,824 Expired - Fee Related US7326413B2 (en) | 1999-02-09 | 2002-04-24 | Antibodies against the PRO1434 polypeptide |
US10/131,823 Expired - Lifetime US7304132B2 (en) | 1997-03-31 | 2002-04-24 | PRO1693 polypeptides |
US10/131,830 Abandoned US20030077720A1 (en) | 1999-12-09 | 2002-04-24 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/131,837 Expired - Lifetime US7294495B2 (en) | 1999-12-09 | 2002-04-24 | PR03580 polypeptides |
US10/131,820 Expired - Lifetime US7312314B2 (en) | 1998-10-28 | 2002-04-24 | Antibody that binds a pro1693 polypeptide |
US10/131,816 Expired - Lifetime US7361337B2 (en) | 1999-12-09 | 2002-04-24 | Antibodies against the PRO1754 polypeptides |
US10/131,819 Expired - Lifetime US7273926B2 (en) | 1999-12-09 | 2002-04-24 | Antibody to PRO1779 polypeptides |
US10/131,826 Expired - Lifetime US7202345B2 (en) | 1998-08-19 | 2002-04-24 | PRO 1384 antibodies |
US10/131,818 Expired - Fee Related US7166703B2 (en) | 1998-10-07 | 2002-04-24 | PRO1561 polypeptides |
US10/131,815 Abandoned US20030092103A1 (en) | 1998-12-22 | 2002-04-24 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/131,828 Expired - Lifetime US7309777B2 (en) | 1998-10-07 | 2002-04-24 | Antibodies against the PRO1556 polypeptide |
US10/131,835 Expired - Lifetime US7294705B2 (en) | 2000-12-01 | 2002-04-24 | Anti-PRO3580 antibodies |
US10/131,817 Expired - Lifetime US7291701B2 (en) | 1997-03-31 | 2002-04-24 | PRO1777 polypeptides |
US10/137,867 Abandoned US20030207349A1 (en) | 1997-03-31 | 2002-05-03 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/137,871 Expired - Lifetime US7323545B2 (en) | 1999-12-09 | 2002-05-03 | PRO1885 polypeptides |
US10/137,872 Abandoned US20030077722A1 (en) | 2000-03-03 | 2002-05-03 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/137,873 Abandoned US20060084138A1 (en) | 2000-03-03 | 2002-05-03 | The pro4979 polypeptide |
US10/137,864 Expired - Lifetime US7291715B2 (en) | 2000-03-03 | 2002-05-03 | Antibodies to the PRO4329 polypeptide |
US10/137,866 Abandoned US20030129689A1 (en) | 2000-03-01 | 2002-05-03 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/137,865 Abandoned US20030032155A1 (en) | 1997-03-31 | 2002-05-03 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/137,869 Expired - Lifetime US7282558B2 (en) | 2000-03-03 | 2002-05-03 | PRO4329 polypeptide |
US10/137,870 Abandoned US20030138883A1 (en) | 2000-03-01 | 2002-05-03 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/137,868 Abandoned US20030082764A1 (en) | 1997-03-31 | 2002-05-03 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,021 Expired - Lifetime US7279552B2 (en) | 1999-12-09 | 2002-05-06 | Pro1782 polypeptides |
US10/140,023 Abandoned US20030207416A1 (en) | 1997-03-31 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,473 Abandoned US20030207351A1 (en) | 2000-12-01 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,472 Abandoned US20030138888A1 (en) | 1999-12-09 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/139,980 Expired - Lifetime US7247710B2 (en) | 1997-03-31 | 2002-05-06 | PRO4395 antibodies |
US10/140,022 Expired - Lifetime US7285627B2 (en) | 2000-06-05 | 2002-05-06 | PRO4989 polypeptides |
US10/139,963 Expired - Lifetime US7288625B2 (en) | 1997-03-31 | 2002-05-06 | PRO4395 polypeptides |
US10/140,020 Abandoned US20030207415A1 (en) | 1997-03-31 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,024 Abandoned US20040058424A1 (en) | 1997-03-31 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,470 Granted US20030022331A1 (en) | 1997-03-31 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,470 Expired - Lifetime US7521539B2 (en) | 2000-12-01 | 2002-05-06 | Anti-PRO4989 antibodies |
US10/140,471 Expired - Lifetime US7291702B2 (en) | 1999-12-09 | 2002-05-06 | PRO4326 polypeptides |
US10/140,474 Abandoned US20030032156A1 (en) | 1997-03-31 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,019 Abandoned US20030148423A1 (en) | 1999-12-09 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,018 Abandoned US20030138885A1 (en) | 2000-03-03 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,274 Abandoned US20030143674A1 (en) | 2000-03-03 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,921 Expired - Fee Related US7317080B2 (en) | 1997-03-31 | 2002-05-07 | PRO4303 polypeptides |
US10/140,927 Expired - Lifetime US7495082B2 (en) | 2000-03-03 | 2002-05-07 | Antibodies to PRO4349 polypeptides |
US10/140,810 Abandoned US20030207353A1 (en) | 2000-03-03 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,928 Abandoned US20030068798A1 (en) | 1997-03-31 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,809 Abandoned US20030207418A1 (en) | 1997-03-31 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,862 Expired - Lifetime US7285628B2 (en) | 1999-12-09 | 2002-05-07 | PRO1867 polypeptides |
US10/140,925 Abandoned US20030073215A1 (en) | 1997-03-31 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,863 Expired - Lifetime US7288626B2 (en) | 2000-03-03 | 2002-05-07 | PRO4403 polypeptides |
US10/140,860 Expired - Lifetime US7307151B2 (en) | 1997-03-31 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,807 Expired - Lifetime US7335745B2 (en) | 2000-03-03 | 2002-05-07 | Antibodies against the PRO4403 polypeptides |
US10/140,808 Expired - Lifetime US7425621B2 (en) | 1997-03-31 | 2002-05-07 | Antibodies against the PRO4401 polypeptide |
US10/140,865 Abandoned US20030207420A1 (en) | 1997-03-31 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,805 Abandoned US20030207417A1 (en) | 1997-03-31 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,861 Abandoned US20030148425A1 (en) | 2000-03-03 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,923 Expired - Lifetime US7282559B2 (en) | 2000-03-03 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,922 Expired - Lifetime US7309765B2 (en) | 2000-03-03 | 2002-05-07 | PRO4349 polypeptides |
US10/140,926 Abandoned US20030134356A1 (en) | 2000-03-03 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,924 Abandoned US20030134355A1 (en) | 2000-03-03 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,864 Abandoned US20030207419A1 (en) | 1997-03-31 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,806 Expired - Lifetime US7309764B2 (en) | 2000-03-03 | 2002-05-07 | PRO4401 polypeptide |
US10/141,700 Expired - Lifetime US7312308B2 (en) | 2000-03-03 | 2002-05-08 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/141,760 Expired - Fee Related US7342104B2 (en) | 1997-03-31 | 2002-05-08 | Antibodies against the PRO4320 polypeptide |
US10/141,698 Expired - Lifetime US7282560B2 (en) | 2000-03-03 | 2002-05-08 | PRO 4326 polypeptides |
US10/141,701 Abandoned US20030207421A1 (en) | 1997-03-31 | 2002-05-08 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/141,702 Expired - Lifetime US7294692B2 (en) | 2000-06-05 | 2002-05-08 | Pro6014 polypeptides |
US10/141,697 Expired - Lifetime US7417123B2 (en) | 2000-03-03 | 2002-05-08 | PRO4399 Antibodies |
US10/141,759 Expired - Lifetime US7291716B2 (en) | 2000-03-03 | 2002-05-08 | PRO4400 antibodies |
US10/141,762 Abandoned US20030207362A1 (en) | 2000-03-03 | 2002-05-08 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/141,755 Expired - Lifetime US7297764B2 (en) | 1997-03-31 | 2002-05-08 | PRO4318 polypeptides |
US10/141,704 Expired - Lifetime US7396916B2 (en) | 2000-06-05 | 2002-05-08 | Antibody to a polypeptide overexpressed in tumors |
US10/141,756 Expired - Lifetime US7488586B2 (en) | 1997-03-31 | 2002-05-08 | PRO4409 polypeptides |
US10/141,703 Abandoned US20030207357A1 (en) | 1999-03-10 | 2002-05-08 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/141,699 Expired - Lifetime US7390887B2 (en) | 2000-03-03 | 2002-05-08 | Antibodies against PRO4330 |
US10/141,705 Expired - Lifetime US7396906B2 (en) | 2000-03-03 | 2002-05-08 | Pro4399 Polypeptides |
US10/141,753 Expired - Lifetime US7323550B2 (en) | 2000-03-03 | 2002-05-08 | Anti-PRO4318 antibodies |
US10/141,761 Expired - Fee Related US7335729B2 (en) | 2000-03-03 | 2002-05-08 | PRO4320 polypeptide |
US10/141,706 Expired - Lifetime US7425609B2 (en) | 2000-03-03 | 2002-05-08 | PRO4330 polypeptides |
US10/141,757 Expired - Fee Related US7314920B2 (en) | 2000-03-03 | 2002-05-08 | Antibodies against the PRO4340 polypeptide |
US10/141,754 Expired - Lifetime US7361732B2 (en) | 1997-03-31 | 2002-05-08 | PRO4400 polypeptides |
US10/141,758 Expired - Lifetime US7301007B2 (en) | 2000-03-03 | 2002-05-08 | PRO4340 polypeptides |
US10/142,761 Expired - Lifetime US7306795B2 (en) | 2000-06-05 | 2002-05-09 | PRO5774 antibodies |
US10/142,420 Abandoned US20030148434A1 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/143,035 Expired - Fee Related US7317081B2 (en) | 2000-03-03 | 2002-05-09 | PRO4371 polypeptides |
US10/143,027 Abandoned US20030207366A1 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/143,117 Expired - Lifetime US7318922B2 (en) | 2000-06-05 | 2002-05-09 | Anti-PRO5337 antibodies |
US10/142,421 Expired - Lifetime US7311909B2 (en) | 2000-03-03 | 2002-05-09 | PRO4348 antibodies |
US10/142,427 Expired - Lifetime US7294702B2 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,426 Abandoned US20040048333A1 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,428 Abandoned US20030207363A1 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,422 Expired - Lifetime US7385030B2 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,888 Abandoned US20030157606A1 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/143,115 Expired - Lifetime US7309767B2 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,887 Expired - Lifetime US7291717B2 (en) | 1999-12-09 | 2002-05-09 | PRO3446 antibodies |
US10/142,425 Abandoned US20030207424A1 (en) | 1997-03-31 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,762 Expired - Lifetime US7288627B2 (en) | 2000-03-03 | 2002-05-09 | PRO4322 polypeptides |
US10/142,889 Abandoned US20030194765A1 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/143,118 Expired - Lifetime US7309768B2 (en) | 2000-03-03 | 2002-05-09 | PRO4347 polypeptides |
US10/142,430 Expired - Lifetime US7309766B2 (en) | 1997-03-31 | 2002-05-09 | PRO5774 polypeptides |
US10/142,432 Expired - Lifetime US7390877B2 (en) | 2000-03-03 | 2002-05-09 | PRO4381 polypeptides |
US10/143,113 Expired - Lifetime US7329730B2 (en) | 1997-03-31 | 2002-05-09 | PRO4348 polypeptides |
US10/143,034 Expired - Lifetime US7378502B2 (en) | 2000-03-03 | 2002-05-09 | PRO4389 antibodies |
US10/142,417 Expired - Lifetime US7304133B2 (en) | 1997-03-31 | 2002-05-09 | PRO4389 polypeptides |
US10/143,114 Abandoned US20030036180A1 (en) | 1997-03-31 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/143,116 Expired - Lifetime US7390486B2 (en) | 2000-03-03 | 2002-05-09 | PRO4381 antibodies |
US10/142,886 Abandoned US20030203432A1 (en) | 2000-06-05 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,760 Abandoned US20030148437A1 (en) | 2000-06-05 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,885 Expired - Lifetime US7718173B2 (en) | 2000-06-05 | 2002-05-10 | Anti-pro6094 antibodies |
US10/142,763 Expired - Lifetime US7189807B2 (en) | 2000-06-05 | 2002-05-10 | PRO4994 polypeptides |
US10/142,766 Expired - Lifetime US7390883B2 (en) | 2000-03-03 | 2002-05-10 | PRO4428 antibodies |
US10/143,032 Expired - Lifetime US7408033B2 (en) | 1997-03-31 | 2002-05-10 | PRO5995 polypeptides |
US10/142,424 Expired - Lifetime US7297766B2 (en) | 2000-06-05 | 2002-05-10 | PRO5337 polypeptides |
US10/142,423 Abandoned US20030049817A1 (en) | 1997-03-31 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,884 Abandoned US20030207365A1 (en) | 2000-06-05 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,419 Expired - Lifetime US7153941B2 (en) | 1997-03-31 | 2002-05-10 | Antibodies that bind PRO4994 polypeptides |
US10/142,418 Expired - Lifetime US7297765B2 (en) | 2000-06-05 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,764 Abandoned US20030180865A1 (en) | 2000-06-05 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,429 Abandoned US20030207364A1 (en) | 2000-06-05 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,765 Abandoned US20030157603A1 (en) | 2000-06-05 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,767 Expired - Lifetime US7294693B2 (en) | 2000-03-03 | 2002-05-10 | Pro4428 Polypeptides |
US10/142,431 Expired - Lifetime US7285629B2 (en) | 1997-03-31 | 2002-05-10 | Pro5005 polypeptides |
US10/143,033 Abandoned US20030134363A1 (en) | 2000-06-05 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/144,957 Abandoned US20030157610A1 (en) | 2000-06-05 | 2002-05-13 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/144,993 Abandoned US20040038336A1 (en) | 2000-03-03 | 2002-05-13 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/144,958 Expired - Lifetime US7479545B2 (en) | 2000-06-05 | 2002-05-13 | PRO6001 antibodies |
US10/144,956 Abandoned US20030207368A1 (en) | 2000-03-03 | 2002-05-13 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,127 Expired - Lifetime US7355007B2 (en) | 2000-06-05 | 2002-05-13 | Antibodies that bind PRO5005 Polypeptides |
US10/144,992 Abandoned US20030157611A1 (en) | 2000-06-05 | 2002-05-13 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,090 Abandoned US20030157613A1 (en) | 2000-03-03 | 2002-05-13 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,091 Abandoned US20030157614A1 (en) | 2000-06-05 | 2002-05-13 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,015 Expired - Lifetime US7439325B2 (en) | 2000-06-05 | 2002-05-13 | PRO6001 polypeptides |
US10/144,994 Abandoned US20030134364A1 (en) | 2000-03-03 | 2002-05-13 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,823 Abandoned US20030134368A1 (en) | 2000-03-03 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,824 Expired - Lifetime US7411047B2 (en) | 2000-06-05 | 2002-05-14 | PRO6097 antibodies |
US10/145,749 Abandoned US20030207371A1 (en) | 2000-05-22 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,632 Expired - Lifetime US7385031B2 (en) | 2000-06-05 | 2002-05-14 | PRO6097 polypeptides |
US10/145,820 Abandoned US20030157623A1 (en) | 2000-06-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,874 Abandoned US20030194766A1 (en) | 2000-06-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,870 Expired - Lifetime US7294703B2 (en) | 2000-06-05 | 2002-05-14 | PRO6093 Antibodies |
US10/145,878 Expired - Lifetime US7317088B2 (en) | 2000-06-05 | 2002-05-14 | PRO5993 polypeptides |
US10/145,871 Expired - Lifetime US7396907B2 (en) | 2000-06-05 | 2002-05-14 | Antibodies that bind PRO6182 polypeptides |
US10/145,827 Expired - Lifetime US7304140B2 (en) | 2000-03-03 | 2002-05-14 | PRO4503 polypeptides |
US10/145,825 Expired - Lifetime US7335740B2 (en) | 2000-06-05 | 2002-05-14 | Antibodies against the PRO7434 polypeptides |
US10/145,869 Abandoned US20030166078A1 (en) | 1999-10-08 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,872 Abandoned US20030157624A1 (en) | 1999-10-08 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,826 Expired - Lifetime US7375195B2 (en) | 2000-06-05 | 2002-05-14 | Anti-PRO7171 polypeptides |
US10/145,634 Abandoned US20030170788A1 (en) | 2000-09-15 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,821 Abandoned US20030148438A1 (en) | 2000-09-15 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,626 Expired - Lifetime US7429640B2 (en) | 2000-06-05 | 2002-05-14 | PRO6181 polypeptides |
US10/145,818 Abandoned US20030157622A1 (en) | 2000-06-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,625 Abandoned US20030180868A1 (en) | 2000-03-03 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,631 Expired - Lifetime US7371824B2 (en) | 2000-06-05 | 2002-05-14 | PRO6093 polypeptides |
US10/145,877 Expired - Lifetime US7411040B2 (en) | 2000-06-05 | 2002-05-14 | PRO6182 polypeptides |
US10/145,628 Expired - Lifetime US7285636B2 (en) | 2000-06-05 | 2002-05-14 | PRO6095 polypeptides |
US10/145,746 Abandoned US20030134366A1 (en) | 2000-06-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,748 Expired - Lifetime US7354998B2 (en) | 2000-06-05 | 2002-05-14 | PRO7171 polypeptides |
US10/145,754 Abandoned US20030157620A1 (en) | 2000-06-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,629 Expired - Lifetime US7285644B2 (en) | 2000-06-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,822 Abandoned US20030166075A1 (en) | 2000-12-01 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,750 Expired - Lifetime US7417115B2 (en) | 2000-06-05 | 2002-05-14 | PRO6027 polypeptides |
US10/145,752 Expired - Lifetime US7319136B2 (en) | 2000-06-05 | 2002-05-14 | PRO7434 polypeptides |
US10/145,751 Abandoned US20030166074A1 (en) | 2000-05-22 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,747 Abandoned US20030157618A1 (en) | 1999-03-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,755 Expired - Lifetime US7312312B2 (en) | 2000-03-03 | 2002-05-14 | PRO6242 polypeptides |
US10/145,960 Expired - Lifetime US7317074B2 (en) | 2000-03-03 | 2002-05-14 | Pro4976 polypeptides |
US10/145,961 Abandoned US20040235092A1 (en) | 1999-12-09 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,958 Expired - Lifetime US7408042B2 (en) | 2000-06-05 | 2002-05-14 | Anti-PRO6181 antibodies |
US10/145,959 Expired - Lifetime US7390878B2 (en) | 2000-06-05 | 2002-05-14 | PRO6090 polypeptides |
US10/145,962 Expired - Lifetime US7335746B2 (en) | 2000-03-03 | 2002-05-14 | Anti-pro4976 antibodies |
US10/145,633 Abandoned US20030138892A1 (en) | 2000-06-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,630 Expired - Lifetime US7309778B2 (en) | 2000-06-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,792 Abandoned US20030207428A1 (en) | 1997-03-31 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,790 Abandoned US20030166083A1 (en) | 1998-04-09 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,730 Abandoned US20030207427A1 (en) | 1997-03-31 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,729 Abandoned US20030082708A1 (en) | 2000-06-05 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,791 Abandoned US20030082709A1 (en) | 1998-08-17 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,793 Abandoned US20030166084A1 (en) | 2000-09-15 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,788 Abandoned US20030129693A1 (en) | 1998-06-23 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,787 Abandoned US20030166082A1 (en) | 2000-05-22 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,725 Abandoned US20030134374A1 (en) | 1999-12-09 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,731 Abandoned US20030129692A1 (en) | 1998-05-07 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,726 Abandoned US20030129690A1 (en) | 2000-06-05 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,795 Abandoned US20030134375A1 (en) | 2000-12-01 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,724 Abandoned US20030134373A1 (en) | 2000-06-05 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,728 Abandoned US20030203437A1 (en) | 1998-07-01 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,508 Abandoned US20030082711A1 (en) | 1998-07-02 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,512 Expired - Fee Related US7087428B2 (en) | 1998-05-15 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,524 Abandoned US20030166093A1 (en) | 1999-12-09 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,509 Abandoned US20030134380A1 (en) | 1998-05-13 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,518 Abandoned US20040214269A1 (en) | 1998-07-07 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,523 Abandoned US20030092113A1 (en) | 1999-12-09 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,517 Abandoned US20030077726A1 (en) | 1998-06-24 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,484 Abandoned US20030082710A1 (en) | 1999-12-09 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,497 Abandoned US20030194767A1 (en) | 1998-08-26 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,529 Abandoned US20030134383A1 (en) | 1999-12-09 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,520 Abandoned US20030170789A1 (en) | 1998-08-17 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,528 Abandoned US20030219885A1 (en) | 1997-03-31 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,502 Abandoned US20030077724A1 (en) | 2000-06-05 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,503 Abandoned US20030157628A1 (en) | 1998-06-24 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,500 Abandoned US20030077723A1 (en) | 1998-08-12 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,531 Abandoned US20040253667A1 (en) | 2000-06-05 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,481 Abandoned US20030157626A1 (en) | 1998-09-17 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,506 Abandoned US20030134379A1 (en) | 2000-12-01 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,535 Abandoned US20030207378A1 (en) | 2000-06-05 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,499 Abandoned US20030203439A1 (en) | 1998-08-04 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,486 Abandoned US20030166087A1 (en) | 2000-03-02 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,492 Abandoned US20030082765A1 (en) | 1997-03-31 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,515 Abandoned US20030077725A1 (en) | 2000-06-05 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,507 Abandoned US20030207377A1 (en) | 2000-06-05 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,510 Abandoned US20030134381A1 (en) | 2000-03-03 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,495 Abandoned US20030134376A1 (en) | 1999-12-09 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,480 Abandoned US20030166085A1 (en) | 1999-12-09 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,526 Abandoned US20030077727A1 (en) | 2000-05-30 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,485 Expired - Fee Related US7098003B2 (en) | 1998-08-19 | 2002-05-17 | PRO 1384 nucleic acids |
US10/147,522 Abandoned US20030157629A1 (en) | 1998-09-15 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,482 Abandoned US20030157627A1 (en) | 1998-08-31 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,537 Abandoned US20030207379A1 (en) | 1998-09-10 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,527 Abandoned US20030077728A1 (en) | 2000-03-03 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,494 Abandoned US20030166090A1 (en) | 1998-10-07 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,511 Abandoned US20030134382A1 (en) | 1999-07-26 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,490 Abandoned US20030166089A1 (en) | 1998-11-17 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,519 Abandoned US20030077791A1 (en) | 1997-03-31 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,488 Abandoned US20040253666A1 (en) | 1998-09-01 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,505 Abandoned US20030180875A1 (en) | 1998-06-19 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,514 Abandoned US20030166092A1 (en) | 1999-12-09 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,496 Abandoned US20030180874A1 (en) | 1998-09-09 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,501 Abandoned US20030134377A1 (en) | 1999-12-09 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,487 Abandoned US20030166088A1 (en) | 2000-06-05 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,483 Abandoned US20030180873A1 (en) | 1998-08-11 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,504 Abandoned US20030134378A1 (en) | 2000-12-01 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,491 Abandoned US20030175865A1 (en) | 1998-10-20 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,489 Abandoned US20030207376A1 (en) | 1998-10-28 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,498 Abandoned US20030166091A1 (en) | 1999-02-09 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,516 Abandoned US20030180876A1 (en) | 1998-08-20 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,493 Abandoned US20040029217A1 (en) | 1998-06-17 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,513 Expired - Fee Related US7220568B2 (en) | 1998-10-07 | 2002-05-17 | Nucleic acids encoding the PRO1561 polypeptide |
