WO2024071956A1 - 정제 태그와 알파-나선 태그를 포함하여 자가 조립체를 형성하는 융합 단백질 및 이를 이용하여 재조합 단백질을 정제하는 방법 - Google Patents

정제 태그와 알파-나선 태그를 포함하여 자가 조립체를 형성하는 융합 단백질 및 이를 이용하여 재조합 단백질을 정제하는 방법 Download PDF

Info

Publication number
WO2024071956A1
WO2024071956A1 PCT/KR2023/014758 KR2023014758W WO2024071956A1 WO 2024071956 A1 WO2024071956 A1 WO 2024071956A1 KR 2023014758 W KR2023014758 W KR 2023014758W WO 2024071956 A1 WO2024071956 A1 WO 2024071956A1
Authority
WO
WIPO (PCT)
Prior art keywords
tag
gfp
assembly
self
protein
Prior art date
Application number
PCT/KR2023/014758
Other languages
English (en)
French (fr)
Inventor
김대헌
나윤정
김종학
최선
Original Assignee
크리포 주식회사
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 크리포 주식회사 filed Critical 크리포 주식회사
Publication of WO2024071956A1 publication Critical patent/WO2024071956A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04—Linear peptides containing only normal peptide links
    • C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/14—Extraction; Separation; Purification
    • C07K1/34—Extraction; Separation; Purification by filtration, ultrafiltration or reverse osmosis
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04—Linear peptides containing only normal peptide links
    • C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62—DNA sequences coding for fusion proteins
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C07K2317/53—Hinge
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/50—Fusion polypeptide containing protease site