US10/147,536 Abandoned US20040077064A1 (en) | 1997-03-31 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,401 Abandoned US20030157630A1 (en) | 2000-03-03 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,405 Abandoned US20030211571A1 (en) | 2000-03-03 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,400 Abandoned US20030207383A1 (en) | 2000-06-05 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,373 Abandoned US20030186367A1 (en) | 1998-12-22 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,393 Abandoned US20030199026A1 (en) | 2000-03-03 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,406 Abandoned US20030166096A1 (en) | 1999-12-09 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,396 Abandoned US20030199027A1 (en) | 2000-03-01 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,397 Abandoned US20030134384A1 (en) | 2000-03-01 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,531 Abandoned US20030148439A1 (en) | 2000-03-03 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,384 Abandoned US20030175869A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,390 Abandoned US20030175872A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,398 Expired - Fee Related US7074910B2 (en) | 2000-03-03 | 2002-05-21 | PRO4340 nucleic acids |
US10/152,381 Abandoned US20030207382A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,372 Abandoned US20040126839A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,378 Abandoned US20030175866A1 (en) | 2000-06-05 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,376 Abandoned US20030207381A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,389 Abandoned US20030175871A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,395 Expired - Lifetime US7189534B2 (en) | 1997-03-31 | 2002-05-21 | PRO4320 polynucleotide |
US10/152,380 Abandoned US20030129694A1 (en) | 1999-12-09 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,370 Abandoned US20060084139A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,403 Abandoned US20030175874A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,379 Abandoned US20030166094A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,387 Abandoned US20030175870A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,371 Abandoned US20030194768A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,394 Abandoned US20030166095A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,375 Expired - Lifetime US7160993B2 (en) | 2000-03-03 | 2002-05-21 | Nucleic acids encoding PRO4400 polypeptides |
US10/152,399 Abandoned US20030194774A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,374 Abandoned US20030194769A1 (en) | 1999-12-09 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,383 Abandoned US20030175868A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,392 Abandoned US20030175873A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,377 Abandoned US20030194771A1 (en) | 1999-12-09 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,391 Abandoned US20030194773A1 (en) | 1999-12-09 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,382 Abandoned US20030175867A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,386 Abandoned US20030194772A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,385 Abandoned US20030199025A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/153,756 Abandoned US20030175875A1 (en) | 2000-03-03 | 2002-05-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/153,585 Abandoned US20030207384A1 (en) | 2000-03-03 | 2002-05-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/153,552 Abandoned US20030199028A1 (en) | 2000-03-03 | 2002-05-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/153,840 Abandoned US20030199029A1 (en) | 2000-03-03 | 2002-05-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/153,934 Abandoned US20030129695A1 (en) | 1997-03-31 | 2002-05-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/153,586 Abandoned US20030134385A1 (en) | 1999-12-09 | 2002-05-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/156,845 Abandoned US20030199033A1 (en) | 2000-06-05 | 2002-05-28 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/156,847 Abandoned US20030166098A1 (en) | 2000-03-03 | 2002-05-28 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/156,844 Abandoned US20030199032A1 (en) | 2000-03-03 | 2002-05-28 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/156,848 Abandoned US20030194775A1 (en) | 2000-03-03 | 2002-05-28 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/156,841 Abandoned US20030199030A1 (en) | 2000-03-03 | 2002-05-28 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/156,842 Abandoned US20030199031A1 (en) | 2000-06-05 | 2002-05-28 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,794 Abandoned US20030194777A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,801 Abandoned US20030207387A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,491 Abandoned US20030175880A1 (en) | 2000-03-03 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,802 Abandoned US20030207388A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,800 Abandoned US20030207386A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,797 Abandoned US20030175879A1 (en) | 2000-03-03 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,786 Abandoned US20030208055A1 (en) | 1997-03-31 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,784 Abandoned US20030175878A1 (en) | 2000-03-03 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,781 Abandoned US20030170790A1 (en) | 2000-03-03 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,782 Abandoned US20030077792A1 (en) | 1997-03-31 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,462 Abandoned US20030158104A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,785 Abandoned US20030194776A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,780 Abandoned US20030207385A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,799 Abandoned US20030166101A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,779 Abandoned US20030175877A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,798 Abandoned US20030203440A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,783 Abandoned US20030157631A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,778 Abandoned US20030166100A1 (en) | 2000-03-03 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,796 Abandoned US20030194778A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,785 Abandoned US20030092115A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,788 Abandoned US20050074837A1 (en) | 2000-09-15 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/160,498 Abandoned US20030073216A1 (en) | 1997-03-31 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,784 Abandoned US20030207389A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,792 Abandoned US20030157632A1 (en) | 1999-10-08 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,790 Abandoned US20030180879A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,787 Abandoned US20040039164A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/160,500 Abandoned US20030194779A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,791 Abandoned US20030207429A1 (en) | 1997-03-31 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,783 Abandoned US20030138893A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/160,504 Abandoned US20030166102A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/160,503 Abandoned US20040033559A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,782 Abandoned US20030082766A1 (en) | 1997-03-31 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,789 Abandoned US20030207390A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,786 Abandoned US20030134791A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/230,417 Expired - Lifetime US7297768B2 (en) | 1999-12-09 | 2002-08-28 | PRO3574 polypeptide |
US10/931,886 Abandoned US20050019823A1 (en) | 2000-12-01 | 2004-08-31 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/955,952 Abandoned US20050153396A1 (en) | 1998-09-16 | 2004-09-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/964,241 Abandoned US20070026487A1 (en) | 1997-11-24 | 2004-10-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/973,115 Abandoned US20060040351A1 (en) | 1999-03-05 | 2004-10-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/020,604 Abandoned US20050153348A1 (en) | 2000-05-22 | 2004-12-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/036,869 Abandoned US20050170396A1 (en) | 2000-12-01 | 2005-01-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/040,809 Abandoned US20050118635A1 (en) | 1998-04-09 | 2005-01-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/056,802 Abandoned US20050136515A1 (en) | 2000-12-01 | 2005-02-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/057,268 Abandoned US20060084144A1 (en) | 1997-09-17 | 2005-02-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/057,966 Abandoned US20050187379A1 (en) | 1997-09-17 | 2005-02-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/060,240 Abandoned US20050164279A1 (en) | 2000-03-03 | 2005-02-16 | Secreted and transmembrane polypetides and nucleic acids encoding the same |
US11/060,652 Abandoned US20050136475A1 (en) | 1998-10-22 | 2005-02-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/110,520 Abandoned US20050202496A1 (en) | 2000-06-05 | 2005-04-19 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/117,757 Abandoned US20050214846A1 (en) | 2000-09-15 | 2005-04-27 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/290,153 Expired - Fee Related US7524497B2 (en) | 1998-07-01 | 2005-11-30 | Antibodies to PRO 1120 polypeptide |
US11/341,175 Expired - Fee Related US7468427B2 (en) | 1997-03-31 | 2006-01-27 | Antibodies to PRO1275 polypeptide |
US11/537,235 Expired - Fee Related US7504484B2 (en) | 1998-10-07 | 2006-09-29 | Antibodies to the PRO1561 polypeptide |
US11/538,714 Expired - Fee Related US8106156B2 (en) | 1998-07-01 | 2006-10-04 | PRO1120 polypeptides |
US11/553,810 Abandoned US20070264686A1 (en) | 2000-06-05 | 2006-10-27 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/929,190 Abandoned US20080050758A1 (en) | 1998-09-09 | 2007-10-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US12/364,329 Abandoned US20090142786A1 (en) | 1998-10-07 | 2009-02-02 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
Family Applications Before (442)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US09/990,456 Abandoned US20020137890A1 (en) | 1997-03-31 | 2001-11-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,059 Abandoned US20030190721A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,041 Abandoned US20030077776A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,040 Abandoned US20030082759A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,045 Abandoned US20030073210A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,051 Abandoned US20030092147A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,046 Abandoned US20030194791A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,047 Abandoned US20030077778A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,042 Abandoned US20030096386A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,044 Abandoned US20030190717A1 (en) | 1997-03-31 | 2002-04-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,048 Abandoned US20030199051A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,043 Expired - Lifetime US7220831B2 (en) | 1997-03-31 | 2002-04-12 | PRO235 polypeptides |
US10/121,057 Abandoned US20030190719A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,054 Abandoned US20030199054A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,053 Abandoned US20030199053A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,055 Abandoned US20030190718A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,062 Abandoned US20030077779A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,063 Abandoned US20030199055A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,061 Abandoned US20030082761A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,058 Abandoned US20030190720A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,056 Abandoned US20030082760A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,060 Abandoned US20030190722A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,052 Abandoned US20030199052A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/121,050 Abandoned US20030054516A1 (en) | 1997-03-31 | 2002-04-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,109 Abandoned US20030190723A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,236 Abandoned US20030068795A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,215 Expired - Lifetime US7291329B2 (en) | 1997-03-31 | 2002-04-15 | Antibodies against PRO4406 |
US10/123,108 Expired - Fee Related US7635478B2 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,261 Abandoned US20030068796A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,262 Abandoned US20030049816A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,157 Abandoned US20030190725A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,212 Expired - Lifetime US7276577B2 (en) | 1997-03-31 | 2002-04-15 | PRO1866 polypeptides |
US10/123,322 Expired - Lifetime US7700736B2 (en) | 2000-05-22 | 2002-04-15 | PRO350 antibodies |
US10/123,156 Abandoned US20030194792A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,155 Abandoned US20030068794A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,771 Abandoned US20030199060A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,291 Abandoned US20030199058A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,322 Granted US20030199059A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,213 Granted US20030199057A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,214 Expired - Fee Related US7343721B2 (en) | 1997-03-31 | 2002-04-15 | PRO4406 polypeptide |
US10/123,235 Abandoned US20030082762A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,292 Granted US20030073211A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,154 Abandoned US20030190724A1 (en) | 1997-03-31 | 2002-04-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,911 Expired - Lifetime US7408032B2 (en) | 1997-03-31 | 2002-04-16 | PRO1188 polypeptides |
US10/123,912 Abandoned US20030100087A1 (en) | 1997-03-31 | 2002-04-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,908 Expired - Lifetime US7335728B2 (en) | 1997-03-31 | 2002-04-16 | PRO1310 polypeptides |
US10/123,902 Abandoned US20030077781A1 (en) | 1997-03-31 | 2002-04-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,907 Expired - Fee Related US7084258B2 (en) | 1997-03-31 | 2002-04-16 | Antibodies against the PRO862 polypeptides |
US10/123,903 Abandoned US20030073212A1 (en) | 1997-03-31 | 2002-04-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,913 Abandoned US20030203462A1 (en) | 1997-03-31 | 2002-04-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,909 Expired - Lifetime US7193049B2 (en) | 1997-03-31 | 2002-04-16 | PRO862 polypeptides |
US10/123,906 Abandoned US20030190726A1 (en) | 1997-03-31 | 2002-04-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,904 Abandoned US20030022328A1 (en) | 1997-03-31 | 2002-04-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/123,910 Expired - Lifetime US7329404B2 (en) | 1997-03-31 | 2002-04-16 | Antibodies against PRO1310 |
US10/124,821 Abandoned US20030199023A1 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/124,818 Abandoned US20030082763A1 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/124,815 Expired - Lifetime US7342096B2 (en) | 1999-12-09 | 2002-04-17 | PRO1879 polypeptide |
US10/124,814 Expired - Lifetime US7105335B2 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/125,805 Abandoned US20030194794A1 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/124,819 Expired - Lifetime US7285626B2 (en) | 1997-03-31 | 2002-04-17 | PRO1076 polypeptides |
US10/124,822 Expired - Lifetime US7109305B2 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/125,704 Expired - Lifetime US7357926B2 (en) | 1997-03-31 | 2002-04-17 | Antibodies against PRO1879 and the use thereof |
US10/124,816 Abandoned US20030190728A1 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/124,824 Abandoned US20030077659A1 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/124,813 Expired - Lifetime US7312307B2 (en) | 1997-03-31 | 2002-04-17 | PRO1056 polypeptides |
US10/124,823 Abandoned US20030199062A1 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/125,795 Expired - Lifetime US7304131B2 (en) | 1997-03-31 | 2002-04-17 | PRO1483 polypeptides |
US10/124,817 Abandoned US20030077786A1 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/124,820 Abandoned US20030190729A1 (en) | 1997-03-31 | 2002-04-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/125,921 Expired - Lifetime US7312313B2 (en) | 1998-08-17 | 2002-04-19 | Anti-PRO1309 antibodies |
US10/125,932 Expired - Fee Related US7317079B2 (en) | 1997-03-31 | 2002-04-19 | PRO812 polypeptides |
US10/125,926 Abandoned US20030082686A1 (en) | 2000-06-05 | 2002-04-19 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/125,931 Abandoned US20030199063A1 (en) | 1997-03-31 | 2002-04-19 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/125,924 Expired - Lifetime US7342097B2 (en) | 1997-03-31 | 2002-04-19 | PRO1309 polypeptides |
US10/125,928 Abandoned US20030087349A1 (en) | 1998-06-19 | 2002-04-19 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/125,927 Abandoned US20030190731A1 (en) | 1997-03-31 | 2002-04-19 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/125,930 Expired - Lifetime US7291700B2 (en) | 2000-06-05 | 2002-04-19 | PRO4985 polypeptide |
US10/125,922 Expired - Lifetime US7309762B2 (en) | 1997-03-31 | 2002-04-19 | PRO1360 polypeptides |
US10/125,923 Abandoned US20030087348A1 (en) | 2000-06-05 | 2002-04-19 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,849 Abandoned US20030082697A1 (en) | 1998-10-20 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,841 Abandoned US20030087361A1 (en) | 1997-03-31 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,835 Abandoned US20030077712A1 (en) | 1998-10-20 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,842 Abandoned US20030082692A1 (en) | 2000-03-03 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,824 Abandoned US20030087352A1 (en) | 1998-08-17 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,827 Abandoned US20030087354A1 (en) | 1998-08-17 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,828 Abandoned US20030087355A1 (en) | 2000-03-03 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,834 Abandoned US20030087359A1 (en) | 1998-09-17 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,852 Abandoned US20030203428A1 (en) | 1999-12-09 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,833 Abandoned US20030087358A1 (en) | 1998-09-01 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,838 Abandoned US20030082691A1 (en) | 1998-11-17 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,850 Abandoned US20030082698A1 (en) | 1998-08-20 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,901 Expired - Fee Related US7342098B2 (en) | 1998-06-17 | 2002-04-22 | PRO1154 polypeptide |
US10/127,837 Abandoned US20030082690A1 (en) | 1998-09-01 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,845 Abandoned US20030082694A1 (en) | 2000-03-03 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,848 Abandoned US20030082696A1 (en) | 1998-11-03 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,821 Abandoned US20030087350A1 (en) | 1998-08-04 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,836 Expired - Lifetime US7432345B2 (en) | 1998-11-17 | 2002-04-22 | PRO1475 polypeptide |
US10/127,825 Abandoned US20030077710A1 (en) | 1998-10-22 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,900 Abandoned US20030203429A1 (en) | 2000-06-05 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,840 Abandoned US20030153033A1 (en) | 1998-09-10 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,830 Expired - Lifetime US7351793B2 (en) | 1998-09-15 | 2002-04-22 | PRO1286 polypeptide |
US10/127,832 Abandoned US20030087357A1 (en) | 1997-03-31 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,822 Expired - Lifetime US7371827B2 (en) | 1998-06-17 | 2002-04-22 | Antibodies against the PRO1126 polypeptide |
US10/127,851 Expired - Fee Related US7348414B2 (en) | 1998-06-17 | 2002-04-22 | Antibodies against the PRO1154 polypeptide |
US10/127,831 Abandoned US20030082689A1 (en) | 1997-03-31 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,844 Expired - Lifetime US7566774B2 (en) | 2000-06-05 | 2002-04-22 | PRO4977 polypeptides |
US10/127,826 Expired - Lifetime US7309763B2 (en) | 1998-06-17 | 2002-04-22 | PRO1126 polypeptide |
US10/127,829 Abandoned US20030077711A1 (en) | 1998-10-22 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,839 Expired - Lifetime US7449554B2 (en) | 2000-06-05 | 2002-04-22 | Antibodies against the PRO4977 polypeptides |
US10/127,843 Abandoned US20030082693A1 (en) | 2000-06-05 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,847 Abandoned US20030119103A1 (en) | 1998-08-20 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/127,846 Abandoned US20030082695A1 (en) | 2000-03-03 | 2002-04-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/128,691 Expired - Lifetime US7319135B2 (en) | 1999-12-09 | 2002-04-23 | PRO1341 polypeptides |
US10/128,684 Abandoned US20030082700A1 (en) | 2000-06-05 | 2002-04-23 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/128,685 Abandoned US20030203430A1 (en) | 1998-08-11 | 2002-04-23 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/128,689 Abandoned US20030087365A1 (en) | 1997-03-31 | 2002-04-23 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/128,688 Expired - Fee Related US7323544B2 (en) | 1999-02-09 | 2002-04-23 | PRO1434 polypeptides |
US10/128,692 Active 2024-06-24 US7704496B2 (en) | 1999-12-09 | 2002-04-23 | Antibodies against PRO1341 polypeptide |
US10/128,686 Expired - Fee Related US7345146B2 (en) | 1998-08-31 | 2002-04-23 | PRO1271 Polypeptides |
US10/128,690 Abandoned US20030082702A1 (en) | 2000-03-02 | 2002-04-23 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/128,694 Expired - Lifetime US7189813B2 (en) | 2000-03-02 | 2002-04-23 | PRO1338 polypeptides |