Definitions

  • the present invention relates to a fusion protein containing a purification tag and an alpha-helix tag, a composition for purifying a recombinant protein containing the same, and a method for purifying a recombinant protein using the same.
  • the His tag or His 6 tag or HAT tag (natural histidine affinity tag) along with the MBP (maltose-binding protein) tag and GST (glutathione s-transferase) tag are widely used for purification of recombinant proteins.
  • a generalized method of using the His tag for purification of recombinant proteins is to fuse the His tag to the recombinant protein and use Ni 2+ -NTA beads (beads or resin) or Co 2+ on which nickel ions or cobalt ions are immobilized through affinity chromatography. -After binding to CMA beads, it is purified by eluting the recombinant protein bound to the beads through excessive imidazole or low pH treatment.
  • the recombinant protein with the His tag fused is eluted using the principle that imidazole, which has a similar structure to the amino acid histidine, competes with the His tag to bind to Ni 2+ -NTA beads or Co 2+ -CMA beads (Kerpe K . 2003).
  • the most widely used method for purifying recombinant proteins, including medical proteins, is the adsorption (affinity) chromatography method using an affinity tag or protein A, which has binding ability to antibodies.
  • affinity affinity
  • this purification method requires expensive beads (beads or resin) to go through a complex, multi-step purification process that takes a lot of time, and the purification purity is somewhat lowered due to contamination by proteins with non-specific binding to the beads.
  • alpha-helical peptide 18A beta-strand peptide ELK16
  • amphipathic surfactant-like peptide L 6 KD amphipathic surfactant-like peptide L 6 KD
  • hydrophobic peptide GFIL8 form inclusion bodies within cells.
  • ELPs Elastin like polypeptides
  • the binding between calmodulin and M13 peptide is calcium ion dependent
  • the binding between Atox1 and WD4 is Zn 2+ , Cu 2+ , and Pt 2+ dependent
  • FRB FKBP12-Rapamycin binding protein
  • FKBP FK506 binding protein
  • the present inventors have solved the problems of existing recombinant protein purification methods through treatment with specific inducers or conditions, which is a completely different concept from the existing methods.
  • the present invention which can induce the formation of macromolecular assemblies and selectively purify high-purity recombinant proteins by simple methods such as centrifugation or filtration, was completed.
  • the technical problem to be achieved by the present invention is to overcome the existing recombinant protein purification methods, that is, the use of expensive beads or resins in the purification process, the need for expensive devices or equipment to be driven for purification, the consumption of a lot of time, and the complex process of several steps.
  • the method of separating and purifying the target recombinant protein using simple methods such as centrifugation and filtration is provided. will be.
  • An example of the present application provides an alpha-helical peptide tag in which the main amino acids forming self-assembly are composed of charged and hydrophobic amino acids.
  • An example of the present application is a first polypeptide represented by an amino acid sequence selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 3, and a second polypeptide in which the main amino acid is an alpha-helix tag consisting of charged and hydrophobic amino acids.
  • a fusion polypeptide comprising:
  • Another example of the present application provides a fusion polypeptide comprising a first polypeptide and a second polypeptide and a fusion protein comprising a target protein.
  • Another example of the present application provides a polynucleotide encoding a fusion polypeptide comprising a first polypeptide and a second polypeptide, or a fusion protein comprising the fusion polypeptide and a target protein.
  • Another example of the present application provides an expression vector comprising a fusion polypeptide comprising a first polypeptide and a second polypeptide, or a polynucleotide encoding a fusion protein comprising the fusion polypeptide and a protein of interest.
  • Another example of the present application provides host cells transformed with the above expression vector.
  • Another example of the present application is the step of culturing cells containing a fusion polypeptide containing a first polypeptide and a second polypeptide, or a polynucleotide encoding a fusion protein containing the fusion polypeptide and a target protein, in a medium.
  • Another example of the present application is a first polypeptide represented by one amino acid sequence selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 3, and/or one amino acid selected from the group consisting of SEQ ID NO: 4 to SEQ ID NO: 8
  • a composition for protein purification comprising a second polypeptide represented by a sequence is provided.
  • Another example of the present application is a first polypeptide represented by an amino acid sequence selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 3, and/or a first polypeptide represented by an amino acid sequence selected from the group consisting of SEQ ID NO: 4 to SEQ ID NO: 8
  • a self-assembly comprising a second polypeptide is provided.
  • an alpha-helical peptide tag is provided where the main amino acids forming self-assembly are composed of charged and hydrophobic amino acids.
  • the main amino acids forming the self-assembly are composed of charged and hydrophobic amino acids.
  • the charged amino acids of the alpha-helical peptide tag include the positively charged amino acids of Lysine (Lys, K), Arginine (Arg, R), Histidine (Hi, H) and Aspartate. (Asp, D), Glutamate (Glu, E) are selected from negatively charged amino acids, and hydrophobic amino acids include Alanine (Ala, A), Valine (Val, V), Leucine (Leu, L), and Isoleucine (Ile, I).
  • Proline Pro, P
  • Phenylalanine P
  • Methionine Me
  • Tryptophan Trp, W
  • charged and hydrophobic amino acids within the alpha-helix tag excluding the hinge region or link region. It is characterized in that the content is 60% or more, 65% or more, 70% or more, preferably 75% or more.
  • the alpha-helical peptide tag may be an artificially designed DLH, IAQ or EAH peptide based on mIZ (modified isoleucine zipper), TZ1H and the charged and hydrophobic amino acids that are characteristic of the main amino acids constituting these peptides. , but is not limited to this.
  • the alpha-helical peptide tag may include one amino acid sequence selected from the group consisting of SEQ ID NO: 4 to SEQ ID NO: 8, and in one embodiment, one amino acid sequence selected from the group consisting of SEQ ID NO: 4 to SEQ ID NO: 8. It may be represented by or consists of an amino acid sequence.
  • the alpha-helical peptide tag can be used in the form of a fusion protein fused with a purification tag such as a His tag, and the fusion protein is fused with the alpha-helical peptide tag or the alpha-helical peptide tag and a purification tag such as a His tag. It has the ability to induce self-assembly formation by fusing with the target protein.
  • the present invention includes a first polypeptide represented by an amino acid sequence selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 3, and a second polypeptide in which the main amino acid is an alpha-helix tag consisting of charged and hydrophobic amino acids.
  • a fusion polypeptide that
  • the first polypeptide may be a purification tag.
  • the first polypeptide may be a His tag capable of binding to Ni 2+ or Co 2+ , a HAT tag in its original form, or a modified HQ tag (or HQ 6 tag) of the His tag. It is not limited.
  • the His tag, HAT tag, and HQ tag may be represented by or comprised of the amino acid sequences of SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3, respectively.
  • the second polypeptide may be a motif, domain, or peptide capable of nucleation or formation of multimers such as dimers.
  • the second polypeptide may be a DLH, IAQ or EAH peptide artificially designed based on mIZ, TZ1H and the charged and hydrophobic amino acids that are characteristic of the main amino acids constituting these peptides, but is limited to this. It doesn't work.
  • the mIZ, TZ1H, DLH, IAQ or EAH peptides may be represented by or consist of the amino acid sequences of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, and SEQ ID NO: 8, respectively.
  • the first polypeptide and the second polypeptide may be connected sequentially.
  • the present invention provides a fusion polypeptide comprising the first polypeptide and the second polypeptide and a fused recombinant protein comprising the target protein.
  • the fusion polypeptide comprising the first polypeptide and the second polypeptide can be inserted not only at the C-terminus of the target protein, but also at the N-terminus or anywhere inside the protein as long as it does not substantially affect the functionality of the protein. .
  • not having a substantial effect on the functionality of the protein means that the activity of the protein is maintained at least 80%, preferably at least 95%, before fusion with the fusion polypeptide.
  • recombinant protein refers to a polymer of amino acids (peptide, oligopeptide, polypeptide, or protein) containing at least two parts, each part containing a distinct function. At least one first part of the recombinant protein comprises a fusion polypeptide comprising at least one first polypeptide and a second polypeptide of the invention, and at least one second part of the recombinant protein comprises at least one protein of interest. (or peptide).
  • target protein refers to any protein that is the target of production or purification, including peptides, and may be used interchangeably with the term “target protein” within the specification.
  • target proteins were Green Fluorescent Protein (GFP), granulocyte colony-stimulating factor (rhG-CSF), interferon alpha 2 (INF- ⁇ 2), and the therapeutic antibody Herceptin light chain (light chain of Herceptin) as examples. , but is not limited to this.
  • GFP Green Fluorescent Protein
  • rhG-CSF granulocyte colony-stimulating factor
  • INF- ⁇ 2 interferon alpha 2
  • therapeutic antibody Herceptin light chain light chain of Herceptin
  • target protein refers to a protein to be produced by the biotechnological method according to the present invention, and is not particularly limited to any one, and is preferably a protein that can be used for medical, industrial, diagnostic, experimental, etc. purposes. may be included.
  • the fusion protein may further include a cleavage site of a protein cleavage enzyme, a hinge region of an immunoglobulin, a target protein, or all of these between the fusion polypeptide including the first polypeptide and the second polypeptide and the target protein. .
  • the hinge region may include the amino acid sequence of SEQ ID NO: 33.
  • the fusion protein is a TEV protease cleavage site or Ni 2+ between the fusion polypeptide and the target protein to remove the fusion polypeptide including the first polypeptide and the second polypeptide from the recombinant fusion protein. It may include a cleavage site generally used for protein purification, such as a SNAC tag that can be cut.
  • the present invention provides a polynucleotide encoding a fusion polypeptide comprising a first polypeptide and a second polypeptide, or a fusion protein comprising the fusion polypeptide and a target protein.
  • the polynucleotide includes respective polynucleotides encoding a first polypeptide and a second polypeptide.
  • the polynucleotide encoding the first polypeptide may be represented by one base sequence selected from the base sequences of SEQ ID NO: 40 to SEQ ID NO: 42, and the polynucleotide encoding the second polypeptide is SEQ ID NO: 43 to Sequence It may be expressed as one base sequence selected from the base sequence number 47.
  • the present invention provides a recombinant expression vector comprising a fusion polypeptide comprising a first polypeptide and a second polypeptide, or a polynucleotide encoding a fusion protein comprising the fusion polypeptide and a protein of interest.
  • recombinant can be used interchangeably with genetic manipulation, and molecular cloning experimental techniques such as modifying, cutting, and linking genes are used to create a form that does not exist in nature. This means manufacturing genes.
  • expression means the production of a protein or nucleic acid in a cell.
  • a recombinant expression vector is a vector that can express a protein or nucleic acid (RNA) of interest in a suitable host cell, and contains essential regulatory elements operably linked so that the polynucleotide (gene) insert can be expressed. refers to a genetic construct containing
  • operably linked refers to a functional linkage between a nucleic acid expression control sequence and a nucleic acid sequence encoding a desired protein or RNA to perform a general function. This means that genes are connected so that they can be expressed.
  • the expression control sequence refers to a DNA sequence that regulates the expression of an operably linked polynucleotide sequence in a specific host cell.
  • regulatory sequences include a promoter to effect transcription, optional operator sequences to regulate transcription, sequences encoding suitable mRNA ribosome binding sites, sequences regulating termination of transcription and translation, initiation codons, stop codons, and polyadenylation. Includes signals and enhancers.
  • the type of recombinant expression vector of the present invention is not particularly limited as long as it is a vector commonly used in the cloning field, and examples include, but are not limited to, plasmid vectors, cosmid vectors, bacteriophage vectors, and viral vectors.
  • the plasmids include E. coli-derived plasmids (pBR322, pBR325, pUC118 and pUC119, pET-22(+)), Bacillus subtilis-derived plasmids (pUB110 and pTP5), and yeast-derived plasmids (pPICZ, YEp13, YEp24, and YCp50).
  • the virus may be a retrovirus, an animal virus such as adenovirus or vaccinia virus, or an insect virus such as baculovirus, and the pET-28a vector may be preferably used.
  • the present invention relates to a host cell transformed with an expression vector containing a fusion polypeptide containing a first polypeptide and a second polypeptide, or a polynucleotide encoding a fusion protein containing the fusion polypeptide and a target protein.
  • the type of host cell according to the present invention is not particularly limited as long as it can be used to express the polynucleotide contained in the recombinant expression vector of the present invention.
  • Cells (host cells) transformed with the recombinant expression vector according to the present invention include prokaryotes (e.g., Escherichia coli), eukaryotes (e.g., yeast or other fungi), and plant cells (e.g., tobacco or tomato). plant cells), animal cells (e.g., human cells, monkey cells, hamster cells, rat cells, mouse cells, insect cells, or hybridomas derived therefrom, preferably It may be E. coli, but is not limited thereto.
  • the recombinant expression vector according to the present invention can be used by methods known in the art, such as, but not limited to, transient transfection, microinjection, transduction, cell fusion, calcium phosphate precipitation, and liposome.
  • liposome-mediated transfection DEAE Dextran-mediated transfection, polybrene-mediated transfection, electroporation, gene gun It can be transformed by introducing it into a cell to produce an antibody or its fragment using a gene gun or a known method for introducing nucleic acid into the cell.
  • Cells transformed with the recombinant expression vector according to the present invention can overexpress or mass produce the fusion protein according to the present invention.
  • the present invention relates to a host cell transformed with an expression vector containing a fusion polypeptide containing a first polypeptide and a second polypeptide, or a polynucleotide encoding a fusion protein containing the fusion polypeptide and a target protein.
  • the method of purifying the target protein may further include the step of extracting the fusion protein from the host cell after the culturing step.
  • the buffer solution used in the fusion protein extraction step may be a buffer solution commonly used for protein extraction, such as HEPES, Tris, or phosphate, and is preferably a HEPES buffer solution, but is not limited thereto.
  • a surfactant such as Triton
  • the method of purifying the target protein involves transformation with an expression vector containing a fusion polypeptide containing a first polypeptide and a second polypeptide, or a polynucleotide encoding a fusion protein containing the fusion polypeptide and the target protein. It may further include a step of inducing self-assembly formation of the fusion protein obtained from the prepared host cell.
  • the step of inducing the formation of self-assembly may further include treating the material under specific conditions to promote self-assembly formation.
  • Specific conditions for inducing the formation of the self-assembly may be physical and chemical conditions such as type of inducer, concentration of inducer, type of salt, salt concentration, pH condition, type of buffer solution, temperature, reaction time, etc. .
  • the step of inducing the formation of self-assembly may include adding an inducing agent to promote self-assembly formation. By adding the inducer, the induction of macromolecular self-assembly formation can be promoted.
  • the inducing agent may be a cationic material, and specifically, any one selected from the group consisting of cations such as Ni 2+ , Co 2+ , Zn 2+ , Cu 2+ , Ag 2+ , Fe 2+ , Ba 2+ It may be more than one, and the type of appropriate inducing agent for inducing self-assembly formation may be different depending on the combination of the first polypeptide and the second polypeptide.
  • the inducer is 0.1 to 2.0mM, 0.1 to 1.5mM, 0.1 to 1.0mM, 0.1 to 0.7mM, 0.3 to 2.0mM, 0.3 to 1.5mM, 0.3 to 1.0mM, 0.3 to 0.7mM, 0.4 to 2.0mM, 0.4 to 1.5mM It may be, but is not limited to, 0.4 to 1.0mM, 0.4 to 0.7mM, 0.4 to 0.6mM, or 0.5mM.
  • the step of inducing the formation of the self-assembly may include adding a salt.
  • the salt may be a salt generally used for protein precipitation, such as ammonium sulfate or sodium chloride, and is preferably ammonium sulfate, but is not limited thereto.
  • ammonium sulfate is 5 to 30% (w/v), 5 to 27% (w/v), 5 to 25% (w/v), 5 to 23% (w/v), 7 to 30% (w) /v), 7 to 27% (w/v), 7 to 25% (w/v), 7 to 23% (w/v), 10 to 30% (w/v), 10 to 27% (w) /v), 10 to 25% (w/v), 10 to 23% (w/v), 12 to 30% (w/v), 12 to 27% (w/v), 12 to 25% (w) /v), 12 to 23% (w/v), or 12 to 22% (w/v), but is not limited thereto.
  • the buffer solution used in the step of inducing the formation of the self-assembly may be a buffer solution commonly used for protein extraction, such as HEPES, Tris, or phosphate, and is preferably a HEPES buffer solution, but is limited thereto. It doesn't work.
  • the step of inducing the formation of the self-assembly may be performed at pH 6 to pH 10, or may be performed at pH 7 to pH 10, but is not limited thereto.
  • the step of inducing the formation of the self-assembly may be performed immediately after treatment with the inducing agent for 10 minutes, 10 minutes or more, 15 minutes or more, 20 minutes or more, 10 minutes to 120 minutes, 15 minutes to 120 minutes, or 20 minutes to 120 minutes. However, it is not limited to this.
  • the method for purifying the target protein may further include the step of selectively separating the formed self-assembly.
  • the separating step may be performed by centrifugation or filtration.
  • the fusion polypeptide containing the first polypeptide and the second polypeptide of the present invention and the fusion protein containing the target protein form a macromolecular self-assembly and increase in size and density, so they can be precipitated using the density difference. Centrifugation or a filtration method that can filter out molecules over a certain size can be used as a separation method.
  • a step of washing the precipitated or filtered recombinant protein fraction using a buffer solution may be further included.
  • the present invention is a method for reversibly converting purified recombinant proteins into monomers by inducing the formation of macromolecular self-assembly through treatment with a specific inducer and/or condition treatment, using EDTA or A step of treating with a chelator such as EGTA may be further included.
  • the method of purifying the target protein may further include the step of cutting the TAV protease cleavage site or snack tag contained in the fusion protein, and the cutting step may be performed using TEV protease or Ni 2+. It may be performed through processing.
  • the present invention provides a first polypeptide represented by an amino acid sequence selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 3, and/or an amino acid sequence selected from the group consisting of SEQ ID NO: 4 to SEQ ID NO: 8
  • a composition for protein purification comprising a second polypeptide represented by is provided.
  • the present invention provides a first polypeptide represented by an amino acid sequence selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 3, and/or an amino acid sequence selected from the group consisting of SEQ ID NO: 4 to SEQ ID NO: 8 It provides a self-assembly body comprising a second polypeptide represented by . Details regarding the first polypeptide and the second polypeptide are the same as above.
  • the present invention relates to a fusion polypeptide in which any one of a His tag, a HAT tag, and an HQ tag are fused to an alpha-helical peptide tag in which the main amino acid is composed of charged and hydrophobic amino acids, and a method for purifying a target protein using the same.
  • the fusion polypeptide It is fused with a target protein and induces the formation of macromolecular self-assembly depending on the specific inducer or processing conditions, thereby producing a purification column filled with expensive beads or resins mainly used in existing affinity chromatography methods and the expensive equipment that drives them. It is possible to separate and purify recombinant proteins using only very simple methods such as centrifugation or filtration, without the need for equipment.
  • the present invention induces the formation of macromolecular self-assembly through salt treatment and treatment with a specific inducing agent or condition in the protein extraction solution, the processing process is very simple and easy, the time required for purification is very short, and the efficiency is high. And it is possible to purify recombinant proteins with high purity.
  • the present invention can easily convert purified recombinant proteins into water-soluble monomers through chelation treatment, and if necessary, cut the tags fused to the target protein and then easily remove these tags by inducing self-assembly reformation. possible.
  • Figure 1a is a diagram showing the concept of inducing the formation of macromolecular self-assembly by a specific inducer acting on the fused purification tag and the self-assembly tag.
  • Figure 1b is a schematic diagram showing the composition of a vector for expression of a target protein, including a gene region encoding a His 6 tag and a self-assembly tag, and a gene region encoding the target protein.
  • Figure 1c is a diagram showing a method of selectively purifying a recombinant protein by centrifugation or filtration after inducing the formation of macromolecular self-assembly through a specific inducing agent or treatment under specific conditions.
  • Figure 2a is a diagram analyzing the helical amino acid distribution of mIZ peptide forming an alpha-helix structure using a wheel diagram.
  • Figure 2b is a diagram analyzing the helical amino acid distribution of the TZ1H peptide forming an alpha-helix structure using a wheel diagram.
  • Figure 2c is a diagram analyzing the helical amino acid distribution of the IAQ peptide forming an alpha-helix structure using a wheel diagram.
  • Figure 2d is a diagram analyzing the helical amino acid distribution of the DLH peptide forming an alpha-helix structure using a wheel diagram.
  • Figure 2e is a diagram analyzing the helical amino acid distribution of EAH peptide forming an alpha-helix structure using a wheel diagram.
  • Figure 3a is a diagram confirming whether macromolecular self-assembly formation is induced upon treatment with various cations by fusing a His tag alone as a purification tag to GFP, the target protein.
  • Figure 3b is a diagram confirming whether macromolecular self-assembly formation is induced upon treatment with various cations by fusing the TZ1H peptide tag, which can form a trimer as a purification tag, to GFP alone.
  • Figure 3c is a diagram confirming whether macromolecular self-assembly formation is induced upon treatment with various cations by fusing a His tag and a TZ1H peptide tag as purification tags to GFP.
  • Figure 3D is a diagram confirming whether macromolecular self-assembly formation is induced upon treatment with various cations by fusing the mIZ peptide tag, which can form a trimer as a purification tag, to GFP alone.
  • Figure 3e is a diagram confirming whether macromolecular self-assembly formation is induced upon treatment with various cations by fusing a His tag and an mIZ peptide tag as purification tags to GFP.
  • Figure 3f is a diagram confirming whether macromolecular self-assembly formation is induced upon treatment with various cations by fusing the DLH peptide tag alone as a purification tag to GFP.
  • Figure 3g is a diagram confirming whether macromolecular self-assembly formation is induced upon treatment with various cations by fusing a combination of a His tag and a DLH peptide tag as a purification tag to GFP.
  • Figure 3h is a diagram confirming whether macromolecular self-assembly formation is induced upon treatment with various cations by fusing the IAQ peptide tag alone as a purification tag to GFP.
  • Figure 3i is a diagram confirming whether macromolecular self-assembly formation is induced upon treatment with various cations by fusing both a His tag and an IAQ peptide tag as purification tags to GFP.
  • Figure 3j is a diagram confirming whether macromolecular self-assembly formation is induced upon treatment with various cations by fusing the EAH peptide tag alone as a purification tag to GFP.
  • Figure 3k is a diagram confirming whether macromolecular self-assembly formation is induced upon treatment with various cations by fusing both a His tag and an EAH peptide tag as purification tags to GFP.
  • Figure 4a shows that the target protein, GFP, one of the model proteins, is fused with His or TZ1H peptide tag as a purification tag alone or both tags are fused together to induce the formation of macromolecular self-assembly when treated with cationic Ni 2+ at various concentrations. This is a province that has confirmed whether or not it is possible.
  • Figure 4b is a diagram confirming whether macromolecular self-assembly formation is induced when cationic Ni 2+ is treated at various concentrations by fusing His or mIZ peptide tags as purification tags to GFP alone or by fusing both tags.
  • Figure 4c is a diagram confirming whether the formation of macromolecular self-assembly is induced when cationic Ni 2+ is treated at various concentrations by fusing His or DLH peptide tags as purification tags to GFP alone or by fusing both tags.
  • Figure 4d is a diagram confirming whether macromolecular self-assembly formation is induced when cationic Ni 2+ is treated at various concentrations by fusing His or IAQ peptide tags as purification tags to GFP alone or by fusing both tags.
  • Figure 4e is a diagram confirming whether macromolecular self-assembly formation is induced when cationic Ni 2+ is treated at various concentrations by fusing His or EAH peptide tags as purification tags to GFP alone or by fusing both tags.
  • Figure 5a is a diagram analyzing whether the formation of macromolecular self-assembly is promoted when treated with the cation Ni 2+ selected as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing His tag alone as a purification tag to GFP. am.
  • Figure 5b shows the analysis of whether the formation of macromolecular self-assembly is promoted when treated with the selected cation Ni 2+ as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing the TZ1H peptide tag alone as a purification tag to GFP. It's a degree.
  • Figure 5c shows whether the formation of macromolecular self-assembly is promoted upon treatment with the selected cation Ni 2+ as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing both a His tag and a TZ1H peptide tag as purification tags to GFP. This is the diagram analyzed.
  • Figure 5d shows whether the formation of macromolecular self-assembly is promoted when treated with the cation Ni 2+ selected as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing the mIZ peptide tag alone as a purification tag to GFP. It's a degree.
  • Figure 5e shows whether the formation of macromolecular self-assembly is promoted when treated with the selected cation Ni 2+ as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing both a His tag and an mIZ peptide tag as purification tags to GFP. This is the diagram analyzed.
  • Figure 5f shows the analysis of whether the formation of macromolecular self-assembly is promoted when treated with the selected cation Ni 2+ as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing the DLH peptide tag alone as a purification tag to GFP. It's a degree.
  • Figure 5g shows whether macromolecular self-assembly formation is promoted upon treatment with the cation Ni 2+ selected as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing both a His tag and a DLH peptide tag as purification tags to GFP. This is the diagram analyzed.
  • Figure 5h shows an analysis of whether the formation of macromolecular self-assembly is promoted when treated with the cation Ni 2+ selected as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing the IAQ peptide tag alone as a purification tag to GFP . It's a degree.
  • Figure 5I shows whether the formation of macromolecular self-assembly is promoted upon treatment with the selected cation Ni 2+ as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing both a His tag and an IAQ peptide tag as purification tags to GFP . This is the diagram analyzed.
  • Figure 5j shows an analysis of whether the formation of macromolecular self-assembly is promoted when treated with the cation Ni 2+ selected as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing the EAH peptide tag alone as a purification tag to GFP. It's a degree.
  • Figure 5k shows whether the formation of macromolecular self-assembly is promoted when treated with the cation Ni 2+ selected as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing both a His tag and an EAH peptide tag as purification tags to GFP. This is the diagram analyzed.
  • Figure 6a analyzes whether the formation of macromolecular self-assembly is promoted when treated with the selected cation Ni 2+ as a specific inducer in the presence of various concentrations of sodium chloride as a salt by fusing a combination of His tag and TZ1H peptide tag as a purification tag to GFP. It is one degree.
  • Figure 6b analyzes whether the formation of macromolecular self-assembly is promoted when treated with the selected cation Ni 2+ as a specific inducer in the presence of various concentrations of sodium chloride as a salt by fusing a combination of His tag and mIZ peptide tag as a purification tag to GFP . It is one degree.
  • Figure 6c analyzes whether the formation of macromolecular self-assembly is promoted when treated with the selected cation Ni 2+ as a specific inducer in the presence of various concentrations of sodium chloride as a salt by fusing a combination of a His tag and a DLH peptide tag as a purification tag to GFP. It is one degree.
  • Figure 6d analyzes whether the formation of macromolecular self-assembly is promoted when treated with the selected cation Ni 2+ as a specific inducer in the presence of various concentrations of sodium chloride as a salt by fusing a combination of His tag and IAQ peptide tag as a purification tag to GFP. It is one degree.
  • Figure 6e analyzes whether the formation of macromolecular self-assembly is promoted when treated with the selected cation Ni 2+ as a specific inducer in the presence of various concentrations of sodium chloride as a salt by fusing a combination of a His tag and an EAH peptide tag as a purification tag to GFP. It is one degree.
  • Figure 7a analyzes the degree of macromolecular self-assembly formation upon treatment with ammonium sulfate as a salt in various buffers and treatment with selected cation Ni 2+ as a specific inducer by fusing a combination of a His tag and a TZ1H peptide tag as a purification tag to GFP. It is one degree.
  • Figure 7b is a diagram analyzing the degree of macromolecular self-assembly formation upon treatment with ammonium sulfate as a salt in various buffer solutions and treatment with cation Ni 2+ selected as a specific inducer by fusing a combination of a His tag and an mIZ peptide tag as a purification tag to GFP. .
  • Figure 7c is a diagram analyzing the degree of macromolecular self-assembly formation upon treatment with ammonium sulfate as a salt in various buffer solutions and treatment with cation Ni 2+ selected as a specific inducer by fusing a combination of a His tag and a DLH peptide tag as a purification tag to GFP. .
  • Figure 7d is a diagram analyzing the degree of macromolecular self-assembly formation upon treatment with ammonium sulfate as a salt in various buffer solutions and treatment with cation Ni 2+ selected as a specific inducer by fusing a combination of a His tag and an IAQ peptide tag as a purification tag to GFP. .
  • Figure 7e is a diagram analyzing the degree of macromolecular self-assembly formation upon treatment with ammonium sulfate as a salt in various buffer solutions and treatment with cation Ni 2+ selected as a specific inducer by fusing a combination of a His tag and an EAH peptide tag as a purification tag to GFP. .
  • Figure 8a shows the degree of macromolecular self-assembly formation according to the treatment concentration of the cation Ni 2+ selected as a specific inducer in the presence of ammonium sulfate as a salt by fusing a combination of a His tag and a TZ1H peptide tag as a purification tag to GFP. It's a degree.
  • Figure 8b shows the degree of macromolecular self-assembly formation according to the treatment concentration of the cation Ni 2+ selected as a specific inducer in the presence of ammonium sulfate as a salt by fusing a combination of a His tag and an mIZ peptide tag as a purification tag to GFP. It's a degree.
  • Figure 8c shows the degree of macromolecular self-assembly formation according to the treatment concentration of the cation Ni 2+ selected as a specific inducer in the presence of ammonium sulfate as a salt by fusing a combination of a His tag and a DLH peptide tag as a purification tag to GFP. It's a degree.
  • Figure 8d shows the degree of macromolecular self-assembly formation according to the treatment concentration of the cation Ni 2+ selected as a specific inducer in the presence of ammonium sulfate as a salt by fusing a combination of a His tag and an IAQ peptide tag as a purification tag to GFP. It's a degree.
  • Figure 8e shows the degree of macromolecular self-assembly formation according to the treatment concentration of the cation Ni 2+ selected as a specific inducer in the presence of ammonium sulfate as a salt by fusing a combination of a His tag and an EAH peptide tag as a purification tag to GFP. It's a degree.
  • Figure 9a shows the degree of macromolecular self-assembly formation when a combination of a His tag and a TZ1H peptide tag are fused to GFP as a purification tag, and when treated with ammonium sulfate as a salt and untreated or treated with selected cation Ni 2+ as a specific inducer under various pH conditions of a buffer solution.
  • This is a diagram analyzing .
  • Figure 9b shows the degree of macromolecular self-assembly formation when a combination of His tag and mIZ peptide tag is fused to GFP as a purification tag, treated with ammonium sulfate as a salt and untreated or treated with selected cation Ni 2+ as a specific inducer under various pH conditions of buffer solution. This is a diagram analyzing .
  • Figure 9c shows the degree of macromolecular self-assembly formation by fusing a combination of His tag and DLH peptide tag as a purification tag to GFP, treated with ammonium sulfate as a salt and untreated or treated with selected cation Ni 2+ as a specific inducer under various pH conditions of buffer solution. This is a diagram analyzing .
  • Figure 9d shows the degree of macromolecular self-assembly formation when a combination of His tag and IAQ peptide tag is fused to GFP as a purification tag, treated with ammonium sulfate as a salt and untreated or treated with selected cation Ni 2+ as a specific inducer under various pH conditions of buffer solution. This is a diagram analyzing .
  • Figure 9e shows the degree of macromolecular self-assembly formation when a combination of a His tag and an EAH peptide tag are fused to GFP as a purification tag, and when treated with ammonium sulfate as a salt and untreated or treated with selected cation Ni 2+ as a specific inducer under various pH conditions of a buffer solution.
  • This is a diagram analyzing .
  • Figure 10a shows the degree of macromolecular self-assembly formation according to the treatment time of the cation Ni 2+ selected as a specific inducer in the presence of ammonium sulfate as a salt by fusing a combination of a His tag and a TZ1H peptide tag as a purification tag to GFP. It's a degree.
  • Figure 10b shows the degree of macromolecular self-assembly formation according to the treatment time of the cation Ni 2+ selected as a specific inducer in the presence of ammonium sulfate as a salt by fusing a combination of a His tag and an mIZ peptide tag as a purification tag to GFP. It's a degree.
  • Figure 10c shows the degree of macromolecular self-assembly formation according to the treatment time of the cation Ni 2+ selected as a specific inducer in the presence of ammonium sulfate as a salt by fusing a combination of a His tag and a DLH peptide tag as a purification tag to GFP. It's a degree.
  • Figure 10d shows the degree of macromolecular self-assembly formation according to the treatment time of the cation Ni 2+ selected as a specific inducer in the presence of ammonium sulfate as a salt by fusing a combination of a His tag and an IAQ peptide tag as a purification tag to GFP. It's a degree.
  • Figure 10e shows the degree of macromolecular self-assembly formation according to the treatment time of the cation Ni 2+ selected as a specific inducer in the presence of ammonium sulfate as a salt by fusing a combination of a His tag and an EAH peptide tag as a purification tag to GFP. It's a degree.
  • Figure 11a is a diagram analyzing whether the formation of macromolecular self-assembly is promoted when treated with cation Ni 2+ selected as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing His tag alone as a purification tag to GFP. am.
  • Figure 11b shows whether the formation of macromolecular self-assembly is promoted by fusing the TZ1H peptide tag as a purification tag to GFP alone and treating it with the cation Ni 2+ selected as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt. It's a degree.
  • Figure 11c shows whether macromolecular self-assembly formation is promoted upon treatment with selected cation Ni 2+ as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing both the HQ tag and the TZ1H peptide tag as purification tags to GFP. This is the diagram analyzed.
  • Figure 11d shows an analysis of whether the formation of macromolecular self-assembly is promoted when treated with the cation Ni 2+ selected as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing the mIZ peptide tag alone as a purification tag to GFP . It's a degree.
  • Figure 11e shows whether macromolecular self-assembly formation is promoted upon treatment with selected cation Ni 2+ as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing both the HQ tag and the mIZ peptide tag as purification tags to GFP. This is the diagram analyzed.
  • Figure 11f shows the analysis of whether the formation of macromolecular self-assembly is promoted when treated with the cation Ni 2+ selected as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing the HAT peptide tag alone as a purification tag to GFP . It's a degree.
  • Figure 11g shows whether macromolecular self-assembly formation is promoted upon treatment with selected cation Ni 2+ as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing both the HAT tag and the mIZ peptide tag as purification tags to GFP. This is the diagram analyzed.
  • Figure 12a shows macromolecules according to the treatment time of the cation Ni 2+ selected as a specific inducer in the presence of ammonium sulfate as a salt by fusing a combination of the HQ tag, a modified form of the His tag, and the TZ1H peptide tag to GFP as a purification tag.
  • This diagram analyzes the degree of self-assembly formation.
  • Figure 12b shows macromolecules depending on the treatment time of the cation Ni 2+ selected as a specific inducer in the presence of ammonium sulfate as a salt by fusing a combination of the HQ tag, a modified form of the His tag, and the mIZ peptide tag to GFP as a purification tag.
  • This diagram analyzes the degree of self-assembly formation.
  • Figure 12c shows the degree of macromolecular self-assembly formation according to the treatment time of the cation Ni 2+ selected as a specific inducer in the presence of ammonium sulfate as a salt by fusing the HAT tag, which is the original His tag, to GFP as a purification tag. This is the diagram analyzed.
  • Figure 12d shows macromolecular self-assembly according to the treatment time of the cation Ni 2+ selected as a specific inducer in the presence of ammonium sulfate as a salt by fusing a combination of the HAT tag, which is the original His tag, and the mIZ peptide tag to GFP as a purification tag. This is a diagram analyzing the degree of formation.
  • Figure 13 shows the degree of self-assembly formation for each unit by fusing the His tag as a purification tag and each peptide tag combination to GFP and treating it with the cation Ni 2+ selected as a specific inducer in the presence of ammonium sulfate as a salt. This is an analysis of recovery rate and purity.
  • Figure 14 shows self-assembly upon treatment with selected cation Ni 2+ as a specific inducer in the presence of ammonium sulfate as a salt by fusing the HAT tag alone as a purification tag to GFP, or by fusing a combination of the HQ or HAT tag with each peptide tag.
  • This diagram analyzes the recovery rate and purity of each unit based on the degree of formation.
  • Figure 15a shows the conditions in which ammonium sulfate is present as a salt by fusing a His tag alone or a combination of a His tag and a DLH peptide tag, a combination of a HQ tag and an mIZ peptide, or a combination of a HAT tag and an mIZ tag to GFP as a purification tag.
  • This is a diagram analyzing the possibility of filtration using a filter and recovery of recombinant protein when treated with the cation Ni 2+ selected as a specific inducer through UV irradiation.
  • Figure 15b shows the combination of His tag and TZ1H peptide tag, combination of His tag and mIZ peptide, combination of His tag and IAQ peptide, combination of His tag and EAH peptide, and HAT tag alone as purification tags to GFP.
  • This is a diagram analyzing the possibility of filtration using a filter and recovery of recombinant protein when treated with the cation Ni 2+ selected as a specific inducer in the presence of ammonium sulfate through UV irradiation.
  • Figure 15c shows the possibility of filtration using a filter and recovery of the recombinant protein upon treatment with the cation Ni 2+ selected as a specific inducer in the presence of ammonium sulfate as a salt by fusing a combination of the HQ tag and the TZ1H peptide tag as a purification tag to GFP.
  • This is a diagram analyzed through UV irradiation.
  • Figure 16a is a diagram showing amino acid sequence information of a peptide tag constructed by replacing each amino acid of the alpha-helix tag-based TZ1H peptide tag.
  • Figure 16b shows the ability of macromolecular self-assembly to form upon treatment with selected cation Ni 2+ as a specific inducer in the presence of ammonium sulfate as a salt by fusing a peptide tag constructed by substituting each amino acid of the alpha-helix tag-based TZ1H peptide tag to GFP.
  • This is a diagram analyzing .
  • Figure 16c shows the analysis of the ability to form self-assembly when fusing a peptide tag constructed by substituting each amino acid of an alpha-helix tag-based TZ1H peptide tag to GFP and treating it with ammonium sulfate as a salt under specific pH conditions of a buffer solution.
  • Figure 17a shows His 6 :GFP obtained under conditions in which the cation Ni 2+ selected as a specific inducer was treated in the presence of ammonium sulfate as a salt to analyze the formation of macromolecular self-assembly and its size through fluorescence microscopy. It is an image.
  • Figure 17b shows His 6 :mIZ:GFP under conditions in which ammonium sulfate is present as a salt and the cation Ni 2+ selected as a specific inducer is treated to analyze the formation and size of macromolecular self-assembly through fluorescence microscopy. This is an acquired image.
  • Figure 17c shows His 6 :TZ1H:GFP under conditions in which ammonium sulfate is present as a salt and the cation Ni 2+ selected as a specific inducer is treated through fluorescence microscopy to analyze the formation of macromolecular self-assembly and its size. This is an acquired image.
  • Figure 17d shows His 6 :GFP, His 6 :TZ1H:GFP, TZ1H:GFP, His 6 :mIZ:GFP, and mIZ:GFP with sulfuric acid as a salt to quantitatively analyze the degree of macromolecular self-assembly formation through fluorescence microscopy.
  • the fluorescence intensity per pixel is analyzed and graphed based on fluorescence images captured under conditions in which ammonium is present and the cation Ni 2+ selected as a specific inducer is treated.
  • Figure 18a shows the degree of macromolecular self-assembly formation upon treatment of cation Ni 2+ selected as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing a combination of His tag and DLH peptide tag as a purification tag to granulocyte colony-stimulating factor. And this is a diagram analyzing the applicability to recombinant proteins other than GFP.
  • Figure 18b shows the degree of macromolecular self-assembly formation upon treatment of selected cation Ni 2+ as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing a combination of His tag and IAQ peptide tag as a purification tag to interferon alpha2.
  • This diagram analyzes applicability to recombinant proteins other than GFP.
  • Figure 18c shows the fusion of a combination of His tag and mIZ peptide tag as a purification tag to the therapeutic antibody Herceptin light chain, forming macromolecular self-assembly upon treatment with selected cation Ni 2+ as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt.
  • This diagram analyzes the extent and applicability to recombinant proteins other than GFP.
  • Figure 18d shows the degree of macromolecular self-assembly formation when a combination of His tag and TZ1H peptide tag as purification tags are fused to granulocyte colony-stimulating factor and treated with cation Ni 2+ selected as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt. And this is a diagram analyzing the applicability to recombinant proteins other than GFP.
  • Figure 18e shows the degree of macromolecular self-assembly formation upon treatment with the selected cation Ni 2+ as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing a combination of His tag and TZ1H peptide tag as a purification tag to interferon alpha2 .
  • This diagram analyzes applicability to recombinant proteins other than GFP.
  • Figure 18f shows the degree of macromolecular self-assembly formation upon treatment with selected cation Ni 2+ as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing a combination of His tag and mIZ peptide tag as a purification tag to interferon alpha2.
  • This diagram analyzes applicability to recombinant proteins other than GFP.
  • Figure 18g shows the degree of macromolecular self-assembly formation upon treatment of selected cation Ni 2+ as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing a combination of His tag and mIZ peptide tag as a purification tag to granulocyte colony-stimulating factor. And this is a diagram analyzing the applicability to recombinant proteins other than GFP.
  • Figure 18h shows the degree of macromolecular self-assembly formation upon treatment with selected cation Ni 2+ as a specific inducer in the presence of various concentrations of ammonium sulfate as a salt by fusing a combination of His tag and DLH peptide tag as a purification tag to interferon alpha2.
  • This diagram analyzes applicability to recombinant proteins other than GFP.
  • Ammonium sulfate (NH 4 ) 2 SO 4 , CAT NO. A4915) and nickel chloride (NiCl 2 , CAT NO. 339350) were purchased from Sigma Aldrich (St. Louis, MO, USA) of each ACS reagent grade and over 98% of the reagents. was purchased and used, and EDTA disodium salt dihydrate (C 10 H 14 N 2 Na 2 O 8 ⁇ 2H 2 O, CAT NO. 0105) was purchased and used at Biotechnology grade from VWR Life Science (Radnor, PA, USA). .
  • F-Kpn I-Hinge-Bgl II-TEV cleavage site:GFP/R-Xho I, Hind III The GFP gene was amplified using the :GFP primer, cut with restriction enzymes, and then inserted into the Kpn I/Xho I site of the pET 28a vector to construct the pET 28a-GFP partial vector.
  • pET 28a-His 6 :TZ1H(Q/G):GFP pET 28a-His 6 :TZ1H(H/G):GFP
  • pET 28a-His 6 :TZ1H(H/K):GFP pET 28a-His 6 :TZ1H(E/G):GFP
  • pET 28a-His 6 :TZ1H(K/G):GFP pET 28a-His 6 :mIZ:GFP
  • pET 28a-His 6 :DLH:GFP pET 28a-His 6 :IAQ:GFP
  • pET 28a-His 6 :EAH:GFP vectors were constructed.
  • F-Nco I BamH I-TZ1H/R-Kpn I-TZ1H
  • F-Nco I BamH I-TZ1H(H/G)/R-Kpn I-TZ1H(H/G)
  • F-Nco I BamH I-TZ1H(K/G)/R-Kpn I-TZ1H(K/G)
  • F-Nco I BamH I-mIZ/R-Kpn I-mIZ
  • F-Nco I BamH I-DLH/R-Kpn I-DLH
  • F-Nco I BamH I-IAQ/R-Kpn I-IAQ
  • pET 28a-TZ1H:GFP pET 28a-TZ1H(H/G):GFP
  • pET 28a-TZ1H(K/G) based on primer combinations of F-Nco I, BamH I-EAH/R-Kpn I-EAH,
  • F-Nco I BamH I-HAT/R-Kpn I-HAT
  • F-Nco I BamH I-HAT:mIZ/R-Kpn I-mIZ
  • F-Nco I BamH I-HQ:TZ1H/R-Kpn I-TZ1H
  • pET 28a-HAT:GFP pET 28a-HAT:mIZ:GFP
  • pET 28a-HQ:TZ1H:GFP based on primer combinations of F-Nco I, BamH I-HQ:mIZ/R-Kpn I-mIZ, respectively.
  • the pET 28a-HQ:mIZ:GFP vector was completed.
  • F-Bgl II-rhG-CSF/R-Hind III-rhG-CSF F-Bgl II-INF-a2/R-Hind III-INF-a2
  • F-Bgl II-HER LC/R-Hind III-HER LC After performing PCR using the primer combination of F-Bgl II-HER LC/R-Hind III-HER LC, digestion was performed with Bgl II/Hind III restriction enzymes to produce pET 28a-His 6 :DLH:GFP and pET 28a-His 6 :IAQ, respectively.
  • Amino acid sequence and nucleic acid sequence information of the first purification tag tag name Amino acid sequence (N ⁇ C) sequence number Nucleic acid sequence (5’ ⁇ 3’) sequence number His 6 HHHHHH One CATCACCATCACCACCAT 40 HAT KDHLIHNVHKEFHAHAHNK 2 AAGGATCATCTTATACACAATGTTCATAAGGAGTTCCACGCACATGCTCACAACAAG 41 HQ 6 HQHQHQHQHQ 3 CATCAGCACCAACATCAGCACCAACACCAGCATCAA 42
  • Amino acid sequence and nucleic acid sequence information of the alpha-helix tag (or second purification tag) tag name Amino acid sequence (N ⁇ C) sequence number Nucleic acid sequence (5’ ⁇ 3’) sequence number mIZ YGGIEKKIEAHEKKHEAIEKKIEA 4 TATGGAGGTATTGAGAAGAAGATTGAGGCACATGAGAAGAAGCATGAGGCAATAGAGAAGAAGATTGAGGCA 43 TZ1H EIAQHEKEIQAIEKKIAQHEYKIQAIEEKIAQHKEKIQAIK 5 GAAATTGCTCAACATGAAAAGGAAATTCAAGCTATTGAAAAGAAGATTGCTCAACATGAATATAAGATTCAAGCTATTGAAGAAAAGATTGCTCAACATAAGGAAAAGATTCAAGCTATTAAG 44 DLH DLHDRDLHDR 6 GACCTACATGACCGATCTTCACGATCGTGATCTTCATGACCGA 45 IAQ IAQHEKEIAQHEKEIAQHEKE 7 ATTGC
  • Amino acid sequence and nucleic acid sequence information of each fusion polypeptide or target protein Clone name Amino acid sequence (N ⁇ C) sequence number Nucleic acid sequence (5’ ⁇ 3’) sequence number His 6 :mIZ MDPMHHHHHHYGGIEKKIEAHEKKHEAIEKKIEA 9 ATGGATCCAATGCATCACCATCACCACCATTATGGAGGTATTGAGAAGAAGATTGAGGCACATGAGAAGAAGCATGAGGCAATAGAGAAGAAGATTGAGGCA 48 His 6 :TZ1H MDPMHHHHHHHEIAQHEKEIQAIEKKIAQHEYKIQAIEEKIAQHKEKIQAIK 10 ATGGATCCAATGCATCACCATCACCACCACCATGAAATTGCTCAACATGAAAAGGAAATTCAAGCTATTGAAAAGAAGATTGCTCAACATGAATATAAGATTCAAGCTATTGAAGAAAAGATTGCTCAACATAAGGAAAAGATTCAAGCTATTAAG 49 His 6 :DLH MDPMHHHHPSDLHDRDL
  • alpha-helix peptide tags were analyzed through wheel diagram analysis using pepwheel (https://www.bioinformatics.nl/cgi-bin/emboss/pepwheel).
  • pepwheel https://www.bioinformatics.nl/cgi-bin/emboss/pepwheel.
  • mIZ, TZ1H, IAQ, DLH, and EAH peptide tags were artificially designed to facilitate self-assembly formation by controlling the relative arrangement positions of major amino acids in the three-dimensional structure of the helix.
  • the mIZ peptide tag was arranged so that the major amino acids, which are charged and hydrophobic, were distributed bidirectionally in the three-dimensional structure of the alpha-helix, and the TZ1H peptide tag was arranged so that the major amino acids were evenly distributed in all directions.
  • the IAQ peptide tag was arranged so that polar amino acids, in addition to the main charged and hydrophobic amino acids, each partially formed a cluster in the three-dimensional structure of the alpha-helix.
  • the DLH and EAH peptide tags were arranged so that clusters of major amino acid combinations were distributed in three directions in the three-dimensional structure of the alpha-helix.
  • the results of wheel diagram analysis of the relative positions of the main amino acids of these alpha-helical peptide tags are shown in Figures 2A to 2E.
  • the vector for expressing the fusion protein prepared in Example 1 was transformed into BL21 (DE3) E. coli and cultured in LB medium (containing 50 ⁇ g/ml of kanamycin) at 37°C.
  • LB medium containing 50 ⁇ g/ml of kanamycin
  • IPTG isopropyl- ⁇
  • the cultured E. coli was centrifuged at 4,000 rpm for 15 minutes at 4°C to obtain a pellet.
  • HEPES buffer HEPES buffer
  • Triton A supernatant containing the fusion protein was obtained.
  • ammonium sulfate in the range of 12 to 22% [w/v] was treated at 2% intervals, centrifuged, and the resulting supernatant was treated with Ni 2+ at a concentration of 0.5 mM.
  • Ni 2+ at a concentration of 0.5 mM was treated under NaCl treatment conditions in the range of 0 to 3 M.
  • pH 7.4 HEPES buffer HEPES; 50mM HEPES buffer (pH 7.4)
  • pH 7.4 PBS buffer PBS; 137mM NaCl, 2.7mM KCl, 10mM Na 2 HPO 4 , 1.8mM KH 2 PO 4 (pH 7.4)
  • pH 7.4 PB buffer PB; 10mM Na 2 HPO 4 , 1.8mM KH 2PO 4 pH 7.4
  • Tris buffer Tris; 50mM Tris-HCl buffer (pH 7.4)
  • 1% [v/v] TritonX-100 and 1X [v/v] Protease inhibitor cocktail tablets were added. The supernatant obtained by centrifugation after treatment with ammonium sulfate in each buffer solution condition was treated with Ni 2+ at a concentration of 0.5 mM.
  • the supernatant obtained by centrifugation after treatment with ammonium sulfate was treated with Ni 2+ in the range of 0 to 2 mM.
  • ammonium sulfate was treated and centrifuged, and the resulting supernatant was adjusted to a pH range of 5 to 10 using HCl and NaOH.
  • the supernatant obtained by centrifugation after treatment with ammonium sulfate at each pH condition was treated with Ni 2+ at a concentration of 0.5 mM.
  • the supernatant obtained by centrifugation after treatment with ammonium sulfate was measured at 10-minute intervals from immediately after treatment with Ni 2+ at a concentration of 0.5 mM to 60 minutes after treatment, and additionally for up to 120 minutes.
  • Example 4 the recombinant protein in which macromolecular self-assembly was formed depending on a specific inducer or condition was recovered through methods such as centrifugation and filtration.
  • the macromolecular assembly was converted into monomers or eluted using the same buffer solution containing a chelate such as EDTA.
  • a chelate such as EDTA.
  • the filter was irradiated with a UV wavelength of 360 nm and visually confirmed.
  • a fluorescence microscope was used to analyze the formation of macromolecular self-assembly and its approximate size, and a filter of exitation: 488 nm, emission: 520 nm was used to detect the GFP fluorescence signal.
  • a filter of exitation: 488 nm, emission: 520 nm was used to detect the GFP fluorescence signal.
  • the relative scale of self-assembly formation was compared by measuring the fluorescence intensity per pixel of the captured fluorescence image.
  • GFP was selected as a model protein and purified using the method described in Examples 1, 2 and 3, where the His tag and the main amino acid were charged and hydrophobic.
  • TZ1H peptide tag an alpha-helix-based unit composed of amino acids, the mIZ peptide tag, and the DLH peptide tag, IAQ peptide tag, and EAH peptide tag, which were artificially designed based on these characteristics, His 6 :TZ1H:GFP, His 6 : mIZ:GFP, His 6 :DLH:GFP, His 6 :IAQ:GFP, and His 6 :EAH:GFP fusion proteins were produced.
  • Proteins induced to form macromolecular self-assembly by a cationic inducer were recovered through centrifugation, dissolved in the same buffer solution used for protein elution, added with SDS sample buffer, heated, and confirmed through SDS-PAGE, as shown in Figures 3a to 3k. shown in
  • the His 6 :TZ1H:GFP fusion protein is a macromolecule by Ni 2+ , Co 2+ , Cu 2+ , Zn 2+ , Fe 2+ , and Ba 2+. Assembly formation was induced, and in particular, it was confirmed that Ni 2+ , Zn 2+ , Fe 2+ , and Ba 2+ were excellent in inducing self-assembly formation (see Figure 3c).
  • the His 6 :mIZ:GFP fusion protein was induced to form macromolecular self-assembly by Ni 2+ , Co 2+ , Cu 2+ , Ag 2+ , Zn 2+ , and Fe 2+ , especially Ni 2+ and Cu 2+.
  • the combination of the His tag and the peptide tag significantly increased the induction of macromolecular self-assembly formation by various cationic inducers, and the induction of self-assembly formation increased depending on the type of alpha helix-based unit peptide tag. It was confirmed that the types of inducers were different.
  • the combination of the His tag and all peptide tags generally showed very good reactivity to the inducer Ni 2+ , and in subsequent experiments, Ni 2+ was used as a specific inducer.
  • His 6 :TZ1H:GFP, His 6 :mIZ:GFP, His 6 :DLH:GFP, His 6 :IAQ:GFP, and His 6 :EAH:GFP fusion proteins obtained in Example 3, His tag alone.
  • Each protein extract containing His 6 :GFP fused to TZ1H:GFP, mIZ:GFP, DLH:GFP, IAQ:GFP, and EAH:GFP fusion proteins fused to each alpha helix-based unit alone was treated with a cationic inducer.
  • the formation of macromolecular self-assembly was induced by treating Ni 2+ at a concentration of 0 to 2 mM.
  • Proteins induced to form macromolecular self-assembly were recovered through centrifugation and dissolved in the same buffer solution used for protein elution. SDS sample buffer was added, heated, and confirmed through SDS-PAGE. The results are shown in Figures 4a to 4e. indicated.
  • His 6 :TZ1H:GFP, His 6 :mIZ:GFP, His 6 :DLH:GFP, His 6 :IAQ:GFP, and His 6 :EAH:GFP fusion proteins obtained in Example 3, His tag alone.
  • the formation of macromolecular self-assembly was induced by the method described in -1.
  • Proteins induced to form macromolecular self-assembly were recovered through centrifugation and dissolved in the same buffer solution used for protein elution. SDS sample buffer was added, heated, and confirmed through SDS-PAGE. The results are shown in Figures 5A to 5K. indicated.
  • TZ1H:GFP is a macromolecule at 16% (w/v), His 6 :DLH:GFP, His 6 :mlZ:GFP, His 6 :IAQ:GFP, and His 6 :EAH:GFP at 20% (w/v). It was analyzed that self-assembly formation was the best.
  • the following experiment was performed to identify a buffer solution suitable for the formation of a macromolecular self-assembly of an alpha helix-based unit fusion protein consisting of a His tag as a purification tag and major amino acids of charged and hydrophobic amino acids.
  • each fusion protein extract was added with pH 7.4 HEPES buffer (HEPES; 50 mM HEPES buffer (pH 7.4)), pH 7.4 PBS buffer (PBS; 137mM NaCl, 2.7mM KCl, 10mM Na 2 HPO 4 , 1.8mM KH 2 PO 4 (pH 7.4)), pH 7.4 PB buffer (PB; 10mM Na 2HPO 4 , 1.8mM KH 2PO 4 pH 7.4)), pH 7.4 Tris buffer (Tris; 50mM Tris-HCl buffer (pH 7.4)) was used as each buffer solution, and 1% [v/v] Triton X-100 and 1X [v/v] Protease inhibitor cocktail tablets (Roche) were added.
  • the protein supernatant containing each fusion protein was treated with ammonium sulfate as a salt, and Ni 2+ cations as an inducer were treated in various concentrations of 0 to 2 mM, respectively, by the method described in Example 4-4.
  • the effect of inducing self-assembly was confirmed through SDS-PAGE, and the results are shown in Figures 8A to 8E.
  • the following experiment was performed to confirm the pH conditions of a buffer solution suitable for the formation of a macromolecular self-assembly of an alpha helix-based unit fusion protein consisting of a His tag as a purification tag and major amino acids of charged and hydrophobic amino acids.
  • the protein supernatant containing each fusion protein was treated with ammonium sulfate as a salt, and Ni 2+ cation as an inducer at a concentration of 0.5 mM.
  • Ni 2+ cation treatment self-assembly was induced by the method described in Example 4-6 at 10-minute intervals for up to 60 minutes, and after additional induction for 120 minutes, the self-assembly induction effect was confirmed through SDS-PAGE, and the results were obtained. is shown in Figures 10a to 10e.
  • each fusion protein in which an alpha helix-based unit composed of charged and hydrophobic amino acids as the main amino acid was bound to the His tag formed a macromolecular self-assembly within 20 minutes. .
  • Green fluorescent protein was used as a model protein to determine whether the ability to induce macromolecular self-assembly is improved under specific inducer conditions by fusing the original HAT tag and modified HQ tag of the His tag with the TZ1H peptide tag and mIZ peptide tag or designing and combining them alone. were selected to produce the following HQ 6 :TZ1H:GFP, HQ 6 :mIZ:GFP, HAT:GFP, and HAT:mIZ:GFP fusion proteins.
  • Example 4-2 an experiment was performed in the same manner as in Example 4-2 to confirm the concentration conditions of ammonium sulfate for the ability to induce self-assembly formation of the HQ tag or HAT tag and alpha helix-based tag fusion protein.
  • HQ 6 :mIZ:GFP, HAT:mIZ:GFP are 12-22% (w/v), HAT:GFP is 16-22% (w/v), HQ 6 :TZ1H:GFP induced macromolecular self-assembly formation in the range of 18-22% (w/v).
  • macromolecular self-assembly is formed at 18% (w/v) for HQ 6 :mlZ:GFP, HAT:GFP, HAT:mlZ:GFP, and 22% (w/v) for HQ 6 :TZ1H:GFP. It was analyzed as the best.
  • each fusion protein of the HQ tag or HAT tag and the alpha helix-based tag all formed macromolecular self-assembly within 20 minutes.
  • the centrifugation method is to induce the formation of macromolecular self-assembly using optimal conditions and a proton inducer, then centrifuge at 3,000 rpm or more at 4°C for 10 minutes to recover the recombinant protein in the form of a pellet and treat it with EDTA to separate the monomer from the multimer.
  • converted to The converted monomer was confirmed through SDS-PAGE, and recovery rate and purity were measured using Bio-Rad's Image Lab program. The recovery rate was obtained by inducing self-assembly using ammonium sulfate and Ni 2+ and using the formula below (Calculation 1).
  • Recovery rate protein intensity of the target band recovered / (intensity of the target protein band not recovered + intensity of the target protein band recovered) ⁇ 100
  • Purity was expressed as a percentage by measuring the ratio of the purified protein band to the total protein.
  • the HAT tag showed improved macromolecular self-assembly formation ability compared to the His tag when used alone as a purification tag, and when combined with the HAT tag or HQ tag and the TZ1H peptide tag and mIZ peptide tag, the His Compared to the tag, it was confirmed that the ability to form macromolecular self-assembly was similar.
  • the method of using a filter is to filter the recombinant protein in which macromolecular self-assembly was formed under optimal conditions and a proton inducer in the protein extract using a 0.2 ⁇ m syringe filter (Satorius, Goettingen, GEU), and then add the same buffer solution used for the macromolecular assembly induction reaction. The washing process was carried out using Then, the macromolecular assembly was converted into monomers or eluted using the same buffer solution containing a chelate such as EDTA. In order to visually confirm this, the filter was irradiated with a UV wavelength of 360 nm and visually confirmed.
  • a chelate such as EDTA
  • the self-assembly in the form of macromolecules was filtered through a filter, and the fluorescence of the protein solution treated with ammonium sulfate and Ni 2+ was observed by irradiating UV.
  • the buffer solution containing EDTA was passed through the filter, the recombinant protein multimers were converted to monomers by EDTA and eluted, so the filter did not fluoresce even when irradiated with UV light. In this way, the conversion from multimer to monomer caused by EDTA is reversible and is a very rapid reaction that occurs within a few seconds.
  • the process of removing the tag after purification can also be easily removed under specific inducers or conditions. Therefore, using this purification method, it was possible to recover recombinant proteins easily, simply, and quickly using equipment and materials that are commonly available to anyone, and it is expected that scale-up can be carried out without difficulty by applying it to the recombinant protein production process in the future.
  • Experimental Example 4-4 Identification of important amino acids for the formation of macromolecular self-assembly of His tag and alpha helix-based tag fusion protein.
  • the following experiment was performed to identify the major amino acids that are key to the formation of macromolecular self-assembly among amino acids constituting an alpha-helix-based unit fusion protein composed of a His tag as a purification tag and major amino acids of charged and hydrophobic amino acids.
  • the formation of macromolecular self-assembly is induced by changing the pH to 8 under the Ni 2+ concentration condition of 0.5 mM and in the absence of Ni 2+ using a specific inducer, followed by centrifugation. It was recovered through SDS sample buffer, heated, and analyzed through SDS-PAGE.
  • the presence of ammonium sulfate as a salt and Ni 2+ as a specific inducer are key amino acids in the formation of macromolecular self-assembly under the condition of 0.5 mM concentration, and the composition of hydrophobic and charged residues within the tag is important for the formation of macromolecular self-assembly. It was confirmed that this was the case. Additionally, the composition of most amino acid residues in the tag was important as a key amino acid in the formation of macromolecular self-assembly under conditions in which ammonium sulfate as a salt was present and Ni 2+ was not present and pH was changed to 8, but glutamic acid, a negatively charged residue, was important. In the case of , there was no significant effect on the formation of macromolecular self-assembly.
  • the fluorescence intensity per unit area was measured and compared. Generally, when self-assembly is formed, as the size of the assembly increases, the number of proteins assembled per unit area increases. In this experimental example, the fluorescence intensity was measured using fused GFP.
  • :rhG-CSF is 92%, 98%, His 6 :IAQ:INF-a2 is 84%, 96%, His 6 :mIZ:HER LC is 80%, 94%, His 6 :TZ1H:rhG-CSF is 93% %, 99%, His 6 :TZ1H:INF-a2 was 96%, 99%, His 6 :mIZ:INF-a2 was 80%, 99%, His 6 :mIZ:rhG-CSF was 84%, 99%, His 6 :DLH:INF-a2 was analyzed at 87% and 98%. In other words, it was confirmed that in purifying numerous target proteins other than the target protein searched for in the present invention, it was possible to select among the various units presented in the present invention and purify them with optimal recovery rate and purity.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Physics & Mathematics (AREA)
  • Water Supply & Treatment (AREA)
  • Analytical Chemistry (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