US10/128,687 Abandoned US20030087363A1 (en) | 1998-09-10 | 2002-04-23 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/128,693 Expired - Lifetime US7355006B2 (en) | 1998-08-31 | 2002-04-23 | Antibodies against the PRO1271 polypeptides |
US10/131,825 Expired - Lifetime US7282566B2 (en) | 1997-03-31 | 2002-04-24 | PRO1779 polypeptide |
US10/131,833 Expired - Fee Related US7141652B1 (en) | 1998-10-07 | 2002-04-24 | Antibodies to PRO1561 polypeptide |
US10/131,836 Expired - Lifetime US7351794B2 (en) | 1999-12-09 | 2002-04-24 | PRO1754 polypeptides |
US10/131,813 Expired - Lifetime US7279551B2 (en) | 1998-10-07 | 2002-04-24 | Pro1556 Polypeptide |
US10/131,829 Abandoned US20030082705A1 (en) | 1999-12-09 | 2002-04-24 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/131,822 Expired - Lifetime US7189806B2 (en) | 1998-08-19 | 2002-04-24 | Pro 1384 polypeptides |
US10/131,821 Abandoned US20030092105A1 (en) | 1999-12-09 | 2002-04-24 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/131,824 Expired - Fee Related US7326413B2 (en) | 1999-02-09 | 2002-04-24 | Antibodies against the PRO1434 polypeptide |
US10/131,823 Expired - Lifetime US7304132B2 (en) | 1997-03-31 | 2002-04-24 | PRO1693 polypeptides |
US10/131,830 Abandoned US20030077720A1 (en) | 1999-12-09 | 2002-04-24 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/131,837 Expired - Lifetime US7294495B2 (en) | 1999-12-09 | 2002-04-24 | PR03580 polypeptides |
US10/131,820 Expired - Lifetime US7312314B2 (en) | 1998-10-28 | 2002-04-24 | Antibody that binds a pro1693 polypeptide |
US10/131,816 Expired - Lifetime US7361337B2 (en) | 1999-12-09 | 2002-04-24 | Antibodies against the PRO1754 polypeptides |
US10/131,819 Expired - Lifetime US7273926B2 (en) | 1999-12-09 | 2002-04-24 | Antibody to PRO1779 polypeptides |
US10/131,826 Expired - Lifetime US7202345B2 (en) | 1998-08-19 | 2002-04-24 | PRO 1384 antibodies |
US10/131,818 Expired - Fee Related US7166703B2 (en) | 1998-10-07 | 2002-04-24 | PRO1561 polypeptides |
US10/131,815 Abandoned US20030092103A1 (en) | 1998-12-22 | 2002-04-24 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/131,828 Expired - Lifetime US7309777B2 (en) | 1998-10-07 | 2002-04-24 | Antibodies against the PRO1556 polypeptide |
US10/131,835 Expired - Lifetime US7294705B2 (en) | 2000-12-01 | 2002-04-24 | Anti-PRO3580 antibodies |
US10/131,817 Expired - Lifetime US7291701B2 (en) | 1997-03-31 | 2002-04-24 | PRO1777 polypeptides |
US10/137,867 Abandoned US20030207349A1 (en) | 1997-03-31 | 2002-05-03 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/137,871 Expired - Lifetime US7323545B2 (en) | 1999-12-09 | 2002-05-03 | PRO1885 polypeptides |
US10/137,872 Abandoned US20030077722A1 (en) | 2000-03-03 | 2002-05-03 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/137,873 Abandoned US20060084138A1 (en) | 2000-03-03 | 2002-05-03 | The pro4979 polypeptide |
US10/137,864 Expired - Lifetime US7291715B2 (en) | 2000-03-03 | 2002-05-03 | Antibodies to the PRO4329 polypeptide |
US10/137,866 Abandoned US20030129689A1 (en) | 2000-03-01 | 2002-05-03 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/137,865 Abandoned US20030032155A1 (en) | 1997-03-31 | 2002-05-03 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/137,869 Expired - Lifetime US7282558B2 (en) | 2000-03-03 | 2002-05-03 | PRO4329 polypeptide |
US10/137,870 Abandoned US20030138883A1 (en) | 2000-03-01 | 2002-05-03 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/137,868 Abandoned US20030082764A1 (en) | 1997-03-31 | 2002-05-03 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,021 Expired - Lifetime US7279552B2 (en) | 1999-12-09 | 2002-05-06 | Pro1782 polypeptides |
US10/140,023 Abandoned US20030207416A1 (en) | 1997-03-31 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,473 Abandoned US20030207351A1 (en) | 2000-12-01 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,472 Abandoned US20030138888A1 (en) | 1999-12-09 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/139,980 Expired - Lifetime US7247710B2 (en) | 1997-03-31 | 2002-05-06 | PRO4395 antibodies |
US10/140,022 Expired - Lifetime US7285627B2 (en) | 2000-06-05 | 2002-05-06 | PRO4989 polypeptides |
US10/139,963 Expired - Lifetime US7288625B2 (en) | 1997-03-31 | 2002-05-06 | PRO4395 polypeptides |
US10/140,020 Abandoned US20030207415A1 (en) | 1997-03-31 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,024 Abandoned US20040058424A1 (en) | 1997-03-31 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,470 Granted US20030022331A1 (en) | 1997-03-31 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,470 Expired - Lifetime US7521539B2 (en) | 2000-12-01 | 2002-05-06 | Anti-PRO4989 antibodies |
US10/140,471 Expired - Lifetime US7291702B2 (en) | 1999-12-09 | 2002-05-06 | PRO4326 polypeptides |
US10/140,474 Abandoned US20030032156A1 (en) | 1997-03-31 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,019 Abandoned US20030148423A1 (en) | 1999-12-09 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,018 Abandoned US20030138885A1 (en) | 2000-03-03 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,274 Abandoned US20030143674A1 (en) | 2000-03-03 | 2002-05-06 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,921 Expired - Fee Related US7317080B2 (en) | 1997-03-31 | 2002-05-07 | PRO4303 polypeptides |
US10/140,927 Expired - Lifetime US7495082B2 (en) | 2000-03-03 | 2002-05-07 | Antibodies to PRO4349 polypeptides |
US10/140,810 Abandoned US20030207353A1 (en) | 2000-03-03 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,928 Abandoned US20030068798A1 (en) | 1997-03-31 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,809 Abandoned US20030207418A1 (en) | 1997-03-31 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,862 Expired - Lifetime US7285628B2 (en) | 1999-12-09 | 2002-05-07 | PRO1867 polypeptides |
US10/140,925 Abandoned US20030073215A1 (en) | 1997-03-31 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,863 Expired - Lifetime US7288626B2 (en) | 2000-03-03 | 2002-05-07 | PRO4403 polypeptides |
US10/140,860 Expired - Lifetime US7307151B2 (en) | 1997-03-31 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,807 Expired - Lifetime US7335745B2 (en) | 2000-03-03 | 2002-05-07 | Antibodies against the PRO4403 polypeptides |
US10/140,808 Expired - Lifetime US7425621B2 (en) | 1997-03-31 | 2002-05-07 | Antibodies against the PRO4401 polypeptide |
US10/140,865 Abandoned US20030207420A1 (en) | 1997-03-31 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,805 Abandoned US20030207417A1 (en) | 1997-03-31 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,861 Abandoned US20030148425A1 (en) | 2000-03-03 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,923 Expired - Lifetime US7282559B2 (en) | 2000-03-03 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,922 Expired - Lifetime US7309765B2 (en) | 2000-03-03 | 2002-05-07 | PRO4349 polypeptides |
US10/140,926 Abandoned US20030134356A1 (en) | 2000-03-03 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,924 Abandoned US20030134355A1 (en) | 2000-03-03 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,864 Abandoned US20030207419A1 (en) | 1997-03-31 | 2002-05-07 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/140,806 Expired - Lifetime US7309764B2 (en) | 2000-03-03 | 2002-05-07 | PRO4401 polypeptide |
US10/141,700 Expired - Lifetime US7312308B2 (en) | 2000-03-03 | 2002-05-08 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/141,760 Expired - Fee Related US7342104B2 (en) | 1997-03-31 | 2002-05-08 | Antibodies against the PRO4320 polypeptide |
US10/141,698 Expired - Lifetime US7282560B2 (en) | 2000-03-03 | 2002-05-08 | PRO 4326 polypeptides |
US10/141,701 Abandoned US20030207421A1 (en) | 1997-03-31 | 2002-05-08 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/141,702 Expired - Lifetime US7294692B2 (en) | 2000-06-05 | 2002-05-08 | Pro6014 polypeptides |
US10/141,697 Expired - Lifetime US7417123B2 (en) | 2000-03-03 | 2002-05-08 | PRO4399 Antibodies |
US10/141,759 Expired - Lifetime US7291716B2 (en) | 2000-03-03 | 2002-05-08 | PRO4400 antibodies |
US10/141,762 Abandoned US20030207362A1 (en) | 2000-03-03 | 2002-05-08 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/141,755 Expired - Lifetime US7297764B2 (en) | 1997-03-31 | 2002-05-08 | PRO4318 polypeptides |
US10/141,704 Expired - Lifetime US7396916B2 (en) | 2000-06-05 | 2002-05-08 | Antibody to a polypeptide overexpressed in tumors |
US10/141,756 Expired - Lifetime US7488586B2 (en) | 1997-03-31 | 2002-05-08 | PRO4409 polypeptides |
US10/141,703 Abandoned US20030207357A1 (en) | 1999-03-10 | 2002-05-08 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/141,699 Expired - Lifetime US7390887B2 (en) | 2000-03-03 | 2002-05-08 | Antibodies against PRO4330 |
US10/141,705 Expired - Lifetime US7396906B2 (en) | 2000-03-03 | 2002-05-08 | Pro4399 Polypeptides |
US10/141,753 Expired - Lifetime US7323550B2 (en) | 2000-03-03 | 2002-05-08 | Anti-PRO4318 antibodies |
US10/141,761 Expired - Fee Related US7335729B2 (en) | 2000-03-03 | 2002-05-08 | PRO4320 polypeptide |
US10/141,706 Expired - Lifetime US7425609B2 (en) | 2000-03-03 | 2002-05-08 | PRO4330 polypeptides |
US10/141,757 Expired - Fee Related US7314920B2 (en) | 2000-03-03 | 2002-05-08 | Antibodies against the PRO4340 polypeptide |
US10/141,754 Expired - Lifetime US7361732B2 (en) | 1997-03-31 | 2002-05-08 | PRO4400 polypeptides |
US10/141,758 Expired - Lifetime US7301007B2 (en) | 2000-03-03 | 2002-05-08 | PRO4340 polypeptides |
US10/142,761 Expired - Lifetime US7306795B2 (en) | 2000-06-05 | 2002-05-09 | PRO5774 antibodies |
US10/142,420 Abandoned US20030148434A1 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/143,035 Expired - Fee Related US7317081B2 (en) | 2000-03-03 | 2002-05-09 | PRO4371 polypeptides |
US10/143,027 Abandoned US20030207366A1 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/143,117 Expired - Lifetime US7318922B2 (en) | 2000-06-05 | 2002-05-09 | Anti-PRO5337 antibodies |
US10/142,421 Expired - Lifetime US7311909B2 (en) | 2000-03-03 | 2002-05-09 | PRO4348 antibodies |
US10/142,427 Expired - Lifetime US7294702B2 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,426 Abandoned US20040048333A1 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,428 Abandoned US20030207363A1 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,422 Expired - Lifetime US7385030B2 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,888 Abandoned US20030157606A1 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/143,115 Expired - Lifetime US7309767B2 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,887 Expired - Lifetime US7291717B2 (en) | 1999-12-09 | 2002-05-09 | PRO3446 antibodies |
US10/142,425 Abandoned US20030207424A1 (en) | 1997-03-31 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,762 Expired - Lifetime US7288627B2 (en) | 2000-03-03 | 2002-05-09 | PRO4322 polypeptides |
US10/142,889 Abandoned US20030194765A1 (en) | 2000-03-03 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/143,118 Expired - Lifetime US7309768B2 (en) | 2000-03-03 | 2002-05-09 | PRO4347 polypeptides |
US10/142,430 Expired - Lifetime US7309766B2 (en) | 1997-03-31 | 2002-05-09 | PRO5774 polypeptides |
US10/142,432 Expired - Lifetime US7390877B2 (en) | 2000-03-03 | 2002-05-09 | PRO4381 polypeptides |
US10/143,113 Expired - Lifetime US7329730B2 (en) | 1997-03-31 | 2002-05-09 | PRO4348 polypeptides |
US10/143,034 Expired - Lifetime US7378502B2 (en) | 2000-03-03 | 2002-05-09 | PRO4389 antibodies |
US10/142,417 Expired - Lifetime US7304133B2 (en) | 1997-03-31 | 2002-05-09 | PRO4389 polypeptides |
US10/143,114 Abandoned US20030036180A1 (en) | 1997-03-31 | 2002-05-09 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/143,116 Expired - Lifetime US7390486B2 (en) | 2000-03-03 | 2002-05-09 | PRO4381 antibodies |
US10/142,886 Abandoned US20030203432A1 (en) | 2000-06-05 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,760 Abandoned US20030148437A1 (en) | 2000-06-05 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,885 Expired - Lifetime US7718173B2 (en) | 2000-06-05 | 2002-05-10 | Anti-pro6094 antibodies |
US10/142,763 Expired - Lifetime US7189807B2 (en) | 2000-06-05 | 2002-05-10 | PRO4994 polypeptides |
US10/142,766 Expired - Lifetime US7390883B2 (en) | 2000-03-03 | 2002-05-10 | PRO4428 antibodies |
US10/143,032 Expired - Lifetime US7408033B2 (en) | 1997-03-31 | 2002-05-10 | PRO5995 polypeptides |
US10/142,424 Expired - Lifetime US7297766B2 (en) | 2000-06-05 | 2002-05-10 | PRO5337 polypeptides |
US10/142,423 Abandoned US20030049817A1 (en) | 1997-03-31 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,884 Abandoned US20030207365A1 (en) | 2000-06-05 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,419 Expired - Lifetime US7153941B2 (en) | 1997-03-31 | 2002-05-10 | Antibodies that bind PRO4994 polypeptides |
US10/142,418 Expired - Lifetime US7297765B2 (en) | 2000-06-05 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,764 Abandoned US20030180865A1 (en) | 2000-06-05 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,429 Abandoned US20030207364A1 (en) | 2000-06-05 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,765 Abandoned US20030157603A1 (en) | 2000-06-05 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/142,767 Expired - Lifetime US7294693B2 (en) | 2000-03-03 | 2002-05-10 | Pro4428 Polypeptides |
US10/142,431 Expired - Lifetime US7285629B2 (en) | 1997-03-31 | 2002-05-10 | Pro5005 polypeptides |
US10/143,033 Abandoned US20030134363A1 (en) | 2000-06-05 | 2002-05-10 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/144,957 Abandoned US20030157610A1 (en) | 2000-06-05 | 2002-05-13 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/144,993 Abandoned US20040038336A1 (en) | 2000-03-03 | 2002-05-13 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/144,958 Expired - Lifetime US7479545B2 (en) | 2000-06-05 | 2002-05-13 | PRO6001 antibodies |
US10/144,956 Abandoned US20030207368A1 (en) | 2000-03-03 | 2002-05-13 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,127 Expired - Lifetime US7355007B2 (en) | 2000-06-05 | 2002-05-13 | Antibodies that bind PRO5005 Polypeptides |
US10/144,992 Abandoned US20030157611A1 (en) | 2000-06-05 | 2002-05-13 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,090 Abandoned US20030157613A1 (en) | 2000-03-03 | 2002-05-13 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,091 Abandoned US20030157614A1 (en) | 2000-06-05 | 2002-05-13 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,015 Expired - Lifetime US7439325B2 (en) | 2000-06-05 | 2002-05-13 | PRO6001 polypeptides |
US10/144,994 Abandoned US20030134364A1 (en) | 2000-03-03 | 2002-05-13 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,823 Abandoned US20030134368A1 (en) | 2000-03-03 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,824 Expired - Lifetime US7411047B2 (en) | 2000-06-05 | 2002-05-14 | PRO6097 antibodies |
US10/145,749 Abandoned US20030207371A1 (en) | 2000-05-22 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,632 Expired - Lifetime US7385031B2 (en) | 2000-06-05 | 2002-05-14 | PRO6097 polypeptides |
US10/145,820 Abandoned US20030157623A1 (en) | 2000-06-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,874 Abandoned US20030194766A1 (en) | 2000-06-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,870 Expired - Lifetime US7294703B2 (en) | 2000-06-05 | 2002-05-14 | PRO6093 Antibodies |
US10/145,878 Expired - Lifetime US7317088B2 (en) | 2000-06-05 | 2002-05-14 | PRO5993 polypeptides |
US10/145,871 Expired - Lifetime US7396907B2 (en) | 2000-06-05 | 2002-05-14 | Antibodies that bind PRO6182 polypeptides |
US10/145,827 Expired - Lifetime US7304140B2 (en) | 2000-03-03 | 2002-05-14 | PRO4503 polypeptides |
US10/145,825 Expired - Lifetime US7335740B2 (en) | 2000-06-05 | 2002-05-14 | Antibodies against the PRO7434 polypeptides |
US10/145,869 Abandoned US20030166078A1 (en) | 1999-10-08 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,872 Abandoned US20030157624A1 (en) | 1999-10-08 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,826 Expired - Lifetime US7375195B2 (en) | 2000-06-05 | 2002-05-14 | Anti-PRO7171 polypeptides |
US10/145,634 Abandoned US20030170788A1 (en) | 2000-09-15 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,821 Abandoned US20030148438A1 (en) | 2000-09-15 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,626 Expired - Lifetime US7429640B2 (en) | 2000-06-05 | 2002-05-14 | PRO6181 polypeptides |
US10/145,818 Abandoned US20030157622A1 (en) | 2000-06-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,625 Abandoned US20030180868A1 (en) | 2000-03-03 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,631 Expired - Lifetime US7371824B2 (en) | 2000-06-05 | 2002-05-14 | PRO6093 polypeptides |
US10/145,877 Expired - Lifetime US7411040B2 (en) | 2000-06-05 | 2002-05-14 | PRO6182 polypeptides |
US10/145,628 Expired - Lifetime US7285636B2 (en) | 2000-06-05 | 2002-05-14 | PRO6095 polypeptides |
US10/145,746 Abandoned US20030134366A1 (en) | 2000-06-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,748 Expired - Lifetime US7354998B2 (en) | 2000-06-05 | 2002-05-14 | PRO7171 polypeptides |
US10/145,754 Abandoned US20030157620A1 (en) | 2000-06-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,629 Expired - Lifetime US7285644B2 (en) | 2000-06-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,822 Abandoned US20030166075A1 (en) | 2000-12-01 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,750 Expired - Lifetime US7417115B2 (en) | 2000-06-05 | 2002-05-14 | PRO6027 polypeptides |
US10/145,752 Expired - Lifetime US7319136B2 (en) | 2000-06-05 | 2002-05-14 | PRO7434 polypeptides |
US10/145,751 Abandoned US20030166074A1 (en) | 2000-05-22 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,747 Abandoned US20030157618A1 (en) | 1999-03-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,755 Expired - Lifetime US7312312B2 (en) | 2000-03-03 | 2002-05-14 | PRO6242 polypeptides |
US10/145,960 Expired - Lifetime US7317074B2 (en) | 2000-03-03 | 2002-05-14 | Pro4976 polypeptides |
US10/145,961 Abandoned US20040235092A1 (en) | 1999-12-09 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,958 Expired - Lifetime US7408042B2 (en) | 2000-06-05 | 2002-05-14 | Anti-PRO6181 antibodies |
US10/145,959 Expired - Lifetime US7390878B2 (en) | 2000-06-05 | 2002-05-14 | PRO6090 polypeptides |
US10/145,962 Expired - Lifetime US7335746B2 (en) | 2000-03-03 | 2002-05-14 | Anti-pro4976 antibodies |
US10/145,633 Abandoned US20030138892A1 (en) | 2000-06-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/145,630 Expired - Lifetime US7309778B2 (en) | 2000-06-05 | 2002-05-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,792 Abandoned US20030207428A1 (en) | 1997-03-31 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,790 Abandoned US20030166083A1 (en) | 1998-04-09 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,730 Abandoned US20030207427A1 (en) | 1997-03-31 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,729 Abandoned US20030082708A1 (en) | 2000-06-05 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,791 Abandoned US20030082709A1 (en) | 1998-08-17 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,793 Abandoned US20030166084A1 (en) | 2000-09-15 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,788 Abandoned US20030129693A1 (en) | 1998-06-23 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,787 Abandoned US20030166082A1 (en) | 2000-05-22 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,725 Abandoned US20030134374A1 (en) | 1999-12-09 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,731 Abandoned US20030129692A1 (en) | 1998-05-07 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,726 Abandoned US20030129690A1 (en) | 2000-06-05 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,795 Abandoned US20030134375A1 (en) | 2000-12-01 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,724 Abandoned US20030134373A1 (en) | 2000-06-05 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/146,728 Abandoned US20030203437A1 (en) | 1998-07-01 | 2002-05-15 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,508 Abandoned US20030082711A1 (en) | 1998-07-02 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,512 Expired - Fee Related US7087428B2 (en) | 1998-05-15 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,524 Abandoned US20030166093A1 (en) | 1999-12-09 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,509 Abandoned US20030134380A1 (en) | 1998-05-13 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,518 Abandoned US20040214269A1 (en) | 1998-07-07 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,523 Abandoned US20030092113A1 (en) | 1999-12-09 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,517 Abandoned US20030077726A1 (en) | 1998-06-24 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,484 Abandoned US20030082710A1 (en) | 1999-12-09 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,497 Abandoned US20030194767A1 (en) | 1998-08-26 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,529 Abandoned US20030134383A1 (en) | 1999-12-09 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,520 Abandoned US20030170789A1 (en) | 1998-08-17 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,528 Abandoned US20030219885A1 (en) | 1997-03-31 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,502 Abandoned US20030077724A1 (en) | 2000-06-05 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,503 Abandoned US20030157628A1 (en) | 1998-06-24 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,500 Abandoned US20030077723A1 (en) | 1998-08-12 | 2002-05-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,531 Abandoned US20040253667A1 (en) | 2000-06-05 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,481 Abandoned US20030157626A1 (en) | 1998-09-17 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,506 Abandoned US20030134379A1 (en) | 2000-12-01 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,535 Abandoned US20030207378A1 (en) | 2000-06-05 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,499 Abandoned US20030203439A1 (en) | 1998-08-04 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,486 Abandoned US20030166087A1 (en) | 2000-03-02 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,492 Abandoned US20030082765A1 (en) | 1997-03-31 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,515 Abandoned US20030077725A1 (en) | 2000-06-05 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,507 Abandoned US20030207377A1 (en) | 2000-06-05 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,510 Abandoned US20030134381A1 (en) | 2000-03-03 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,495 Abandoned US20030134376A1 (en) | 1999-12-09 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,480 Abandoned US20030166085A1 (en) | 1999-12-09 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,526 Abandoned US20030077727A1 (en) | 2000-05-30 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,485 Expired - Fee Related US7098003B2 (en) | 1998-08-19 | 2002-05-17 | PRO 1384 nucleic acids |