본 발명은 His 태그, HAT 태그 및 HQ 태그 중 어느 하나와 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 알파-나선 펩타이드 태그를 융합한 융합 폴리펩타이드 및 이를 이용한 목적 단백질 정제 방법에 관한 것으로, 상기 융합 폴리펩타이드는 목적 단백질과 융합되어 자가 조립체 형성 유도능이 있으므로, 이를 이용한 목적 단백질 정제 방법은 원심분리 또는 여과 방법과 같은 매우 간단한 방법만으로 목적 단백질을 분리 정제가 가능하다.

Description

정제 태그와 알파-나선 태그를 포함하여 자가 조립체를 형성하는 융합 단백질 및 이를 이용하여 재조합 단백질을 정제하는 방법
관련 출원(들)과의 상호 인용
본 출원은 2022년 9월 27일자 한국특허출원 제10-2022-0122186호에 기초한 우선권의 이익을 주장하며, 해당 한국 특허 출원의 문헌들에 개시된 모든 내용은 본 명세서의 일부로서 포함된다.
본 발명은 정제 태그와 알파-나선(alpha-helix) 태그를 포함하는 융합 단백질, 이를 포함하는 재조합 단백질 정제용 조성물 및 이를 이용한 재조합 단백질 정제 방법에 관한 것이다.
일반적으로 MBP(maltose-binding protein) 태그, GST(glutathione s-transferase) 태그와 함께 His 태그 (또는 His6 태그) 또는 HAT 태그(natural histidine affinity tag)는 재조합 단백질의 정제에 널리 사용되고 있다. 재조합 단백질의 정제에 His 태그를 이용하는 일반화된 방법은, His 태그를 재조합 단백질에 융합하여 친화 크로마토그래피를 통해 니켈 이온 또는 코발트 이온이 고정화된 Ni2+-NTA 비드(bead or resin) 또는 Co2+-CMA 비드에 결합시킨 후, 과량의 이미다졸(imidazole) 또는 낮은 pH 처리를 통해 비드에 결합된 재조합 단백질을 용출(elution)시키는 방식으로 정제한다. 즉, 아미노산 히스티딘과 구조가 유사한 이미다졸이 His 태그와 경쟁하여 Ni2+-NTA 비드 또는 Co2+-CMA 비드에 결합하려는 원리를 이용하여 His 태그가 융합된 재조합 단백질을 용출하는 것이다(Kerpe K. 2003). 이처럼 의료용 단백질을 포함하는 재조합 단백질의 정제에 가장 널리 사용되고 있는 방법은 친화 태그(affinity tag)를 이용하거나 항체에 대한 결합력을 갖는 protein A를 이용한 흡착(친화성) 크로마토그래피법이다. 그러나, 이러한 정제 방법은 고가의 비드(bead or resin)를 사용하여 많은 시간이 소요되는 복잡한 여러 단계의 정제과정을 거쳐야 하며, 비드에 대한 비특이적 결합력을 가지는 단백질들의 오염으로 인해 정제 순도가 다소 낮아지고, 정제 후 크기가 큰 태그를 제거하는 과정이 필요하며, 다른 종류의 재조합 단백질 생산에 재활용 비드의 사용이 어려운 점 등의 다양한 문제점을 가지고 있다. 이러한 문제점들은 정제 단계의 scale-up을 제한하고 생산비용을 증가시키는 주요한 요인으로 작용한다.
다른 한편으로, 핵 형성(nucleation) 또는 이량체 등의 다량체 형성이 가능한 모티프, 도메인 또는 펩타이드에 대해 많은 연구가 진행되었다. 코일 구조(coil structure)를 형성하는 루이신 지퍼 펩타이드(isoleucine zipper peptide) 내에 인위적으로 히스티딘 잔기를 도입함으로써 Ni2+, Zn2+, Cu2+의 금속이온 의존적인 삼량체(trimer)를 형성한다는 것이 보고되었다. 그리고 역시 코일 구조를 가지는 TZ1H 펩타이드가 Ag2+ 또는 pH 의존적인 구조 전환을 통해 삼량체를 형성하는 것이 알려져 있다. 뿐만 아니라, 다양한 생물종에서 발견되는 철 저장 단백질 페리틴(ferritin)은 철이온과 결합할 수 있는 능력이 있으며, 24개의 페리틴 단백질이 결합하여 하나의 페리틴 복합체(ferritin complexes)를 형성한다는 것이 보고되었다. 나아가, 알파-나선구조(α-helical) 펩타이드 18A, 베타-병풍구조(β-strand) 펩타이드 ELK16, 양친매성의 계면 활성제 유사 펩타이드 L6KD, 그리고 소수성 펩타이드 GFIL8 등은 세포 내에서 응집체(inclusion bodies)를 형성한다는 것이 알려져 있다. 이외에도, ELPs(Elastin like polypeptides)는 열처리 조건하에서 단백질 응집(aggregation)이 이루어진다는 것이 보고되었으며, 이러한 특성을 이용하여 재조합 단백질의 정제에 응용하고자 하는 연구들이 진행되었고, 칼모듈린(calmodulin)과 M13 펩타이드는 칼슘이온 의존적인 결합이, Atox1과 WD4간의 결합력은 Zn2+, Cu2+, Pt2+ 의존적으로, 그리고 FRB(FKBP12-Rapamycin binding protein)와 FKBP(FK506 binding protein)은 rapamycin이 존재하는 조건하에서 특이적인 결합을 한다는 것이 보고되었다.
전술한 기술적 또는 특정 단백질의 모티프, 도메인 또는 펩타이드의 특성적 배경 하에서, 본 발명자들은 기존의 재조합 단백질 정제 방법의 문제점을 해결하고 기존 방법과는 전혀 다른 개념인 특정 유도제(inducer) 또는 조건 처리를 통해 거대분자 조립체 형성을 유도하여 원심분리 또는 여과와 같은 간단한 방법으로 고순도의 재조합 단백질을 선택적으로 정제할 수 있는 본 발명을 완성하였다.　　 　　　
본　발명이 이루고자 하는 기술적 과제는 기존의 재조합 단백질 정제 방법 즉, 정제 과정에 고가의 비드 또는 레진의 사용, 정제를 위해 구동되는 고가의 장치 또는 설비 필요, 많은 시간 소요 및 여러 단계의 복잡한 과정을 거치는 등의 다양한 문제점을 해결하기 위한 것으로, 특정 유도제 또는 조건 의존적으로 재조합 단백질에 융합된 태그의 거대분자 자가 조립체 형성을 유도하여 원심분리, 여과 등의 간단한 방법만으로 목적하는 재조합 단백질 분리 정제하는 방법에 관한 것이다. 이를 통해 고가의 비드 또는 레진이 필요하지 않으면서 매우 쉽고, 빠르고, 간편하고, 고순도, 고효율, 저비용으로 재조합 단백질을 정제할 수 있는 경쟁력 있는 차세대 재조합 단백질 정제 방법을 개발하고자 함이다.
본 출원의 일 예는 자가조립체를 형성하는 주요 아미노산이 전하성 및 소수성 아미노산(charged and hydrophobic amino acids)으로 구성된 알파-나선 펩타이드 태그를 제공한다.
본 출원의 일 예는 서열번호 1 내지 서열번호 3으로 이루어진 군에서 선택되는 하나의 아미노산 서열로 표시되는 제1 폴리펩타이드 및 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 알파-나선 태그인 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드를 제공한다.
본 출원의 다른 예는 제1 폴리펩타이드 및 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드 및 목적 단백질을 포함하는 융합 단백질을 제공한다.
본 출원의 다른 예는 제1 폴리펩타이드 및 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드, 또는 상기 융합 폴리펩타이드 및 목적 단백질을 포함하는 융합 단백질을 암호화하는 폴리뉴클레오티드를 제공한다.
본 출원의 다른 예는 제1 폴리펩타이드 및 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드, 또는 상기 융합 폴리펩타이드 및 목적 단백질을 포함하는 융합 단백질을 암호화하는 폴리뉴클레오티드를 포함하는 발현 벡터를 제공한다.
본 출원의 다른 예는 상기 발현 벡터로 형질전환시킨 숙주세포를 제공한다.
본 출원의 다른 예는 제1 폴리펩타이드 및 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드, 또는 상기 융합 폴리펩타이드 및 목적 단백질을 포함하는 융합 단백질을 암호화하는 폴리뉴클레오티드를 포함하는 세포를 배지에서 배양하는 단계를 포함하는 목적 단백질을 정제하는 방법을 제공한다.
본 출원의 다른 예는 서열번호 1 내지 서열번호 3으로 이루어진 군에서 선택되는 하나의 아미노산 서열로 표시되는 제1 폴리펩타이드, 및/또는 서열번호 4 내지 서열번호 8로 이루어진 군에서 선택되는 하나의 아미노산 서열로 표시되는 제2 폴리펩타이드를 포함하는 단백질 정제용 조성물을 제공한다.
본 출원의 다른 예는 서열번호 1 내지 서열번호 3으로 이루어진 군에서 선택되는 아미노산 서열로 표시되는 제1 폴리펩타이드, 및/또는 서열번호 4 내지 서열번호 8로 이루어진 군에서 선택되는 아미노산 서열로 표시되는 제2 폴리펩타이드를 포함하는 자가조립체를 제공한다.
본 출원에서 개시되는 각각의 설명 및 실시 형태는 각각의 다른 설명 및 실시 형태에도 적용될 수 있다. 즉, 본 출원에서 개시된 다양한 요소들의 모든 조합이 본 출원의 범주에 속한다. 또한, 하기 기술된 구체적인 서술에 의하여 본 출원의 범주가 제한된다고 볼 수 없다. 또한, 당해 기술분야의 통상의 지식을 가진 자는 통상의 실험만을 사용하여 본 출원에 기재된 본 출원의 특정 양태에 대한 다수의 등가물을 인지하거나 확인할 수 있다. 또한, 이러한 등가물은 본 출원에 포함되는 것으로 의도된다.
상기와 같은 본 발명의 목적을 달성하기 위하여, 자가조립체를 형성하는 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 알파-나선 펩타이드 태그를 제공한다.
상기 자가 조립체를 형성하는 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 알파-나선 펩타이드 태그의 전하성 아미노산은 Lysine(Lys, K), Arginine(Arg, R), Histidine(His, H)의 양전하성 아미노산과 Aspartate(Asp, D), Glutamate(Glu, E)의 음전하성 아미노산 중에서 선택되고, 소수성 아미노산으로는 Alanine (Ala, A), Valine (Val, V), Leucine (Leu, L), Isoleucine (Ile, I), Proline (Pro, P), Phenylalanine (Phe, F), Methionine (Met), Tryptophan (Trp, W) 중에서 선택될 수 있으며, 힌지 영역 또는 링크 부위를 제외한 알파-나선 태그 내에서 전하성 및 소수성 아미노산의 함유량이 60% 이상, 65% 이상, 70% 이상, 바람직하게는 75% 이상인 것을 특징으로 한다.
상기 알파-나선 펩타이드 태그는 mIZ(modified isoleucine zipper), TZ1H 및 이들 펩타이드를 구성하고 있는 주요 아미노산의 특징인 전하성과 소수성을 띠는 아미노산을 기반으로 인위적으로 디자인한 DLH, IAQ 또는 EAH 펩타이드일 수 있으며, 이에 국한되는 것은 아니다.
상기 알파-나선 펩타이드 태그는 서열번호 4 내지 서열번호 8로 이루어진 군에서 선택되는 하나의 아미노산 서열을 포함하는 것일 수 있고, 일 구체 예에서, 서열번호 4 내지 서열번호 8로 이루어진 군에서 선택되는 하나의 아미노산 서열로 표시되거나, 이루어지는 것일 수 있다.
상기 알파-나선 펩타이드 태그는 His 태그 등의 정제 태그와 융합된 융합 단백질 형태로 사용될 수 있으며, 상기 알파-나선 펩타이드 태그 또는 상기 알파-나선 펩타이드 태그 및 His 태그 등의 정제 태그가 융합된 융합 단백질은 목적 단백질과 융합되어 자가 조립체 형성 유도능을 갖는다.
또한, 본 발명은 서열번호 1 내지 서열번호 3으로 이루어진 군에서 선택되는 하나의 아미노산 서열로 표시되는 제1 폴리펩타이드 및 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 알파-나선 태그인 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드를 제공한다.
상기 제1 폴리펩타이드는 정제 태그일 수 있다. 구체적으로, 상기 제1 폴리펩타이드는 Ni2+ 또는 Co2+에 결합할 수 있는 His 태그, 이의 오리지널 형태인 HAT 태그, 또는 His 태그의 변형된 HQ 태그(또는 HQ6 태그)일 수 있으며, 이에 국한되는 것은 아니다. 상기 His 태그, HAT 태그 및 HQ 태그는 각각 서열번호 1, 서열번호 2, 및 서열번호 3의 아미노산 서열로 표시되거나, 이루어진 것일 수 있다.
상기 제2 폴리펩타이드는 핵 형성 (nucleation) 또는 이량체 등의 다량체 형성이 가능한 모티프, 도메인 또는 펩타이드일 수 있다. 구체적으로, 상기 제2 폴리펩타이드는 mIZ, TZ1H 및 이들 펩타이드를 구성하고 있는 주요 아미노산의 특징인 전하성과 소수성을 띠는 아미노산을 기반으로 인위적으로 디자인한 DLH, IAQ 또는 EAH 펩타이드일 수 있으며, 이에 국한되는 것은 아니다. 상기 mIZ, TZ1H, DLH, IAQ 또는 EAH 펩타이드는 각각 서열번호 4, 서열번호 5, 서열번호 6, 서열번호 7 및 서열번호 8의 아미노산 서열로 표시되거나, 이루어진 것일 수 있다.
상기 제1 폴리펩타이드와 제2 폴리펩타이드는 순차적으로 연결되는 것일 수 있다.
또한, 본 발명은 상기 제1 폴리펩타이드 및 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드 및 목적 단백질을 포함하는 융합된 재조합 단백질을 제공한다.
상기 제1 폴리펩타이드 및 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드는 목적 단백질의 C-말단뿐만 아니라, N-말단 또는 단백질의 기능성에 실질적인 영향을 미치지 않는 한 단백질 내부의 어느 곳에라도 삽입할 수 있다. 여기에서 단백질의 기능성에 실질적인 영향을 미치지 않는다는 것은 상기 융합 폴리펩타이드를 융합시키기 전에 단백질이 갖는 활성을 80% 이상, 바람직하게는 95% 이상 유지한다는 것을 의미한다.
본 발명에서 “재조합 단백질”은 각각의 부분이 별개의 기능을 포함하는 적어도 2개의 부분을 포함하는 아미노산(펩타이드, 올리고펩타이드, 폴리펩타이드, 또는 단백질)의 중합체를 의미한다. 재조합 단백질의 적어도 하나의 제1 부분은 적어도 하나의 본 발명의 제1 폴리펩타이드 및 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드를 포함하고, 재조합 단백질의 적어도 하나의 제2 부분은 적어도 하나의 목적 단백질(또는 펩타이드)를 포함한다.
본 발명에서 “목적 단백질”은 생산 또는 정제의 목적이 되는 임의의 단백질로서, 펩타이드를 포함하는 의미이고, 본 명세서 내에서 “표적 단백질”의 용어와 혼용될 수 있다.
상기 목적 단백질은 녹색 형광 단백질(Green Fluorescent Protein, GFP), 과립구 콜로니자극인자(rhG-CSF), 인터페론 알파2(INF-α2), 치료용 항체 허셉틴 경쇄(light chain of Herceptin)를 예시로서 사용하였으나, 이에 제한되는 것은 아니다. 상기 용어 “목적 단백질”은 본 발명에 따른 생명공학적 방법으로 생산하고자 하는 단백질을 말하는 것으로, 특별히 어느 하나에 제한되지 않으며, 바람직하게는 의료용, 산업용, 진단용, 실험용 등의 용도로 사용될 수 있는 단백질이 포함될 수 있다.
상기 융합 단백질은 제1 폴리펩타이드 및 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드와 목적 단백질 사이에 단백질 절단효소의 절단 부위, 면역글로불린의 힌지 영역, 목적 단백질 또는 이들 모두를 추가로 포함하는 것일 수 있다.
상기 힌지 영역은 서열번호 33의 아미노산 서열을 포함하는 것일 수 있다.
상기 융합 단백질은 재조합 융합 단백질에서 제1 폴리펩타이드 및 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드를 제거하기 위해 융합 폴리펩타이드와 목적 단백질 사이에 태브(TEV) 단백질분해효소 절단 부위 또는 Ni2+에 의해 절단될 수 있는 스넥 태그(SNAC tag) 등 일반적으로 단백질 정제에 이용되는 절단부위를 포함할 수 있다.
또한, 본 발명은 제1 폴리펩타이드 및 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드, 또는 상기 융합 폴리펩타이드 및 목적 단백질을 포함하는 융합 단백질을 암호화하는 폴리뉴클레오티드를 제공한다.
상기 폴리뉴클레오티드는 제1 폴리펩타이드 및 제2 폴리펩타이드를 암호화하는 각각의 폴리뉴클레오티드를 포함한다. 상기 제1 폴리펩타이드를 암호화하는 폴리뉴클레오티드는 서열번호 40 내지 서열번호 42의 염기서열 중 선택되는 하나의 염기서열로 표시되는 것일 수 있고, 제2 폴리펩타이드를 암호화하는 폴리뉴클레오티드는 서열번호 43 내지 서열번호 47의 염기서열 중 선택되는 하나의 염기서열로 표시되는 것일 수 있다.
본 명세서에 기재된 서열목록의 염기서열은 별도의 표시가 없더라도 5’ 말단으로부터 3’ 말단의 방향으로 기재된 것이다.
또한, 본 발명은 제1 폴리펩타이드 및 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드, 또는 상기 융합 폴리펩타이드 및 목적 단백질을 포함하는 융합 단백질을 암호화하는 폴리뉴클레오티드를 포함하는 재조합 발현 벡터를 제공한다.
본 발명에서 재조합(recombinant)은 유전자 조작(genetic manipulation)과 호환하여 사용될 수 있으며, 유전자에 변형을 가하고 자르고 연결하는 등 분자적 클로닝(molecular cloning) 실험 기법을 이용하여 자연의 상태에는 존재하지 않는 형태의 유전자를 제조하는 것을 의미한다.
본 발명에서 발현(expression)은 세포에서 단백질 또는 핵산이 생성되는 것을 의미한다.
본 발명에서 재조합 발현 벡터란 적합한 숙주세포(host cell)에서 목적하는 단백질 또는 핵산(RNA)을 발현할 수 있는 벡터로서, 폴리뉴클레오티드(유전자) 삽입물이 발현될 수 있도록 작동가능하게 연결된 필수적인 조절 요소를 포함하는 유전자 작제물을 말한다.
본 명세서에서 “작동가능하게 연결된(operably linked)”이란 일반적 기능을 수행하도록 핵산 발현조절서열과 목적하는 단백질 또는 RNA를 코딩하는 핵산 서열이 기능적으로 연결(functional linkage)되어 있는 것으로, 발현조절서열에 의해 유전자가 발현될 수 있도록 연결된 것을 의미한다. 상기 발현조절서열(expression control sequence)이란 특정한 숙주세포에서 작동가능하게 연결된 폴리뉴클레오티드 서열의 발현을 조절하는 DNA 서열을 의미한다. 그러한 조절 서열은 전사를 실시하기 위한 프로모터, 전사를 조절하기 위한 임의의 오퍼레이터 서열, 적합한 mRNA 리보좀 결합 부위를 코딩하는 서열, 전사 및 해독의 종결을 조절하는 서열, 개시 코돈, 종결 코돈, 폴리아데닐화 시그널 및 인핸서 등을 포함한다.
본 발명의 재조합 발현 벡터는 클로닝 분야에서 통상적으로 사용되는 벡터라면 그 종류가 특별히 제한되지 않으며, 그 예로는 플라스미드 벡터, 코즈미드 벡터, 박테리오파아지 벡터 및 바이러스 벡터 등을 포함하나 이에 제한되지 않는다. 상기 플라스미드에는 대장균 유래 플라스미드(pBR322, pBR325, pUC118 및 pUC119, pET-22(+)), 바실러스 서브틸리스 유래 플라스미드(pUB110 및 pTP5) 및 효모 유래 플라스미드(pPICZ, YEp13, YEp24 및 YCp50) 등이 있으며, 상기 바이러스는 레트로바이러스, 아데노바이러스 또는 백시니아 바이러스와 같은 동물 바이러스, 배큘로 바이러스와 같은 곤충 바이러스 등이 사용될 수 있으며, 바람직하게는 pET-28a 벡터를 사용할 수 있다.
또한, 본 발명은 제1 폴리펩타이드 및 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드, 또는 상기 융합 폴리펩타이드 및 목적 단백질을 포함하는 융합 단백질을 암호화하는 폴리뉴클레오티드를 포함하는 발현 벡터로 형질전환시킨 숙주세포를 제공한다.
본 발명에 따른 숙주 세포는 본 발명의 재조합 발현 벡터에 포함된 폴리뉴클레오티드를 발현하는데 사용될 수 있는 세포라면 그 종류는 특별히 제한되지 아니한다. 본 발명에 따른 재조합 발현 벡터로 형질전환된 세포(숙주세포)는 원핵생물(예를 들어, 대장균), 진핵생물(예를 들어, 효모 또는 다른 균류), 식물 세포(예를 들어, 담배 또는 토마토 식물 세포), 동물 세포(예를 들어, 인간 세포, 원숭이 세포, 햄스터(hamster) 세포, 랫(rat) 세포, 마우스 (mouse) 세포, 곤충 세포 또는 이들에서 유래한 하이브리도마일 수도 있고, 바람직하게는 대장균 (E. coli)일 수 있으나, 이에 한정되지 않는다.
본 발명에 따른 재조합 발현 벡터는 당업계에 공지된 방법, 예를 들어 이에 한정되지는 않으나, 일시적 형질감염(transient transfection), 미세주사, 형질도입(transduction), 세포융합, 칼슘 포스페이트 침전법, 리포좀 매개된 형질감염(liposome-mediated transfection), DEAE 덱스트란-매개된 형질감염(DEAE Dextran- mediated transfection), 폴리브렌-매개된 형질감염(polybrene-mediated transfection), 전기천공법(electroporation), 유전자 총(gene gun) 및 세포 내로 핵산을 유입시키기 위한 공지의 방법에 의해 항체 또는 그 단편을 생산하기 위한 세포 내부로 도입하여 형질전환 할 수 있다. 상기 본 발명에 따른 재조합 발현 벡터로 형질전환된 세포는 본 발명에 따른 융합 단백질을 과발현 또는 대량으로 생산할 수 있다.
또한, 본 발명은 제1 폴리펩타이드 및 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드, 또는 상기 융합 폴리펩타이드 및 목적 단백질을 포함하는 융합 단백질을 암호화하는 폴리뉴클레오티드를 포함하는 발현 벡터로 형질전환시킨 숙주세포를 배지에서 배양하는 단계를 포함하는, 목적 단백질을 정제하는 방법을 제공한다.
상기 융합 폴리펩타이드 및 목적 단백질에 관한 내용은 상기한 바와 같다.
상기 목적 단백질을 정제하는 방법은 상기 배양하는 단계 이후에, 숙주세포로부터 융합 단백질을 추출하는 단계를 더 포함할 수 있다.
상기 융합 단백질 추출 단계에서 사용되는 완충 용액은 HEPES, Tris, 또는 phosphate 등 일반적으로(통상적으로) 단백질 추출에 사용하는 완충 용액일 수 있고, 바람직하게는 HEPES 완충 용액일 수 있으나, 이에 제한되지 않는다.
상기 융합 단백질 추출 단계에서 세포 파쇄 효율을 높이기 위해 Triton X-100과 같은 계면활성제를, 단백질 분해를 억제하기 위해 다양한 단백질분해효소 억제제가 혼합된 protease inhibitor cocktail을 첨가할 수 있다.
상기 목적 단백질을 정제하는 방법은 제1 폴리펩타이드 및 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드, 또는 상기 융합 폴리펩타이드 및 목적 단백질을 포함하는 융합 단백질을 암호화하는 폴리뉴클레오티드를 포함하는 발현 벡터로 형질전환시킨 숙주세포로부터 얻은 상기 융합 단백질의 자가 조립체 형성을 유도하는 단계를 추가로 포함할 수 있다.
상기 자가 조립체 형성을 유도하는 단계는 자가 조립체 형성을 촉진하게 위한 특정 조건으로 처리하는 단계를 더 포함할 수 있다. 상기 자가 조립체 형성을 유도하기 위한 특정 조건은 유도제의 종류, 유도제의 농도, 염(salt)의 종류, 염의 농도, pH 조건, 완충 용액의 종류, 온도, 반응 시간 등의 물리·화학적 조건일 수 있다.
상기 자가 조립체 형성을 유도하는 단계는 자가 조립체 형성을 촉진하기 위한 유도제를 첨가하는 단계를 포함하는 것일 수 있다. 상기 유도제를 첨가함에 따라 거대분자 자가 조립체 형성 유도가 촉진될 수 있다.
상기 유도제는 양이온성 물질일 수 있고, 구체적으로, Ni2+, Co2+, Zn2+, Cu2+, Ag2+, Fe2+, Ba2+ 등 양이온으로 이루어진 군으로부터 선택되는 어느 하나 이상인 것일 수 있으며, 제1 폴리펩타이드 및 제2 폴리펩타이드의 조합에 따라 자가 조립체 형성을 유도하기 위한 적절한 유도제의 종류가 상이할 수 있다.
상기 유도제는 0.1 내지 2.0 mM, 0.1 내지 1.5 mM, 0.1 내지 1.0 mM, 0.1 내지 0.7 mM 0.3 내지 2.0 mM, 0.3 내지 1.5 mM, 0.3 내지 1.0 mM, 0.3 내지 0.7 mM, 0.4 내지 2.0 mM, 0.4 내지 1.5 mM, 0.4 내지 1.0 mM, 0.4 내지 0.7 mM, 0.4 내지 0.6 mM, 또는 0.5 mM일 수 있으나, 이에 제한되지 않는다.
상기 자가 조립체 형성을 유도하는 단계는 염을 첨가하는 단계를 포함할 수 있다. 상기 염은 황산암모늄 또는 염화나트륨 등 일반적으로 단백질 침전에 사용되는 염일 수 있고, 바람직하게는 황산암모늄일 수 있으나, 이에 제한되지 않는다.
상기 황산암모늄은 5 내지 30% (w/v), 5 내지 27% (w/v), 5 내지 25% (w/v), 5 내지 23% (w/v), 7 내지 30% (w/v), 7 내지 27% (w/v), 7 내지 25% (w/v), 7 내지 23% (w/v), 10 내지 30% (w/v), 10 내지 27% (w/v), 10 내지 25% (w/v), 10 내지 23% (w/v), 12 내지 30% (w/v), 12 내지 27% (w/v), 12 내지 25% (w/v), 12 내지 23% (w/v), 또는 12 내지 22% (w/v)일 수 있으나, 이에 제한되지 않는다.
상기 자가 조립체 형성을 유도하는 단계에 사용되는 완충 용액은 HEPES, Tris, 또는 phosphate 등 일반적으로(통상적으로) 단백질 추출에 사용하는 완충 용액일 수 있고, 바람직하게는 HEPES 완충 용액일 수 있으나, 이에 제한되지 않는다.
상기 자가 조립체 형성을 유도하는 단계는 pH 6 내지 pH 10에서 수행되는 것일 수 있고, pH 7 내지 pH 10에서 수행되는 것일 수 있으나, 이에 제한되지 않는다.
상기 자가 조립체 형성을 유도하는 단계는 유도제 처리 즉시 내지 10분, 10분 이상, 15분 이상, 20분 이상, 10분 내지 120분, 15분 내지 120분, 20분 내지 120분 동안 수행하는 것일 수 있으나, 이에 제한되지 않는다.
상기 목적 단백질을 정제하는 방법은 형성된 자가 조립체를 선택적으로 분리하는 단계를 더 포함할 수 있다.
상기 분리하는 단계는 원심분리 방법 또는 여과 방법으로 수행되는 것일 수 있다.
본 발명의 제1 폴리펩타이드 및 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드 및 목적 단백질을 포함하는 융합 단백질은 거대분자 자가 조립체를 형성하여 크기와 밀도가 증가되므로, 밀도 차이를 이용하여 침전시킬 수 있는 원심분리 방법 또는 일정 크기 이상의 분자를 거를 수 있는 여과 방법을 분리 방법으로 사용할 수 있다.
상기 원심분리 방법 또는 여과 방법의 분리하는 단계 이후 잔존할 수 있는 비특이적 단백질의 오염을 최소화하기 위해 완충 용액을 이용하여 침전 또는 여과된 재조합 단백질 분획을 세척하는 단계를 더 포함할 수 있다.
또한, 본 발명은 특정 유도제 처리 및/또는 조건 처리를 통해 거대 분자 자가 조립체 형성을 유도하여 정제된 재조합 단백질을 가역적으로 단량체로 전환시키기 위한 방법으로, 양이온성의 특정 유도제와 강하게 결합할 수 있는 EDTA 또는 EGTA와 같은 킬레이트(chelator)를 처리하는 단계를 더 포함할 수 있다.
상기 목적 단백질을 정제하는 방법은 융합 단백질에 포함된 태브 단백질분해효소 절단 부위 또는 스넥 태그를 절단하는 단계를 더 포함할 수 있고, 상기 절단하는 단계는 태브 단백질분해효소(TEV protease) 또는 Ni2+ 처리에 의해 수행되는 것일 수 있다.
또한, 본 발명은 서열번호 1 내지 서열번호 3으로 이루어진 군에서 선택되는 하나의 아미노산 서열로 표시되는 제1 폴리펩타이드, 및/또는 서열번호 4 내지 서열번호 8로 이루어진 군에서 선택되는 하나의 아미노산 서열로 표시되는 제2 폴리펩타이드를 포함하는 단백질 정제용 조성물을 제공한다.
상기 제1 폴리펩타이드 및 제2 폴리펩타이드에 관한 내용은 상기한 바와 같다.
또한, 본 발명은 서열번호 1 내지 서열번호 3으로 이루어진 군에서 선택되는 하나의 아미노산 서열로 표시되는 제1 폴리펩타이드, 및/또는 서열번호 4 내지 서열번호 8로 이루어진 군에서 선택되는 하나의 아미노산 서열로 표시되는 제2 폴리펩타이드를 포함하는 자가조립체를 제공한다. 상기 제1 폴리펩타이드 및 제2 폴리펩타이드에 관한 내용은 상기한 바와 같다.
본 발명은 His 태그, HAT 태그 및 HQ 태그 중 어느 하나와 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 알파-나선 펩타이드 태그를 융합한 융합 폴리펩타이드 및 이를 이용한 목적 단백질 정제 방법에 관한 것으로, 상기 융합 폴리펩타이드는 목적 단백질과 융합되어 특정 유도제 또는 처리 조건 의존적으로 거대분자 자가 조립체 형성을 유도함으로써 기존의 친화 크로마토그래피법에서 주로 사용되는 고가의 비드 또는 레진이 충진되어 있는 정제 컬럼 및 이를 구동하는 고가의 장치나 설비의 필요 없이, 단지 원심분리 또는 여과와 같은 매우 간단한 방법 만으로 재조합 단백질을 분리 정제하는 것이 가능하다. 뿐만 아니라, 본 발명은 단백질 추출용액에 염 처리 및 특정 유도제 또는 조건 처리를 통해 거대분자 자가 조립체 형성이 유도되기 때문에, 처리 과정이 매우 간단하고, 쉬우며, 정제에 소요되는 시간이 매우 짧고, 고효율 및 고순도로 재조합 단백질을 정제하는 것이 가능하다. 또한, 본 발명은 정제된 재조합 단백질을 킬레이트 처리를 통해 수용성의 단위체로 쉽게 전환할 수 있으며, 필요에 따라 목적 단백질에 융합된 태그를 자른 후 이들 태그를 자가 조립체 재형성을 유도하여 쉽게 제거하는 것이 가능하다.　
도 1a는 융합된 정제 태그와 자가 조립 태그에 작용하는 특정 유도제에 의해 거대분자 자가 조립체 형성을 유도하는 개념을 나타내는 도이다.
도 1b는 His6 태그와 자가 조립 태그를 암호화하는 유전자 부위를 포함하고, 목적 단백질을 암호화하는 유전자 부위를 포함하는 목적 단백질 발현을 위한 벡터의 구성을 나타내는 모식도이다.
도 1c는 특정 유도제 또는 특정 조건 처리를 통해 거대분자 자가 조립체 형성 유도 후 원심분리 또는 여과 등의 방법으로 재조합 단백질을 선택적으로 정제하는 방법을 나타내는 도이다.
도 2a는 알파-나선 구조를 형성하는 mIZ 펩타이드의 나선상 아미노산 분포를 휠 다이어그램 (Wheel diagram)을 통해 분석한 도이다.
도 2b는 알파-나선 구조를 형성하는 TZ1H 펩타이드의 나선상 아미노산 분포를 휠 다이어그램을 통해 분석한 도이다.
도 2c는 알파-나선 구조를 형성하는 IAQ 펩타이드의 나선상 아미노산 분포를 휠 다이어그램을 통해 분석한 도이다.
도 2d는 알파-나선 구조를 형성하는 DLH 펩타이드의 나선상 아미노산 분포를 휠 다이어그램을 통해 분석한 도이다.
도 2e는 알파-나선 구조를 형성하는 EAH 펩타이드의 나선상 아미노산 분포를 휠 다이어그램을 통해 분석한 도이다.
도 3a는 목적 단백질인 GFP에 정제 태그로서 His 태그를 단독으로 융합하여, 다양한 양이온 처리 시 거대분자 자가 조립체 형성이 유도되는지 여부를 확인한 도이다.
도 3b는 GFP에 정제 태그로서 삼량체 형성이 가능한 TZ1H 펩타이드 태그를 단독으로 융합하여, 다양한 양이온 처리 시 거대분자 자가 조립체 형성이 유도되는지 여부를 확인한 도이다.
도 3c는 GFP에 정제 태그로서 His 태그와 TZ1H 펩타이드 태그를 융합하여, 다양한 양이온 처리 시 거대분자 자가 조립체 형성이 유도되는지 여부를 확인한 도이다.
도 3d는 GFP에 정제 태그로서 삼량체 형성이 가능한 mIZ 펩타이드 태그를 단독으로 융합하여, 다양한 양이온 처리 시 거대분자 자가 조립체 형성이 유도되는지 여부를 확인한 도이다.
도 3e는 GFP에 정제 태그로서 His 태그와 mIZ 펩타이드 태그를 융합하여, 다양한 양이온 처리 시 거대분자 자가 조립체 형성이 유도되는지 여부를 확인한 도이다.
도 3f는 GFP에 정제 태그로서 DLH 펩타이드 태그를 단독으로 융합하여, 다양한 양이온 처리 시 거대분자 자가 조립체 형성이 유도되는지 여부를 확인한 도이다.
도 3g는 GFP에 정제 태그로서 His 태그와 DLH 펩타이드 태그 조합을 융합하여, 다양한 양이온 처리 시 거대분자 자가 조립체 형성이 유도되는지 여부를 확인한 도이다.
도 3h는 GFP에 정제 태그로서 IAQ 펩타이드 태그를 단독으로 융합하여, 다양한 양이온 처리 시 거대분자 자가 조립체 형성이 유도되는지 여부를 확인한 도이다.
도 3i는 GFP에 정제 태그로서 His 태그와 IAQ 펩타이드 태그를 모두 융합하여, 다양한 양이온 처리 시 거대분자 자가 조립체 형성이 유도되는지 여부를 확인한 도이다.
도 3j는 GFP에 정제 태그로서 EAH 펩타이드 태그를 단독으로 융합하여, 다양한 양이온 처리 시 거대분자 자가 조립체 형성이 유도되는지 여부를 확인한 도이다.
도 3k는 GFP에 정제 태그로서 His 태그와 EAH 펩타이드 태그를 모두 융합하여, 다양한 양이온 처리 시 거대분자 자가 조립체 형성이 유도되는지 여부를 확인한 도이다.
도 4a는 목적 단백질로 모델 단백질의 하나인 GFP에 정제 태그로서 His 혹은 TZ1H 펩타이드 태그를 단독으로 융합하거나 이 두 태그를 모두 융합하여 양이온 Ni2+을 다양한 농도로 처리 시 거대분자 자가 조립체 형성이 유도되는지 여부를 확인한 도이다.
도 4b는 GFP에 정제 태그로서 His 혹은 mIZ 펩타이드 태그를 단독으로 융합하거나 이 두 태그를 모두 융합하여 양이온 Ni2+을 다양한 농도로 처리 시 거대분자 자가 조립체 형성이 유도되는지 여부를 확인한 도이다.
도 4c는 GFP에 정제 태그로서 His 혹은 DLH 펩타이드 태그를 단독으로 융합하거나 이 두 태그를 모두 융합하여 양이온 Ni2+을 다양한 농도로 처리 시 거대분자 자가 조립체 형성이 유도되는지 여부를 확인한 도이다.
도 4d는 GFP에 정제 태그로서 His 혹은 IAQ 펩타이드 태그를 단독으로 융합하거나 이 두 태그를 모두 융합하여 양이온 Ni2+을 다양한 농도로 처리 시 거대분자 자가 조립체 형성이 유도되는지 여부를 확인한 도이다.
도 4e는 GFP에 정제 태그로서 His 혹은 EAH 펩타이드 태그를 단독으로 융합하거나 이 두 태그를 모두 융합하여 양이온 Ni2+을 다양한 농도로 처리 시 거대분자 자가 조립체 형성이 유도되는지 여부를 확인한 도이다.
도 5a는 GFP에 정제 태그로서 His 태그를 단독으로 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 5b는 GFP에 정제 태그로서 TZ1H 펩타이드 태그를 단독으로 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 5c는 GFP에 정제 태그로서 His 태그와 TZ1H 펩타이드 태그를 모두 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 5d는 GFP에 정제 태그로서 mIZ 펩타이드 태그를 단독으로 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 5e는 GFP에 정제 태그로서 His 태그와 mIZ 펩타이드 태그를 모두 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 5f는 GFP에 정제 태그로서 DLH 펩타이드 태그를 단독으로 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 5g는 GFP에 정제 태그로서 His 태그와 DLH 펩타이드 태그를 모두 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 5h는 GFP에 정제 태그로서 IAQ 펩타이드 태그를 단독으로 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 5i는 GFP에 정제 태그로서 His 태그와 IAQ 펩타이드 태그를 모두 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 5j는 GFP에 정제 태그로서 EAH 펩타이드 태그를 단독으로 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 5k는 GFP에 정제 태그로서 His 태그와 EAH 펩타이드 태그를 모두 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 6a는 GFP에 정제 태그로서 His 태그와 TZ1H 펩타이드 태그 조합을 융합하여, 염으로서 다양한 농도의 염화나트륨이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 6b는 GFP에 정제 태그로서 His 태그와 mIZ 펩타이드 태그 조합을 융합하여, 염으로서 다양한 농도의 염화나트륨이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 6c는 GFP에 정제 태그로서 His 태그와 DLH 펩타이드 태그 조합을 융합하여, 염으로서 다양한 농도의 염화나트륨이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 6d는 GFP에 정제 태그로서 His 태그와 IAQ 펩타이드 태그 조합을 융합하여, 염으로서 다양한 농도의 염화나트륨이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 6e는 GFP에 정제 태그로서 His 태그와 EAH 펩타이드 태그 조합을 융합하여, 염으로서 다양한 농도의 염화나트륨이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 7a는 GFP에 정제 태그로서 His 태그와 TZ1H 펩타이드 태그의 조합을 융합하여 다양한 완충용액(buffer)에 염으로서 황산암모늄 처리 및 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 7b는 GFP에 정제 태그로서 His 태그와 mIZ 펩타이드 태그의 조합을 융합하여 다양한 완충용액에 염으로서 황산암모늄 처리 및 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 7c는 GFP에 정제 태그로서 His 태그와 DLH 펩타이드 태그의 조합을 융합하여 다양한 완충용액에 염으로서 황산암모늄 처리 및 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 7d는 GFP에 정제 태그로서 His 태그와 IAQ 펩타이드 태그의 조합을 융합하여 다양한 완충용액에 염으로서 황산암모늄 처리 및 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 7e는 GFP에 정제 태그로서 His 태그와 EAH 펩타이드 태그의 조합을 융합하여 다양한 완충용액에 염으로서 황산암모늄 처리 및 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 8a는 GFP에 정제 태그로서 His 태그와 TZ1H 펩타이드 태그의 조합을 융합하여 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+의 처리 농도에 따른 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 8b는 GFP에 정제 태그로서 His 태그와 mIZ 펩타이드 태그의 조합을 융합하여 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+의 처리 농도에 따른 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 8c는 GFP에 정제 태그로서 His 태그와 DLH 펩타이드 태그의 조합을 융합하여 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+의 처리 농도에 따른 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 8d는 GFP에 정제 태그로서 His 태그와 IAQ 펩타이드 태그의 조합을 융합하여 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+의 처리 농도에 따른 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 8e는 GFP에 정제 태그로서 His 태그와 EAH 펩타이드 태그의 조합을 융합하여 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+의 처리 농도에 따른 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 9a는 GFP에 정제 태그로서 His 태그와 TZ1H 펩타이드 태그 조합을 융합하여, 완충용액의 다양한 pH 조건에서 염으로서 황산암모늄 처리 및 특정 유도제로 선택된 양이온 Ni2+ 미처리 혹은 처리 시 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 9b는 GFP에 정제 태그로서 His 태그와 mIZ 펩타이드 태그 조합을 융합하여, 완충용액의 다양한 pH 조건에서 염으로서 황산암모늄 처리 및 특정 유도제로 선택된 양이온 Ni2+ 미처리 혹은 처리 시 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 9c는 GFP에 정제 태그로서 His 태그와 DLH 펩타이드 태그 조합을 융합하여, 완충용액의 다양한 pH 조건에서 염으로서 황산암모늄 처리 및 특정 유도제로 선택된 양이온 Ni2+ 미처리 혹은 처리 시 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 9d는 GFP에 정제 태그로서 His 태그와 IAQ 펩타이드 태그 조합을 융합하여, 완충용액의 다양한 pH 조건에서 염으로서 황산암모늄 처리 및 특정 유도제로 선택된 양이온 Ni2+ 미처리 혹은 처리 시 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 9e는 GFP에 정제 태그로서 His 태그와 EAH 펩타이드 태그 조합을 융합하여, 완충용액의 다양한 pH 조건에서 염으로서 황산암모늄 처리 및 특정 유도제로 선택된 양이온 Ni2+ 미처리 혹은 처리 시 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 10a는 GFP에 정제 태그로서 His 태그와 TZ1H 펩타이드 태그 조합을 융합하여, 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+의 처리 시간에 따른 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 10b는 GFP에 정제 태그로서 His 태그와 mIZ 펩타이드 태그 조합을 융합하여, 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+의 처리 시간에 따른 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 10c는 GFP에 정제 태그로서 His 태그와 DLH 펩타이드 태그 조합을 융합하여, 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+의 처리 시간에 따른 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 10d는 GFP에 정제 태그로서 His 태그와 IAQ 펩타이드 태그 조합을 융합하여, 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+의 처리 시간에 따른 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 10e는 GFP에 정제 태그로서 His 태그와 EAH 펩타이드 태그 조합을 융합하여, 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+의 처리 시간에 따른 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 11a는 GFP에 정제 태그로서 His 태그를 단독으로 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 11b는 GFP에 정제 태그로서 TZ1H 펩타이드 태그를 단독으로 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 11c는 GFP에 정제 태그로서 HQ 태그와 TZ1H 펩타이드 태그를 모두 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 11d는 GFP에 정제 태그로서 mIZ 펩타이드 태그를 단독으로 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 11e는 GFP에 정제 태그로서 HQ 태그와 mIZ 펩타이드 태그를 모두 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 11f는 GFP에 정제 태그로서 HAT 펩타이드 태그를 단독으로 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
도 11g는 GFP에 정제 태그로서 HAT 태그와 mIZ 펩타이드 태그를 모두 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성이 촉진되는지를 분석한 도이다.
　　　　　　도 12a는 GFP에 정제 태그로서 His 태그의 변형된 형태인 HQ 태그와 TZ1H 펩타이드 태그 조합을 융합하여, 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+의 처리 시간에 따른 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 12b는 GFP에 정제 태그로서 His 태그의 변형된 형태인 HQ 태그와 mIZ 펩타이드 태그 조합을 융합하여, 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+의 처리 시간에 따른 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 12c는 GFP에 정제 태그로서 His 태그의 오리지날인 HAT 태그를 단독으로 융합하여, 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+의 처리 시간에 따른 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 12d는 GFP에 정제 태그로서 His 태그의 오리지날인 HAT 태그와 mIZ 펩타이드 태그 조합을 융합하여, 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+의 처리 시간에 따른 거대분자 자가 조립체 형성 정도를 분석한 도이다.
도 13은 GFP에 정제 태그로서 His 태그와 각 펩타이드 태그 조합을 융합하여, 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 자가 조립체 형성 정도를 통해 각 유닛(unit)별 회수율과 순도를 분석한 도이다.
도 14는 GFP에 정제 태그로서 HAT 태그를 단독으로 융합하거나, HQ 또는 HAT 태그와 각 펩타이드 태그 조합을 융합하여, 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 자가 조립체 형성 정도를 통해 각 유닛별 회수율과 순도를 분석한 도이다.
도 15a는 GFP에 정제 태그로서 His 태그를 단독으로 또는 His 태그와 DLH 펩타이드 태그의 조합, HQ 태그와 mIZ 펩타이드의 조합, HAT 태그와 mIZ 태그의 조합을 융합하여, 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+의 처리 시 필터를 이용한 여과 및 재조합 단백질의 회수 가능성을 UV의 조사를 통해 분석한 도이다.
도 15b는 GFP에 정제 태그로서 His 태그와 TZ1H 펩타이드 태그의 조합, His 태그와 mIZ 펩타이드의 조합, His 태그와 IAQ 펩타이드의 조합, His 태그와 EAH 펩타이드의 조합, HAT 태그를 단독으로 융합하여, 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+의 처리 시 필터를 이용한 여과 및 재조합 단백질의 회수 가능성을 UV의 조사를 통해 분석한 도이다.
도 15c는 GFP에 정제 태그로서 HQ 태그와 TZ1H 펩타이드 태그의 조합을 융합하여, 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+의 처리 시 필터를 이용한 여과 및 재조합 단백질의 회수 가능성을 UV의 조사를 통해 분석한 도이다.
도 16a는 알파-나선 태그 기반 TZ1H 펩타이드 태그의 각 아미노산을 치환하여 구성한 펩타이드 태그의 아미노산 서열 정보를 나타낸 도이다.
도 16b는 GFP에 알파-나선 태그 기반 TZ1H 펩타이드 태그의 각 아미노산을 치환하여 구성한 펩타이드 태그를 융합하여, 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성능을 분석한 도이다.
도 16c는 GFP에 알파-나선 태그 기반 TZ1H 펩타이드 태그의 각 아미노산을 치환하여 구성한 펩타이드 태그를 융합하여, 완충용액의 특정 pH 조건에서 염으로서 황산암모늄을 처리 시 자가 조립체 형성능을 분석한도이다.
도 17a는 형광 현미경을 통해 거대분자 자기 조립체 형성 유무 및 그 크기를 분석하기 위해, His6:GFP에 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 이 처리된 조건하에서 획득한 이미지이다.
도 17b는 형광 현미경을 통해 거대분자 자기 조립체 형성 유무 및 그 크기를 분석하기 위해, His6:mIZ:GFP에 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 이 처리된 조건하에서 획득한 이미지이다.
도 17c는 형광 현미경을 통해 거대분자 자기 조립체 형성 유무 및 그 크기를 분석하기 위해, His6:TZ1H:GFP에 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 이 처리된 조건하에서 획득한 이미지이다.
도 17d는 형광 현미경을 통해 거대분자 자기 조립체 형성 정도를 정량적으로 분석하기 위해, His6:GFP, His6:TZ1H:GFP, TZ1H:GFP, His6:mIZ:GFP, mIZ:GFP에 염으로서 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 이 처리된 조건하에서 캡처된 형광 이미지를 바탕으로 픽셀당 형광 세기를 분석하여 그래프로 나타낸 것이다.
도 18a는 과립구 콜로니자극인자에 정제 태그로서 His 태그와 DLH 펩타이드 태그 조합을 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성 정도 및 GFP 외 재조합 단백질에 적용 가능성을 분석한 도이다.
도 18b는 인터페론 알파2에 정제 태그로서 His 태그와 IAQ 펩타이드 태그 조합을 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성 정도 및 GFP 외 재조합 단백질에 적용 가능성을 분석한 도이다.
도 18c는 치료용 항체 허셉틴 경쇄에 정제 태그로서 His 태그와 mIZ 펩타이드 태그 조합을 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성 정도 및 GFP 외 재조합 단백질에 적용 가능성을 분석한 도이다.
도 18d는 과립구 콜로니자극인자에 정제 태그로서 His 태그와 TZ1H 펩타이드 태그 조합을 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성 정도 및 GFP 외 재조합 단백질에 적용 가능성을 분석한 도이다.
도 18e는 인터페론 알파2에 정제 태그로서 His 태그와 TZ1H 펩타이드 태그 조합을 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성 정도 및 GFP 외 재조합 단백질에 적용 가능성을 분석한 도이다.
도 18f는 인터페론 알파2에 정제 태그로서 His 태그와 mIZ 펩타이드 태그 조합을 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성 정도 및 GFP 외 재조합 단백질에 적용 가능성을 분석한 도이다.
도 18g는 과립구 콜로니자극인자에 정제 태그로서 His 태그와 mIZ 펩타이드 태그 조합을 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성 정도 및 GFP 외 재조합 단백질에 적용 가능성을 분석한 도이다.
도 18h는 인터페론 알파2에 정제 태그로서 His 태그와 DLH 펩타이드 태그 조합을 융합하여, 염으로서 다양한 농도의 황산암모늄이 존재하는 조건에서 특정 유도제로 선택된 양이온 Ni2+ 처리 시 거대분자 자가 조립체 형성 정도 및 GFP 외 재조합 단백질에 적용 가능성을 분석한 도이다.
이하, 첨부된 도면을 참조하여 본 발명의 바람직한 실시 형태를 설명한다. 그러나, 본 발명의 실시 형태는 여러 가지 다른 형태로 변형될 수 있으며, 본 발명의 범위가 이하 설명하는 실시 형태로 한정되는 것은 아니다. 즉, 본 발명의 개념 및 기술의 범위에 포함되는 모든 응용과 변환, 균등물 내지 대체물을 포함하는 것으로 이해되어야 한다.
　　　　　
[실험 재료 및 방법]
<실험의 재료>
황산암모늄((NH4)2SO4, CAT NO. A4915)과 염화니켈(NiCl2, CAT NO. 339350)은 Sigma Aldrich (St. Louis, MO, USA)에서 각 ACS reagent 등급과 98% 이상의 시약을 구입하여 사용하였고, EDTA disodium salt dihydrate (C10H14N2Na2O8·2H2O, CAT NO. 0105)는 VWR Life Science (Radnor, PA, USA)에서 Biotechnology 등급을 구입하여 사용하였다.
실시예 1. 단백질 발현용 벡터 제작
Bead-free형 자가 조립체 유도방식의 재조합 단백질 정제시스템 구축을 위한 GFP를 활용한 모델시스템을 확립하기 위하여, F-Kpn I-Hinge-Bgl II-TEV cleavage site:GFP/R-Xho I,Hind III:GFP 프라미어를 이용하여 GFP 유전자를 증폭하여 제한효소로 절단 후 pET 28a 벡터에 Kpn I/Xho I 부위에 삽입하여 pET 28a-GFP 부분 벡터를 구축하였다. 추가적으로, F-Nco I, BamH I-His6/R-Kpn I-His6 프라이머를 이용하여 overlapping PCR 수행 후 제한효소로 절단하여 pET 28a-GFP 부분 벡터의 Nco I/Kpn I 부위에 삽입하여 기본 벡터 pET 28a-His6:GFP 벡터를 완성하였다. 이후 F-Nco I, BamH I-His6:TZ1H/R-Kpn I-TZ1H; F-Nco I, BamH I-His6:TZ1H(IA/GG)/R-Kpn I-TZ1H(IA/GG); F-Nco I, BamH I-His6:TZ1H(Q/G)/R-Kpn I-TZ1H(Q/G); F-Nco I, BamH I-His6:TZ1H(H/G)/R-Kpn I-TZ1H(H/G); F-Nco I, BamH I-His6:TZ1H(H/K)/R-Kpn I-TZ1H(H/K); F-Nco I, BamH I-His6:TZ1H(E/G)/R-Kpn I-TZ1H(E/G); F-Nco I, BamH I-His6:TZ1H(K/G)/R-Kpn I-TZ1H(K/G); F-Nco I, BamH I-His6:mIZ/R-Kpn I-mIZ; F-Nco I, BamH I-His6:DLH/R-Kpn I-DLH; F-Nco I, BamH I-His6:IAQ/R-Kpn I-IAQ; F-Nco I, BamH I-His6:EAH/R-Kpn I-EAH의 프라이머 조합을 기반으로 각각 pET 28a-His6:TZ1H:GFP, pET 28a-His6:TZ1H(IA/GG):GFP, pET 28a-His6:TZ1H(Q/G):GFP, pET 28a-His6:TZ1H(H/G):GFP, pET 28a-His6:TZ1H(H/K):GFP, pET 28a-His6:TZ1H(E/G):GFP, pET 28a-His6:TZ1H(K/G):GFP, pET 28a-His6:mIZ:GFP, pET 28a-His6:DLH:GFP, pET 28a-His6:IAQ:GFP, pET 28a-His6:EAH:GFP 벡터를 제작하였다. His6 태그가 제외된 벡터를 구축하기 위하여, F-Nco I, BamH I-TZ1H/R-Kpn I-TZ1H; F-Nco I, BamH I-TZ1H(H/G)/R-Kpn I-TZ1H(H/G); F-Nco I, BamH I-TZ1H(K/G)/R-Kpn I-TZ1H(K/G); F-Nco I, BamH I-mIZ/R-Kpn I-mIZ; F-Nco I, BamH I-DLH/R-Kpn I-DLH; F-Nco I, BamH I-IAQ/R-Kpn I-IAQ; F-Nco I, BamH I-EAH/R-Kpn I-EAH의 프라이머 조합을 기반으로 각각 pET 28a-TZ1H:GFP, pET 28a-TZ1H(H/G):GFP, pET 28a-TZ1H(K/G):GFP, pET 28a-mIZ:GFP, pET 28a-DLH:GFP, pET 28a-IAQ:GFP, pET 28a-EAH:GFP 벡터를 제작하였다. 그리고 His6 태그 유사서열의 활용가능성을 시험하기 위하여 F-Nco I, BamH I-HAT/R-Kpn I-HAT; F-Nco I, BamH I-HAT:mIZ/R-Kpn I-mIZ; F-Nco I, BamH I-HQ:TZ1H/R-Kpn I-TZ1H; F-Nco I, BamH I-HQ:mIZ/R-Kpn I-mIZ의 프라이머 조합을 기반으로 각각 pET 28a-HAT:GFP, pET 28a-HAT:mIZ:GFP, pET 28a-HQ:TZ1H:GFP, pET 28a-HQ:mIZ:GFP 벡터를 완성하였다. 다양한 단백질 의약품에 대한 정제 확장성을 평가하기 위하여, F-Bgl II-rhG-CSF/R-Hind III-rhG-CSF; F-Bgl II-INF-a2/R-Hind III-INF-a2; F-Bgl II-HER LC/R-Hind III-HER LC의 프라이머 조합으로 PCR 수행 후 Bgl II/Hind III 제한효소로 절단하여 각각 pET 28a-His6:DLH:GFP, pET 28a-His6:IAQ:GFP, pET 28a-His6:mIZ:GFP, pET 28a-His6:TZ1H:GFP 벡터의 GFP 위치에 삽입하여 최종적으로 pET 28a-His6:DLH:rhG-CSF, pET 28a-His6:IAQ:INF-a2, pET 28a-His6:mIZ:HER LC, His6:TZ1H:rhG-CSF, pET 28a-His6:TZ1H:INF-a2, pET 28a-His6:mIZ:INF-a2, pET 28a-His6:mIZ:rhG-CSF, pET 28a-His6:DLH:INF-a2를 제작하였다. 각 태그와 설계된 재조합 단백질의 구체적인 서열정보는 하기 표 1 내지 표 3과 같다.