US10/147,522 Abandoned US20030157629A1 (en) | 1998-09-15 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,482 Abandoned US20030157627A1 (en) | 1998-08-31 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,537 Abandoned US20030207379A1 (en) | 1998-09-10 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,527 Abandoned US20030077728A1 (en) | 2000-03-03 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,494 Abandoned US20030166090A1 (en) | 1998-10-07 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,511 Abandoned US20030134382A1 (en) | 1999-07-26 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,490 Abandoned US20030166089A1 (en) | 1998-11-17 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,519 Abandoned US20030077791A1 (en) | 1997-03-31 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,488 Abandoned US20040253666A1 (en) | 1998-09-01 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,505 Abandoned US20030180875A1 (en) | 1998-06-19 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,514 Abandoned US20030166092A1 (en) | 1999-12-09 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,496 Abandoned US20030180874A1 (en) | 1998-09-09 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,501 Abandoned US20030134377A1 (en) | 1999-12-09 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,487 Abandoned US20030166088A1 (en) | 2000-06-05 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,483 Abandoned US20030180873A1 (en) | 1998-08-11 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,504 Abandoned US20030134378A1 (en) | 2000-12-01 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,491 Abandoned US20030175865A1 (en) | 1998-10-20 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,489 Abandoned US20030207376A1 (en) | 1998-10-28 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,498 Abandoned US20030166091A1 (en) | 1999-02-09 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,516 Abandoned US20030180876A1 (en) | 1998-08-20 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,493 Abandoned US20040029217A1 (en) | 1998-06-17 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/147,513 Expired - Fee Related US7220568B2 (en) | 1998-10-07 | 2002-05-17 | Nucleic acids encoding the PRO1561 polypeptide |
US10/147,536 Abandoned US20040077064A1 (en) | 1997-03-31 | 2002-05-17 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,401 Abandoned US20030157630A1 (en) | 2000-03-03 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,405 Abandoned US20030211571A1 (en) | 2000-03-03 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,400 Abandoned US20030207383A1 (en) | 2000-06-05 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,373 Abandoned US20030186367A1 (en) | 1998-12-22 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,393 Abandoned US20030199026A1 (en) | 2000-03-03 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,406 Abandoned US20030166096A1 (en) | 1999-12-09 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,396 Abandoned US20030199027A1 (en) | 2000-03-01 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,397 Abandoned US20030134384A1 (en) | 2000-03-01 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,531 Abandoned US20030148439A1 (en) | 2000-03-03 | 2002-05-20 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,384 Abandoned US20030175869A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,390 Abandoned US20030175872A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,398 Expired - Fee Related US7074910B2 (en) | 2000-03-03 | 2002-05-21 | PRO4340 nucleic acids |
US10/152,381 Abandoned US20030207382A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,372 Abandoned US20040126839A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,378 Abandoned US20030175866A1 (en) | 2000-06-05 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,376 Abandoned US20030207381A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,389 Abandoned US20030175871A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,395 Expired - Lifetime US7189534B2 (en) | 1997-03-31 | 2002-05-21 | PRO4320 polynucleotide |
US10/152,380 Abandoned US20030129694A1 (en) | 1999-12-09 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,370 Abandoned US20060084139A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,403 Abandoned US20030175874A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,379 Abandoned US20030166094A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,387 Abandoned US20030175870A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,371 Abandoned US20030194768A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,394 Abandoned US20030166095A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,375 Expired - Lifetime US7160993B2 (en) | 2000-03-03 | 2002-05-21 | Nucleic acids encoding PRO4400 polypeptides |
US10/152,399 Abandoned US20030194774A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,374 Abandoned US20030194769A1 (en) | 1999-12-09 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,383 Abandoned US20030175868A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,392 Abandoned US20030175873A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,377 Abandoned US20030194771A1 (en) | 1999-12-09 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,391 Abandoned US20030194773A1 (en) | 1999-12-09 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,382 Abandoned US20030175867A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,386 Abandoned US20030194772A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/152,385 Abandoned US20030199025A1 (en) | 2000-03-03 | 2002-05-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/153,756 Abandoned US20030175875A1 (en) | 2000-03-03 | 2002-05-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/153,585 Abandoned US20030207384A1 (en) | 2000-03-03 | 2002-05-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/153,552 Abandoned US20030199028A1 (en) | 2000-03-03 | 2002-05-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/153,840 Abandoned US20030199029A1 (en) | 2000-03-03 | 2002-05-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/153,934 Abandoned US20030129695A1 (en) | 1997-03-31 | 2002-05-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/153,586 Abandoned US20030134385A1 (en) | 1999-12-09 | 2002-05-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/156,845 Abandoned US20030199033A1 (en) | 2000-06-05 | 2002-05-28 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/156,847 Abandoned US20030166098A1 (en) | 2000-03-03 | 2002-05-28 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/156,844 Abandoned US20030199032A1 (en) | 2000-03-03 | 2002-05-28 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/156,848 Abandoned US20030194775A1 (en) | 2000-03-03 | 2002-05-28 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/156,841 Abandoned US20030199030A1 (en) | 2000-03-03 | 2002-05-28 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/156,842 Abandoned US20030199031A1 (en) | 2000-06-05 | 2002-05-28 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,794 Abandoned US20030194777A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,801 Abandoned US20030207387A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,491 Abandoned US20030175880A1 (en) | 2000-03-03 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,802 Abandoned US20030207388A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,800 Abandoned US20030207386A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,797 Abandoned US20030175879A1 (en) | 2000-03-03 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,786 Abandoned US20030208055A1 (en) | 1997-03-31 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,784 Abandoned US20030175878A1 (en) | 2000-03-03 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,781 Abandoned US20030170790A1 (en) | 2000-03-03 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,782 Abandoned US20030077792A1 (en) | 1997-03-31 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,462 Abandoned US20030158104A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,785 Abandoned US20030194776A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,780 Abandoned US20030207385A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,799 Abandoned US20030166101A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,779 Abandoned US20030175877A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,798 Abandoned US20030203440A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,783 Abandoned US20030157631A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,778 Abandoned US20030166100A1 (en) | 2000-03-03 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/157,796 Abandoned US20030194778A1 (en) | 2000-06-05 | 2002-05-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,785 Abandoned US20030092115A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,788 Abandoned US20050074837A1 (en) | 2000-09-15 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/160,498 Abandoned US20030073216A1 (en) | 1997-03-31 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,784 Abandoned US20030207389A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,792 Abandoned US20030157632A1 (en) | 1999-10-08 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,790 Abandoned US20030180879A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,787 Abandoned US20040039164A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/160,500 Abandoned US20030194779A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,791 Abandoned US20030207429A1 (en) | 1997-03-31 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,783 Abandoned US20030138893A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/160,504 Abandoned US20030166102A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
Family Applications After (25)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/158,782 Abandoned US20030082766A1 (en) | 1997-03-31 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,789 Abandoned US20030207390A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/158,786 Abandoned US20030134791A1 (en) | 2000-06-05 | 2002-05-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/230,417 Expired - Lifetime US7297768B2 (en) | 1999-12-09 | 2002-08-28 | PRO3574 polypeptide |
US10/931,886 Abandoned US20050019823A1 (en) | 2000-12-01 | 2004-08-31 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/955,952 Abandoned US20050153396A1 (en) | 1998-09-16 | 2004-09-29 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/964,241 Abandoned US20070026487A1 (en) | 1997-11-24 | 2004-10-12 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US10/973,115 Abandoned US20060040351A1 (en) | 1999-03-05 | 2004-10-22 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/020,604 Abandoned US20050153348A1 (en) | 2000-05-22 | 2004-12-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/036,869 Abandoned US20050170396A1 (en) | 2000-12-01 | 2005-01-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/040,809 Abandoned US20050118635A1 (en) | 1998-04-09 | 2005-01-21 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/056,802 Abandoned US20050136515A1 (en) | 2000-12-01 | 2005-02-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/057,268 Abandoned US20060084144A1 (en) | 1997-09-17 | 2005-02-11 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/057,966 Abandoned US20050187379A1 (en) | 1997-09-17 | 2005-02-14 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/060,240 Abandoned US20050164279A1 (en) | 2000-03-03 | 2005-02-16 | Secreted and transmembrane polypetides and nucleic acids encoding the same |
US11/060,652 Abandoned US20050136475A1 (en) | 1998-10-22 | 2005-02-16 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/110,520 Abandoned US20050202496A1 (en) | 2000-06-05 | 2005-04-19 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/117,757 Abandoned US20050214846A1 (en) | 2000-09-15 | 2005-04-27 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/290,153 Expired - Fee Related US7524497B2 (en) | 1998-07-01 | 2005-11-30 | Antibodies to PRO 1120 polypeptide |
US11/341,175 Expired - Fee Related US7468427B2 (en) | 1997-03-31 | 2006-01-27 | Antibodies to PRO1275 polypeptide |
US11/537,235 Expired - Fee Related US7504484B2 (en) | 1998-10-07 | 2006-09-29 | Antibodies to the PRO1561 polypeptide |
US11/538,714 Expired - Fee Related US8106156B2 (en) | 1998-07-01 | 2006-10-04 | PRO1120 polypeptides |
US11/553,810 Abandoned US20070264686A1 (en) | 2000-06-05 | 2006-10-27 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US11/929,190 Abandoned US20080050758A1 (en) | 1998-09-09 | 2007-10-30 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US12/364,329 Abandoned US20090142786A1 (en) | 1998-10-07 | 2009-02-02 | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
Country Status (5)
Country | Link |
---|---|
US (468) | US20020137890A1 (en) |
KR (1) | KR20040074090A (en) |
AT (1) | ATE408419T1 (en) |
DE (1) | DE60228997D1 (en) |
ZA (1) | ZA200404849B (en) |
Families Citing this family (171)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6300487B1 (en) * | 1996-03-19 | 2001-10-09 | Cell Therapuetics, Inc. | Mammalian lysophosphatidic acid acyltransferase |
US20020137890A1 (en) * | 1997-03-31 | 2002-09-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20060122373A1 (en) * | 1997-04-04 | 2006-06-08 | Millennium Pharmaceuticals, Inc. | Delta3, FTHMA-070, Tango85, Tango77, SPOIL,NEOKINE, Tango129 and integrin alpha subunit protein and nucleic acid molecules and uses thereof |
WO1999040189A2 (en) * | 1998-02-09 | 1999-08-12 | Genset | Cdnas encoding secreted proteins |
US20040141972A1 (en) | 1997-11-21 | 2004-07-22 | Genentech, Inc. | Compounds, compositions and methods for the treatment of diseases characterized by A-33 related antigens |
US20030175778A1 (en) * | 1998-06-05 | 2003-09-18 | Jian Ni | Interferon Receptor HKAEF92 |
US20030211578A1 (en) * | 1998-06-05 | 2003-11-13 | Jian Ni | Interferon receptor HKAEF92 |
US6699688B1 (en) * | 1998-09-16 | 2004-03-02 | The Research Foundation Of The State University Of New York | Human platelet F11 receptor |
EP1117773A4 (en) * | 1998-09-30 | 2005-11-16 | Millennium Pharm Inc | Secreted proteins and nucleic acids encoding them |
US7625859B1 (en) | 2000-02-16 | 2009-12-01 | Oregon Health & Science University | HER-2 binding antagonists |
US7393823B1 (en) | 1999-01-20 | 2008-07-01 | Oregon Health And Science University | HER-2 binding antagonists |
US7396810B1 (en) | 2000-08-14 | 2008-07-08 | Oregon Health Sciences University | Compositions and methods for treating cancer by modulating HER-2 and EGF receptors |
US7144996B1 (en) * | 1999-03-05 | 2006-12-05 | Genentech, Inc. | Nucleic acid encoding human suppressor of fused |
EP1171597A2 (en) * | 1999-04-12 | 2002-01-16 | Agensys, Inc. | Prostate-restricted gene 30p3c8 expressed in prostate cancer |
US6630142B2 (en) * | 1999-05-03 | 2003-10-07 | Zymogenetics, Inc. | Method of treating fibroproliferative disorders |
US6468543B1 (en) | 1999-05-03 | 2002-10-22 | Zymogenetics, Inc. | Methods for promoting growth of bone using ZVEGF4 |
AUPQ206399A0 (en) * | 1999-08-06 | 1999-08-26 | Imr Worldwide Pty Ltd. | Network user measurement system and method |
DE60041333D1 (en) | 1999-08-12 | 2009-02-26 | Agensys Inc | HEN PROSTATE CANCER IS EXPRESSED AND ITS USES |
US7842458B2 (en) * | 1999-08-12 | 2010-11-30 | Agensys, Inc. | Nucleic acids and corresponding proteins entitled 58P1D12 useful in treatment and detection of cancer |
US20030228288A1 (en) | 1999-10-15 | 2003-12-11 | Scarborough Nelson L. | Volume maintaining osteoinductive/osteoconductive compositions |
AU775272B2 (en) | 1999-10-28 | 2004-07-29 | Agensys, Inc. | 36P6D5: secreted tumor antigen |
US6639041B2 (en) * | 1999-12-03 | 2003-10-28 | Dupont-Toray Co. Ltd. | Spandex having low set at low temperatures |
US20010044525A1 (en) * | 2000-01-05 | 2001-11-22 | Conklin Darrell C. | Novel FGF Homolog zFGF12 |
US20060160181A1 (en) * | 2000-02-15 | 2006-07-20 | Amgen Inc. | Fibroblast Growth Factor-23 molecules and uses thereof |
JP2004509605A (en) * | 2000-05-04 | 2004-04-02 | インサイト・ゲノミックス・インコーポレイテッド | Protease |
US20040081961A1 (en) * | 2001-05-04 | 2004-04-29 | Delegeane Angelo M | Proteases |
US7329729B1 (en) * | 2000-06-21 | 2008-02-12 | Amgen Inc. | Secreted epithelial colon stromal-1 molecules and uses thereof |
US9387094B2 (en) | 2000-07-19 | 2016-07-12 | Warsaw Orthopedic, Inc. | Osteoimplant and method of making same |
US6984522B2 (en) | 2000-08-03 | 2006-01-10 | Regents Of The University Of Michigan | Isolation and use of solid tumor stem cells |
US8044259B2 (en) | 2000-08-03 | 2011-10-25 | The Regents Of The University Of Michigan | Determining the capability of a test compound to affect solid tumor stem cells |
EP1191097A1 (en) * | 2000-09-21 | 2002-03-27 | Leids Universitair Medisch Centrum | Induction of exon skipping in eukaryotic cells |
US7323193B2 (en) | 2001-12-14 | 2008-01-29 | Osteotech, Inc. | Method of making demineralized bone particles |
EP2280030A3 (en) | 2001-04-10 | 2011-06-15 | Agensys, Inc. | Nucleic acids and corresponding proteins useful in the detection and treatment of various cancers |
US7927597B2 (en) * | 2001-04-10 | 2011-04-19 | Agensys, Inc. | Methods to inhibit cell growth |
WO2003030956A2 (en) | 2001-10-12 | 2003-04-17 | Osteotech, Inc. | Improved bone graft |
DE60224822T2 (en) * | 2001-10-19 | 2009-01-22 | Zymogenetics, Inc., Seattle | DIMERIZED GROWTH FACTOR AND MATERIALS AND METHOD FOR THE PRODUCTION THEREOF |
US20050123925A1 (en) | 2002-11-15 | 2005-06-09 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
US7175503B2 (en) | 2002-02-04 | 2007-02-13 | Kla-Tencor Technologies Corp. | Methods and systems for determining a characteristic of polishing within a zone on a specimen from combined output signals of an eddy current device |
AU2003210996A1 (en) * | 2002-02-11 | 2003-09-04 | Zymogenetics, Inc. | Materials and methods for preparing dimeric growth factors |
US6993539B2 (en) | 2002-03-19 | 2006-01-31 | Network Appliance, Inc. | System and method for determining changes in two snapshots and for transmitting changes to destination snapshot |
EP1541677A4 (en) | 2002-07-10 | 2007-06-27 | Takeda Pharmaceutical | Novel proteins and use thereof |
US7126148B2 (en) * | 2002-07-17 | 2006-10-24 | The Johns Hopkins University | Neutron detection based on boron activated liquid scintillation |
DE10232329A1 (en) * | 2002-07-17 | 2004-02-05 | Daimlerchrysler Ag | Car body with a strut assembly |
CA2499843A1 (en) * | 2002-09-25 | 2004-04-08 | Genentech, Inc. | Novel compositions and methods for the treatment of psoriasis |
US6890175B2 (en) * | 2002-12-18 | 2005-05-10 | Ultradent Products, Inc. | Cooling system for hand-held curing light |
JP2004267015A (en) * | 2003-03-05 | 2004-09-30 | National Institute Of Advanced Industrial & Technology | Nucleic acid and method for testing canceration using the same nucleic acid |
RS54160B1 (en) | 2003-03-19 | 2015-12-31 | Biogen Idec Ma Inc. | Nogo receptor binding protein |
AU2003225410A1 (en) | 2003-03-21 | 2004-10-11 | Academisch Ziekenhuis Leiden | Modulation of exon recognition in pre-mrna by interfering with the secondary rna structure |
AU2004247143B2 (en) | 2003-06-11 | 2010-09-23 | Warsaw Orthopedic, Inc. | Osteoimplants and methods for their manufacture |
JP4054727B2 (en) * | 2003-07-14 | 2008-03-05 | 株式会社リコー | Output buffer circuit and interface circuit using output buffer circuit |
US20070178458A1 (en) * | 2003-09-05 | 2007-08-02 | O'brien Philippa | Methods of diagnosis and prognosis of ovarian cancer II |
EP1560025A3 (en) * | 2003-10-03 | 2011-09-07 | F. Hoffmann-La Roche AG | Specific markers for diabetes |
KR20060116834A (en) * | 2003-11-20 | 2006-11-15 | 제넨테크, 인크. | Compositions and methods for the diagnosis and treatment of tumor |
CA2554526A1 (en) * | 2004-01-29 | 2005-08-18 | Genentech, Inc. | Variants of the extracellular domain of bcma and uses thereof |
EP1730189A2 (en) * | 2004-02-20 | 2006-12-13 | DeveloGen Aktiengesellschaft | Use of secreted protein products for preventing and treating pancreatic diseases and/or obesity and/or metabolic syndrome |
DE102004010203B4 (en) * | 2004-03-02 | 2007-05-10 | Siemens Ag | Method, device and computer program for creating a configuration for an operating device of an automation component |
US20050214303A1 (en) * | 2004-03-24 | 2005-09-29 | Oncotherapy Science, Inc. | Methods for damaging cells using effector functions of anti FAM3D antibodies |
WO2005089799A1 (en) * | 2004-03-24 | 2005-09-29 | Oncotherapy Science, Inc. | Cytotoxicity method using effector function of anti-fam3d antibody |
US7659915B2 (en) * | 2004-04-02 | 2010-02-09 | K-Nfb Reading Technology, Inc. | Portable reading device with mode processing |
CN102895663A (en) | 2004-04-14 | 2013-01-30 | 健泰科生物技术公司 | Compositions containing EGFL 7 antagonist for modulating vascular development and methods |
JP2007535959A (en) * | 2004-05-10 | 2007-12-13 | エボテツク・ニユーロサイエンシーズ・ゲー・エム・ベー・ハー | Diagnostic and therapeutic use of KCNJ6 for Alzheimer's disease |
EP1751188A1 (en) * | 2004-06-04 | 2007-02-14 | Applied Research Systems ARS Holding N.V. | Splice variant of unc5h2 |
CA2572193A1 (en) | 2004-06-24 | 2006-01-05 | Biogen Idec Ma Inc. | Treatment of conditions involving oligodendrocytes with sp35 based agents |
WO2006005459A2 (en) * | 2004-07-15 | 2006-01-19 | Bayer Healthcare Ag | Diagnostics and therapeutics for diseases associated with thyrotropin-releasing hormone degrading ectoenzyme (trhde) |
US8604185B2 (en) | 2004-07-20 | 2013-12-10 | Genentech, Inc. | Inhibitors of angiopoietin-like 4 protein, combinations, and their use |
DK1781698T3 (en) * | 2004-07-20 | 2016-10-03 | Genentech Inc | COMPOSITIONS AND METHODS FOR THE USE OF Angiopoietin-like-4-PROTEIN |
BRPI0513534A (en) * | 2004-07-20 | 2008-05-06 | Genentech Inc | angiopoietin-like protein 4 inhibitors, combinations, and their use |
WO2006014013A1 (en) * | 2004-08-04 | 2006-02-09 | Riken | Bone/joint disease sensitivity gene and use thereof |
CA2576500A1 (en) * | 2004-08-16 | 2006-03-02 | Agensys, Inc. | Nucleic acids and corresponding proteins entitled 58p1d12 useful in treatment and detection of cancer |
WO2006042002A2 (en) * | 2004-10-05 | 2006-04-20 | Oregon Health And Science University | Compositions and methods for treating disease |
US7938307B2 (en) * | 2004-10-18 | 2011-05-10 | Tyco Healthcare Group Lp | Support structures and methods of using the same |
US20060155862A1 (en) * | 2005-01-06 | 2006-07-13 | Hari Kathi | Data traffic load balancing based on application layer messages |
MX2007008561A (en) * | 2005-01-14 | 2008-02-21 | Osteotech Inc | Expandable osteoimplant. |
US20080193446A1 (en) * | 2005-01-27 | 2008-08-14 | Phillips Heidi S | Compositions and Methods for the Diagnosis and Treatment of Tumor |
EP2366726A3 (en) | 2005-04-22 | 2015-05-06 | Mitsubishi Chemical Corporation | Biomass-resource-derived polyester and production process thereof |
WO2006115295A1 (en) * | 2005-04-25 | 2006-11-02 | University Of Yamanashi | Compositions and methods for treating hemostasis disorders associated with clec-2 signal transduction |
EP2238986A3 (en) | 2005-07-08 | 2010-11-03 | Biogen Idec MA Inc. | Sp35 antibodies and uses thereof |
CA2619577A1 (en) * | 2005-08-15 | 2007-02-22 | Genentech, Inc. | Gene disruptions, compositions and methods relating thereto |
EP1915626B1 (en) * | 2005-08-16 | 2011-11-09 | Genentech, Inc. | Apoptosis sensitivity to apo2l/trail by testing for galnac-t14 expression in cells/tissues |