제1 정제 태그의 아미노산 서열 및 핵산 서열 정보
태그 명칭 아미노산 서열 (N → C) 서열번호 핵산 서열 (5’ → 3’) 서열번호
His6 HHHHHH 1 CATCACCATCACCACCAT 40
HAT KDHLIHNVHKEFHAHAHNK 2 AAGGATCATCTTATACACAATGTTCATAAGGAGTTCCACGCACATGCTCACAACAAG 41
HQ6 HQHQHQHQHQHQ 3 CATCAGCACCAACATCAGCACCAACACCAGCATCAA 42
알파-나선 태그(또는 제2 정제 태그)의 아미노산 서열 및 핵산 서열 정보
태그 명칭 아미노산 서열 (N → C) 서열번호 핵산 서열 (5’ → 3’) 서열번호
mIZ YGGIEKKIEAHEKKHEAIEKKIEA 4 TATGGAGGTATTGAGAAGAAGATTGAGGCACATGAGAAGAAGCATGAGGCAATAGAGAAGAAGATTGAGGCA 43
TZ1H EIAQHEKEIQAIEKKIAQHEYKIQAIEEKIAQHKEKIQAIK 5 GAAATTGCTCAACATGAAAAGGAAATTCAAGCTATTGAAAAGAAGATTGCTCAACATGAATATAAGATTCAAGCTATTGAAGAAAAGATTGCTCAACATAAGGAAAAGATTCAAGCTATTAAG 44
DLH DLHDRDLHDRDLHDR 6 GACCTACATGACCGAGATCTTCACGATCGTGATCTTCATGACCGA 45
IAQ IAQHEKEIAQHEKEIAQHEKE 7 ATTGCTCAACATGAAAAGGAAATAGCACAGCACGAGAAGGAGATTGCGCAACATGAGAAAGAA 46
EAH EAHEKEAHEKEAHEK 8 GAGGCACATGAGAAGGAAGCTCACGAAAAGGAAGCGCATGAGAAG 47
각 융합 폴리펩타이드 또는 목적 단백질의 아미노산 서열 및 핵산 서열 정보
클론 명칭 아미노산 서열 (N → C) 서열번호 핵산 서열 (5’ → 3’) 서열번호
His6:mIZ MDPMHHHHHHYGGIEKKIEAHEKKHEAIEKKIEA 9 ATGGATCCAATGCATCACCATCACCACCATTATGGAGGTATTGAGAAGAAGATTGAGGCACATGAGAAGAAGCATGAGGCAATAGAGAAGAAGATTGAGGCA 48
His6:TZ1H MDPMHHHHHHEIAQHEKEIQAIEKKIAQHEYKIQAIEEKIAQHKEKIQAIK 10 ATGGATCCAATGCATCACCATCACCACCATGAAATTGCTCAACATGAAAAGGAAATTCAAGCTATTGAAAAGAAGATTGCTCAACATGAATATAAGATTCAAGCTATTGAAGAAAAGATTGCTCAACATAAGGAAAAGATTCAAGCTATTAAG 49
His6:DLH MDPMHHHHHHPSDLHDRDLHDRDLHDR 11 ATGGATCCAATGCATCACCATCACCACCATCCTAGCGACCTACATGACCGAGATCTTCACGATCGTGATCTTCATGACCGA 50
His6:IAQ MDPMHHHHHHIAQHEKEIAQHEKEIAQHEKE 12 ATGGATCCAATGCATCACCATCACCACCATATTGCTCAACATGAAAAGGAAATAGCACAGCACGAGAAGGAGATTGCGCAACATGAGAAAGAA 51
His6:EAH MDPMHHHHHHPSEAHEKEAHEKEAHEK 13 ATGGATCCAATGCATCACCATCACCACCATCCTAGCGAGGCACATGAGAAGGAAGCTCACGAAAAGGAAGCGCATGAGAAG 52
mIZ MDPMYGGIEKKIEAHEKKHEAIEKKIEA 14 ATGGATCCAATGTATGGAGGTATTGAGAAGAAGATTGAGGCACATGAGAAGAAGCATGAGGCAATAGAGAAGAAGATTGAGGCA 53
TZ1H MDPMEIAQHEKEIQAIEKKIAQHEYKIQAIEEKIAQHKEKIQAIK 15 ATGGATCCAATGGAAATTGCTCAACATGAAAAGGAAATTCAAGCTATTGAAAAGAAGATTGCTCAACATGAATATAAGATTCAAGCTATTGAAGAAAAGATTGCTCAACATAAGGAAAAGATTCAAGCTATTAAG 54
DLH MADLHDRDLHDRDLHDR 16 ATGGCAGACCTACATGACCGAGATCTTCACGATCGTGATCTTCATGACCGA 55
IAQ MDPIAQHEKEIAQHEKEIAQHEKE 17 ATGGATCCAATTGCTCAACATGAAAAGGAAATAGCACAGCACGAGAAGGAGATTGCGCAACATGAGAAAGAA 56
EAH MDPEAHEKEAHEKEAHEK 18 ATGGATCCAGAGGCACATGAGAAGGAAGCTCACGAAAAGGAAGCGCATGAGAAG 57
His6:mIZ:HER LC MDPMHHHHHHYGGIEKKIEAHEKKHEAIEKKIEAGTGSPPVPSTPPTPSPSCRSENLYFQGDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19 ATGGATCCAATGCATCACCATCACCACCATTATGGAGGTATTGAGAAGAAGATTGAGGCACATGAGAAGAAGCATGAGGCAATAGAGAAGAAGATTGAGGCAGGTACCGGTTCTCCACCAGTACCAAGCACACCTCCAACTCCGAGTCCGAGTTGTAGATCTGAAAACCTGTATTTTCAGGGCGATATTCAGATGACACAGAGCCCTAGTAGTCTGAGCGCTAGCGTGGGAGATAGAGTGACAATTACATGTAGAGCCAGCCAGGATGTGAACACAGCCGTGGCTTGGTACCAGCAGAAGCCTGGCAAGGCCCCCAAGCTTCTGATCTATTCCGCTTCTTTCCTCTACTCTGGGGTCCCCAGCAGGTTTAGCGGGAGCAGGAGCGGGACCGACTTTACCCTTACAATCAGCTCCCTGCAGCCCGAGGACTTCGCCACATACTACTGCCAGCAGCATTACACTACTCCACCCACTTTCGGGCAAGGAACTAAAGTGGAGATTAAGCGGACAGTGGCCGCCCCCAGCGTGTTCATTTTCCCCCCCTCCGACGAGCAGCTGAAGAGCGGCACAGCCAGCGTGGTGTGCCTGCTGAACAACTTCTACCCACGGGAGGCCAAGGTGCAGTGGAAGGTGGACAACGCTCTGCAGAGCGGCAACAGCCAGGAAAGCGTGACCGAGCAGGATTCCAAGGATAGCACATACAGCCTGTCGAGCACCCTGACACTGAGCAAGGCCGACTACGAGAAGCACAAGGTGTACGCCTGCGAGGTGACACACCAGGGGCTCAGCAGCCCCGTCACAAAGAGCTTCAACAGGGGGGAGTGCTAG 58
His6:DLH:rhG-CSF MDPMHHHHHHPSDLHDRDLHDRDLHDRGTGSPPVPSTPPTPSPSCGSAAAENLYFQGTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP 20 ATGGACCCAATGCATCACCATCACCACCATCCTAGCGACCTACATGACCGAGATCTTCACGATCGTGATCTTCATGACCGAGGTACCGGTTCTCCACCAGTACCAAGCACACCTCCAACTCCGAGTCCGAGTTGTGGATCTGCGGCCGCAGAAAACCTGTATTTTCAGGGCACCCCCCTGGGCCCTGCCAGCTCCCTGCCCCAGAGCTTCCTGCTCAAGTGCTTAGAGCAAGTGAGGAAGATCCAGGGCGATGGCGCAGCGCTCCAGGAGAAGCTGTGTGCCACCTACAAGCTGTGCCACCCCGAGGAGCTGGTGCTGCTCGGACACTCTCTGGGCATCCCCTGGGCTCCCCTGAGCAGCTGCCCCAGCCAGGCCCTACAGCTGGCAGGCTGCTTGAGCCAACTCCATAGCGGCCTTTTCCTCTACCAGGGGCTCCTACAGGCCCTGGAAGGGATCTCCCCCGAGTTGGGTCCCACCTTGGACACACTACAGCTGGACGTCGCCGACTTTGCCACCACCATCTGGCAGCAGATGGAAGAACTGGGAATGGCCCCTGCCCTACAGCCCACCCAGGGTGCCATGCCGGCCTTCGCCTCTGCTTTCCAGCGCCGGGCAGGAGGGGTCCTAGTTGCCTCCCATCTACAGAGCTTCCTGGAGGTGTCGTACCGCGTTCTACGCCACCTTGCCCAGCCCTGA 59
His6:IAQ:INF-a2 MDPMHHHHHHIAQHEKEIAQHEKEIAQHEKEGTGSPPVPSTPPTPSPSCRSENLYFQGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE 21 ATGGATCCAATGCATCACCATCACCACCATATTGCTCAACATGAAAAGGAAATAGCACAGCACGAGAAGGAGATTGCGCAACATGAGAAAGAAGGTACCGGTTCTCCACCAGTACCAAGCACACCTCCAACTCCGAGTCCGAGTTGTAGATCTGAAAACCTGTATTTTCAGGGCTGCGATCTCCCACAAACCCACTCCTTAGGTTCTCGACGTACTCTAATGCTTCTCGCTCAGATGAGGAGGATTTCACTTTTCAGTTGTTTGAAGGATCGTCACGACTTCGGATTTCCCCAAGAAGAGTTTGGAAACCAATTCCAAAAGGCTGAGACAATTCCAGTTTTGCACGAAATGATTCAACAAATCTTTAATCTGTTTAGCACTAAGGATAGCAGCGCAGCATGGGATGAAACACTCCTTGATAAATTTTATACAGAATTATATCAGCAACTGAATGACCTTGAGGCATGCGTCATACAGGGTGTTGGGGTAACAGAGACTCCTCTCATGAAAGAAGACAGTATTTTAGCCGTTCGTAAATATTTTCAGCGTATTACTCTTTATCTTAAAGAAAAAAAATACTCCCCTTGCGCATGGGAGGTTGTCCGAGCAGAAATTATGAGGAGCTTCTCCCTCTCTACAAATCTGCAAGAGTCTTTGAGAAGTAAAGAATGA 60
His6:TZ1H:rhG-CSF MDPMEHHHHHHIAQHEKEIQAIEKKIAQHEYKIQAIEEKIAQHKEKIQAIKGTGSPPVPSTPPTPSPSCRSAAAENLYFQGTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP 22 ATGGATCCAATGCATCACCATCACCACCATGAAATTGCTCAACATGAAAAGGAAATTCAAGCTATTGAAAAGAAGATTGCTCAACATGAATATAAGATTCAAGCTATTGAAGAAAAGATTGCTCAACATAAGGAAAAGATTCAAGCTATTAAGGGTACCGGTTCTCCACCAGTACCAAGCACACCTCCAACTCCGAGTCCGAGTTGTAGATCTGCGGCCGCAGAAAACCTGTATTTTCAGGGCACCCCCCTGGGCCCTGCCAGCTCCCTGCCCCAGAGCTTCCTGCTCAAGTGCTTAGAGCAAGTGAGGAAGATCCAGGGCGATGGCGCAGCGCTCCAGGAGAAGCTGTGTGCCACCTACAAGCTGTGCCACCCCGAGGAGCTGGTGCTGCTCGGACACTCTCTGGGCATCCCCTGGGCTCCCCTGAGCAGCTGCCCCAGCCAGGCCCTACAGCTGGCAGGCTGCTTGAGCCAACTCCATAGCGGCCTTTTCCTCTACCAGGGGCTCCTACAGGCCCTGGAAGGGATCTCCCCCGAGTTGGGTCCCACCTTGGACACACTACAGCTGGACGTCGCCGACTTTGCCACCACCATCTGGCAGCAGATGGAAGAACTGGGAATGGCCCCTGCCCTACAGCCCACCCAGGGTGCCATGCCGGCCTTCGCCTCTGCTTTCCAGCGCCGGGCAGGAGGGGTCCTAGTTGCCTCCCATCTACAGAGCTTCCTGGAGGTGTCGTACCGCGTTCTACGCCACCTTGCCCAGCCCTGA 61
His6:TZ1H:INF-a2 MDPMHHHHHHEIAQHEKEIQAIEKKIAQHEYKIQAIEEKIAQHKEKIQAIKGTGSPPVPSTPPTPSPSCRSENLYFQGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE 23 ATGGATCCAATGCATCACCATCACCACCATGAAATTGCTCAACATGAAAAGGAAATTCAAGCTATTGAAAAGAAGATTGCTCAACATGAATATAAGATTCAAGCTATTGAAGAAAAGATTGCTCAACATAAGGAAAAGATTCAAGCTATTAAGGGTACCGGTTCTCCACCAGTACCAAGCACACCTCCAACTCCGAGTCCGAGTTGTAGATCTGAAAACCTGTATTTTCAGGGCTGCGATCTCCCACAAACCCACTCCTTAGGTTCTCGACGTACTCTAATGCTTCTCGCTCAGATGAGGAGGATTTCACTTTTCAGTTGTTTGAAGGATCGTCACGACTTCGGATTTCCCCAAGAAGAGTTTGGAAACCAATTCCAAAAGGCTGAGACAATTCCAGTTTTGCACGAAATGATTCAACAAATCTTTAATCTGTTTAGCACTAAGGATAGCAGCGCAGCATGGGATGAAACACTCCTTGATAAATTTTATACAGAATTATATCAGCAACTGAATGACCTTGAGGCATGCGTCATACAGGGTGTTGGGGTAACAGAGACTCCTCTCATGAAAGAAGACAGTATTTTAGCCGTTCGTAAATATTTTCAGCGTATTACTCTTTATCTTAAAGAAAAAAAATACTCCCCTTGCGCATGGGAGGTTGTCCGAGCAGAAATTATGAGGAGCTTCTCCCTCTCTACAAATCTGCAAGAGTCTTTGAGAAGTAAAGAATGA 62
His6:mIZ:INF-a2 MDPMHHHHHHYGGIEKKIEAHEKKHEAIEKKIEAGTGSPPVPSTPPTPSPSCRSENLYFQGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE 24 ATGGATCCAATGCATCACCATCACCACCATTATGGAGGTATTGAGAAGAAGATTGAGGCACATGAGAAGAAGCATGAGGCAATAGAGAAGAAGATTGAGGCAGGTACCGGTTCTCCACCAGTACCAAGCACACCTCCAACTCCGAGTCCGAGTTGTAGATCTGAAAACCTGTATTTTCAGGGCTGCGATCTCCCACAAACCCACTCCTTAGGTTCTCGACGTACTCTAATGCTTCTCGCTCAGATGAGGAGGATTTCACTTTTCAGTTGTTTGAAGGATCGTCACGACTTCGGATTTCCCCAAGAAGAGTTTGGAAACCAATTCCAAAAGGCTGAGACAATTCCAGTTTTGCACGAAATGATTCAACAAATCTTTAATCTGTTTAGCACTAAGGATAGCAGCGCAGCATGGGATGAAACACTCCTTGATAAATTTTATACAGAATTATATCAGCAACTGAATGACCTTGAGGCATGCGTCATACAGGGTGTTGGGGTAACAGAGACTCCTCTCATGAAAGAAGACAGTATTTTAGCCGTTCGTAAATATTTTCAGCGTATTACTCTTTATCTTAAAGAAAAAAAATACTCCCCTTGCGCATGGGAGGTTGTCCGAGCAGAAATTATGAGGAGCTTCTCCCTCTCTACAAATCTGCAAGAGTCTTTGAGAAGTAAAGAATGA 63
His6:mIZ:rhG-CSF MDPMHHHHHHYGGIEKKIEAHEKKHEAIEKKIEAGTGSPPVPSTPPTPSPSCRSAAAENLYFQGTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP 25 ATGGATCCAATGCATCACCATCACCACCATTATGGAGGTATTGAGAAGAAGATTGAGGCACATGAGAAGAAGCATGAGGCAATAGAGAAGAAGATTGAGGCAGGTACCGGTTCTCCACCAGTACCAAGCACACCTCCAACTCCGAGTCCGAGTTGTAGATCTGCGGCCGCAGAAAACCTGTATTTTCAGGGCACCCCCCTGGGCCCTGCCAGCTCCCTGCCCCAGAGCTTCCTGCTCAAGTGCTTAGAGCAAGTGAGGAAGATCCAGGGCGATGGCGCAGCGCTCCAGGAGAAGCTGTGTGCCACCTACAAGCTGTGCCACCCCGAGGAGCTGGTGCTGCTCGGACACTCTCTGGGCATCCCCTGGGCTCCCCTGAGCAGCTGCCCCAGCCAGGCCCTACAGCTGGCAGGCTGCTTGAGCCAACTCCATAGCGGCCTTTTCCTCTACCAGGGGCTCCTACAGGCCCTGGAAGGGATCTCCCCCGAGTTGGGTCCCACCTTGGACACACTACAGCTGGACGTCGCCGACTTTGCCACCACCATCTGGCAGCAGATGGAAGAACTGGGAATGGCCCCTGCCCTACAGCCCACCCAGGGTGCCATGCCGGCCTTCGCCTCTGCTTTCCAGCGCCGGGCAGGAGGGGTCCTAGTTGCCTCCCATCTACAGAGCTTCCTGGAGGTGTCGTACCGCGTTCTACGCCACCTTGCCCAGCCCTGA 64
His6:DLH:INF-a2 MDPMHHHHHHPSDLHDRDLHDRDLHDRGTGSPPVPSTPPTPSPSCRSENLYFQGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE 26 ATGGATCCAATGCATCACCATCACCACCATCCTAGCGACCTACATGACCGAGATCTTCACGATCGTGATCTTCATGACCGAGGTACCGGTTCTCCACCAGTACCAAGCACACCTCCAACTCCGAGTCCGAGTTGTAGATCTGAAAACCTGTATTTTCAGGGCTGCGATCTCCCACAAACCCACTCCTTAGGTTCTCGACGTACTCTAATGCTTCTCGCTCAGATGAGGAGGATTTCACTTTTCAGTTGTTTGAAGGATCGTCACGACTTCGGATTTCCCCAAGAAGAGTTTGGAAACCAATTCCAAAAGGCTGAGACAATTCCAGTTTTGCACGAAATGATTCAACAAATCTTTAATCTGTTTAGCACTAAGGATAGCAGCGCAGCATGGGATGAAACACTCCTTGATAAATTTTATACAGAATTATATCAGCAACTGAATGACCTTGAGGCATGCGTCATACAGGGTGTTGGGGTAACAGAGACTCCTCTCATGAAAGAAGACAGTATTTTAGCCGTTCGTAAATATTTTCAGCGTATTACTCTTTATCTTAAAGAAAAAAAATACTCCCCTTGCGCATGGGAGGTTGTCCGAGCAGAAATTATGAGGAGCTTCTCCCTCTCTACAAATCTGCAAGAGTCTTTGAGAAGTAAAGAATGA 65
HAT MDPMKDHLIHNVHKEFHAHAHNK 27 ATGGATCCAATGAAGGATCATCTTATACACAATGTTCATAAGGAGTTCCACGCACATGCTCACAACAAG 66
HAT:mIZ MDPMKDHLIHNVHKEFHAHAHNKPGYGGIEKKIEAHEKKHEAIEKKIEA 28 ATGGATCCAATGAAGGATCATCTTATACACAATGTTCATAAGGAGTTCCACGCACATGCTCACAACAAGCCTGGTTATGGAGGTATTGAGAAGAAGATTGAGGCACATGAGAAGAAGCATGAGGCAATAGAGAAGAAGATTGAGGCA 67
HQ6 MAHQHQHQHQHQHQ 29 ATGGCACATCAGCACCAACATCAGCACCAACACCAGCATCAA 68
HQ6:mIZ MAHQHQHQHQHQHQYGGIEKKIEAHEKKHEAIEKKIEA 30 ATGGCACATCAGCACCAACATCAGCACCAACACCAGCATCAATATGGAGGTATTGAGAAGAAGATTGAGGCACATGAGAAGAAGCATGAGGCAATAGAGAAGAAGATTGAGGCA 69
HQ6:TZ1H MAHQHQHQHQHQHQEIAQHEKEIQAIEKKIAQHEYKIQAIEEKIAQHKEKIQAIK 31 ATGGCACATCAGCACCAACATCAGCACCAACACCAGCATCAAGAAATTGCTCAACATGAAAAGGAAATTCAAGCTATTGAAAAGAAGATTGCTCAACATGAATATAAGATTCAAGCTATTGAAGAAAAGATTGCTCAACATAAGGAAAAGATTCAAGCTATTAAG 70
GFP SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKANFKTRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK 32 AGTAAAGGAGAGGAGTTGTTTACTGGTGTTGTCCCGATTTTAGTTGAACTTGACGGTGATGTTAATGGGCACAAGTTCTCTGTCAGTGGAGAAGGGGAAGGCGATGCAACATATGGTAAGCTCACGTTGAAGTTTATTTGCACTACTGGAAAACTCCCTGTTCCGTGGCCAACACTTGTGACTACGTTTTCTTACGGTGTTCAGTGTTTTTCAAGATACCCTGATCATATGAAGCGGCACGATTTCTTTAAGAGCGCGATGCCTGAGGGATACGTGCAGGAAAGAACCATCTTCTTCAAGGACGACGGTAATTATAAGACACGTGCTGAAGTTAAGTTCGAGGGAGACACCTTGGTGAATCGAATAGAACTTAAAGGAATCGATTTTAAGGAAGATGGAAACATTCTCGGCCACAAGTTGGAGTACAACTACAACTCACATAACGTATACATAATGGCAGATAAGCAAAAGAACGGCATCAAGGCAAACTTCAAGACCAGGCACAATATCGAGGATGGGGGTGTGCAACTAGCTGATCATTATCAGCAAAATACTCCAATTGGTGATGGACCTGTCCTCTTACCAGATAATCATTATCTGTCCACGCAATCTGCCCTGTCGAAGGACCCCAACGAAAAGAGAGACCATATGGTGCTTCTTGAGTTCGTAACAGCTGCTGGGATTACACATGGTATGGACGAGCTATATAAGTGA 71
Hinge GSPPVPSTPPTPSPSC 33 GGTTCTCCACCAGTACCAAGCACACCTCCAACTCCGAGTCCGAGTTGT 72
TZ1H 기반 중요 아미노산 분석을 위한 돌연변이 클론의 아미노산 서열 및 핵산 서열 정보
태그 명칭 아미노산 서열 (N → C) 서열번호 핵산 서열 (5’ → 3’) 서열번호
TZ1H(IA/GG) EGGQHEKEGQAIEKKGGQHEYKGQAIEEKGGQHKEKGQAIK 34 GAAGGTGGTCAACATGAAAAGGAAGGTCAAGCTATTGAAAAGAAGGGTGGTCAACATGAATATAAGGGTCAAGCTATTGAAGAAAAGGGTGGTCAACATAAGGAAAAGGGTCAAGCTATTAAG 73
TZ1H(Q/G) EIAGHEKEIGAIEKKIAGHEYKIGAIEEKIAGHKEKIGAIK 35 GAAATTGCTGGACATGAAAAGGAAATTGGAGCTATTGAAAAGAAGATTGCTGGACATGAATATAAGATTGGAGCTATTGAAGAAAAGATTGCTGGACATAAGGAAAAGATTGGAGCTATTAAG 74
TZ1H(H/G) EIAQGEKEIQAIEKKIAQGEYKIQAIEEKIAQGKEKIQAIK 36 GAAATTGCTCAAGGTGAAAAGGAAATTCAAGCTATTGAAAAGAAGATTGCTCAAGGTGAATATAAGATTCAAGCTATTGAAGAAAAGATTGCTCAAGGTAAGGAAAAGATTCAAGCTATTAAG 75
TZ1H(H/K) EIAQKEKEIQAIEKKIAQKEYKIQAIEEKIAQKKEKIQAIK 37 GAAATTGCTCAAAAGGAAAAGGAAATTCAAGCTATTGAAAAGAAGATTGCTCAAAAGGAATATAAGATTCAAGCTATTGAAGAAAAGATTGCTCAAAAGAAGGAAAAGATTCAAGCTATTAAG 76
TZ1H(E/G) GIAQHGKGIQAIGKKIAQHGYKIQAIGGKIAQHKGKIQAIK 38 GGAATTGCTCAACATGGAAAGGGAATTCAAGCTATTGGAAAGAAGATTGCTCAACATGGATATAAGATTCAAGCTATTGGAGGAAAGATTGCTCAACATAAGGGAAAGATTCAAGCTATTAAG 77
TZ1H(K/G) EIAQHEGEIQAIEGGIAQHEYGIQAIEEGIAQHGEGIQAIG 39 GAAATTGCTCAACATGAAGGGGAAATTCAAGCTATTGAAGGTGGTATTGCTCAACATGAATATGGGATTCAAGCTATTGAAGAAGGGATTGCTCAACATGGGGAAGGTATTCAAGCTATTGGA 78
실시예 2. 알파-나선 펩타이드 태그의 디자인 및 휠 다이어그램 분석
알파-나선 펩타이드 태그를 구성하는 주요 아미노산인 전하성과 소수성을 띄는 아미노산을 기반으로, pepwheel(https://www.bioinformatics.nl/cgi-bin/emboss/pepwheel)을 이용한 휠 다이어그램 분석을 통해 알파-나선의 입체적 구조상에서 주요 아미노산의 상대적 배열 위치를 조절함으로써 자가조립체 형성이 용이할 수 있도록 mIZ, TZ1H, IAQ, DLH 및 EAH 펩타이드 태그를 인위적으로 디자인하였다. mIZ 펩타이드 태그는 전하성과 소수성을 띄는 주요 아미노산이 알파-나선의 입체적 구조상에서 이방향성으로 분포하도록 배열하였으며, TZ1H 펩타이드 태그는 주요 아미노산이 전체방향으로 고르게 분포하도록 배열하였다. IAQ 펩타이드 태그는 전하성과 소수성의 주요 아미노산에 더하여 극성 아미노산이 알파-나선의 입체적 구조상에서 각각 부분적으로 cluster를 형성하도록 배열하였다. 그리고 DLH 및 EAH 펩타이드 태그는 알파-나선의 입체적 구조상에서 주요 아미노산 조합의 cluster가 세 방향으로 분포하도록 배열하였다. 이들 알파-나선 펩타이드 태그의 주요 아미노산의 상대적 위치에 대한 휠 다이어그램 분석한 결과를 도 2a 내지 도 2e에 나타내었다.
실시예 3. 융합단백질의 발현 유도 및 추출
상기 실시예 1에서 제작한 융합단백질 발현용 벡터는 BL21 (DE3) 대장균에 형질전환하여 37℃ LB 배지(카나마이신 50 ㎍/㎖ 포함)에서 배양하였다. 단백질의 과발현을 유도하기 위해 O.D600값 0.6에서 1.0 mM IPTG (isopropyl-β)를 첨가하고 18℃에서 18시간 추가 배양하였다. 배양된 대장균은 4,000 rpm에서 15분간 4℃에서 원심분리하여 펠렛으로 얻었다. 과발현된 융합단백질 추출에는 HEPES 버퍼(HEPES; 50 mM HEPES buffer (pH 7.5), Triton X-100, protease inhibitor cocktail (Roche, Mannheim, GEU) 포함)로 sonication 후 13,000 rpm에서 15분간 4℃에서 원심분리하여 융합단백질을 포함하는 상층액을 얻었다.
실시예 4. 거대분자 자가 조립체 형성 유도 및 최적화
실시예 4-1. 염으로서 황산암모늄 농도의 최적화
황산암모늄 농도의 최적화를 위해 12~22% [w/v] 범위의 황산암모늄을 2% 간격으로 처리하여 원심분리 한 후 얻어진 상층액에 0.5 mM 농도의 Ni2+를 처리하였다.
실시예 4-2. 염으로서 염화나트륨 농도의 최적화
염으로서 염화나트륨 처리 농도에 따른 효과를 분석하기 위해 0~3 M 범위의 NaCl 처리 조건에서 0.5 mM 농도의 Ni2+를 처리하였다.
실시예 4-3. 완충 용액의 최적화
완충용액 최적화를 위해 pH 7.4 HEPES buffer (HEPES; 50 mM HEPES buffer (pH 7.4)), pH 7.4 PBS buffer (PBS; 137 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4 (pH 7.4)), pH 7.4 PB buffer (PB; 10 mM Na2HPO4, 1.8 mM KH2PO4 pH 7.4)), pH 7.4 Tris buffer (Tris; 50 mM Tris-HCl buffer (pH 7.4))를　사용하였으며, 모두 1% [v/v] TritonX-100과 1X [v/v] Protease inhibitor cocktail tablets (Roche)을 첨가하여 사용하였다. 각 완충용액 조건에서 황산암모늄 처리 후 원심분리하여 얻은 상층액에 0.5 mM 농도의 Ni2+를 처리하였다.
실시예 4-4. Ni 2+ 농도의 최적화
Ni2+ 농도의 최적화를 위해 황산암모늄 처리 후 원심분리하여 얻은 상층액에 0~2 mM 범위의 Ni2+를 처리하였다.
실시예 4-5. 완충용액 pH 최적화
Buffer pH 최적화를 위해 황산암모늄을 처리하여 원심분리한 후 얻어진 상층액에 HCl과 NaOH를 사용해 pH 5 내지 10 범위로 조절하여 사용하였다. 각 pH 조건에서 황산암모늄 처리 후 원심분리하여 얻은 상층액에 0.5 mM 농도의 Ni2+를 처리하였다.
실시예 4-6. 자가 조립체 형성 반응 시간의 최적화
거대분자 자가 조립체 형성 시간의 최적화를 위해 황산암모늄 처리 후 원심분리하여 얻은 상층액에 0.5 mM 농도의 Ni2+ 처리 즉시부터 처리 후 60분까지 10분 간격으로 측정하였으며, 추가적으로 120분까지 측정하였다.
실시예 5. 거대분자 자가 조립체 재조합 단백질의 회수 및 단량체로의 전환
상기 실시예 4에서 특정 유도제 또는 조건 의존적으로 거대분자 자가 조립체가 형성된 재조합 단백질을 원심분리와 여과 등의 방법을 통해 회수하였다.