JP2007063225A (en) | 2005-09-01 | 2007-03-15 | Takeda Chem Ind Ltd | Imidazopyridine compound |
US7722889B2 (en) | 2005-09-30 | 2010-05-25 | Seattle Biomedical Research Institute | Plasmodium liver stage antigens |
JP5368798B2 (en) | 2005-10-31 | 2013-12-18 | オンコメッド ファーマシューティカルズ インコーポレイテッド | Compositions and methods for diagnosing and treating cancer |
US7723477B2 (en) | 2005-10-31 | 2010-05-25 | Oncomed Pharmaceuticals, Inc. | Compositions and methods for inhibiting Wnt-dependent solid tumor cell growth |
WO2007056671A1 (en) * | 2005-11-02 | 2007-05-18 | Osteotech, Inc. | Hemostatic bone graft |
US7293487B2 (en) * | 2005-11-15 | 2007-11-13 | 3M Innovative Properties Company | Cutting tool having variable and independent movement in an x-direction and a z-direction into and laterally along a work piece for making microstructures |
US20070197532A1 (en) * | 2005-11-18 | 2007-08-23 | Cao Sheldon X | Glucokinase activators |
WO2007084487A2 (en) * | 2006-01-13 | 2007-07-26 | Wayne State University | Pericytes for use as stem cells |
WO2007104034A2 (en) | 2006-03-08 | 2007-09-13 | Takeda San Diego, Inc. | Glucokinase activators |
WO2007123391A1 (en) * | 2006-04-20 | 2007-11-01 | Academisch Ziekenhuis Leiden | Therapeutic intervention in a genetic disease in an individual by modifying expression of an aberrantly expressed gene. |
EP1857548A1 (en) * | 2006-05-19 | 2007-11-21 | Academisch Ziekenhuis Leiden | Means and method for inducing exon-skipping |
US8008332B2 (en) | 2006-05-31 | 2011-08-30 | Takeda San Diego, Inc. | Substituted indazoles as glucokinase activators |
AU2007282224B2 (en) | 2006-08-11 | 2013-08-29 | Vico Therapeutics B.V. | Methods and means for treating DNA repeat instability associated genetic disorders |
SI2066694T1 (en) * | 2006-09-29 | 2016-02-29 | Oncomed Pharmaceuticals, Inc. | Compositions and methods for diagnosing and treating cancer |
US7875747B2 (en) * | 2006-10-10 | 2011-01-25 | Afton Chemical Corporation | Branched succinimide dispersant compounds and methods of making the compounds |
EP2076990B1 (en) * | 2006-10-20 | 2018-12-12 | Schrader Electronics Limited | Method for detecting and correcting data errors in an rf data link |
US20100233153A1 (en) * | 2006-11-14 | 2010-09-16 | Genentech, Inc. | Novel gene disruptions, compositions and the methods relating thereto |
WO2008079787A2 (en) | 2006-12-20 | 2008-07-03 | Takeda San Diego, Inc. | Glucokinase activators |
US7980000B2 (en) * | 2006-12-29 | 2011-07-19 | Applied Materials, Inc. | Vapor dryer having hydrophilic end effector |
US8128926B2 (en) | 2007-01-09 | 2012-03-06 | Biogen Idec Ma Inc. | Sp35 antibodies and uses thereof |
US8148147B2 (en) | 2007-01-24 | 2012-04-03 | The Regents Of The University Of Michigan | Compositions and methods for treating and diagnosing pancreatic cancer |
EP1961849A1 (en) * | 2007-02-22 | 2008-08-27 | ALBIS Spa | Pre-consolidated spunbonded web, composite nonwowen comprising said pre-consolidated spunbonded web, method and continuous system for producing said composite |
GB0704396D0 (en) * | 2007-03-07 | 2007-04-11 | Royal Bank Of Scotland Plc The | Cash dispensing methods and systems |
US8173645B2 (en) | 2007-03-21 | 2012-05-08 | Takeda San Diego, Inc. | Glucokinase activators |
US20080240081A1 (en) * | 2007-03-30 | 2008-10-02 | Texas Instruments Incorporated | Method, system and apparatus for providing rules-based restriction of incoming calls |
US7705085B2 (en) * | 2007-04-06 | 2010-04-27 | 3M Innovative Properties Company | Fluoroelastomer composition for cold shrink articles |
AU2008273094B2 (en) * | 2007-07-12 | 2013-05-09 | Prosensa Technologies B.V. | Molecules for targeting compounds to various selected organs, tissues or tumor cells |
WO2009008727A2 (en) * | 2007-07-12 | 2009-01-15 | Prosensa Technologies B.V. | Molecules for targeting compounds to various selected organs or tissues |
US8103302B2 (en) * | 2007-09-11 | 2012-01-24 | Telefonaktiebolaget Lm Ericsson (Publ) | Power-aware link adaptation with variable bandwidth allocation |
EP2207805B1 (en) * | 2007-10-02 | 2014-07-09 | Genentech, Inc. | Nlrr-1 antagonists and uses thereof |
US20110020786A1 (en) * | 2007-10-08 | 2011-01-27 | Baylor College Of Medicine | Peptide dendrimers: affinity reagents for binding noroviruses |
CN101980603A (en) * | 2007-10-11 | 2011-02-23 | 比奥根艾迪克Ma公司 | Use of LINGO-1 and TrkB antagonists |
AU2008317566B2 (en) | 2007-10-26 | 2014-05-01 | Academisch Ziekenhuis Leiden | Means and methods for counteracting muscle disorders |
USRE48468E1 (en) | 2007-10-26 | 2021-03-16 | Biomarin Technologies B.V. | Means and methods for counteracting muscle disorders |
CN101918540B (en) * | 2007-11-08 | 2016-05-11 | 比奥根Ma公司 | LINGO-4 antagonist relates to the application in the illness of demyelinate in treatment |
NZ587178A (en) * | 2008-02-08 | 2011-11-25 | Prosensa Holding Bv | Methods and means for treating dna repeat instability associated genetic disorders |
EP2119783A1 (en) | 2008-05-14 | 2009-11-18 | Prosensa Technologies B.V. | Method for efficient exon (44) skipping in Duchenne Muscular Dystrophy and associated means |
AU2009269099B2 (en) | 2008-07-09 | 2016-03-10 | Biogen Ma Inc. | Compositions comprising antibodies to LINGO or fragments thereof |
US20100047166A1 (en) * | 2008-08-20 | 2010-02-25 | Kanner Steven B | Antibodies and related molecules that bind to 58p1d12 proteins |
EP2326669A2 (en) * | 2008-09-04 | 2011-06-01 | Oxford Biotherapeutics Ltd. | Pta072 protein |
SG190568A1 (en) | 2008-09-26 | 2013-06-28 | Oncomed Pharm Inc | Frizzled-binding agents and uses thereof |
US8551789B2 (en) | 2010-04-01 | 2013-10-08 | OncoMed Pharmaceuticals | Frizzled-binding agents and their use in screening for WNT inhibitors |
EP2358352B1 (en) | 2008-10-24 | 2018-08-29 | Warsaw Orthopedic, Inc. | Compositions and methods for promoting bone formation |
JP2010225758A (en) * | 2009-03-23 | 2010-10-07 | Fuji Xerox Co Ltd | Organic semiconductor transistor |
US20120046342A1 (en) | 2009-04-24 | 2012-02-23 | Prosensa Technologies B.V. | Oligonucleotide comprising an inosine for treating dmd |
TWI428142B (en) | 2009-05-08 | 2014-03-01 | Genentech Inc | Humanized anti-egfl7 antibodies and methods using same |
AU2010248782B2 (en) * | 2009-05-15 | 2015-06-11 | Insight Genetics, Inc. | Methods and compositions relating to fusions of ALK for diagnosing and treating cancer |
CN102481698B (en) | 2009-08-28 | 2014-11-05 | 赫尔克里士公司 | Stable acid denatured soy/urea adhesives and methods of making same |
ES2567030T3 (en) | 2009-09-03 | 2016-04-19 | Cancer Research Technology Limited | CLEC14A inhibitors |
US20110086806A1 (en) * | 2009-10-09 | 2011-04-14 | Anaphore, Inc. | Polypeptides that Bind IL-23R |
US8883145B2 (en) | 2009-10-16 | 2014-11-11 | Oncomed Pharmaceuticals, Inc. | Methods of treatment with DLL4 antagonists and an anti-hypertensive agent |
EP2493916B1 (en) | 2009-10-26 | 2016-06-08 | Externautics S.p.A. | Lung tumor markers and methods of use thereof |
WO2011051277A1 (en) | 2009-10-26 | 2011-05-05 | Externautics S.P.A. | Breast tumor markers and methods of use thereof |
WO2011051276A1 (en) | 2009-10-26 | 2011-05-05 | Externautics S.P.A. | Colon and rectal tumor markers and methods of use thereof |
US20110165162A1 (en) * | 2009-12-01 | 2011-07-07 | Oncomed Pharmaceuticals, Inc. | Methods for Treating Cancers Comprising K-ras Mutations |
WO2011068801A2 (en) | 2009-12-01 | 2011-06-09 | The Rockefeller University | Methods for identifying compounds that modulate ion channel activity of a kir channel |
GB0922085D0 (en) * | 2009-12-17 | 2010-02-03 | Cambridge Entpr Ltd | Cancer diagnosis and treatment |
EP2516647B1 (en) | 2009-12-24 | 2016-12-14 | BioMarin Technologies B.V. | Molecule for treating an inflammatory disorder |
TWI535445B (en) | 2010-01-12 | 2016-06-01 | 安可美德藥物股份有限公司 | Wnt antagonists and methods of treatment and screening |
EP2556086B1 (en) * | 2010-04-09 | 2015-03-04 | Amgen Inc. | Btnl9 proteins, nucleic acids, and antibodies and uses thereof |
US20110301103A1 (en) | 2010-06-05 | 2011-12-08 | Chugh Sumant S | Methods of Treatment |
US9139629B2 (en) | 2010-06-05 | 2015-09-22 | The Uab Research Foundation | Methods for treatment of nephrotic syndrome and related conditions |
US8551479B2 (en) | 2010-09-10 | 2013-10-08 | Oncomed Pharmaceuticals, Inc. | Methods for treating melanoma |
CN102569428B (en) * | 2010-12-21 | 2015-06-03 | 上海华虹宏力半导体制造有限公司 | Longitudinal voltage-controlled varactor and preparation method thereof |
HUE042192T2 (en) | 2011-09-23 | 2019-06-28 | Oncomed Pharm Inc | Vegf/dll4 binding agents and uses thereof |
WO2013059426A1 (en) * | 2011-10-21 | 2013-04-25 | The Regents Of The University Of California | Human endogenous retrovirus peptides, antibodies to the peptides, and methods of use thereof |
US9443007B2 (en) | 2011-11-02 | 2016-09-13 | Salesforce.Com, Inc. | Tools and techniques for extracting knowledge from unstructured data retrieved from personal data sources |
ITUD20110196A1 (en) * | 2011-12-02 | 2013-06-03 | Asoltech S R L | COMPOSITION BASED ON UBIDECARENONE |
BR112014018427B1 (en) | 2012-01-27 | 2021-11-03 | Biomarin Technologies B.V. | RNA MODULATOR OLIGONUCLEOTIDES WITH IMPROVED FEATURES FOR THE TREATMENT OF DUCHENNE AND BECKER'S MUSCULAR DYSTROPHY |
JP2015518829A (en) | 2012-05-14 | 2015-07-06 | バイオジェン・エムエイ・インコーポレイテッドBiogen MA Inc. | LINGO-2 antagonist for treatment of conditions involving motor neurons |
US20140035949A1 (en) * | 2012-08-03 | 2014-02-06 | Tempo Ai, Inc. | Method and apparatus for enhancing a calendar view on a device |
EP2911691B1 (en) | 2012-10-23 | 2018-10-10 | OncoMed Pharmaceuticals, Inc. | Methods of treating neuroendocrine tumors using wnt pathway-binding agents |
JP6371294B2 (en) | 2012-10-31 | 2018-08-08 | オンコメッド ファーマシューティカルズ インコーポレイテッド | Methods and monitoring of treatment with DLL4 antagonists |
JP2016510411A (en) | 2013-02-04 | 2016-04-07 | オンコメッド ファーマシューティカルズ インコーポレイテッド | Methods and monitoring of treatment with WNT pathway inhibitors |
US9168300B2 (en) | 2013-03-14 | 2015-10-27 | Oncomed Pharmaceuticals, Inc. | MET-binding agents and uses thereof |
AU2014236769B2 (en) | 2013-03-15 | 2018-09-27 | Amgen Inc. | Heterodimeric bispecific antibodies |
WO2015048272A1 (en) | 2013-09-25 | 2015-04-02 | Amgen Inc. | V-c-fc-v-c antibody |
US10367649B2 (en) | 2013-11-13 | 2019-07-30 | Salesforce.Com, Inc. | Smart scheduling and reporting for teams |
AU2015323313B2 (en) | 2014-09-25 | 2021-04-01 | Amgen Inc. | Protease-activatable bispecific proteins |
WO2016070051A2 (en) | 2014-10-31 | 2016-05-06 | Oncomed Pharmaceuticals, Inc. | Combination therapy for treatment of disease |
CA2973266A1 (en) | 2015-01-08 | 2016-07-14 | Biogen Ma Inc. | Lingo-1 antagonists and uses for treatment of demyelinating disorders |
JP7175760B2 (en) | 2015-09-07 | 2022-11-21 | ヘルムホルツ ツェントゥルム ミュンヘン ドイチェス フォルシュングスツェントゥルム フューア ゲズントハイト ウント ウムヴェルト (ゲーエムベーハー) | NOVEL IGFR-LIKE RECEPTOR AND USES THEREOF |
JP6967003B2 (en) | 2015-09-23 | 2021-11-17 | メレオ バイオファーマ 5 インコーポレイテッド | Methods and compositions for the treatment of cancer |
US20180061660A1 (en) * | 2016-08-26 | 2018-03-01 | Infineon Technologies Ag | Barrier Layer Formation Using Thermal Processing |
US11667697B2 (en) | 2016-10-19 | 2023-06-06 | Vanderbilt University | Human orthopoxvirus antibodies and methods of use therefor |
US11634486B2 (en) | 2016-12-23 | 2023-04-25 | Bluefin Biomedicine, Inc. | Anti-SEZ6L2 antibodies and antibody drug conjugates |
US20180196053A1 (en) * | 2017-01-10 | 2018-07-12 | Chang Gung Memorial Hospital, Linkou | Methods and kits for detecting cancer |
US11043305B1 (en) * | 2018-02-02 | 2021-06-22 | Immuneering Corporation | Systems and methods for rapid gene set enrichment analysis |
JP2022513406A (en) * | 2018-10-31 | 2022-02-07 | デリニア インコーポレイテッド | Multivalent regulatory T cell regulator |
JP2022535060A (en) | 2019-06-07 | 2022-08-04 | アムジエン・インコーポレーテツド | Bispecific binding constructs with selectively cleavable linkers |
CA3184351A1 (en) | 2020-06-04 | 2021-12-09 | Amgen Inc. | Bispecific binding constructs |
EP4255931A1 (en) | 2020-12-03 | 2023-10-11 | Amgen Inc. | Immunoglobuline constructs with multiple binding domains |
Family Cites Families (363)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US553637A (en) * | 1896-01-28 | bagnall | ||
US2929866A (en) * | 1953-10-30 | 1960-03-22 | Westinghouse Electric Corp | Television pickup tube |
GB937358A (en) * | 1961-11-13 | 1963-09-18 | Marconi Wireless Telegraph Co | Improvements in or relating to television scanning systems |
JPS4844279B1 (en) * | 1965-05-08 | 1973-12-24 | ||
US3515800A (en) * | 1966-05-10 | 1970-06-02 | Victor Company Of Japan | Television camera for selectively picking up scenes in color or monochromatically |
US3654090A (en) | 1968-09-24 | 1972-04-04 | Organon | Method for the determination of antigens and antibodies |
US3783190A (en) * | 1971-04-08 | 1974-01-01 | Gte Sylvania Inc | Aperture correction circuit for low light level television camera |
JPS5110986B2 (en) * | 1972-10-05 | 1976-04-08 | ||
GB1415827A (en) * | 1973-03-31 | 1975-11-26 | Schumacher Klimsch Co E | Photomechanical reproduction |
US4256833A (en) * | 1979-01-08 | 1981-03-17 | Majid Ali | Enzyme immunoassay for allergic disorders |
JPS57108866A (en) * | 1980-12-26 | 1982-07-07 | Fuji Xerox Co Ltd | Dichromatic copying machine |
US4554101A (en) * | 1981-01-09 | 1985-11-19 | New York Blood Center, Inc. | Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity |
US4433346A (en) * | 1982-03-31 | 1984-02-21 | Xerox Corporation | Raster input scanner |
US4491865A (en) * | 1982-09-29 | 1985-01-01 | Welch Allyn, Inc. | Image sensor assembly |
US4516153A (en) * | 1983-03-30 | 1985-05-07 | Rca Corporation | Composite video signal processing apparatus providing amplitude equalization |
US4816567A (en) * | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
DE3429548A1 (en) * | 1983-08-24 | 1985-05-15 | Kabushiki Kaisha Toshiba, Kawasaki, Kanagawa | COLOR CONTROL UNIT FOR AN IMAGE GENERATION DEVICE |
KR850004274A (en) * | 1983-12-13 | 1985-07-11 | 원본미기재 | Method for preparing erythropoietin |
US4608606A (en) * | 1984-03-15 | 1986-08-26 | Rca Corporation | CCD floating-element output stages providing low reset noise with single sampling |
US4658298A (en) * | 1984-05-30 | 1987-04-14 | El Planning System Ltd. | Portable type audio-visual sensory apparatus |
JPS612957A (en) * | 1984-06-18 | 1986-01-08 | Toyota Motor Corp | Hydraulic controller for power transmission gear with continuously variable transmission |
JPS6147919A (en) * | 1984-08-15 | 1986-03-08 | Olympus Optical Co Ltd | Optical system of endoscope |
JPS6142513U (en) * | 1984-08-23 | 1986-03-19 | 富士写真光機株式会社 | Endoscope |
US4599116A (en) * | 1984-11-08 | 1986-07-08 | Parker Chemical Company | Alkaline cleaning process |
US4879224A (en) * | 1985-01-10 | 1989-11-07 | Biogen, Inc. | DNA sequences, recombinant DNA molecules and processes for producing human phospholipase inhibitor polypeptides |
US4787927A (en) * | 1985-08-13 | 1988-11-29 | National Research Development Corporation | Fabrication of optical fibers |
JPH0522897Y2 (en) * | 1985-08-16 | 1993-06-11 | ||
JP2679014B2 (en) * | 1986-03-19 | 1997-11-19 | オリンパス光学工業株式会社 | Electronic endoscope device |
JPS6365840A (en) * | 1986-04-04 | 1988-03-24 | オリンパス光学工業株式会社 | Endoscope |
US4735501A (en) * | 1986-04-21 | 1988-04-05 | Identechs Corporation | Method and apparatus for fluid propelled borescopes |
JPH0664243B2 (en) * | 1986-04-30 | 1994-08-22 | オリンパス光学工業株式会社 | Endoscope |
DE3715417A1 (en) * | 1986-05-13 | 1987-11-19 | Olympus Optical Co | SEMICONDUCTOR IMAGE GENERATION DEVICE, AND ENDOSCOPE HERE EQUIPPED WITH IT |
JPS635722A (en) * | 1986-06-25 | 1988-01-11 | オリンパス光学工業株式会社 | Endoscope |
JP2812940B2 (en) * | 1986-09-01 | 1998-10-22 | オリンパス光学工業株式会社 | Endoscope |
US4946778A (en) * | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
US5013652A (en) * | 1986-10-14 | 1991-05-07 | Genex Corporation | Composite yeast vectors |
US4733937A (en) * | 1986-10-17 | 1988-03-29 | Welch Allyn, Inc. | Illuminating system for endoscope or borescope |
US4758891A (en) * | 1986-10-20 | 1988-07-19 | North American Philips Consumer Electronics Corp. | Method and apparatus for improving the rise and fall time of a video signal |
US4895431A (en) * | 1986-11-13 | 1990-01-23 | Olympus Optical Co., Ltd. | Method of processing endoscopic images |
US5011912A (en) * | 1986-12-19 | 1991-04-30 | Immunex Corporation | Hybridoma and monoclonal antibody for use in an immunoaffinity purification system |
US4727859A (en) * | 1986-12-29 | 1988-03-01 | Welch Allyn, Inc. | Right angle detachable prism assembly for borescope |
US4918521A (en) * | 1987-01-20 | 1990-04-17 | Olympus Optical Co., Ltd. | Solid state imaging apparatus |
JPS63316476A (en) * | 1987-06-18 | 1988-12-23 | Seiko Instr & Electronics Ltd | Semiconductor device and manufacture thereof |
US4796607A (en) * | 1987-07-28 | 1989-01-10 | Welch Allyn, Inc. | Endoscope steering section |
US4794912A (en) * | 1987-08-17 | 1989-01-03 | Welch Allyn, Inc. | Borescope or endoscope with fluid dynamic muscle |
US4786609A (en) * | 1987-10-05 | 1988-11-22 | North American Philips Corporation, Signetics Division | Method of fabricating field-effect transistor utilizing improved gate sidewall spacers |
US5021888A (en) * | 1987-12-18 | 1991-06-04 | Kabushiki Kaisha Toshiba | Miniaturized solid state imaging device |
JP2594627B2 (en) * | 1988-02-26 | 1997-03-26 | オリンパス光学工業株式会社 | Electronic endoscope device |
US5654270A (en) * | 1988-06-28 | 1997-08-05 | La Jolla Cancer Research Foundation | Use of fibromodulin to prevent or reduce dermal scarring |
US5583103A (en) * | 1988-06-28 | 1996-12-10 | La Jolla Cancer Research Foundation | Inhibition of transforming growth factor beta activity |
US4862253A (en) * | 1988-07-20 | 1989-08-29 | Welch Allyn, Inc. | Apparatus for converting a video processor |
US5089473A (en) * | 1988-08-29 | 1992-02-18 | Monsanto Company | Somatotropin variants and their use |
US4909600A (en) * | 1988-10-28 | 1990-03-20 | Welch Allyn, Inc. | Light chopper assembly |
US5530101A (en) * | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5968778A (en) * | 1989-01-12 | 1999-10-19 | Jurgen Hoppe | PDGF-AB, preparation process and pharmaceuticals containing them |
JP2751320B2 (en) * | 1989-02-21 | 1998-05-18 | 日本電気株式会社 | Emitter follower circuit |
US5116964A (en) * | 1989-02-23 | 1992-05-26 | Genentech, Inc. | Hybrid immunoglobulins |
US4993405A (en) * | 1989-05-15 | 1991-02-19 | Olympus Optical Co., Ltd. | Imaging apparatus |
US5014515A (en) * | 1989-05-30 | 1991-05-14 | Welch Allyn, Inc. | Hydraulic muscle pump |
US4913369A (en) * | 1989-06-02 | 1990-04-03 | Welch Allyn, Inc. | Reel for borescope insertion tube |
JPH0323832A (en) * | 1989-06-22 | 1991-01-31 | Toshiba Corp | Electric endoscope apparatus |
US5194596A (en) * | 1989-07-27 | 1993-03-16 | California Biotechnology Inc. | Production of vascular endothelial cell growth factor |
US5395760A (en) * | 1989-09-05 | 1995-03-07 | Immunex Corporation | DNA encoding tumor necrosis factor-α and -β receptors |
US4941456A (en) * | 1989-10-05 | 1990-07-17 | Welch Allyn, Inc. | Portable color imager borescope |
US4941454A (en) * | 1989-10-05 | 1990-07-17 | Welch Allyn, Inc. | Servo actuated steering mechanism for borescope or endoscope |
FR2654258A1 (en) * | 1989-11-03 | 1991-05-10 | Philips Nv | METHOD FOR MANUFACTURING A MITTED TRANSISTOR DEVICE HAVING A REVERSE "T" SHAPE ELECTRODE ELECTRODE |
JP2579372B2 (en) * | 1989-12-04 | 1997-02-05 | 日本テキサス・インスツルメンツ株式会社 | Low power imaging device |
US4971655A (en) * | 1989-12-26 | 1990-11-20 | Micron Technology, Inc. | Protection of a refractory metal silicide during high-temperature processing using a dual-layer cap of silicon dioxide and silicon nitride |
WO1991010727A1 (en) | 1990-01-22 | 1991-07-25 | La Jolla Cancer Research Foundation | Inhibitors of cell regulatory factors |
US5014600A (en) * | 1990-02-06 | 1991-05-14 | Welch Allyn, Inc. | Bistep terminator for hydraulic or pneumatic muscle |
US4998182A (en) * | 1990-02-08 | 1991-03-05 | Welch Allyn, Inc. | Connector for optical sensor |
US4981810A (en) * | 1990-02-16 | 1991-01-01 | Micron Technology, Inc. | Process for creating field effect transistors having reduced-slope, staircase-profile sidewall spacers |
US5536638A (en) * | 1990-04-18 | 1996-07-16 | N.V. Innogenetics S.A. | Hybridization probes derived from the spacer region between the 16S and 23S rRNA genes for the detection of Neisseria gonorrhoeae |
US5126283A (en) * | 1990-05-21 | 1992-06-30 | Motorola, Inc. | Process for the selective encapsulation of an electrically conductive structure in a semiconductor device |
US5019121A (en) * | 1990-05-25 | 1991-05-28 | Welch Allyn, Inc. | Helical fluid-actuated torsional motor |
US4989581A (en) * | 1990-06-01 | 1991-02-05 | Welch Allyn, Inc. | Torsional strain relief for borescope |
US5018506A (en) * | 1990-06-18 | 1991-05-28 | Welch Allyn, Inc. | Fluid controlled biased bending neck |
US5203319A (en) * | 1990-06-18 | 1993-04-20 | Welch Allyn, Inc. | Fluid controlled biased bending neck |
JPH0456341A (en) * | 1990-06-26 | 1992-02-24 | Matsushita Electric Ind Co Ltd | Semiconductor integrated circuit layout method |
US5306655A (en) * | 1990-07-24 | 1994-04-26 | Matsushita Electric Industrial Co., Ltd. | Structure and method of manufacture for MOS field effect transistor having lightly doped drain and source diffusion regions |
US5114636A (en) * | 1990-07-31 | 1992-05-19 | Welch Allyn, Inc. | Process for reducing the internal cross section of elastomeric tubing |
US5018436A (en) * | 1990-07-31 | 1991-05-28 | Welch Allyn, Inc. | Folded bladder for fluid dynamic muscle |
JP3216650B2 (en) * | 1990-08-27 | 2001-10-09 | オリンパス光学工業株式会社 | Solid-state imaging device |
JPH0817235B2 (en) * | 1990-08-29 | 1996-02-21 | 株式会社東芝 | Offset gate structure transistor and manufacturing method thereof |
US5418566A (en) * | 1990-09-10 | 1995-05-23 | Kabushiki Kaisha Toshiba | Compact imaging apparatus for electronic endoscope with improved optical characteristics |
DE4037837A1 (en) * | 1990-11-28 | 1992-06-04 | Behringwerke Ag | CELL-FREE RECEPTOR BINDING TESTS, THEIR PRODUCTION AND USE |
WO1992010518A1 (en) | 1990-12-07 | 1992-06-25 | Yale University | Purified slit protein and sequence elements thereof |
DE69121535T2 (en) * | 1990-12-07 | 1997-01-02 | At & T Corp | Field effect transistor with inverse T-shaped silicide gate electrode |
US5291151A (en) * | 1991-01-19 | 1994-03-01 | Canon Kabushiki Kaisha | Sensor amplifier |
US5994088A (en) * | 1991-03-08 | 1999-11-30 | Board Of Trustees Of The University Of Illinois | Methods and reagents for preparing and using immunological agents specific for P-glycoprotein |
JP3078085B2 (en) * | 1991-03-26 | 2000-08-21 | オリンパス光学工業株式会社 | Image processing apparatus and image processing method |
JPH0595900A (en) * | 1991-04-11 | 1993-04-20 | Olympus Optical Co Ltd | Endoscope image processing device |
US5417210A (en) * | 1992-05-27 | 1995-05-23 | International Business Machines Corporation | System and method for augmentation of endoscopic surgery |
KR940006702B1 (en) * | 1991-06-14 | 1994-07-25 | 금성일렉트론 주식회사 | Manufacturing method of mosfet |
US5191879A (en) * | 1991-07-24 | 1993-03-09 | Welch Allyn, Inc. | Variable focus camera for borescope or endoscope |