구체적으로, 원심분리를 통한 정제방법에서는 3000 rpm 이상에서 10분간 4℃에서 원심분리 진행하였고, 거대분자 조립체 재조합 단백질을 펠렛으로 얻었으며, 거대분자 조립체 유도반응에 사용한 동일 버퍼에 5 mM EDTA를 첨가하여 단량체의 재조합 단백질을 얻었다. 여과를 통한 방법에서는 0.2 μm syringe filter (Satorius, Goettingen, GEU)를 사용하였으며, 거대분자 자가 조립체 형성된 재조합 단백질을 여과한 후 거대분자 조립체 유도반응에 사용한 동일 완충용액을 이용하여 세척과정을 진행하였다. 그리고 EDTA와 같은 킬레이트를 첨가한 동일 완충용액을 이용하여 거대분자 조립체를 단량체로서 전환시키거나 용출하였다. 이를 가시적으로 확인하기 위해서 필터를 360 nm UV 파장으로 조사하여 가시적으로 확인하였다.
실시예 6. SDS-PAGE를 통한 정제된 단백질의 확인
원심분리 및 여과를 통해 회수한 단량체의 재조합 단백질을 일정량 취해 SDS 샘플버퍼(glycerol, 2M Tris-HCl(pH 6.8), 30% SDS, 2-mercaptoethanol)를 넣고 가열하여 분석에 사용하였으며, 일반적인 SDS-PAGE법을 통해 정제 단백질의 거대분자 자가 조립체 유도 최적화 조건 탐색, 정제 회수율 및 순도 등을 평가하였다.
실시예 7. 형광현미경을 통한 거대분자 자가 조립체 형성 확인
거대분자 자가 조립체 형성 유무 및 대략적인 크기 등을 분석하기 위하여 형광현미경을 활용하였으며, GFP 형광신호를 검출하기 위하여 exitation: 488 nm, emission: 520 nm 필터를 사용하였다. 거대분자 자가 조립체 형성 정도를 정량적으로 분석하기 위하여, 캡쳐된 형광 이미지의 픽셀당 형광 세기를 측정하여 상대적인 자가 조립체 형성 규모를 비교하였다.
[실험 결과]
실험예 1. His 태그와 알파 나선 기반 유닛 펩타이드 태그 융합 단백질의 자가 조립체 형성 유도에 적합한 유도제 확인
특정 유도제 또는 조건 의존적으로 거대분자 자가 조립체 형성 유도능을 확인하기 위해 GFP를 모델 단백질로 선택하여, 실시예 1,2 및 실시예 3에 기재된 방법으로 정제 태그로서 His 태그와 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 알파-나선 기반 유닛인 TZ1H 펩타이드 태그, mIZ 펩타이드 태그 및 이들 특성을 기반으로 인위적으로 디자인된 DLH 펩타이드 태그, IAQ 펩타이드 태그, EAH 펩타이드 태그를 조합하여 His6:TZ1H:GFP, His6:mIZ:GFP, His6:DLH:GFP, His6:IAQ:GFP, His6:EAH:GFP 융합단백질을 제작하였다. 대조군 실험을 위해서 정제 태그로서 His 태그를 단독으로 융합한 His6:GFP, 각 알파 나선기반 유닛을 단독으로 융합한 TZ1H:GFP, mIZ:GFP, DLH:GFP, IAQ:GFP, EAH:GFP 융합단백질을 제작하였다(도 1b 참조). 그런 다음, 융합단백질을 포함한 단백질 추출액에 다양한 양이온 유도제를 처리하여 거대분자 자가 조립체 형성을 유도하였다. 양이온 유도제에 의해 거대분자 자가 조립체 형성이 유도된 단백질은 원심분리를 통해 회수하여 단백질 용출 시 사용한 동일 완충용액에 녹였고, SDS 샘플버퍼를 넣고 가열하여 SDS-PAGE를 통해 확인하여 도 3a 내지 도 3k에 나타내었다.
그 결과, 도 3a 내지 도 3k에 나타낸 바와 같이, His6:TZ1H:GFP 융합단백질은 Ni2+, Co2+, Cu2+, Zn2+, Fe2+, Ba2+에 의해 거대분자 자가 조립체 형성이 유도되었으며, 특히, Ni2+, Zn2+, Fe2+, Ba2+에 의해 자가 조립체 형성 유도가 우수함을 확인하였다(도 3c 참조). His6:mIZ:GFP 융합단백질은 Ni2+, Co2+, Cu2+, Ag2+ Zn2+, Fe2+ 에 의해 거대분자 자가 조립체 형성이 유도되었고, 특히, Ni2+, Cu2+, Ag2+, Fe2+에 의해 자가 조립체 형성 유도가 우수함을 확인하였다(도 3e 참조). His6:DLH:GFP와 His6:IAQ:GFP 융합단백질은 Ni2+, Co2+, Cu2+, Zn2+, Fe2+에 의해 거대분자 자가 조립체 형성이 유도되었으며(도 3g 및 도 3i 참조), His6:EAH:GFP는 Ni2+, Cu2+, Zn2+, Fe2+에 의해 거대분자 자가 조립체 형성이 유도되었다(도 3k 참조). 반면, His 태그 단독(His6:GFP) 또는 펩타이드 태그 단독(TZ1H:GFP, mIZ:GFP, DLH:GFP, IAQ:GFP, EAH:GFP)으로 사용한 대조군의 경우 Ni2+, Cu2+, Zn2+, Fe2+ 등과 같은 양이온 유도제 처리 시 거대분자 자가 조립체 형성이 유도되지 않거나 매우 약하게 유도되었다(도 3a, 도 3b, 도 3d, 도 3f, 도 3h 및 도 3j 참조). 상기 결과를 종합하면, His 태그와 펩타이드 태그의 조합이 다양한 양이온 유도제에 의해 거대분자 자가 조립체 형성의 유도가 현저하게 증가되었으며, 알파 나선 기반 유닛 펩타이드 태그의 종류에 따라 자가 조립체 형성 유도를 증가시키는 양이온 유도제 종류가 상이함을 확인하였다. His 태그와 모든 펩타이드 태그의 조합에서 공통적으로 유도제 Ni2+에 대한 반응성이 매우 우수하였으며, 이후 실험에서는 특정 유도제로서 Ni2+을 사용하여 실험을 진행하였다.
실험예 2. 유도제로 양이온 Ni 2+ 처리 시 자가 조립체 형성 여부 확인
상기 실험예 1에서 Ni2+이 유도제로서 자가 조립체 형성에 적합함을 확인하였으므로, 이를 이용하여 Ni2+ 처리 시 각각의 His6:TZ1H:GFP, His6:mIZ:GFP, His6:DLH:GFP, His6:IAQ:GFP, His6:EAH:GFP 융합단백질의 자가 조립체 형성 여부를 확인하였다.
구체적으로, 실시예 3에서 수득한 His6:TZ1H:GFP, His6:mIZ:GFP, His6:DLH:GFP, His6:IAQ:GFP, His6:EAH:GFP 융합단백질, His 태그를 단독으로 융합한 His6:GFP, 각 알파 나선기반 유닛을 단독으로 융합한 TZ1H:GFP, mIZ:GFP, DLH:GFP, IAQ:GFP, EAH:GFP 융합단백질을 포함하는 각각의 단백질 추출액에 양이온 유도제로 Ni2+를 0 내지 2 mM 농도로 각각 처리하여 거대분자 자가 조립체 형성을 유도하였다. 거대분자 자가 조립체 형성이 유도된 단백질은 원심분리를 통해 회수하여 단백질 용출 시 사용한 동일 완충용액에 녹였고, SDS 샘플버퍼를 넣고 가열하여 SDS-PAGE를 통해 확인하여 그 결과를 도 4a 내지 도 4e에 나타내었다.
그 결과, 도 4a 내지 도 4e에 나타난 바와 같이, His6:TZ1H:GFP 융합단백질, His6:mIZ:GFP 융합단백질, His6:DLH:GFP 융합단백질, His6:IAQ:GFP 융합단백질, His6:EAH:GFP는 Ni2+에 의해 거대분자 자가 조립체 형성이 유도됨이 확인된 반면, His 태그 단독(His6:GFP) 대조군과 펩타이드 태그 단독(TZ1H:GFP, mIZ:GFP, DLH:GFP, IAQ:GFP, EAH:GFP)으로 사용한 대조군의 경우 Ni2+ 유도제 처리 시 거대분자 자가 조립체 형성이 유도되지 않음을 확인하였다 (도 4a 내지 도 4e 참조).
실험예 3. 거대분자 자가 조립체 형성을 위한 최적 조건 확립
정제 태그로서 His 태그와 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 알파 나선 기반 유닛 융합 단백질의 거대분자 자가 조립체 형성 유도 극대화 및 목적 단백질 이외의 비선택적 단백질 제거 및 결합 최소화를 통한 고순도 정제조건 최적화를 위하여, 완충 용액, 염 처리, Ni2+ 처리 농도, pH 변화, 처리 시간 등 다양한 조건에 대한 자가 조립체 형성 유도 효과를 분석하였다.
실험예 3-1. 염으로서 황산암모늄 농도 조건의 최적화
정제 태그로서 His 태그와 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 알파 나선 기반 유닛 융합 단백질의 거대분자 자가 조립체 형성에 적합한 황산암모늄 농도 조건을 확인하기 위하여 하기와 같은 실험을 수행하였다.
구체적으로, 실시예 3에서 수득한 His6:TZ1H:GFP, His6:mIZ:GFP, His6:DLH:GFP, His6:IAQ:GFP, His6:EAH:GFP 융합단백질, His 태그를 단독으로 융합한 His6:GFP, 각 알파 나선 기반 유닛을 단독으로 융합한 TZ1H:GFP, mIZ:GFP, DLH:GFP, IAQ:GFP, EAH:GFP 융합단백질을 포함하는 각각의 단백질 추출액에 실시예 4-1에 기재된 방법으로 거대분자 자가 조립체 형성을 유도하였다. 거대분자 자가 조립체 형성이 유도된 단백질은 원심분리를 통해 회수하여 단백질 용출 시 사용한 동일 완충용액에 녹였고, SDS 샘플버퍼를 넣고 가열하여 SDS-PAGE를 통해 확인하여 그 결과를 도 5a 내지 도 5k에 나타내었다.
그 결과, 도 5a 내지 도 5k에 나타난 바와 같이, His6:TZ1H:GFP는 12~22% (w/v), His6:mlZ:GFP, His6:DLH:GFP, His6:IAQ:GFP는 14~22% (w/v), His6:EAH:GFP는 16~22% (w/v) 범위에서 거대분자 자가 조립체 형성이 유도됨을 확인하였다. 각 유닛은 His6:
TZ1H:GFP는 16% (w/v), His6:DLH:GFP, His6:mlZ:GFP, His6:IAQ:GFP, His6:EAH:GFP는 20% (w/v)에서 거대분자 자가 조립체 형성이 가장 우수한 것으로 분석되었다.
실험예 3-2. 염으로서 염화나트륨 농도 조건의 최적화
정제 태그로서 His 태그와 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 알파 나선 기반 유닛 융합 단백질의 거대분자 자가 조립체 형성에 적합한 염화나트륨 농도 조건을 확인하기 위하여 하기와 같은 실험을 수행하였다.
구체적으로, 염으로써 0~3 M 농도 범위의 NaCl 처리조건에서 실시예 4-2에 기재된 방법으로 자가 조립체를 유도한 후, SDS-PAGE를 통해 확인하여 그 결과를 도 6a 내지 도 6e에 나타내었다.
그 결과, 도 6a 내지 도 6e에 나타난 바와 같이, His6:DLH:GFP, His6:EAH:GFP는 모든 NaCl 농도에서 거대분자 자가 조립체가 형성되지 않았으며, His6:mlZ:GFP, His6:IAQ:GFP는 100 mM, His6:TZ1H:GFP는 300 mM NaCl를 첨가 시 거대분자 자가 조립체 형성이 가장 우수한 것으로 분석되었다.
상기 실험예 3-1 및 3-2의 결과를 통해 염화나트륨에 비해 황산암모늄을 처리한 경우 자가 조립체 유도가 상대적으로 우수함을 확인하였는 바, 이후 실험에서는 염으로서 황산암모늄을 사용하여 실험을 진행하였다.
실험예 3-3. 완충 용액 조건의 최적화
정제 태그로서 His 태그와 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 알파 나선 기반 유닛 융합 단백질의 거대분자 자가 조립체 형성에 적합한 완충용액을 확인하기 위하여 하기와 같은 실험을 수행하였다.
구체적으로, 각각의 융합 단백질 추출액에 pH 7.4 HEPES buffer (HEPES; 50 mM HEPES buffer (pH 7.4)), pH 7.4 PBS buffer (PBS; 137 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4 (pH 7.4)), pH 7.4 PB buffer (PB; 10 mM Na2HPO4, 1.8 mM KH2PO4 pH 7.4)), pH 7.4 Tris buffer (Tris; 50 mM Tris-HCl buffer (pH 7.4))를 각각의 완충용액으로 사용하고, 모두 1% [v/v] Triton X-100과 1X [v/v] Protease inhibitor cocktail tablets (Roche)을 첨가하였다. 그런 다음, 염으로서 황산암모늄을 처리하고, 0.5 mM 농도의 Ni2+ 을 처리하여 자가 조립체를 유도하였다. SDS-PAGE를 통해 HEPES, Tris, phosphate 등 완충용액의 종류에 따른 자가 조립체 유도 효과를 분석한 결과를 도 7a 내지 도 7e에 나타내었다.
그 결과, 도 7a 내지 도 7e에 나타난 바와 같이, His6:TZ1H:GFP를 제외한 모든 융합단백질은 HEPES (pH 7,4) 완충 용액 사용시 거대분자 자가 조립체 형성 유도 효과가 가장 우수하였으며, His6:TZ1H:GFP 융합단백질은 PB buffer (pH 7.4) 사용시 거대분자 자가 조립체 형성 유도 효과 가장 우수함을 확인하였다.
실험예 3-4. Ni 2+ 농도의 최적화
정제 태그로서 His 태그와 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 알파 나선 기반 유닛 융합 단백질의 거대분자 자가 조립체 형성에 적합한 Ni2+ 농도 조건을 확인하기 위하여 하기와 같은 실험을 수행하였다.
구체적으로, 각각의 융합단백질을 포함하는 단백질 상층액에 염으로서 황산암모늄을 처리하고, 유도제인 Ni2+ 양이온을 0 내지 2 mM 농도의 다양한 범위로 각각 처리하여 실시예 4-4에 기재된 방법으로 자가 조립체를 유도한 후, SDS-PAGE를 통해 자가 조립체 유도 효과를 확인하여 그 결과를 도 8a 내지 도 8e에 나타내었다.
그 결과, 도 8a 내지 도 8e에 나타난 바와 같이, His6:TZ1H:GFP, His6:mIZ:GFP, His6:DLH:GFP, His6:IAQ:GFP, His6:EAH:GFP 융합단백질은 황산암모늄 처리 후 양이온 유도제 Ni2+를 0.5 mM 농도로 처리하였을 때, 20분 내에 단백질 추출액에 존재하는 거의 모든 단량체가 거대분자 자가 조립체를 형성하는 것을 확인하였다.
실험예 3-5. 완충용액 pH 최적화
정제 태그로서 His 태그와 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 알파 나선 기반 유닛 융합 단백질의 거대분자 자가 조립체 형성에 적합한 완충용액의 pH 조건을 확인하기 위하여 하기와 같은 실험을 수행하였다.
구체적으로, 황산암모늄을 처리하여 원심분리한 후 얻어진 상층액에 HCl과 NaOH를 사용해 pH 5 내지 10 범위로 각각 조절하고, 실시예 4-5에 기재된 방법으로 자가 조립체를 유도한 후, SDS-PAGE를 통해 확인하여 그 결과를 도 9a 내지 도 9e에 나타내었다.
그 결과, 도 9a 내지 도 9e에 나타난 바와 같이, His6:TZ1H:GFP와 His6:mlZ:GFP는 pH 7~8에서 거대분자 자가 조립체 형성 유도가 정상적으로 일어났지만, 그 이상의 염기 조건에서는 거대분자 자가 조립체 형성 유도가 감소하는 경향을 나타냈다. 이외 다른 융합단백질은 pH 7 내지 pH 10의 염기 조건에서 거대분자 자가 조립체 형성 유도가 정상적으로 일어났으며, pH 5 이하의 산성 조건에서는 비특이적인 단백질들의 침전이 일어남을 확인하였다.
실험예 3-6. His 태그와 알파 나선 기반 태그 융합 단백질의 자가 조립체 형성 반응 시간의 최적화
정제 태그로서 His 태그와 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 알파 나선 기반 유닛 융합 단백질의 거대분자 자가 조립체 형성에 적합한 반응 시간 조건을 확인하기 위하여 하기와 같은 실험을 수행하였다.
구체적으로, 각각의 융합단백질을 포함하는 단백질 상층액에 염으로서 황산암모늄을 처리하고, 유도제인 Ni2+ 양이온을 0.5 mM 농도로 처리하였다. Ni2+ 양이온 처리 후 60분까지 10분 간격으로 실시예 4-6에 기재된 방법으로 자가 조립체를 유도하고, 추가적으로 120분까지 유도한 후, SDS-PAGE를 통해 자가 조립체 유도 효과를 확인하여 그 결과를 도 10a 내지 도 10e에 나타내었다.
그 결과, 도 10a 내지 도 10e에 나타난 바와 같이, His 태그에 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 알파 나선 기반 유닛이 결합된 각 융합단백질은 모두 20분 내에 거대분자 자가 조립체를 형성함을 확인하였다.
실험예 3-7. HQ 태그 또는 HAT 태그와 알파 나선 기반 태그 융합 단백질의 자가 조립체 형성 유도능 확인
His 태그의 오리지날인 HAT 태그 및 변형된 HQ 태그를 TZ1H 펩타이드 태그 및 mIZ 펩타이드 태그와 융합하거나 단독으로 설계 조합하여 특정 유도제 조건에서 거대분자 자가 조립체 형성 유도능이 향상되는지 확인하기 위해 녹색 형광 단백질을 모델 단백질로 선택하여 다음의 각 HQ6:TZ1H:GFP와 HQ6:mIZ:GFP, HAT:GFP, HAT:mIZ:GFP 융합단백질을 제작하였다. 각 최적 완충용액 조건 및 염으로서 황산암모늄과 특정 유도제로 Ni2+ 0.5 mM 농도 조건에서 거대분자 자가 조립체 형성을 유도하여 원심분리를 통해 회수하였고, SDS 샘플버퍼를 넣고 가열하여 SDS-PAGE를 통해 이를 분석하였다.
우선, HQ태그 또는 HAT 태그와 알파 나선 기반 태그 융합단백질의 자가 조립체 형성 유도능에 대한 황산암모늄의 농도 조건을 확인하기 위하여 실시예 4-2와 동일한 방법으로 실험을 수행하였다.
그 결과, 도 11a 내지 도 11g에 나타난 바와 같이, HQ6:mIZ:GFP, HAT:mIZ:GFP는 12~22% (w/v), HAT:GFP는 16~22% (w/v), HQ6:TZ1H:GFP는 18~22% (w/v) 범위에서 거대분자 자가 조립체 형성이 유도되었다. 각 unit은 HQ6:mlZ:GFP, HAT:GFP, HAT:mlZ:GFP는 18% (w/v), HQ6:TZ1H:GFP는 22% (w/v)에서 거대분자 자가 조립체가 형성이 가장 우수한 것으로 분석되었다.
HQ 태그 또는 HAT 태그와 알파 나선 기반 태그 융합 단백질의 자가 조립체 형성의 반응 시간을 최적화하기 위하여, HQ 태그 또는 HAT 태그와 알파 나선 기반 태그 융합 단백질을 사용하여 실험예 4-6과 동일한 방법으로 실험을 수행한 후, 그 결과를 도 12a 내지 도 12d에 나타내었다.
그 결과, 도 12a 내지 도 12d에 나타난 바와 같이, HQ 태그 또는 HAT 태그와 알파 나선 기반 태그 각 융합단백질은 모두 20분 내에 거대분자 자가 조립체를 형성함을 확인하였다.
실험예 4. 거대분자 자가 조립체 형성이 유도된 재조합 단백질의 회수 확인
실험예 4-1. His 태그와 알파 나선 기반 태그 융합 단백질의 회수율 및 순도 확인
상기 실험예 3에서 확인한 자가 조립체 형성에 최적화된 조건으로 His 태그와 알파 나선 기반 태그 융합 단백질의 자가 조립체 형성을 유도한 후, 원심분리 방법으로 회수하였다.
구체적으로, 원심분리 방법은 최적조건 및 양성자 유도제로 거대분자 자가 조립체 형성 유도 후 3,000 rpm 이상에서 4℃, 10분간 원심분리를 하여 펠렛의 형태로 재조합 단백질을 회수하고 EDTA를 처리함으로써 다량체에서 단량체로 전환시켰다. 전환된 단량체는 SDS-PAGE를 통해 확인하였고, Bio-Rad 사의 Image Lab 프로그램을 이용하여 회수율과 순도를 측정하였다. 회수율은 황산암모늄과 Ni2+를 이용해 자가 조립체를 유도한 후 아래의 공식(계산식 1)에 의해 구하였다.
[계산식 1]
회수율 = 회수된 목적 밴드의 단백질 세기 / (회수되지 않은 목적 단백질 밴드 세기 + 회수된 목적 단백질 밴드 세기) × 100
순도는 전체 단백질 중 정제된 단백질 밴드가 차지하는 비율을 측정하여 백분율로 나타내었다.
그 결과, 도 13에 나타난 바와 같이, 황산암모늄 처리 후 양이온 유도제 Ni2+을 0.5 mM 처리 시, His 태그와 알파 나선 기반 태그 융합 단백질 별 최대 회수율과 최대 순도는 각각 His6:TZ1H:GFP는 96%, 97%, His6:mlZ:GFP는 98%, 97%. His6:DLH:GFP는 96%, 99%, His6:IAQ:GFP는 98%, 96% His6:EAH:GFP는 89%, 97%로 분석되었다.
실험예 4-2. HQ 태그 또는 HAT 태그와 알파 나선 기반 태그 융합 단백질의 회수율 및 순도 확인
상기 실험예 3에서 확인한 자가 조립체 형성에 최적화된 조건으로 HQ 태그 또는 HAT 태그와 알파 나선 기반 태그 융합 단백질의 자가 조립체 형성을 유도한 후, 실험예 4-1과 동일한 방법으로 단백질을 회수하여 회수율 및 순도 확인하였다.
그 결과, 도 14에 나타난 바와 같이, 황산암모늄 처리 후 양이온 유도제 Ni2+을 0.5 mM 처리 시 HQ 태그 또는 HAT 태그와 알파 나선 기반 태그 융합 단백질 별 최대 회수율과 최대 순도는 각각 HQ6:TZ1H:GFP는 62%, 96%, HAT:GFP는 90%, 97%. HQ6:mIZ:GFP는 97%, 99%, HAT:mIZ:GFP는 96%, 99%로 분석되었다.
상기 결과를 통해, HAT 태그는 단독으로 정제 태그로서 사용하였을 때 His 태그와 비교해 보다 향상된 거대분자 자가 조립체 형성능을 보였으며, HAT 태그 또는 HQ 태그와 TZ1H 펩타이드 태그 및 mIZ 펩타이드 태그와 조합하였을 때, His 태그와 비교해 거대분자 자가 조립체 형성능이 유사함을 확인하였다.
실험예 4-3. His 태그, HQ 태그 및 HAT 태그와 알파 나선 기반 태그 융합단백질의 필터를 이용한 정제 확인
필터를 이용하는 방법은 단백질 추출액에 최적 조건 및 양성자 유도제로 거대분자 자가 조립체 형성된 재조합 단백질을 0.2 μm syringe filter (Satorius, Goettingen, GEU)를 사용하여 여과한 후 거대분자 조립체 유도반응에 사용한 동일 완충용액을 이용하여 세척과정을 진행하였다. 그리고 EDTA와 같은 킬레이트를 첨가한 동일 완충용액을 이용하여 거대분자 조립체를 단량체로서 전환시키거나 용출하였다. 이를 가시적으로 확인하기 위해서 필터를 360 nm UV 파장으로 조사하여 가시적으로 확인하였다.
그 결과, 도 15a 내지 도 15c에 나타난 바와 같이, 거대분자 형태의 자가 조립체는 필터에 여과되어 황산암모늄과 Ni2+이 처리된 단백질 용액의 필터는 UV를 조사하여 형광을 관찰할 수 있었다. 그 후 EDTA가 첨가된 완충용액을 필터에 통과시켜주면 EDTA에 의해 재조합 단백질 다량체가 단량체로 전환이 되어 용출되기 때문에 필터는 UV를 조사하더라도 형광을 띄지 않았다. 이처럼 EDTA에 의해 일어나는 다량체에서 단량체로의 전환은 가역적이며 수초 내에 일어나는 매우 신속한 반응이다. 추가적으로 정제 후 태그를 제거하는 과정 역시 특정 유도제 또는 조건하에서 쉽게 제거할 수 있다. 따라서 본 정제방법을 이용하면 누구나 흔하게 구할 수 있는 기기와 재료로 손쉽게 그리고 간편하고 빠르게 재조합 단백질을 회수할 수 있었으며, 추후 재조합 단백질 생산과정에 적용하여 어려움 없이 scale-up을 진행할 수 있을 것으로 기대된다.
실험예 4-4. His태그와 알파 나선 기반 태그 융합단백질의 거대 분자 자가 조립체 형성을 위한 중요 아미노산 확인
정제 태그로서 His 태그와 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 알파-나선 기반 유닛 융합 단백질을 구성하고 있는 아미노산 중 거대분자 자가 조립체 형성에 핵심적인 주요 아미노산을 확인하기 위해 하기와 같은 실험을 수행하였다.
구체적으로, His6:TZ1H:GFP 융합단백질의 아미노산을 치환하여His6:TZ1H(IA/GG):GFP, His6:TZ1H(Q/G):GFP, His6:TZ1H(H/G):GFP, His6:TZ1H(H/K):GFP, His6:TZ1H(E/G):GFP, His6:TZ1H(K/G):GFP 융합단백질을 수득하였다. 또한, TZ1H:GFP 융합단백질의 아미노산을 치환하여 TZ1H(H/G):GFP, TZ1H(K/G):GFP 융합단백질을 수득하였으며, 각 아미노산 서열은 도 16a에 나타내었다. 이후 각 최적 완충용액 조건 및 염으로서 황산암모늄이 존재할 때, 특정 유도제로 Ni2+ 0.5 mM 농도 조건 및 Ni2+이 존재하지 않는 조건에서 pH 8로 변화시킴으로써 거대분자 자가 조립체 형성을 유도하여 원심분리를 통해 회수하였고, SDS 샘플버퍼를 넣고 가열하여 SDS-PAGE를 통해 이를 분석하였다.
그 결과, 도 16b에 나타난 바와 같이, 염으로서 황산암모늄이 존재하고 특정 유도제로 Ni2+ 0.5 mM 농도 조건에서는 His6:TZ1H:GFP의 형성능이 73%인 것과 비교해 His6:TZ1H(IA/GG):GFP는 거대분자 자가 조립체가 형성되지 않았으며, His6:TZ1H(Q/G):GFP, His6:TZ1H(H/G):GFP, His6:TZ1H(H/K):GFP, His6:TZ1H(E/G):GFP, His6:TZ1H(K/G):GFP의 형성능은 각각 68%, 65%, 63%, 46%, 63%로 감소하였다. 추가적으로 도 16c에 나타난 바와 같이, 염으로서 황산암모늄이 존재하고 Ni2+이 존재하지 않으며 pH 8로 변환시킨 조건에서는 His6:TZ1H:GFP의 형성능이 40%인 것과 비교해 His6:TZ1H(IA/GG):GFP, His6:TZ1H(Q/G):GFP, His6:TZ1H(H/K):GFP는 거대분자 자가 조립체가 형성되지 않았으며, His6:TZ1H(E/G):GFP의 형성능은 61%로 상승하였고, His6:TZ1H(H/G):GFP, His6:TZ1H(K/G):GFP의 형성능은 각각 19%, 15%로 감소되었다.
상기 결과를 통해 염으로서 황산암모늄이 존재하고 특정 유도제로 Ni2+ 0.5 mM 농도 조건에서 거대분자 자가 조립체 형성에 핵심적인 주요 아미노산으로써 태그 내에 소수성 잔기와 전하성 잔기의 구성이 거대분자 자가 조립체 형성에 중요함을 확인하였다. 추가적으로 염으로서 황산암모늄이 존재하고 Ni2+이 존재하지 않으며 pH 8로 변환시킨 조건에서 거대분자 자가 조립체 형성에 핵심적인 주요 아미노산으로써 태그 내에 대부분의 아미노산 잔기의 구성이 중요했으나, 음전하성 잔기인 글루탐산의 경우 거대분자 자가 조립체 형성에 큰 영향을 주지 않았다.
실험예 4-5. 형광현미경을 통한 거대분자 자가 조립체 형성 확인
거대분자 자가 조립체를 저속원심분리를 통한 침강 또는 ㎛ scale의 여과 필터를 통해 여과하여 회수하기 위해서는 박테리아 크기 이상으로 조립체가 형성되어야만 가능하다. 이러한 거대분자 자가 조립체의 형성 유무, 크기, 픽셀당 형광 세기를 시각적, 정량적으로 분석하기 위하여 형광현미경 하에서 관찰하였다. 대표적으로 His6:mIZ:GFP와 His6:TZ1H:GFP 선정하여 분석에 사용하였으며, 대조군으로 His6:GFP를 사용하였다. 구체적인 실험 조건은 상기 실험예 3 및 실험예 4의 최적화된 정제조건을 적용하였다.
우선, 거대분자 조립체 형성 유무를 관찰한 결과, His6:GFP의 경우 매우 작은 크기의 조립체가 부분적으로 관찰되었으나, His6:mIZ:GFP와 His6:TZ1H:GFP의 경우 거대분자 자가 조립체가 전체적으로 형성되는 것을 관찰할 수 있었다(도17a 내지 도 17c). 이러한 거대분자 자가 조립체의 형성은 3차원적으로 형성되어 정확한 크기를 측정하는 것이 매우 어려우나, 하나의 초점면을 기준으로 평면적 이미지를 바탕으로 거대분자 자가 조립체의 크기를 분석한 결과, 수십 ㎛ ~ ㎜ 크기로 형성됨을 확인할 수 있었다(도 17b 및 도 17c). 이러한 크기는 일반적인 박테리아 크기의 수배~수십배에 달하는 거대한 크기이며, 진핵세포에서 크기가 큰 것으로 분류되는 식물세포의 평균 크기와 동일하거나 더 큰 것으로 평가된다.
추가적으로, 거대분자 조립체 형성 정도를 정량적으로 분석하기 위하여, 단위면적당 형광 세기를 측정하여 비교하였다. 일반적으로, 자가 조립체 형성 시 조립체의 크기가 증가할 수록 단위면적당 조립되는 단백질의 수가 증가하게 되는데, 본 실험예에서는 융합된 GFP를 활용하여 형광 세기를 측정하였다.
그 결과, 대조군과 비교하여 His6:mIZ:GFP와 His6:TZ1H:GFP에서 형광의 상대적 세기가 최소 수십배~수천배 증가됨을 알 수 있었으며, fresh한 단백질을 추가 한 경우 His6:mIZ:GFP와 His6:TZ1H:GFP에서 형광의 세기 및 거대분자 자가조립체의 사이즈가 증가함을 확인하였다(도 17d).
실험예 5. 다양한 목적 단백질 정제 가능 여부 확인
항체신약, 백신, 단백질 신약 등을 포함하는 바이오 의약품 시장 규모는 가파르게 성장하고 있으며, 이러한 바이오 의약품을 포함한 재조합 단백질을 쉽고 빠르게 고순도로 정제한다면, 의약품 시장에서 가격 경쟁력을 확보할 수 있을 것이다. 즉, 정제방법을 다양한 목적 단백질에 적용하여 범용성을 확대하는 것은 상당히 중요하다. 따라서 본 발명의 특정 유도제 또는 조건 의존적 자가 조립체 유도방식의 재조합 단백질 정제방법이 의료용 단백질, 효소, 항체와 같이 다양한 목적 단백질에 적용 가능 여부를 확인하였다. 목적 단백질로써 과립구 콜로니자극인자, 인터페론 알파, 치료용 항체 허셉팁 경쇄를 사용하여 다양한 종류의 목적 단백질의 정제를 진행하였으며 상기 실험예 3 및 실험예 4에서 최적화된 정제방법을 이용하였다.
그 결과, 도 18a 내지 도 18h에 나타난 바와 같이, 목적 단백질에 따라 거대분자 자가 조립체가 가장 잘 형성되는 융합단백질을 확인하였으며, 본 발명에서 탐색한 목적 단백질의 최대 회수율과 최대 순도는 His6:DLH:rhG-CSF는 92%, 98%, His6:IAQ:INF-a2는 84%, 96%, His6:mIZ:HER LC는 80%, 94%, His6:TZ1H:rhG-CSF는 93%, 99%, His6:TZ1H:INF-a2는 96%, 99%, His6:mIZ:INF-a2는 80%, 99%, His6:mIZ:rhG-CSF는 84%, 99%, His6:DLH:INF-a2는 87%, 98%로 분석되었다. 즉, 본 발명에서 탐색한 목적 단백질 이외의 수많은 목적 단백질을 정제함에 있어 본 발명에서 제시하는 다양한 유닛들 중 선별하여 최적의 회수율과 순도로 정제할 수 있음을 확인하였다.

Claims (20)

  1. 서열번호 1 내지 서열번호 3으로 이루어진 군에서 선택되는 아미노산 서열로 표시되는 제1 폴리펩타이드 및 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 알파-나선 태그인 제2 폴리펩타이드를 포함하는 융합 폴리펩타이드.
  2. 제1항에 있어서, 상기 제2 폴리펩타이드는 서열번호 4 내지 서열번호 8로 이루어진 군에서 선택되는 하나의 아미노산 서열로 표시되는 것인, 융합 폴리펩타이드.
  3. 제1항에 있어서, 상기 제1 폴리펩타이드와 제2 폴리펩타이드는 순차적으로 연결된 것인, 융합 폴리펩타이드.
  4. 제1항의 융합 폴리펩타이드 및 목적 단백질을 포함하는, 융합 단백질.
  5. 제4항에 있어서, 상기 목적 단백질은 상기 융합 폴리펩타이드의 N 말단 또는 C 말단에 연결된 것인, 융합 단백질.
  6. 제5항에 있어서, 상기 융합 폴리펩타이드와 목적 단백질 사이에 단백질 절단효소의 절단부위, 면역글로불린의 힌지 영역, 또는 이들 모두를 추가로 포함하는, 융합 단백질.
  7. 제4항 내지 제6항 중 어느 한 항의 융합 단백질을 암호화하는 폴리뉴클레오티드.
  8. 제7항의 폴리뉴클레오티드를 포함하는 발현 벡터.
  9. 제8항의 발현 벡터로 형질전환시킨 숙주세포.
  10. 제4항 내지 제6항 중 어느 한 항의 융합 단백질을 암호화하는 폴리뉴클레오티드를 포함하는 세포를 배지에서 배양하는 단계를 포함하는, 목적 단백질을 정제하는 방법.
  11. 제10항에 있어서, 상기 배양하는 단계 이후에,
    상기 세포에서 생산된 융합 단백질의 자가 조립체 형성을 유도하는 단계를 추가로 포함하는, 목적 단백질 정제 방법.
  12. 제11항에 있어서, 상기 자가 조립체 형성을 유도하는 단계는 유도제를 첨가하는 단계를 포함하는, 목적 단백질 정제 방법.
  13. 제12항에 있어서, 상기 유도제는 양이온인 것인, 목적 단백질 정제 방법.
  14. 제13항에 있어서, 상기 유도제는 0.1 내지 2.0 mM 농도인 것인, 목적 단백질 정제 방법.
  15. 제11항에 있어서, 상기 자가 조립체 형성을 유도하는 단계는 황산암모늄을 포함하는 염을 첨가하는 단계를 포함하는, 목적 단백질 정제 방법.
  16. 제15항에 있어서, 상기 황산암모늄은 10 내지 25% (w/v) 농도인, 목적 단백질 정제 방법.
  17. 제11항에 있어서, 상기 자가 조립체 형성을 유도하는 단계는 pH 6 내지 pH 10의 조건에서 수행되는 것인, 목적 단백질 정제 방법.
  18. 제11항에 있어서,
    상기 형성된 자가 조립체를 선택적으로 분리하는 단계를 더 포함하는, 목적 단백질 정제 방법.
  19. 제18항에 있어서, 상기 분리하는 단계는 원심분리 방법 또는 여과 방법으로 수행되는 것인, 목적 단백질 정제 방법.
  20. 서열번호 1 내지 서열번호 3으로 이루어진 군에서 선택되는 하나의 아미노산 서열로 표시되는 제1 폴리펩타이드, 또는 서열번호 4 내지 서열번호 8로 이루어진 군에서 선택되는 하나의 아미노산 서열로 표시되는 제2 폴리펩타이드를 포함하는 단백질 정제용 조성물.
PCT/KR2023/014758 2022-09-27 2023-09-26 정제 태그와 알파-나선 태그를 포함하여 자가 조립체를 형성하는 융합 단백질 및 이를 이용하여 재조합 단백질을 정제하는 방법 WO2024071956A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2022-0122186 2022-09-27
KR1020220122186A KR20240043837A (ko) 2022-09-27 2022-09-27 정제 태그와 알파-나선 태그를 포함하여 자가 조립체를 형성하는 융합 단백질 및 이를 이용하여 재조합 단백질을 정제하는 방법

Publications (1)

Publication Number Publication Date
WO2024071956A1 true WO2024071956A1 (ko) 2024-04-04

Family

ID=90478689

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2023/014758 WO2024071956A1 (ko) 2022-09-27 2023-09-26 정제 태그와 알파-나선 태그를 포함하여 자가 조립체를 형성하는 융합 단백질 및 이를 이용하여 재조합 단백질을 정제하는 방법

Country Status (2)

Country Link
KR (1) KR20240043837A (ko)
WO (1) WO2024071956A1 (ko)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5449758A (en) * 1993-12-02 1995-09-12 Life Technologies, Inc. Protein size marker ladder
JP2004043447A (ja) * 2002-05-17 2004-02-12 Sekisui Chem Co Ltd 蛋白質の製造方法
KR20160007509A (ko) * 2013-04-25 2016-01-20 (재) 스크립스코리아항체연구원 자가 절단 카세트를 포함하는 단백질 정제 방법 및 이의 용도
KR20200135191A (ko) * 2019-05-23 2020-12-02 고려대학교 세종산학협력단 EctP1 펩타이드 태그 및 상기 태그를 이용한 재조합 단백질의 고정화 또는 정제 방법
KR20210094895A (ko) * 2020-01-22 2021-07-30 전북대학교산학협력단 신규 펩타이드 태그, 이에 결합하는 항체 및 이들의 용도

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5449758A (en) * 1993-12-02 1995-09-12 Life Technologies, Inc. Protein size marker ladder
JP2004043447A (ja) * 2002-05-17 2004-02-12 Sekisui Chem Co Ltd 蛋白質の製造方法
KR20160007509A (ko) * 2013-04-25 2016-01-20 (재) 스크립스코리아항체연구원 자가 절단 카세트를 포함하는 단백질 정제 방법 및 이의 용도
KR20200135191A (ko) * 2019-05-23 2020-12-02 고려대학교 세종산학협력단 EctP1 펩타이드 태그 및 상기 태그를 이용한 재조합 단백질의 고정화 또는 정제 방법
KR20210094895A (ko) * 2020-01-22 2021-07-30 전북대학교산학협력단 신규 펩타이드 태그, 이에 결합하는 항체 및 이들의 용도

Also Published As

Publication number Publication date
KR20240043837A (ko) 2024-04-04

Similar Documents

Publication Publication Date Title
WO2018062866A2 (en) CELL-PERMEABLE (CP)-Cas9 RECOMBINANT PROTEIN AND USES THEREOF
WO2015053523A1 (ko) 항체 발현용 바이시스트로닉 발현벡터 및 이를 이용한 항체의 생산 방법
WO2016021973A1 (ko) 캄필로박터 제주니 crispr/cas 시스템 유래 rgen을 이용한 유전체 교정
WO2014030780A1 (en) Screening and engineering method of super-stable immunoglobulin variable domains and their uses
WO2017026779A1 (en) Improved cell-permeable cre (icp-cre) recombinant protein and use thereof
WO2010056043A2 (en) Cell-penetrating, sequence-specific and nucleic acid-hydrolyzing antibody, method for preparing the same and pharmaceutical composition comprising the same
WO2015199387A2 (ko) 가용성 단백질 발현량 및 활성이 증대된 헬리코박터 파일로리 유래 α-1,3 푸코실 전달효소의 유전자와 단백질 및 α-1,3 푸코실올리고당 생산에의 응용
WO2011025242A2 (ko) 번역 효율 증진용 ｄｎａ 단편 및 이를 포함하는 재조합 벡터
WO2014142453A1 (ko) 램프 기능이 포함된 범용 단백질 과발현 태그와 그 활용
WO2015199386A1 (ko) 가용성 단백질 발현량이 증대된 헬리코박터 파일로리 유래 α-1,2 푸코실 전달효소의 유전자와 단백질 및 α-1,2 푸코실올리고당 생산에의 응용
WO2024071956A1 (ko) 정제 태그와 알파-나선 태그를 포함하여 자가 조립체를 형성하는 융합 단백질 및 이를 이용하여 재조합 단백질을 정제하는 방법
Kopeyan et al. Amino acid sequence of neurotoxin V from the scorpion Leiurus quinquestriatus quinquestriatus
WO2024071964A1 (ko) 주요 아미노산이 전하성 및 극성 아미노산으로 구성된 펩타이드 태그를 포함하여 자가 조립체를 형성하는 융합 단백질 및 이를 이용하여 재조합 단백질을 정제하는 방법
WO2022065913A1 (ko) 요산산화효소-알부민 접합체, 그 제조방법 및 용도
WO2024071957A1 (ko) 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 비정형 펩타이드 태그를 포함하여 자가 조립체를 형성하는 융합 단백질 및 이를 이용하여 재조합 단백질을 정제하는 방법
WO2024071960A1 (ko) 주요 아미노산이 전하성 및 소수성 아미노산으로 구성된 분산된 his-태그 기반 펩타이드 태그를 포함하여 자가 조립체를 형성하는 융합 단백질 및 이를 이용하여 재조합 단백질을 정제하는 방법
WO2024071970A1 (ko) 주요 아미노산이 전하성 아미노산으로 구성된 펩타이드 태그를 포함하여 자가 조립체를 형성하는 융합 단백질 및 이를 이용하여 재조합 단백질을 정제하는 방법
CN1330666C (zh) 低氧－诱导因子1αHIF－1α变体和鉴定HIF－1α调节剂的方法
WO2023132543A1 (ko) 포토박테리움 레이오그나티 유래의 우라실-ｄｎａ 글리코실라제를 사용하여 핵산 증폭 반응에서의 캐리오버 오염을 제거하는 방법
WO2016122058A1 (ko) 세포성점균을 이용한 인간 페닐알라닌 수산화효소의 활성분석 방법
WO2017131279A1 (ko) 항균 펩타이드를 포함하는 불용성 융합단백질 및 이를 이용한 항균 펩타이드의 제조 방법
WO2017026776A1 (en) Improved cell-permeable reprogramming factor (icp-rf) recombinant protein and use thereof
WO2024143925A1 (ko) Rnase a에 특이적으로 결합하는 항체 또는 펩티드, 및 rnase a 검출 면역분석 장치 및 방법 그리고 rnase a 포집 방법
WO2023085582A1 (ko) 식물에서 재조합 단백질 발현의 증진에 있어서 gb1 도메인 융합의 효과
WO2022131788A1 (ko) 항체결합단백질 및 칼시퀘스트린 융합단백질을 이용한 면역침강 방법

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23873071

Country of ref document: EP

Kind code of ref document: A1