KR960000225B1 (en) * | 1991-08-26 | 1996-01-03 | 가부시키가이샤 한도오따이 에네루기 겐큐쇼 | Making method of insulated gate type semiconductor device |
US5314834A (en) * | 1991-08-26 | 1994-05-24 | Motorola, Inc. | Field effect transistor having a gate dielectric with variable thickness |
US5445940A (en) * | 1991-08-28 | 1995-08-29 | Brigham & Women's Hospital | Methods and compositions for detecting and treating a subset of human patients having an autoimmune disease |
US5202758A (en) * | 1991-09-16 | 1993-04-13 | Welch Allyn, Inc. | Fluorescent penetrant measurement borescope |
US5565332A (en) * | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
JP3067347B2 (en) * | 1991-10-30 | 2000-07-17 | 株式会社島津製作所 | Gel-like bead sorting equipment |
US5187759A (en) * | 1991-11-07 | 1993-02-16 | At&T Bell Laboratories | High gain multi-mode optical amplifier |
US5932211A (en) * | 1991-11-12 | 1999-08-03 | Women's And Children's Hospital | Glycosylation variants of iduronate 2-sulfatase |
US5817310A (en) * | 1991-12-02 | 1998-10-06 | Cor Therapeutics, Inc. | Inhibitory immunoglobulin polypeptides to human PDGF beta receptor |
US5614943A (en) * | 1991-12-19 | 1997-03-25 | Olympus Optical Co., Ltd. | Dissimilar endoscopes usable with a common control unit |
US5278642A (en) * | 1992-02-26 | 1994-01-11 | Welch Allyn, Inc. | Color imaging system |
US5441883A (en) * | 1992-03-03 | 1995-08-15 | State Of Oregon, Acting By And Through The Oregon State Board Of Higher Education On Behalf Of The Oregon Health Sciences University | A3 adenosine receptor, DNA, and uses |
GB2264948B (en) * | 1992-03-13 | 1996-10-16 | Merck & Co Inc | Human adenosine receptors |
US5569662A (en) | 1992-03-23 | 1996-10-29 | Pfizer Inc. | Quinuclidine derivatives as substance P antagonists |
DE4211547C2 (en) * | 1992-04-06 | 1994-08-11 | Henke Sass Wolf Gmbh | Protective cover for the distal end of endoscopes |
US5306951A (en) * | 1992-05-14 | 1994-04-26 | Micron Technology, Inc. | Sidewall silicidation for improved reliability and conductivity |
US5762959A (en) * | 1992-05-29 | 1998-06-09 | Vivorx, Inc. | Microencapsulation of cells |
US5429821A (en) * | 1992-05-29 | 1995-07-04 | The Regents Of The University Of California | Non-fibrogenic high mannuronate alginate coated transplants, processes for their manufacture, and methods for their use |
EP0647270B1 (en) | 1992-06-22 | 2004-01-07 | Matritech, Inc. | Novel malignant cell type markers of the interior nuclear matrix |
US5874082A (en) * | 1992-07-09 | 1999-02-23 | Chiron Corporation | Humanized anti-CD40 monoclonal antibodies and fragments capable of blocking B cell proliferation |
GB9214857D0 (en) * | 1992-07-13 | 1992-08-26 | Medical Res Council | Human nucleic acid fragments and their use |
US5275152A (en) * | 1992-07-27 | 1994-01-04 | Welch Allyn, Inc. | Insertion tube terminator |
EP0671926B1 (en) * | 1992-08-11 | 2002-11-13 | President And Fellows Of Harvard College | Immunomodulatory peptides |
US5480805A (en) * | 1992-08-12 | 1996-01-02 | Amoco Corporation | Composition for modulating sterols in yeast |
US5322807A (en) * | 1992-08-19 | 1994-06-21 | At&T Bell Laboratories | Method of making thin film transistors including recrystallization and high pressure oxidation |
JPH06121678A (en) * | 1992-08-28 | 1994-05-06 | Hoechst Japan Ltd | Bone-related sulfatase-like protein and its production |
JP3472587B2 (en) * | 1992-08-28 | 2003-12-02 | アベンティス ファーマ株式会社 | Bone-related carboxypeptidase-like protein and method for producing the same |
US5262352A (en) * | 1992-08-31 | 1993-11-16 | Motorola, Inc. | Method for forming an interconnection structure for conductive layers |
DE69333969T2 (en) * | 1992-10-30 | 2006-09-14 | The General Hospital Corp., Boston | Interactive trap system for the isolation of proteins |
KR970011744B1 (en) * | 1992-11-04 | 1997-07-15 | 마쯔시다덴기산교 가부시기가이샤 | Mosfet of ldd type and a method for fabricating the same |
KR950011983B1 (en) * | 1992-11-23 | 1995-10-13 | 삼성전자주식회사 | Fabricating method of semiconductor device |
US5371026A (en) * | 1992-11-30 | 1994-12-06 | Motorola Inc. | Method for fabricating paired MOS transistors having a current-gain differential |
US5314070A (en) * | 1992-12-16 | 1994-05-24 | Welch Allyn, Inc. | Case for flexible borescope and endoscope insertion tubes |
JP3220538B2 (en) * | 1992-12-24 | 2001-10-22 | オリンパス光学工業株式会社 | Stereoscopic endoscope and stereoscopic endoscope device |
US5798224A (en) | 1992-12-29 | 1998-08-25 | Doheny Eye Institute | Nucleic acids encoding protocadherin |
JPH06214354A (en) * | 1993-01-14 | 1994-08-05 | Fuji Photo Film Co Ltd | Silver halide color photographic sensitive material and its processing method |
US5293836A (en) * | 1993-01-15 | 1994-03-15 | Ziggity Systems, Inc. | Water retaining trigger pin |
US5386344A (en) * | 1993-01-26 | 1995-01-31 | International Business Machines Corporation | Flex circuit card elastomeric cable connector assembly |
US5633675A (en) * | 1993-02-16 | 1997-05-27 | Welch Allyn, Inc, | Shadow probe |
US5674182A (en) * | 1993-02-26 | 1997-10-07 | Olympus Optical Co., Ltd. | Endoscope system including endoscope and protection cover |
USD358471S (en) * | 1993-03-11 | 1995-05-16 | Welch Allyn, Inc. | Combined control handle and viewing screen for an endoscope |
US5334556A (en) * | 1993-03-23 | 1994-08-02 | Texas Instruments Incorporated | Method for improving gate oxide integrity using low temperature oxidation during source/drain anneal |
AU6497694A (en) * | 1993-04-02 | 1994-10-24 | Ribogene, Inc. | Method for selective inactivation of viral replication |
US5536637A (en) * | 1993-04-07 | 1996-07-16 | Genetics Institute, Inc. | Method of screening for cDNA encoding novel secreted mammalian proteins in yeast |
US5323899A (en) * | 1993-06-01 | 1994-06-28 | Welch Allyn, Inc. | Case for video probe |
US5435296A (en) * | 1993-06-11 | 1995-07-25 | Welch Allyn, Inc. | Endoscope having crimped and soldered cable terminator |
US5382533A (en) * | 1993-06-18 | 1995-01-17 | Micron Semiconductor, Inc. | Method of manufacturing small geometry MOS field-effect transistors having improved barrier layer to hot electron injection |
GB9315011D0 (en) * | 1993-07-20 | 1993-09-01 | British Telecomm | Dispersion compensation |
US5439483A (en) * | 1993-10-21 | 1995-08-08 | Ventritex, Inc. | Method of quantifying cardiac fibrillation using wavelet transform |
US6983051B1 (en) * | 1993-11-18 | 2006-01-03 | Digimarc Corporation | Methods for audio watermarking and decoding |
US5439846A (en) * | 1993-12-17 | 1995-08-08 | Sgs-Thomson Microelectronics, Inc. | Self-aligned method for forming contact with zero offset to gate |
US5556767A (en) | 1993-12-22 | 1996-09-17 | Human Genome Sciences, Inc. | Polynucleotide encoding macrophage inflammatory protein γ |
US5552329A (en) * | 1994-01-05 | 1996-09-03 | Lg Semicon Co., Ltd. | Method of making metal oxide semiconductor transistors |
US5519003A (en) * | 1994-02-01 | 1996-05-21 | Board Of Trustees Of The Leland Stanford Junior University | WD-40-derived peptides and uses thereof |
JP3423761B2 (en) * | 1994-03-02 | 2003-07-07 | 東北パイオニア株式会社 | Optical wavelength converter |
US5712111A (en) * | 1994-04-15 | 1998-01-27 | Merck & Co., Inc. | DNA encoding bradykinin B1 receptor |
TW387560U (en) * | 1994-05-13 | 2000-04-11 | Prec Optics Coroporation | Viewing scope with image intensification |
KR0141195B1 (en) * | 1994-06-08 | 1998-07-15 | 김광호 | Fabrication method of semiconductor device having low-resistance gate electrod |
US5622701A (en) * | 1994-06-14 | 1997-04-22 | Protein Design Labs, Inc. | Cross-reacting monoclonal antibodies specific for E- and P-selectin |
JPH0829701A (en) * | 1994-07-18 | 1996-02-02 | Olympus Optical Co Ltd | Stereoscopic viewing endoscope system |
US5853975A (en) * | 1994-08-23 | 1998-12-29 | Millennium Pharmaceuticals, Inc. | Methods for identifying compositions for the treatment of body weight disorders, including obesity |
WO1999014328A2 (en) | 1997-09-17 | 1999-03-25 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US6068867A (en) * | 1994-11-02 | 2000-05-30 | Yissum Research Development Company Of The Hebrew University Of Jerusalem | Protective coatings for food and agricultural products |
US6221839B1 (en) * | 1994-11-14 | 2001-04-24 | Helsinki University Licensing Ltd. Oy | FIt4 ligand and methods of use |
US5888774A (en) * | 1994-12-19 | 1999-03-30 | Cangene Corporation | Recombinant DNA molecules and expression vectors for erythropoietin |
JPH08243078A (en) * | 1995-03-07 | 1996-09-24 | Fuji Photo Optical Co Ltd | Image pickup element assembly body of electronic endoscope |
US5730129A (en) * | 1995-04-03 | 1998-03-24 | General Electric Company | Imaging of interventional devices in a non-stationary subject |
GB9506954D0 (en) * | 1995-04-04 | 1995-05-24 | Street Graham S B | Method and apparatus for image enhancement |
US6008325A (en) * | 1995-04-19 | 1999-12-28 | Orion Diagnostica | Antibody to aminoterminal propeptide of type 1 procollagen |
EP0824589B1 (en) * | 1995-04-24 | 2003-12-10 | Medical Research Council | Utrophin gene promoter |
CA2221798A1 (en) * | 1995-06-06 | 1996-12-12 | Human Genome Sciences, Inc. | Colon specific genes and proteins |
US5684126A (en) * | 1995-06-06 | 1997-11-04 | The Johns Hopkins University School Of Medicine | Ebnerin: a secreted von Ebner's gland protein associated with taste buds |
US5627848A (en) * | 1995-09-05 | 1997-05-06 | Imra America, Inc. | Apparatus for producing femtosecond and picosecond pulses from modelocked fiber lasers cladding pumped with broad area diode laser arrays |
US6060879A (en) * | 1995-09-07 | 2000-05-09 | Core Engineering Inc. | Current magnitude sensing circuit |
ATE459715T1 (en) * | 1995-09-29 | 2010-03-15 | Univ Siena | REGULATED GENES AND THEIR USES |
KR0169376B1 (en) * | 1995-10-10 | 1999-03-20 | 김광호 | Multi-media ccd camera system |
JPH09124697A (en) * | 1995-11-01 | 1997-05-13 | Toagosei Co Ltd | Peptide and monoclonal antibody |
KR970049406A (en) * | 1995-12-15 | 1997-07-29 | 김광호 | Image processing device with graphic overlay speed improvement |
US6613544B1 (en) * | 1995-12-22 | 2003-09-02 | Amgen Inc. | Osteoprotegerin |
US6586570B1 (en) * | 1996-01-11 | 2003-07-01 | Corixa Corporation | Compositions and methods for the treatment and diagnosis of breast cancer |
US5867305A (en) * | 1996-01-19 | 1999-02-02 | Sdl, Inc. | Optical amplifier with high energy levels systems providing high peak powers |
US6300487B1 (en) * | 1996-03-19 | 2001-10-09 | Cell Therapuetics, Inc. | Mammalian lysophosphatidic acid acyltransferase |
CA2248136A1 (en) * | 1996-03-21 | 1997-09-25 | Human Genome Sciences, Inc. | Human endometrial specific steroid-binding factor i, ii and iii |
US6004780A (en) * | 1996-03-26 | 1999-12-21 | Human Genome Sciences, Inc. | Growth factor HTTER36 |
US5861248A (en) * | 1996-03-29 | 1999-01-19 | Urocor, Inc. | Biomarkers for detection of prostate cancer |
US5874254A (en) * | 1996-03-29 | 1999-02-23 | Director-General Of Agency Of Industrial Science And Technology | FGF-5 analogous protein, and pharmaceutical composition containing the same |
AU733322B2 (en) * | 1996-07-15 | 2001-05-10 | Chugai Seiyaku Kabushiki Kaisha | Novel VEGF-like factor |
US5734418A (en) * | 1996-07-17 | 1998-03-31 | Welch Allyn, Inc. | Endoscope with tab imager package |
US5754313A (en) * | 1996-07-17 | 1998-05-19 | Welch Allyn, Inc. | Imager assembly |
US5857963A (en) * | 1996-07-17 | 1999-01-12 | Welch Allyn, Inc. | Tab imager assembly for use in an endoscope |
US6111090A (en) * | 1996-08-16 | 2000-08-29 | Schering Corporation | Mammalian cell surface antigens; related reagents |
US6586210B1 (en) * | 1996-08-23 | 2003-07-01 | Human Genome Sciences, Inc. | Polynucleotides encoding T1 receptor like ligand II |
ES2251740T3 (en) * | 1996-08-23 | 2006-05-01 | Ludwig Institute For Cancer Research | GROWTH FACTOR OF VASCULAR D RECOMBINANT ENDOTHELIAL CELLS (VEGF-D). |
US6329197B2 (en) * | 1996-10-09 | 2001-12-11 | Synaptic Pharmaceutical Corporation | DNA encoding galanin GALR3 receptors and uses thereof |
RO120919B1 (en) * | 1996-10-25 | 2006-09-29 | G.D. Searle & Co. | Hematopoietic protein, nucleic acid molecule encoding the same, pharmaceutical composition and use of said protein |
US6632923B1 (en) * | 1996-11-27 | 2003-10-14 | Boston Heart Foundation, Inc. | Low density lipoprotein binding proteins and their use in diagnosing and treating atherosclerosis |
US6084461A (en) * | 1996-11-29 | 2000-07-04 | Varian Medical Systems, Inc. | Charge sensitive amplifier with high common mode signal rejection |
AU5902398A (en) * | 1996-12-31 | 1998-07-31 | Human Genome Sciences, Inc. | Cortistatin polypeptides |
AU6241698A (en) * | 1997-01-21 | 1998-08-07 | Human Genome Sciences, Inc. | Tace-like and matrilysin-like polypeptides |
US5840532A (en) * | 1997-01-21 | 1998-11-24 | Board Of Regents, The University Of Texas System | Neuronal bHLH-PAS domain proteins |
US5965397A (en) * | 1997-01-31 | 1999-10-12 | Genetics Institute, Inc. | Secreted proteins and polynucleotides encoding them |
US6130325A (en) * | 1997-02-14 | 2000-10-10 | Incyte Pharmaceuticals, Inc. | Human P24 vesicle proteins |
US5939271A (en) * | 1997-02-19 | 1999-08-17 | The Regents Of The University Of California | Netrin receptor |
JPH10295388A (en) * | 1997-02-28 | 1998-11-10 | Japan Tobacco Inc | Mammalian-derived, physiologically active protein |
WO2001034626A1 (en) | 1999-11-05 | 2001-05-17 | Human Genome Sciences, Inc. | 28 human secreted proteins |
WO1998056804A1 (en) | 1997-06-13 | 1998-12-17 | Human Genome Sciences, Inc. | 86 human secreted proteins |
US20030065139A1 (en) * | 1998-03-19 | 2003-04-03 | Craig A. Rosen | Secreted protein hmmbd35 |
WO1998039448A2 (en) | 1997-03-07 | 1998-09-11 | Human Genome Sciences, Inc. | 186 human secreted proteins |
US6420526B1 (en) * | 1997-03-07 | 2002-07-16 | Human Genome Sciences, Inc. | 186 human secreted proteins |
US7053190B2 (en) * | 1997-03-07 | 2006-05-30 | Human Genome Sciences, Inc. | Secreted protein HRGDF73 |
EP0972029A1 (en) * | 1997-03-07 | 2000-01-19 | Human Genome Sciences, Inc. | Human secreted proteins |
US5856139A (en) * | 1997-03-11 | 1999-01-05 | Incyte Pharmaceuticals, Inc. | Proline-rich acidic protein |
US5989909A (en) * | 1997-09-26 | 1999-11-23 | Millennium Biotherapeutics, Inc. | Huchordin and uses thereof |
JP2001522239A (en) * | 1997-03-21 | 2001-11-13 | ヒューマン ジノーム サイエンシーズ,インコーポレイテッド | 87 human secreted proteins |
US5925521A (en) * | 1997-03-31 | 1999-07-20 | Incyte Pharmaceuticals, Inc. | Human serine carboxypeptidase |
US20020137890A1 (en) | 1997-03-31 | 2002-09-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030004311A1 (en) * | 1997-06-18 | 2003-01-02 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US6088612A (en) * | 1997-04-04 | 2000-07-11 | Medtech Research Corporation | Method and apparatus for reflective glare removal in digital photography useful in cervical cancer detection |
US5877803A (en) * | 1997-04-07 | 1999-03-02 | Tritech Mircoelectronics International, Ltd. | 3-D image detector |
US20030162956A1 (en) * | 1997-04-07 | 2003-08-28 | Human Genome Sciences, Inc. | Leukocyte regulatory factors 1 and 2 |
US20010039335A1 (en) * | 1997-04-10 | 2001-11-08 | Kenneth Jacobs | Secreted proteins and polynucleotides encoding them |
US6084088A (en) * | 1997-05-06 | 2000-07-04 | Zymogenetics, Inc. | Polynucleotides encoding novel tumor antigens |
ATE361099T1 (en) * | 1997-05-15 | 2007-05-15 | Chugai Pharmaceutical Co Ltd | REMEDIES FOR CACHEXIA |
US5922567A (en) * | 1997-06-03 | 1999-07-13 | Incyte Pharmaceuticals, Inc. | Two new human DNAJ-like proteins |
US6525174B1 (en) * | 1997-06-06 | 2003-02-25 | Human Genome Sciences, Inc. | Precerebellin-like protein |
DE19726796A1 (en) * | 1997-06-24 | 1999-01-07 | Basf Ag | Propylene polymers |
US5818630A (en) * | 1997-06-25 | 1998-10-06 | Imra America, Inc. | Single-mode amplifiers and compressors based on multi-mode fibers |
AU8389498A (en) * | 1997-07-11 | 1999-02-08 | Eli Lilly And Company | Combinatorial process for preparing fused substituted pyrimidine libraries |
IL134011A0 (en) * | 1997-07-18 | 2001-04-30 | Zymogenetics Inc | Adipocyte-specific protein homologs |
US6060284A (en) * | 1997-07-25 | 2000-05-09 | Schering Corporation | DNA encoding interleukin-B30 |
WO1999006548A2 (en) * | 1997-08-01 | 1999-02-11 | Genset | 5'ESTs FOR NON TISSUE SPECIFIC SECRETED PROTEINS |
US6380370B1 (en) * | 1997-08-14 | 2002-04-30 | Genome Therapeutics Corporation | Nucleic acid and amino acid sequences relating to Staphylococcus epidermidis for diagnostics and therapeutics |
WO1999009061A1 (en) | 1997-08-21 | 1999-02-25 | Genetics Institute, Inc. | Secreted proteins |
US5876963A (en) * | 1997-08-27 | 1999-03-02 | Mitchell; Peter | Human nucleotide pyrophosphohydrolase |
US6211904B1 (en) * | 1997-09-11 | 2001-04-03 | Edwin L. Adair | Surgical devices incorporating reduced area imaging devices |
DK0968288T3 (en) * | 1997-10-06 | 2005-12-19 | Zymogenetics Inc | z219a, a human homolog for 2-19 protein |
US20030176681A1 (en) * | 1997-10-24 | 2003-09-18 | Ping Feng | 148 human secreted proteins |
EP1042674A4 (en) * | 1997-10-24 | 2005-03-23 | Human Genome Sciences Inc | 148 human secreted proteins |
US5932445A (en) | 1997-11-07 | 1999-08-03 | Incyte Pharmaceuticals, Inc. | Signal peptide-containing proteins |
US6548633B1 (en) * | 1998-12-22 | 2003-04-15 | Genset, S.A. | Complementary DNA's encoding proteins with signal peptides |
WO1999040189A2 (en) | 1998-02-09 | 1999-08-12 | Genset | Cdnas encoding secreted proteins |
US6573068B1 (en) * | 1997-11-13 | 2003-06-03 | Genset, S. A. | Claudin-50 protein |
US6025194A (en) * | 1997-11-19 | 2000-02-15 | Geron Corporation | Nucleic acid sequence of senescence asssociated gene |
US5972684A (en) * | 1997-11-25 | 1999-10-26 | Incyte Pharmaceuticals, Inc. | Carbonic anhydrase VIII |
US6194556B1 (en) * | 1997-12-11 | 2001-02-27 | Millennium Pharmaceuticals, Inc. | Angiotensin converting enzyme homolog and therapeutic and diagnostic uses therfor |
ES2251120T3 (en) * | 1997-12-17 | 2006-04-16 | Immunex Corporation | CELLULAR SURFACE GLICOPROTEINS ASSOCIATED WITH HUMAN B-LYMPHOMAS-ULBP, DNA AND POLYPEPTIDES. |
US6124095A (en) * | 1997-12-22 | 2000-09-26 | Incyte Pharmaceuticals, Inc. | Human nucleotide pyrophosphohydrolase-2 |
WO1999033963A1 (en) * | 1997-12-31 | 1999-07-08 | Chiron Corporation | Metastatic cancer regulated gene |
US6191809B1 (en) * | 1998-01-15 | 2001-02-20 | Vista Medical Technologies, Inc. | Method and apparatus for aligning stereo images |
US6607879B1 (en) * | 1998-02-09 | 2003-08-19 | Incyte Corporation | Compositions for the detection of blood cell and immunological response gene expression |
AU2783899A (en) * | 1998-02-26 | 1999-09-15 | Human Genome Sciences, Inc. | 36 human secreted proteins |
US6034975A (en) * | 1998-03-09 | 2000-03-07 | Imra America, Inc. | High power, passively modelocked fiber laser, and method of construction |
ES2312205T3 (en) | 1998-03-10 | 2009-02-16 | Genentech, Inc. | NEW POLYPEPTIDE AND NUCLEIC ACIDS THAT CODE IT. |
US6174687B1 (en) * | 1999-02-26 | 2001-01-16 | The Burnham Institute | Methods of identifying lung homing molecules using membrane dipeptidase |
US6245550B1 (en) * | 1998-03-20 | 2001-06-12 | Smithkline Beecham Corporation | Cytokine family member EF-7 |
US5945308A (en) * | 1998-04-03 | 1999-08-31 | Incyte Pharmaceuticals, Inc. | Human oxidized LDL receptor |
ATE474849T1 (en) * | 1998-04-14 | 2010-08-15 | Chugai Pharmaceutical Co Ltd | NEW CYTOKINE-LIKE PROTEIN |
DE19817948A1 (en) * | 1998-04-17 | 1999-10-21 | Metagen Gesellschaft Fuer Genomforschung Mbh | New nucleic acid sequences expressed in uterine cancer tissues, and derived polypeptides, for treatment of uterine and endometrial cancer and identification of therapeutic agents |
US6150502A (en) * | 1998-04-29 | 2000-11-21 | Genesis Research & Development Corporation Limited | Polypeptides expressed in skin cells |
US6573095B1 (en) * | 1998-04-29 | 2003-06-03 | Genesis Research & Development Corporation Limited | Polynucleotides isolated from skin cells |
CA2328895A1 (en) | 1998-06-02 | 1999-12-09 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US6800473B1 (en) * | 1998-06-05 | 2004-10-05 | Daiichi Fine Chemical Co., Ltd. | Human cathepsin L2 protein, gene encoding said protein and use thereof |
JP2002521055A (en) * | 1998-07-30 | 2002-07-16 | ヒューマン ジノーム サイエンシーズ, インコーポレイテッド | 98 human secreted proteins |
US20020182677A1 (en) * | 1998-08-03 | 2002-12-05 | Zymogenetics, Inc. | Pancreatic and ovarian polypeptide, zsig58 |
EP0978251B1 (en) * | 1998-08-07 | 2005-01-26 | Olympus Corporation | Endoscope capable of being autoclaved |
JP2002538762A (en) * | 1998-08-10 | 2002-11-19 | ジェネティックス・インスチチュート・インコーポレーテッド | Human chordin-related proteins and polynucleotides encoding them |
US6168920B1 (en) * | 1998-08-10 | 2001-01-02 | Incyte Genomics, Inc. | Extracellular adhesive proteins |
US20030096951A1 (en) * | 1998-08-14 | 2003-05-22 | Kenneth Jacobs | Secreted proteins and polynucleotides encoding them |
EP1107978A1 (en) | 1998-08-24 | 2001-06-20 | Alphagene, Inc. | Secreted proteins and polynucleotides encoding them |
EP1109821A4 (en) * | 1998-08-25 | 2002-04-03 | Human Genome Sciences Inc | 49 human secreted proteins |
NZ531664A (en) * | 1998-09-01 | 2005-07-29 | Genentech Inc | Pro1317 polypeptides and sequences thereof with homology to the semaphorin B glycoprotein family |
US7026448B2 (en) * | 1998-09-01 | 2006-04-11 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
AU6142899A (en) | 1998-09-10 | 2000-03-27 | Incyte Pharmaceuticals, Inc. | Human transferase proteins |
US6808895B1 (en) * | 1999-10-06 | 2004-10-26 | Incyte Corporation | DNA encoding oxidoreductase and polypeptide encoded thereby |
AU1231400A (en) * | 1998-10-28 | 2000-06-05 | Human Genome Sciences, Inc. | 12 human secreted proteins |
US6174311B1 (en) * | 1998-10-28 | 2001-01-16 | Sdgi Holdings, Inc. | Interbody fusion grafts and instrumentation |
US6214582B1 (en) * | 1998-11-16 | 2001-04-10 | The Research Foundation Of State University Of Ny | Y2H35 a strong IKK binding protein |
WO2000031275A1 (en) * | 1998-11-19 | 2000-06-02 | Azwell Inc. | Recombinant lysophosphatidic acid phosphatase |
US6275512B1 (en) * | 1998-11-25 | 2001-08-14 | Imra America, Inc. | Mode-locked multimode fiber laser pulse source |
WO2001053455A2 (en) | 1999-12-23 | 2001-07-26 | Hyseq, Inc. | Novel nucleic acids and polypeptides |
EP1143005A4 (en) * | 1998-12-09 | 2002-11-06 | Shionogi & Co | Human secretory phospholipase a 2? |
US6278042B1 (en) * | 1998-12-16 | 2001-08-21 | E.I. Du Pont De Nemours And Company | Plant arsenic transporters |
CA2348757A1 (en) | 1998-12-16 | 2000-06-22 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US6184514B1 (en) * | 1998-12-18 | 2001-02-06 | Eastman Kodak Company | Plastic cover for image sensors |
JP4632543B2 (en) * | 1998-12-21 | 2011-02-16 | ルードヴィッヒ インスティテュート フォー キャンサー リサーチ | Cleaved VEGF-D antibody and use thereof |
US6172361B1 (en) * | 1998-12-29 | 2001-01-09 | Cirrus Logic, Inc. | Methods for mounting an imager to a support structure and circuitry and systems embodying the same |
US20040132158A1 (en) * | 1999-01-11 | 2004-07-08 | Incyte Corporation | Human peptidases |
US6083152A (en) * | 1999-01-11 | 2000-07-04 | Welch Allyn, Inc. | Endoscopic insertion tube |
CA2360464A1 (en) * | 1999-01-11 | 2000-07-20 | Incyte Pharmaceuticals, Inc. | Human peptidases |
EP1144614A4 (en) | 1999-01-19 | 2003-08-06 | Human Genome Sciences Inc | 33 human secreted proteins |
WO2000043493A2 (en) * | 1999-01-22 | 2000-07-27 | Human Genome Sciences, Inc. | Metalloproteinase adam 22 |
US6492505B1 (en) * | 1999-02-01 | 2002-12-10 | Incyte Genomics, Inc. | Composition for detection of genes encoding membrane-associated proteins |
AU3430800A (en) | 1999-03-26 | 2000-10-16 | Smithkline Beecham Biologicals (Sa) | Novel compounds |
US6331427B1 (en) * | 1999-03-26 | 2001-12-18 | Millennium Pharmaceuticals, Inc. | Protease homologs |
CA2383592A1 (en) | 1999-03-31 | 2000-10-05 | Curagen Corporation | 2384891 acids including open reading frames encoding polypeptides; orfx |
EP1051037A3 (en) * | 1999-05-04 | 2001-08-29 | Everest-VIT, Inc. (a New Jersey Corporation) | Inspection system and method |
EP1179066A2 (en) * | 1999-05-19 | 2002-02-13 | Incyte Genomics, Inc. | Extracellular signaling molecules |
CA2373693A1 (en) * | 1999-05-20 | 2000-11-30 | Human Genome Sciences, Inc. | Seven transmembrane receptor genes |
US6186834B1 (en) * | 1999-06-08 | 2001-02-13 | Avaya Technology Corp. | Enhanced communication connector assembly with crosstalk compensation |
US6960651B2 (en) * | 1999-06-29 | 2005-11-01 | Millennium Pharmaceuticals, Inc. | TANGO 332 polypeptides |
US6696279B1 (en) * | 1999-07-01 | 2004-02-24 | University Of Tennessee Research Foundation | Purified and isolated Mat II β subunit nucleic acids and polypeptides and therapeutic and screening methods using same |
EP1130094A3 (en) | 1999-07-08 | 2001-11-21 | Helix Research Institute | Primers for synthesizing full length cDNA clones and their use |
US6951738B2 (en) * | 1999-07-16 | 2005-10-04 | Human Genome Sciences, Inc. | Human tumor necrosis factor receptors TR13 and TR14 |
US20050048623A1 (en) * | 1999-07-21 | 2005-03-03 | Incyte Corporation | Cell cycle and proliferation proteins |
EP1200587A2 (en) * | 1999-07-21 | 2002-05-02 | Incyte Genomics, Inc. | Receptors and associated proteins |
EP1074617A3 (en) | 1999-07-29 | 2004-04-21 | Research Association for Biotechnology | Primers for synthesising full-length cDNA and their use |
AU6181200A (en) * | 1999-07-29 | 2001-02-19 | Helix Research Institute | Stomach cancer-associated gene |
CA2311201A1 (en) * | 1999-08-05 | 2001-02-05 | Genset S.A. | Ests and encoded human proteins |
DE60041333D1 (en) * | 1999-08-12 | 2009-02-26 | Agensys Inc | HEN PROSTATE CANCER IS EXPRESSED AND ITS USES |
AU6590500A (en) * | 1999-08-16 | 2001-03-13 | Universita' Degli Studi Di Siena | Vegf-d and angiogenic use thereof |
US7090847B1 (en) * | 1999-09-09 | 2006-08-15 | Schering Corporation | Mammalian cytokines; related reagents and methods |
AU7603800A (en) * | 1999-09-24 | 2001-04-24 | Human Genome Sciences, Inc. | 32 human secreted proteins |
WO2001022920A2 (en) | 1999-09-29 | 2001-04-05 | Human Genome Sciences, Inc. | Colon and colon cancer associated polynucleotides and polypeptides |
AU7508100A (en) * | 1999-10-04 | 2001-05-10 | Jens Andersen | Human seizure related proteins |
WO2001025444A2 (en) * | 1999-10-07 | 2001-04-12 | Zymogenetics, Inc. | Novel human phosphodiesterase zcytor13 |
US6992170B2 (en) * | 1999-10-15 | 2006-01-31 | Curagen Corporation | Polypeptides and polynucleotides homologous to thymosin, ephrin a receptors, and fibromodulin |
AUPQ434899A0 (en) * | 1999-11-26 | 1999-12-23 | University Of Queensland, The | Novel polynucleotide and polypeptide |
CA2391455A1 (en) | 1999-12-01 | 2001-06-07 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
WO2001053312A1 (en) | 1999-12-23 | 2001-07-26 | Hyseq, Inc. | Novel nucleic acids and polypeptides |
US6569662B1 (en) * | 2000-01-21 | 2003-05-27 | Hyseq, Inc. | Nucleic acids and polypeptides |
GB0001898D0 (en) * | 2000-01-27 | 2000-03-22 | Smithkline Beecham Plc | Novel compounds |
WO2001055358A2 (en) * | 2000-01-28 | 2001-08-02 | Incyte Genomics, Inc. | Phosphodiesterases |
WO2001059064A2 (en) | 2000-01-31 | 2001-08-16 | Human Genome Sciences, Inc. | Nucleic acids, proteins, and antibodies |
WO2001055317A2 (en) | 2000-01-31 | 2001-08-02 | Human Genome Sciences, Inc. | Nucleic acids, proteins, and antibodies |
WO2001057190A2 (en) | 2000-02-03 | 2001-08-09 | Hyseq, Inc. | Novel nucleic acids and polypeptides |
EP1254236A2 (en) | 2000-02-11 | 2002-11-06 | Incyte Genomics, Inc. | Drug metabolizing enzymes |
WO2001060850A1 (en) | 2000-02-14 | 2001-08-23 | Smithkline Beecham Corporation | Novel compounds |
US20060160181A1 (en) * | 2000-02-15 | 2006-07-20 | Amgen Inc. | Fibroblast Growth Factor-23 molecules and uses thereof |
AU2001249125A1 (en) * | 2000-03-08 | 2001-09-17 | Chiron Corporation | Human fgf-23 gene and gene expression products |
AU2001287275A1 (en) * | 2000-03-24 | 2001-10-08 | Millenium Pharmaceuticals, Inc. | 33877 and 47179, novel human glycosyl transferase family members and uses thereof |
US6800455B2 (en) * | 2000-03-31 | 2004-10-05 | Scios Inc. | Secreted factors |
CA2405709A1 (en) | 2000-04-12 | 2001-10-25 | Human Genome Sciences, Inc. | Albumin fusion proteins |
US7264926B2 (en) * | 2000-04-18 | 2007-09-04 | Millennium Pharmaceuticals, Inc. | Nucleoside Phosphatase |
WO2001085942A2 (en) * | 2000-05-05 | 2001-11-15 | Incyte Genomics, Inc. | Cytoskeleton-associated proteins |
US7422743B2 (en) * | 2000-05-10 | 2008-09-09 | Schering Corporation | Mammalian receptor protein DCRS5;methods of treatment |
WO2001090304A2 (en) | 2000-05-19 | 2001-11-29 | Human Genome Sciences, Inc. | Nucleic acids, proteins, and antibodies |
EP1297112A2 (en) * | 2000-05-22 | 2003-04-02 | PHARMACIA & UPJOHN COMPANY | Novel matrix metalloproteinases |
US7190705B2 (en) * | 2000-05-23 | 2007-03-13 | Imra America. Inc. | Pulsed laser sources |
US6429127B1 (en) * | 2000-06-08 | 2002-08-06 | Micron Technology, Inc. | Methods for forming rough ruthenium-containing layers and structures/methods using same |
US6590470B1 (en) * | 2000-06-13 | 2003-07-08 | Welch Allyn, Inc. | Cable compensator circuit for CCD video probe |
EP1176200A3 (en) * | 2000-06-20 | 2005-01-12 | Switch Biotech Aktiengesellschaft | Use of polyeptides or their encoding nucleic acids for the diagnosis or treatment of skin diseases or wound healing and their use in indentifying pharmacologically acitve substances |
CA2413186A1 (en) | 2000-06-30 | 2002-01-10 | Incyte Genomics, Inc. | Extracellular matrix and cell adhesion molecules |
KR20090036151A (en) * | 2000-07-19 | 2009-04-13 | 인디애나 유니버시티 리서치 앤드 테크놀로지 코포레이션 | Novel fibroblast growth factor (fgf23) and methods for use |
US6812339B1 (en) * | 2000-09-08 | 2004-11-02 | Applera Corporation | Polymorphisms in known genes associated with human disease, methods of detection and uses thereof |
US6492281B1 (en) * | 2000-09-22 | 2002-12-10 | Advanced Micro Devices, Inc. | Method of fabricating conductor structures with metal comb bridging avoidance |
US20030143686A1 (en) * | 2000-09-29 | 2003-07-31 | Incyte Genomics, Inc. | Transferases |
US6531297B2 (en) * | 2000-10-20 | 2003-03-11 | Applera Corporation | Isolated human drug-metabolizing proteins, nucleic acid molecules encoding human drug-metabolizing proteins, and uses thereof |
US20030130485A1 (en) * | 2000-11-14 | 2003-07-10 | Meyers Rachel E. | Novel human genes and methods of use thereof |
EP1661986A1 (en) | 2000-11-17 | 2006-05-31 | Nuvelo, Inc. | Nucleic acids and polypeptides enocoded thereby that are member of the kallikrein gene familyNovel nucleic acids and polypeptides |
EP1397495A2 (en) | 2000-12-21 | 2004-03-17 | Millenium Pharmaceuticals, Inc. | 22437, a human sulfatase and uses therefor |
US20030148920A1 (en) | 2000-12-27 | 2003-08-07 | Steven Rosen | Sulfatases and methods of use thereof |
US7262797B2 (en) * | 2001-02-22 | 2007-08-28 | Ge Inspection Technologies Lp | Method and system for storing calibration data within image files |
CA2433474A1 (en) * | 2001-02-23 | 2002-09-06 | Human Genome Sciences, Inc. | 70 human secreted proteins |
US6536637B1 (en) | 2001-03-16 | 2003-03-25 | Mclaughlin Marty E. | Combination backpack and water container |
JP2005506049A (en) * | 2001-03-30 | 2005-03-03 | インサイト・ゲノミックス・インコーポレイテッド | Secreted protein |
US7436435B2 (en) * | 2001-10-01 | 2008-10-14 | Minolta Co., Ltd. | Image taking device having image-blur compensator |
US6841087B2 (en) * | 2002-04-19 | 2005-01-11 | Korea Institute Of Science And Technology | Refrigerant composition comprising difluoromethane, 1,1,1-trifluoroethane and 1,1,1,2-tetrafluoroethane |
WO2004042009A2 (en) * | 2002-10-30 | 2004-05-21 | Genentech, Inc. | Inhibition of il-17 production |
US20050129108A1 (en) * | 2003-01-29 | 2005-06-16 | Everest Vit, Inc. | Remote video inspection system |
WO2004071517A2 (en) * | 2003-02-06 | 2004-08-26 | Schering Corporation | Uses of il-23 related reagents |
DK1601694T3 (en) * | 2003-03-10 | 2009-12-14 | Schering Corp | Uses of IL23 antagonists, related reagents |
US20050050707A1 (en) * | 2003-09-05 | 2005-03-10 | Scott Joshua Lynn | Tip tool |
KR20060116834A (en) | 2003-11-20 | 2006-11-15 | 제넨테크, 인크. | Compositions and methods for the diagnosis and treatment of tumor |
US20050162643A1 (en) * | 2004-01-22 | 2005-07-28 | Thomas Karpen | Automotive fuel tank inspection device |
BRPI0507794A (en) * | 2004-02-17 | 2007-07-17 | Schering Corp | methods of modulating il-23 activity, related reagents |
US20050287593A1 (en) * | 2004-05-03 | 2005-12-29 | Schering Corporation | Use of cytokine expression to predict skin inflammation; methods of treatment |
US20060050983A1 (en) * | 2004-09-08 | 2006-03-09 | Everest Vit, Inc. | Method and apparatus for enhancing the contrast and clarity of an image captured by a remote viewing device |
EP1853707A2 (en) * | 2004-12-20 | 2007-11-14 | Schering Corporation | Uses of il-23 antagonists in the treatment of diabetes mellitus |
-
2001
- 2001-11-14 US US09/990,456 patent/US20020137890A1/en not_active Abandoned
-
2002
- 2002-04-11 US US10/121,059 patent/US20030190721A1/en not_active Abandoned
- 2002-04-11 US US10/121,041 patent/US20030077776A1/en not_active Abandoned
- 2002-04-11 US US10/121,040 patent/US20030082759A1/en not_active Abandoned
- 2002-04-11 US US10/121,045 patent/US20030073210A1/en not_active Abandoned
- 2002-04-11 US US10/121,051 patent/US20030092147A1/en not_active Abandoned
- 2002-04-11 US US10/121,046 patent/US20030194791A1/en not_active Abandoned
- 2002-04-11 US US10/121,047 patent/US20030077778A1/en not_active Abandoned
- 2002-04-11 US US10/121,042 patent/US20030096386A1/en not_active Abandoned
- 2002-04-11 US US10/121,044 patent/US20030190717A1/en not_active Abandoned
- 2002-04-12 US US10/121,048 patent/US20030199051A1/en not_active Abandoned
- 2002-04-12 US US10/121,043 patent/US7220831B2/en not_active Expired - Lifetime
- 2002-04-12 US US10/121,057 patent/US20030190719A1/en not_active Abandoned
- 2002-04-12 US US10/121,054 patent/US20030199054A1/en not_active Abandoned
- 2002-04-12 US US10/121,053 patent/US20030199053A1/en not_active Abandoned
- 2002-04-12 US US10/121,055 patent/US20030190718A1/en not_active Abandoned
- 2002-04-12 US US10/121,062 patent/US20030077779A1/en not_active Abandoned
- 2002-04-12 US US10/121,063 patent/US20030199055A1/en not_active Abandoned
- 2002-04-12 US US10/121,061 patent/US20030082761A1/en not_active Abandoned
- 2002-04-12 US US10/121,058 patent/US20030190720A1/en not_active Abandoned
- 2002-04-12 US US10/121,056 patent/US20030082760A1/en not_active Abandoned
- 2002-04-12 US US10/121,060 patent/US20030190722A1/en not_active Abandoned
- 2002-04-12 US US10/121,052 patent/US20030199052A1/en not_active Abandoned
- 2002-04-12 US US10/121,050 patent/US20030054516A1/en not_active Abandoned
- 2002-04-15 US US10/123,109 patent/US20030190723A1/en not_active Abandoned
- 2002-04-15 US US10/123,236 patent/US20030068795A1/en not_active Abandoned
- 2002-04-15 US US10/123,215 patent/US7291329B2/en not_active Expired - Lifetime
- 2002-04-15 US US10/123,108 patent/US7635478B2/en not_active Expired - Fee Related
- 2002-04-15 US US10/123,261 patent/US20030068796A1/en not_active Abandoned
- 2002-04-15 US US10/123,262 patent/US20030049816A1/en not_active Abandoned
- 2002-04-15 US US10/123,157 patent/US20030190725A1/en not_active Abandoned
- 2002-04-15 US US10/123,212 patent/US7276577B2/en not_active Expired - Lifetime
- 2002-04-15 US US10/123,322 patent/US7700736B2/en not_active Expired - Lifetime
- 2002-04-15 US US10/123,156 patent/US20030194792A1/en not_active Abandoned
- 2002-04-15 US US10/123,155 patent/US20030068794A1/en not_active Abandoned
- 2002-04-15 US US10/123,771 patent/US20030199060A1/en not_active Abandoned
- 2002-04-15 US US10/123,291 patent/US20030199058A1/en not_active Abandoned
- 2002-04-15 US US10/123,322 patent/US20030199059A1/en active Granted
- 2002-04-15 US US10/123,213 patent/US20030199057A1/en active Granted
- 2002-04-15 US US10/123,214 patent/US7343721B2/en not_active Expired - Fee Related
- 2002-04-15 US US10/123,235 patent/US20030082762A1/en not_active Abandoned
- 2002-04-15 US US10/123,292 patent/US20030073211A1/en active Granted
- 2002-04-15 US US10/123,154 patent/US20030190724A1/en not_active Abandoned
- 2002-04-16 US US10/123,911 patent/US7408032B2/en not_active Expired - Lifetime
- 2002-04-16 US US10/123,912 patent/US20030100087A1/en not_active Abandoned
- 2002-04-16 US US10/123,908 patent/US7335728B2/en not_active Expired - Lifetime
- 2002-04-16 US US10/123,902 patent/US20030077781A1/en not_active Abandoned
- 2002-04-16 US US10/123,907 patent/US7084258B2/en not_active Expired - Fee Related
- 2002-04-16 US US10/123,903 patent/US20030073212A1/en not_active Abandoned
- 2002-04-16 US US10/123,913 patent/US20030203462A1/en not_active Abandoned
- 2002-04-16 US US10/123,909 patent/US7193049B2/en not_active Expired - Lifetime
- 2002-04-16 US US10/123,906 patent/US20030190726A1/en not_active Abandoned
- 2002-04-16 US US10/123,904 patent/US20030022328A1/en not_active Abandoned
- 2002-04-16 US US10/123,910 patent/US7329404B2/en not_active Expired - Lifetime
- 2002-04-17 US US10/124,821 patent/US20030199023A1/en not_active Abandoned
- 2002-04-17 US US10/124,818 patent/US20030082763A1/en not_active Abandoned
- 2002-04-17 US US10/124,815 patent/US7342096B2/en not_active Expired - Lifetime
- 2002-04-17 US US10/124,814 patent/US7105335B2/en not_active Expired - Lifetime
- 2002-04-17 US US10/125,805 patent/US20030194794A1/en not_active Abandoned
- 2002-04-17 US US10/124,819 patent/US7285626B2/en not_active Expired - Lifetime
- 2002-04-17 US US10/124,822 patent/US7109305B2/en not_active Expired - Lifetime
- 2002-04-17 US US10/125,704 patent/US7357926B2/en not_active Expired - Lifetime
- 2002-04-17 US US10/124,816 patent/US20030190728A1/en not_active Abandoned
- 2002-04-17 US US10/124,824 patent/US20030077659A1/en not_active Abandoned
- 2002-04-17 US US10/124,813 patent/US7312307B2/en not_active Expired - Lifetime
- 2002-04-17 US US10/124,823 patent/US20030199062A1/en not_active Abandoned
- 2002-04-17 US US10/125,795 patent/US7304131B2/en not_active Expired - Lifetime
- 2002-04-17 US US10/124,817 patent/US20030077786A1/en not_active Abandoned
- 2002-04-17 US US10/124,820 patent/US20030190729A1/en not_active Abandoned
- 2002-04-19 US US10/125,921 patent/US7312313B2/en not_active Expired - Lifetime
- 2002-04-19 US US10/125,932 patent/US7317079B2/en not_active Expired - Fee Related
- 2002-04-19 US US10/125,926 patent/US20030082686A1/en not_active Abandoned
- 2002-04-19 US US10/125,931 patent/US20030199063A1/en not_active Abandoned
- 2002-04-19 US US10/125,924 patent/US7342097B2/en not_active Expired - Lifetime
- 2002-04-19 US US10/125,928 patent/US20030087349A1/en not_active Abandoned
- 2002-04-19 US US10/125,927 patent/US20030190731A1/en not_active Abandoned
- 2002-04-19 US US10/125,930 patent/US7291700B2/en not_active Expired - Lifetime
- 2002-04-19 US US10/125,922 patent/US7309762B2/en not_active Expired - Lifetime
- 2002-04-19 US US10/125,923 patent/US20030087348A1/en not_active Abandoned
- 2002-04-22 US US10/127,849 patent/US20030082697A1/en not_active Abandoned
- 2002-04-22 US US10/127,841 patent/US20030087361A1/en not_active Abandoned
- 2002-04-22 US US10/127,835 patent/US20030077712A1/en not_active Abandoned
- 2002-04-22 US US10/127,842 patent/US20030082692A1/en not_active Abandoned
- 2002-04-22 US US10/127,824 patent/US20030087352A1/en not_active Abandoned
- 2002-04-22 US US10/127,827 patent/US20030087354A1/en not_active Abandoned
- 2002-04-22 US US10/127,828 patent/US20030087355A1/en not_active Abandoned
- 2002-04-22 US US10/127,834 patent/US20030087359A1/en not_active Abandoned
- 2002-04-22 US US10/127,852 patent/US20030203428A1/en not_active Abandoned
- 2002-04-22 US US10/127,833 patent/US20030087358A1/en not_active Abandoned
- 2002-04-22 US US10/127,838 patent/US20030082691A1/en not_active Abandoned
- 2002-04-22 US US10/127,850 patent/US20030082698A1/en not_active Abandoned
- 2002-04-22 US US10/127,901 patent/US7342098B2/en not_active Expired - Fee Related
- 2002-04-22 US US10/127,837 patent/US20030082690A1/en not_active Abandoned
- 2002-04-22 US US10/127,845 patent/US20030082694A1/en not_active Abandoned
- 2002-04-22 US US10/127,848 patent/US20030082696A1/en not_active Abandoned
- 2002-04-22 US US10/127,821 patent/US20030087350A1/en not_active Abandoned
- 2002-04-22 US US10/127,836 patent/US7432345B2/en not_active Expired - Lifetime
- 2002-04-22 US US10/127,825 patent/US20030077710A1/en not_active Abandoned
- 2002-04-22 US US10/127,900 patent/US20030203429A1/en not_active Abandoned
- 2002-04-22 US US10/127,840 patent/US20030153033A1/en not_active Abandoned
- 2002-04-22 US US10/127,830 patent/US7351793B2/en not_active Expired - Lifetime
- 2002-04-22 US US10/127,832 patent/US20030087357A1/en not_active Abandoned
- 2002-04-22 US US10/127,822 patent/US7371827B2/en not_active Expired - Lifetime
- 2002-04-22 US US10/127,851 patent/US7348414B2/en not_active Expired - Fee Related
- 2002-04-22 US US10/127,831 patent/US20030082689A1/en not_active Abandoned
- 2002-04-22 US US10/127,844 patent/US7566774B2/en not_active Expired - Lifetime
- 2002-04-22 US US10/127,826 patent/US7309763B2/en not_active Expired - Lifetime
- 2002-04-22 US US10/127,829 patent/US20030077711A1/en not_active Abandoned
- 2002-04-22 US US10/127,839 patent/US7449554B2/en not_active Expired - Lifetime
- 2002-04-22 US US10/127,843 patent/US20030082693A1/en not_active Abandoned
- 2002-04-22 US US10/127,847 patent/US20030119103A1/en not_active Abandoned
- 2002-04-22 US US10/127,846 patent/US20030082695A1/en not_active Abandoned
- 2002-04-23 US US10/128,691 patent/US7319135B2/en not_active Expired - Lifetime
- 2002-04-23 US US10/128,684 patent/US20030082700A1/en not_active Abandoned
- 2002-04-23 US US10/128,685 patent/US20030203430A1/en not_active Abandoned
- 2002-04-23 US US10/128,689 patent/US20030087365A1/en not_active Abandoned
- 2002-04-23 US US10/128,688 patent/US7323544B2/en not_active Expired - Fee Related
- 2002-04-23 US US10/128,692 patent/US7704496B2/en active Active
- 2002-04-23 US US10/128,686 patent/US7345146B2/en not_active Expired - Fee Related
- 2002-04-23 US US10/128,690 patent/US20030082702A1/en not_active Abandoned
- 2002-04-23 US US10/128,694 patent/US7189813B2/en not_active Expired - Lifetime
- 2002-04-23 US US10/128,687 patent/US20030087363A1/en not_active Abandoned
- 2002-04-23 US US10/128,693 patent/US7355006B2/en not_active Expired - Lifetime
- 2002-04-24 US US10/131,825 patent/US7282566B2/en not_active Expired - Lifetime
- 2002-04-24 US US10/131,833 patent/US7141652B1/en not_active Expired - Fee Related
- 2002-04-24 US US10/131,836 patent/US7351794B2/en not_active Expired - Lifetime
- 2002-04-24 US US10/131,813 patent/US7279551B2/en not_active Expired - Lifetime
- 2002-04-24 US US10/131,829 patent/US20030082705A1/en not_active Abandoned
- 2002-04-24 US US10/131,822 patent/US7189806B2/en not_active Expired - Lifetime
- 2002-04-24 US US10/131,821 patent/US20030092105A1/en not_active Abandoned
- 2002-04-24 US US10/131,824 patent/US7326413B2/en not_active Expired - Fee Related
- 2002-04-24 US US10/131,823 patent/US7304132B2/en not_active Expired - Lifetime
- 2002-04-24 US US10/131,830 patent/US20030077720A1/en not_active Abandoned
- 2002-04-24 US US10/131,837 patent/US7294495B2/en not_active Expired - Lifetime
- 2002-04-24 US US10/131,820 patent/US7312314B2/en not_active Expired - Lifetime
- 2002-04-24 US US10/131,816 patent/US7361337B2/en not_active Expired - Lifetime
- 2002-04-24 US US10/131,819 patent/US7273926B2/en not_active Expired - Lifetime
- 2002-04-24 US US10/131,826 patent/US7202345B2/en not_active Expired - Lifetime
- 2002-04-24 US US10/131,818 patent/US7166703B2/en not_active Expired - Fee Related
- 2002-04-24 US US10/131,815 patent/US20030092103A1/en not_active Abandoned
- 2002-04-24 US US10/131,828 patent/US7309777B2/en not_active Expired - Lifetime
- 2002-04-24 US US10/131,835 patent/US7294705B2/en not_active Expired - Lifetime
- 2002-04-24 US US10/131,817 patent/US7291701B2/en not_active Expired - Lifetime
- 2002-05-03 US US10/137,867 patent/US20030207349A1/en not_active Abandoned
- 2002-05-03 US US10/137,871 patent/US7323545B2/en not_active Expired - Lifetime
- 2002-05-03 US US10/137,872 patent/US20030077722A1/en not_active Abandoned
- 2002-05-03 US US10/137,873 patent/US20060084138A1/en not_active Abandoned
- 2002-05-03 US US10/137,864 patent/US7291715B2/en not_active Expired - Lifetime
- 2002-05-03 US US10/137,866 patent/US20030129689A1/en not_active Abandoned
- 2002-05-03 US US10/137,865 patent/US20030032155A1/en not_active Abandoned
- 2002-05-03 US US10/137,869 patent/US7282558B2/en not_active Expired - Lifetime
- 2002-05-03 US US10/137,870 patent/US20030138883A1/en not_active Abandoned
- 2002-05-03 US US10/137,868 patent/US20030082764A1/en not_active Abandoned
- 2002-05-06 US US10/140,021 patent/US7279552B2/en not_active Expired - Lifetime
- 2002-05-06 US US10/140,023 patent/US20030207416A1/en not_active Abandoned
- 2002-05-06 US US10/140,473 patent/US20030207351A1/en not_active Abandoned
- 2002-05-06 US US10/140,472 patent/US20030138888A1/en not_active Abandoned
- 2002-05-06 US US10/139,980 patent/US7247710B2/en not_active Expired - Lifetime
- 2002-05-06 US US10/140,022 patent/US7285627B2/en not_active Expired - Lifetime
- 2002-05-06 US US10/139,963 patent/US7288625B2/en not_active Expired - Lifetime
- 2002-05-06 US US10/140,020 patent/US20030207415A1/en not_active Abandoned
- 2002-05-06 US US10/140,024 patent/US20040058424A1/en not_active Abandoned
- 2002-05-06 US US10/140,470 patent/US20030022331A1/en active Granted
- 2002-05-06 US US10/140,470 patent/US7521539B2/en not_active Expired - Lifetime
- 2002-05-06 US US10/140,471 patent/US7291702B2/en not_active Expired - Lifetime
- 2002-05-06 US US10/140,474 patent/US20030032156A1/en not_active Abandoned
- 2002-05-06 US US10/140,019 patent/US20030148423A1/en not_active Abandoned
- 2002-05-06 US US10/140,018 patent/US20030138885A1/en not_active Abandoned
- 2002-05-06 US US10/140,274 patent/US20030143674A1/en not_active Abandoned
- 2002-05-07 US US10/140,921 patent/US7317080B2/en not_active Expired - Fee Related
- 2002-05-07 US US10/140,927 patent/US7495082B2/en not_active Expired - Lifetime
- 2002-05-07 US US10/140,810 patent/US20030207353A1/en not_active Abandoned
- 2002-05-07 US US10/140,928 patent/US20030068798A1/en not_active Abandoned
- 2002-05-07 US US10/140,809 patent/US20030207418A1/en not_active Abandoned
- 2002-05-07 US US10/140,862 patent/US7285628B2/en not_active Expired - Lifetime
- 2002-05-07 US US10/140,925 patent/US20030073215A1/en not_active Abandoned
- 2002-05-07 US US10/140,863 patent/US7288626B2/en not_active Expired - Lifetime
- 2002-05-07 US US10/140,860 patent/US7307151B2/en not_active Expired - Lifetime
- 2002-05-07 US US10/140,807 patent/US7335745B2/en not_active Expired - Lifetime
- 2002-05-07 US US10/140,808 patent/US7425621B2/en not_active Expired - Lifetime
- 2002-05-07 US US10/140,865 patent/US20030207420A1/en not_active Abandoned
- 2002-05-07 US US10/140,805 patent/US20030207417A1/en not_active Abandoned
- 2002-05-07 US US10/140,861 patent/US20030148425A1/en not_active Abandoned
- 2002-05-07 US US10/140,923 patent/US7282559B2/en not_active Expired - Lifetime
- 2002-05-07 US US10/140,922 patent/US7309765B2/en not_active Expired - Lifetime
- 2002-05-07 US US10/140,926 patent/US20030134356A1/en not_active Abandoned
- 2002-05-07 US US10/140,924 patent/US20030134355A1/en not_active Abandoned
- 2002-05-07 US US10/140,864 patent/US20030207419A1/en not_active Abandoned
- 2002-05-07 US US10/140,806 patent/US7309764B2/en not_active Expired - Lifetime
- 2002-05-08 US US10/141,700 patent/US7312308B2/en not_active Expired - Lifetime
- 2002-05-08 US US10/141,760 patent/US7342104B2/en not_active Expired - Fee Related
- 2002-05-08 US US10/141,698 patent/US7282560B2/en not_active Expired - Lifetime
- 2002-05-08 US US10/141,701 patent/US20030207421A1/en not_active Abandoned
- 2002-05-08 US US10/141,702 patent/US7294692B2/en not_active Expired - Lifetime
- 2002-05-08 US US10/141,697 patent/US7417123B2/en not_active Expired - Lifetime
- 2002-05-08 US US10/141,759 patent/US7291716B2/en not_active Expired - Lifetime
- 2002-05-08 US US10/141,762 patent/US20030207362A1/en not_active Abandoned
- 2002-05-08 US US10/141,755 patent/US7297764B2/en not_active Expired - Lifetime
- 2002-05-08 US US10/141,704 patent/US7396916B2/en not_active Expired - Lifetime
- 2002-05-08 US US10/141,756 patent/US7488586B2/en not_active Expired - Lifetime
- 2002-05-08 US US10/141,703 patent/US20030207357A1/en not_active Abandoned
- 2002-05-08 US US10/141,699 patent/US7390887B2/en not_active Expired - Lifetime
- 2002-05-08 US US10/141,705 patent/US7396906B2/en not_active Expired - Lifetime
- 2002-05-08 US US10/141,753 patent/US7323550B2/en not_active Expired - Lifetime
- 2002-05-08 US US10/141,761 patent/US7335729B2/en not_active Expired - Fee Related
- 2002-05-08 US US10/141,706 patent/US7425609B2/en not_active Expired - Lifetime
- 2002-05-08 US US10/141,757 patent/US7314920B2/en not_active Expired - Fee Related
- 2002-05-08 US US10/141,754 patent/US7361732B2/en not_active Expired - Lifetime
- 2002-05-08 US US10/141,758 patent/US7301007B2/en not_active Expired - Lifetime
- 2002-05-09 US US10/142,761 patent/US7306795B2/en not_active Expired - Lifetime
- 2002-05-09 US US10/142,420 patent/US20030148434A1/en not_active Abandoned
- 2002-05-09 US US10/143,035 patent/US7317081B2/en not_active Expired - Fee Related
- 2002-05-09 US US10/143,027 patent/US20030207366A1/en not_active Abandoned
- 2002-05-09 US US10/143,117 patent/US7318922B2/en not_active Expired - Lifetime
- 2002-05-09 US US10/142,421 patent/US7311909B2/en not_active Expired - Lifetime
- 2002-05-09 US US10/142,427 patent/US7294702B2/en not_active Expired - Lifetime
- 2002-05-09 US US10/142,426 patent/US20040048333A1/en not_active Abandoned
- 2002-05-09 US US10/142,428 patent/US20030207363A1/en not_active Abandoned
- 2002-05-09 US US10/142,422 patent/US7385030B2/en not_active Expired - Lifetime
- 2002-05-09 US US10/142,888 patent/US20030157606A1/en not_active Abandoned
- 2002-05-09 US US10/143,115 patent/US7309767B2/en not_active Expired - Lifetime
- 2002-05-09 US US10/142,887 patent/US7291717B2/en not_active Expired - Lifetime
- 2002-05-09 US US10/142,425 patent/US20030207424A1/en not_active Abandoned
- 2002-05-09 US US10/142,762 patent/US7288627B2/en not_active Expired - Lifetime
- 2002-05-09 US US10/142,889 patent/US20030194765A1/en not_active Abandoned
- 2002-05-09 US US10/143,118 patent/US7309768B2/en not_active Expired - Lifetime
- 2002-05-09 US US10/142,430 patent/US7309766B2/en not_active Expired - Lifetime
- 2002-05-09 US US10/142,432 patent/US7390877B2/en not_active Expired - Lifetime
- 2002-05-09 US US10/143,113 patent/US7329730B2/en not_active Expired - Lifetime
- 2002-05-09 US US10/143,034 patent/US7378502B2/en not_active Expired - Lifetime
- 2002-05-09 US US10/142,417 patent/US7304133B2/en not_active Expired - Lifetime
- 2002-05-09 US US10/143,114 patent/US20030036180A1/en not_active Abandoned
- 2002-05-09 US US10/143,116 patent/US7390486B2/en not_active Expired - Lifetime
- 2002-05-10 US US10/142,886 patent/US20030203432A1/en not_active Abandoned
- 2002-05-10 US US10/142,760 patent/US20030148437A1/en not_active Abandoned
- 2002-05-10 US US10/142,885 patent/US7718173B2/en not_active Expired - Lifetime
- 2002-05-10 US US10/142,763 patent/US7189807B2/en not_active Expired - Lifetime
- 2002-05-10 US US10/142,766 patent/US7390883B2/en not_active Expired - Lifetime
- 2002-05-10 US US10/143,032 patent/US7408033B2/en not_active Expired - Lifetime
- 2002-05-10 US US10/142,424 patent/US7297766B2/en not_active Expired - Lifetime
- 2002-05-10 US US10/142,423 patent/US20030049817A1/en not_active Abandoned
- 2002-05-10 US US10/142,884 patent/US20030207365A1/en not_active Abandoned
- 2002-05-10 US US10/142,419 patent/US7153941B2/en not_active Expired - Lifetime
- 2002-05-10 US US10/142,418 patent/US7297765B2/en not_active Expired - Lifetime
- 2002-05-10 US US10/142,764 patent/US20030180865A1/en not_active Abandoned
- 2002-05-10 US US10/142,429 patent/US20030207364A1/en not_active Abandoned
- 2002-05-10 US US10/142,765 patent/US20030157603A1/en not_active Abandoned
- 2002-05-10 US US10/142,767 patent/US7294693B2/en not_active Expired - Lifetime
- 2002-05-10 US US10/142,431 patent/US7285629B2/en not_active Expired - Lifetime
- 2002-05-10 US US10/143,033 patent/US20030134363A1/en not_active Abandoned
- 2002-05-13 US US10/144,957 patent/US20030157610A1/en not_active Abandoned
- 2002-05-13 US US10/144,993 patent/US20040038336A1/en not_active Abandoned
- 2002-05-13 US US10/144,958 patent/US7479545B2/en not_active Expired - Lifetime
- 2002-05-13 US US10/144,956 patent/US20030207368A1/en not_active Abandoned
- 2002-05-13 US US10/145,127 patent/US7355007B2/en not_active Expired - Lifetime
- 2002-05-13 US US10/144,992 patent/US20030157611A1/en not_active Abandoned
- 2002-05-13 US US10/145,090 patent/US20030157613A1/en not_active Abandoned
- 2002-05-13 US US10/145,091 patent/US20030157614A1/en not_active Abandoned
- 2002-05-13 US US10/145,015 patent/US7439325B2/en not_active Expired - Lifetime
- 2002-05-13 US US10/144,994 patent/US20030134364A1/en not_active Abandoned
- 2002-05-14 US US10/145,823 patent/US20030134368A1/en not_active Abandoned
- 2002-05-14 US US10/145,824 patent/US7411047B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,749 patent/US20030207371A1/en not_active Abandoned
- 2002-05-14 US US10/145,632 patent/US7385031B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,820 patent/US20030157623A1/en not_active Abandoned
- 2002-05-14 US US10/145,874 patent/US20030194766A1/en not_active Abandoned
- 2002-05-14 US US10/145,870 patent/US7294703B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,878 patent/US7317088B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,871 patent/US7396907B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,827 patent/US7304140B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,825 patent/US7335740B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,869 patent/US20030166078A1/en not_active Abandoned
- 2002-05-14 US US10/145,872 patent/US20030157624A1/en not_active Abandoned
- 2002-05-14 US US10/145,826 patent/US7375195B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,634 patent/US20030170788A1/en not_active Abandoned
- 2002-05-14 US US10/145,821 patent/US20030148438A1/en not_active Abandoned
- 2002-05-14 US US10/145,626 patent/US7429640B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,818 patent/US20030157622A1/en not_active Abandoned
- 2002-05-14 US US10/145,625 patent/US20030180868A1/en not_active Abandoned
- 2002-05-14 US US10/145,631 patent/US7371824B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,877 patent/US7411040B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,628 patent/US7285636B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,746 patent/US20030134366A1/en not_active Abandoned
- 2002-05-14 US US10/145,748 patent/US7354998B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,754 patent/US20030157620A1/en not_active Abandoned
- 2002-05-14 US US10/145,629 patent/US7285644B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,822 patent/US20030166075A1/en not_active Abandoned
- 2002-05-14 US US10/145,750 patent/US7417115B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,752 patent/US7319136B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,751 patent/US20030166074A1/en not_active Abandoned
- 2002-05-14 US US10/145,747 patent/US20030157618A1/en not_active Abandoned
- 2002-05-14 US US10/145,755 patent/US7312312B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,960 patent/US7317074B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,961 patent/US20040235092A1/en not_active Abandoned
- 2002-05-14 US US10/145,958 patent/US7408042B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,959 patent/US7390878B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,962 patent/US7335746B2/en not_active Expired - Lifetime
- 2002-05-14 US US10/145,633 patent/US20030138892A1/en not_active Abandoned
- 2002-05-14 US US10/145,630 patent/US7309778B2/en not_active Expired - Lifetime
- 2002-05-15 US US10/146,792 patent/US20030207428A1/en not_active Abandoned
- 2002-05-15 US US10/146,790 patent/US20030166083A1/en not_active Abandoned
- 2002-05-15 US US10/146,730 patent/US20030207427A1/en not_active Abandoned
- 2002-05-15 US US10/146,729 patent/US20030082708A1/en not_active Abandoned
- 2002-05-15 US US10/146,791 patent/US20030082709A1/en not_active Abandoned
- 2002-05-15 US US10/146,793 patent/US20030166084A1/en not_active Abandoned
- 2002-05-15 US US10/146,788 patent/US20030129693A1/en not_active Abandoned
- 2002-05-15 US US10/146,787 patent/US20030166082A1/en not_active Abandoned
- 2002-05-15 US US10/146,725 patent/US20030134374A1/en not_active Abandoned
- 2002-05-15 US US10/146,731 patent/US20030129692A1/en not_active Abandoned
- 2002-05-15 US US10/146,726 patent/US20030129690A1/en not_active Abandoned
- 2002-05-15 US US10/146,795 patent/US20030134375A1/en not_active Abandoned
- 2002-05-15 US US10/146,724 patent/US20030134373A1/en not_active Abandoned
- 2002-05-15 US US10/146,728 patent/US20030203437A1/en not_active Abandoned
- 2002-05-16 US US10/147,508 patent/US20030082711A1/en not_active Abandoned
- 2002-05-16 US US10/147,512 patent/US7087428B2/en not_active Expired - Fee Related
- 2002-05-16 US US10/147,524 patent/US20030166093A1/en not_active Abandoned
- 2002-05-16 US US10/147,509 patent/US20030134380A1/en not_active Abandoned
- 2002-05-16 US US10/147,518 patent/US20040214269A1/en not_active Abandoned
- 2002-05-16 US US10/147,523 patent/US20030092113A1/en not_active Abandoned
- 2002-05-16 US US10/147,517 patent/US20030077726A1/en not_active Abandoned
- 2002-05-16 US US10/147,484 patent/US20030082710A1/en not_active Abandoned
- 2002-05-16 US US10/147,497 patent/US20030194767A1/en not_active Abandoned
- 2002-05-16 US US10/147,529 patent/US20030134383A1/en not_active Abandoned
- 2002-05-16 US US10/147,520 patent/US20030170789A1/en not_active Abandoned
- 2002-05-16 US US10/147,528 patent/US20030219885A1/en not_active Abandoned
- 2002-05-16 US US10/147,502 patent/US20030077724A1/en not_active Abandoned
- 2002-05-16 US US10/147,503 patent/US20030157628A1/en not_active Abandoned
- 2002-05-16 US US10/147,500 patent/US20030077723A1/en not_active Abandoned
- 2002-05-17 US US10/147,531 patent/US20040253667A1/en not_active Abandoned
- 2002-05-17 US US10/147,481 patent/US20030157626A1/en not_active Abandoned
- 2002-05-17 US US10/147,506 patent/US20030134379A1/en not_active Abandoned
- 2002-05-17 US US10/147,535 patent/US20030207378A1/en not_active Abandoned
- 2002-05-17 US US10/147,499 patent/US20030203439A1/en not_active Abandoned
- 2002-05-17 US US10/147,486 patent/US20030166087A1/en not_active Abandoned
- 2002-05-17 US US10/147,492 patent/US20030082765A1/en not_active Abandoned
- 2002-05-17 US US10/147,515 patent/US20030077725A1/en not_active Abandoned
- 2002-05-17 US US10/147,507 patent/US20030207377A1/en not_active Abandoned
- 2002-05-17 US US10/147,510 patent/US20030134381A1/en not_active Abandoned
- 2002-05-17 US US10/147,495 patent/US20030134376A1/en not_active Abandoned
- 2002-05-17 US US10/147,480 patent/US20030166085A1/en not_active Abandoned
- 2002-05-17 US US10/147,526 patent/US20030077727A1/en not_active Abandoned
- 2002-05-17 US US10/147,485 patent/US7098003B2/en not_active Expired - Fee Related
- 2002-05-17 US US10/147,522 patent/US20030157629A1/en not_active Abandoned
- 2002-05-17 US US10/147,482 patent/US20030157627A1/en not_active Abandoned
- 2002-05-17 US US10/147,537 patent/US20030207379A1/en not_active Abandoned
- 2002-05-17 US US10/147,527 patent/US20030077728A1/en not_active Abandoned
- 2002-05-17 US US10/147,494 patent/US20030166090A1/en not_active Abandoned
- 2002-05-17 US US10/147,511 patent/US20030134382A1/en not_active Abandoned
- 2002-05-17 US US10/147,490 patent/US20030166089A1/en not_active Abandoned
- 2002-05-17 US US10/147,519 patent/US20030077791A1/en not_active Abandoned
- 2002-05-17 US US10/147,488 patent/US20040253666A1/en not_active Abandoned
- 2002-05-17 US US10/147,505 patent/US20030180875A1/en not_active Abandoned
- 2002-05-17 US US10/147,514 patent/US20030166092A1/en not_active Abandoned
- 2002-05-17 US US10/147,496 patent/US20030180874A1/en not_active Abandoned
- 2002-05-17 US US10/147,501 patent/US20030134377A1/en not_active Abandoned
- 2002-05-17 US US10/147,487 patent/US20030166088A1/en not_active Abandoned
- 2002-05-17 US US10/147,483 patent/US20030180873A1/en not_active Abandoned
- 2002-05-17 US US10/147,504 patent/US20030134378A1/en not_active Abandoned
- 2002-05-17 US US10/147,491 patent/US20030175865A1/en not_active Abandoned
- 2002-05-17 US US10/147,489 patent/US20030207376A1/en not_active Abandoned
- 2002-05-17 US US10/147,498 patent/US20030166091A1/en not_active Abandoned
- 2002-05-17 US US10/147,516 patent/US20030180876A1/en not_active Abandoned
- 2002-05-17 US US10/147,493 patent/US20040029217A1/en not_active Abandoned
- 2002-05-17 US US10/147,513 patent/US7220568B2/en not_active Expired - Fee Related
- 2002-05-17 US US10/147,536 patent/US20040077064A1/en not_active Abandoned
- 2002-05-20 US US10/152,401 patent/US20030157630A1/en not_active Abandoned
- 2002-05-20 US US10/152,405 patent/US20030211571A1/en not_active Abandoned
- 2002-05-20 US US10/152,400 patent/US20030207383A1/en not_active Abandoned
- 2002-05-20 US US10/152,373 patent/US20030186367A1/en not_active Abandoned
- 2002-05-20 US US10/152,393 patent/US20030199026A1/en not_active Abandoned
- 2002-05-20 US US10/152,406 patent/US20030166096A1/en not_active Abandoned
- 2002-05-20 US US10/152,396 patent/US20030199027A1/en not_active Abandoned
- 2002-05-20 US US10/152,397 patent/US20030134384A1/en not_active Abandoned
- 2002-05-20 US US10/152,531 patent/US20030148439A1/en not_active Abandoned
- 2002-05-21 US US10/152,384 patent/US20030175869A1/en not_active Abandoned
- 2002-05-21 US US10/152,390 patent/US20030175872A1/en not_active Abandoned
- 2002-05-21 US US10/152,398 patent/US7074910B2/en not_active Expired - Fee Related
- 2002-05-21 US US10/152,381 patent/US20030207382A1/en not_active Abandoned
- 2002-05-21 US US10/152,372 patent/US20040126839A1/en not_active Abandoned
- 2002-05-21 US US10/152,378 patent/US20030175866A1/en not_active Abandoned
- 2002-05-21 US US10/152,376 patent/US20030207381A1/en not_active Abandoned
- 2002-05-21 US US10/152,389 patent/US20030175871A1/en not_active Abandoned
- 2002-05-21 US US10/152,395 patent/US7189534B2/en not_active Expired - Lifetime
- 2002-05-21 US US10/152,380 patent/US20030129694A1/en not_active Abandoned
- 2002-05-21 US US10/152,370 patent/US20060084139A1/en not_active Abandoned
- 2002-05-21 US US10/152,403 patent/US20030175874A1/en not_active Abandoned
- 2002-05-21 US US10/152,379 patent/US20030166094A1/en not_active Abandoned
- 2002-05-21 US US10/152,387 patent/US20030175870A1/en not_active Abandoned
- 2002-05-21 US US10/152,371 patent/US20030194768A1/en not_active Abandoned
- 2002-05-21 US US10/152,394 patent/US20030166095A1/en not_active Abandoned
- 2002-05-21 US US10/152,375 patent/US7160993B2/en not_active Expired - Lifetime
- 2002-05-21 US US10/152,399 patent/US20030194774A1/en not_active Abandoned
- 2002-05-21 US US10/152,374 patent/US20030194769A1/en not_active Abandoned
- 2002-05-21 US US10/152,383 patent/US20030175868A1/en not_active Abandoned
- 2002-05-21 US US10/152,392 patent/US20030175873A1/en not_active Abandoned
- 2002-05-21 US US10/152,377 patent/US20030194771A1/en not_active Abandoned
- 2002-05-21 US US10/152,391 patent/US20030194773A1/en not_active Abandoned
- 2002-05-21 US US10/152,382 patent/US20030175867A1/en not_active Abandoned
- 2002-05-21 US US10/152,386 patent/US20030194772A1/en not_active Abandoned
- 2002-05-21 US US10/152,385 patent/US20030199025A1/en not_active Abandoned
- 2002-05-22 US US10/153,756 patent/US20030175875A1/en not_active Abandoned
- 2002-05-22 US US10/153,585 patent/US20030207384A1/en not_active Abandoned
- 2002-05-22 US US10/153,552 patent/US20030199028A1/en not_active Abandoned
- 2002-05-22 US US10/153,840 patent/US20030199029A1/en not_active Abandoned
- 2002-05-22 US US10/153,934 patent/US20030129695A1/en not_active Abandoned
- 2002-05-22 US US10/153,586 patent/US20030134385A1/en not_active Abandoned
- 2002-05-28 US US10/156,845 patent/US20030199033A1/en not_active Abandoned
- 2002-05-28 US US10/156,847 patent/US20030166098A1/en not_active Abandoned
- 2002-05-28 US US10/156,844 patent/US20030199032A1/en not_active Abandoned
- 2002-05-28 US US10/156,848 patent/US20030194775A1/en not_active Abandoned
- 2002-05-28 US US10/156,841 patent/US20030199030A1/en not_active Abandoned
- 2002-05-28 US US10/156,842 patent/US20030199031A1/en not_active Abandoned
- 2002-05-29 US US10/157,794 patent/US20030194777A1/en not_active Abandoned
- 2002-05-29 US US10/157,801 patent/US20030207387A1/en not_active Abandoned
- 2002-05-29 US US10/158,491 patent/US20030175880A1/en not_active Abandoned
- 2002-05-29 US US10/157,802 patent/US20030207388A1/en not_active Abandoned
- 2002-05-29 US US10/157,800 patent/US20030207386A1/en not_active Abandoned
- 2002-05-29 US US10/157,797 patent/US20030175879A1/en not_active Abandoned
- 2002-05-29 US US10/157,786 patent/US20030208055A1/en not_active Abandoned
- 2002-05-29 US US10/157,784 patent/US20030175878A1/en not_active Abandoned
- 2002-05-29 US US10/157,781 patent/US20030170790A1/en not_active Abandoned
- 2002-05-29 US US10/157,782 patent/US20030077792A1/en not_active Abandoned
- 2002-05-29 US US10/158,462 patent/US20030158104A1/en not_active Abandoned
- 2002-05-29 US US10/157,785 patent/US20030194776A1/en not_active Abandoned
- 2002-05-29 US US10/157,780 patent/US20030207385A1/en not_active Abandoned
- 2002-05-29 US US10/157,799 patent/US20030166101A1/en not_active Abandoned
- 2002-05-29 US US10/157,779 patent/US20030175877A1/en not_active Abandoned
- 2002-05-29 US US10/157,798 patent/US20030203440A1/en not_active Abandoned
- 2002-05-29 US US10/157,783 patent/US20030157631A1/en not_active Abandoned
- 2002-05-29 US US10/157,778 patent/US20030166100A1/en not_active Abandoned
- 2002-05-29 US US10/157,796 patent/US20030194778A1/en not_active Abandoned
- 2002-05-30 US US10/158,785 patent/US20030092115A1/en not_active Abandoned
- 2002-05-30 US US10/158,788 patent/US20050074837A1/en not_active Abandoned
- 2002-05-30 US US10/160,498 patent/US20030073216A1/en not_active Abandoned
- 2002-05-30 US US10/158,784 patent/US20030207389A1/en not_active Abandoned
- 2002-05-30 US US10/158,792 patent/US20030157632A1/en not_active Abandoned
- 2002-05-30 US US10/158,790 patent/US20030180879A1/en not_active Abandoned
- 2002-05-30 US US10/158,787 patent/US20040039164A1/en not_active Abandoned
- 2002-05-30 US US10/160,500 patent/US20030194779A1/en not_active Abandoned
- 2002-05-30 US US10/158,791 patent/US20030207429A1/en not_active Abandoned
- 2002-05-30 US US10/158,783 patent/US20030138893A1/en not_active Abandoned
- 2002-05-30 US US10/160,504 patent/US20030166102A1/en not_active Abandoned
- 2002-05-30 US US10/160,503 patent/US20040033559A1/en not_active Abandoned
- 2002-05-30 US US10/158,782 patent/US20030082766A1/en not_active Abandoned
- 2002-05-30 US US10/158,789 patent/US20030207390A1/en not_active Abandoned
- 2002-05-30 US US10/158,786 patent/US20030134791A1/en not_active Abandoned
- 2002-08-28 US US10/230,417 patent/US7297768B2/en not_active Expired - Lifetime
- 2002-10-16 AT AT02805508T patent/ATE408419T1/en not_active IP Right Cessation
- 2002-10-16 KR KR10-2004-7009417A patent/KR20040074090A/en not_active Application Discontinuation
- 2002-10-16 DE DE60228997T patent/DE60228997D1/en not_active Expired - Lifetime
-
2004
- 2004-06-18 ZA ZA200404849A patent/ZA200404849B/en unknown
- 2004-08-31 US US10/931,886 patent/US20050019823A1/en not_active Abandoned
- 2004-09-29 US US10/955,952 patent/US20050153396A1/en not_active Abandoned
- 2004-10-12 US US10/964,241 patent/US20070026487A1/en not_active Abandoned
- 2004-10-22 US US10/973,115 patent/US20060040351A1/en not_active Abandoned
- 2004-12-21 US US11/020,604 patent/US20050153348A1/en not_active Abandoned
-
2005
- 2005-01-14 US US11/036,869 patent/US20050170396A1/en not_active Abandoned
- 2005-01-21 US US11/040,809 patent/US20050118635A1/en not_active Abandoned
- 2005-02-11 US US11/056,802 patent/US20050136515A1/en not_active Abandoned
- 2005-02-11 US US11/057,268 patent/US20060084144A1/en not_active Abandoned
- 2005-02-14 US US11/057,966 patent/US20050187379A1/en not_active Abandoned
- 2005-02-16 US US11/060,240 patent/US20050164279A1/en not_active Abandoned
- 2005-02-16 US US11/060,652 patent/US20050136475A1/en not_active Abandoned
- 2005-04-19 US US11/110,520 patent/US20050202496A1/en not_active Abandoned
- 2005-04-27 US US11/117,757 patent/US20050214846A1/en not_active Abandoned
- 2005-11-30 US US11/290,153 patent/US7524497B2/en not_active Expired - Fee Related
-
2006
- 2006-01-27 US US11/341,175 patent/US7468427B2/en not_active Expired - Fee Related
- 2006-09-29 US US11/537,235 patent/US7504484B2/en not_active Expired - Fee Related
- 2006-10-04 US US11/538,714 patent/US8106156B2/en not_active Expired - Fee Related
- 2006-10-27 US US11/553,810 patent/US20070264686A1/en not_active Abandoned
-
2007
- 2007-10-30 US US11/929,190 patent/US20080050758A1/en not_active Abandoned
-
2009
- 2009-02-02 US US12/364,329 patent/US20090142786A1/en not_active Abandoned
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US8106156B2 (en) | PRO1120 polypeptides | |
US20030022239A1 (en) | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |