WO2024033441A1 - Transient expression system for rna - Google Patents
Transient expression system for rna Download PDFInfo
- Publication number
- WO2024033441A1 WO2024033441A1 PCT/EP2023/072103 EP2023072103W WO2024033441A1 WO 2024033441 A1 WO2024033441 A1 WO 2024033441A1 EP 2023072103 W EP2023072103 W EP 2023072103W WO 2024033441 A1 WO2024033441 A1 WO 2024033441A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- rna
- sequence
- booster
- virus
- vector
- Prior art date
Links
- 230000010474 transient expression Effects 0.000 title description 10
- 230000014509 gene expression Effects 0.000 claims abstract description 55
- 238000000034 method Methods 0.000 claims abstract description 48
- 239000013598 vector Substances 0.000 claims description 229
- 229920002477 rna polymer Polymers 0.000 claims description 228
- 102000053602 DNA Human genes 0.000 claims description 134
- 108020004414 DNA Proteins 0.000 claims description 134
- 150000007523 nucleic acids Chemical class 0.000 claims description 129
- 230000002441 reversible effect Effects 0.000 claims description 118
- 239000013603 viral vector Substances 0.000 claims description 88
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 claims description 84
- 230000001177 retroviral effect Effects 0.000 claims description 77
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 claims description 74
- 108090000623 proteins and genes Proteins 0.000 claims description 68
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 62
- 102000039446 nucleic acids Human genes 0.000 claims description 62
- 108020004707 nucleic acids Proteins 0.000 claims description 62
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 claims description 59
- 241001493065 dsRNA viruses Species 0.000 claims description 52
- 238000004806 packaging method and process Methods 0.000 claims description 52
- 102100034349 Integrase Human genes 0.000 claims description 50
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 claims description 42
- 229940104302 cytosine Drugs 0.000 claims description 37
- 241000712907 Retroviridae Species 0.000 claims description 33
- 229930024421 Adenine Natural products 0.000 claims description 29
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 claims description 29
- 229960000643 adenine Drugs 0.000 claims description 29
- 229940113082 thymine Drugs 0.000 claims description 28
- 241000700605 Viruses Species 0.000 claims description 27
- 239000002773 nucleotide Substances 0.000 claims description 26
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical group O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 claims description 25
- 125000003729 nucleotide group Chemical group 0.000 claims description 24
- 230000001124 posttranscriptional effect Effects 0.000 claims description 20
- 108091027981 Response element Proteins 0.000 claims description 19
- 238000000338 in vitro Methods 0.000 claims description 15
- 239000013612 plasmid Substances 0.000 claims description 14
- 241001430294 unidentified retrovirus Species 0.000 claims description 14
- 241000725303 Human immunodeficiency virus Species 0.000 claims description 13
- 241000713772 Human immunodeficiency virus 1 Species 0.000 claims description 11
- 241000598436 Human T-cell lymphotropic virus Species 0.000 claims description 10
- 241000713311 Simian immunodeficiency virus Species 0.000 claims description 10
- 238000004519 manufacturing process Methods 0.000 claims description 10
- 241000713704 Bovine immunodeficiency virus Species 0.000 claims description 8
- 241000714266 Bovine leukemia virus Species 0.000 claims description 8
- 241000713756 Caprine arthritis encephalitis virus Species 0.000 claims description 8
- 241000713730 Equine infectious anemia virus Species 0.000 claims description 8
- 241000713800 Feline immunodeficiency virus Species 0.000 claims description 8
- 241001663880 Gammaretrovirus Species 0.000 claims description 8
- 241000725694 Puma lentivirus Species 0.000 claims description 8
- 230000033228 biological regulation Effects 0.000 claims description 8
- 241000714165 Feline leukemia virus Species 0.000 claims description 7
- 241000713862 Moloney murine sarcoma virus Species 0.000 claims description 7
- 241000016377 Orthoretrovirinae Species 0.000 claims description 7
- 238000010367 cloning Methods 0.000 claims description 7
- 230000002950 deficient Effects 0.000 claims description 7
- 239000008194 pharmaceutical composition Substances 0.000 claims description 7
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 7
- 230000002463 transducing effect Effects 0.000 claims description 7
- 241000714175 Abelson murine leukemia virus Species 0.000 claims description 6
- 241000713838 Avian myeloblastosis virus Species 0.000 claims description 6
- 241001064132 Chick syncytial virus Species 0.000 claims description 6
- 241000714174 Feline sarcoma virus Species 0.000 claims description 6
- 241000713813 Gibbon ape leukemia virus Species 0.000 claims description 6
- 241000713326 Jaagsiekte sheep retrovirus Species 0.000 claims description 6
- 241000881678 Koala retrovirus Species 0.000 claims description 6
- 241000713821 Mason-Pfizer monkey virus Species 0.000 claims description 6
- 241000714177 Murine leukemia virus Species 0.000 claims description 6
- 241000984550 Ovine enzootic nasal tumor virus Species 0.000 claims description 6
- 241000714474 Rous sarcoma virus Species 0.000 claims description 6
- 241001529934 Simian T-lymphotropic virus 3 Species 0.000 claims description 6
- 241001533396 Walleye dermal sarcoma virus Species 0.000 claims description 6
- 241000101098 Xenotropic MuLV-related virus Species 0.000 claims description 6
- 239000003937 drug carrier Substances 0.000 claims description 6
- 239000003550 marker Substances 0.000 claims description 6
- 238000003259 recombinant expression Methods 0.000 claims description 6
- 238000010839 reverse transcription Methods 0.000 claims description 6
- 208000031886 HIV Infections Diseases 0.000 claims description 5
- 241000713340 Human immunodeficiency virus 2 Species 0.000 claims description 5
- 241001505307 Jembrana disease virus Species 0.000 claims description 5
- 238000012258 culturing Methods 0.000 claims description 5
- 230000010076 replication Effects 0.000 claims description 5
- 238000002560 therapeutic procedure Methods 0.000 claims description 5
- 101150104269 RT gene Proteins 0.000 claims description 4
- 241000016379 Spumaretrovirinae Species 0.000 claims description 4
- 108010003533 Viral Envelope Proteins Proteins 0.000 claims description 4
- 208000010094 Visna Diseases 0.000 claims description 4
- 241000272525 Anas platyrhynchos Species 0.000 claims description 3
- 241000700199 Cavia porcellus Species 0.000 claims description 3
- 241000713333 Mouse mammary tumor virus Species 0.000 claims description 3
- 241001507111 Porcine type-C oncovirus Species 0.000 claims description 3
- 241000712909 Reticuloendotheliosis virus Species 0.000 claims description 3
- 241000785681 Sander vitreus Species 0.000 claims description 3
- 241000713896 Spleen necrosis virus Species 0.000 claims description 3
- 241000271897 Viperidae Species 0.000 claims description 3
- 241000714205 Woolly monkey sarcoma virus Species 0.000 claims description 3
- 208000005266 avian sarcoma Diseases 0.000 claims description 3
- 230000036566 epidermal hyperplasia Effects 0.000 claims description 3
- 230000005758 transcription activity Effects 0.000 claims description 3
- 108091032973 (ribonucleotides)n+m Proteins 0.000 abstract description 7
- 230000001052 transient effect Effects 0.000 abstract description 5
- 210000004027 cell Anatomy 0.000 description 124
- 241000713666 Lentivirus Species 0.000 description 49
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 43
- 239000000203 mixture Substances 0.000 description 41
- 201000010099 disease Diseases 0.000 description 38
- 210000003491 skin Anatomy 0.000 description 37
- 239000000427 antigen Substances 0.000 description 28
- 108091007433 antigens Proteins 0.000 description 26
- 102000036639 antigens Human genes 0.000 description 26
- 206010028980 Neoplasm Diseases 0.000 description 25
- -1 coatings Substances 0.000 description 25
- 102000004169 proteins and genes Human genes 0.000 description 25
- 230000001225 therapeutic effect Effects 0.000 description 25
- 230000001105 regulatory effect Effects 0.000 description 23
- 206010058314 Dysplasia Diseases 0.000 description 22
- 239000007924 injection Substances 0.000 description 22
- 238000002347 injection Methods 0.000 description 22
- 238000010361 transduction Methods 0.000 description 21
- 108700019146 Transgenes Proteins 0.000 description 20
- 238000011144 upstream manufacturing Methods 0.000 description 20
- 108010058846 Ovalbumin Proteins 0.000 description 19
- 229940092253 ovalbumin Drugs 0.000 description 19
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 18
- 102000003972 Fibroblast growth factor 7 Human genes 0.000 description 17
- 108090000385 Fibroblast growth factor 7 Proteins 0.000 description 17
- 108020004999 messenger RNA Proteins 0.000 description 17
- 230000026683 transduction Effects 0.000 description 17
- 108020005004 Guide RNA Proteins 0.000 description 16
- 230000003612 virological effect Effects 0.000 description 16
- 108091033409 CRISPR Proteins 0.000 description 13
- 229940098448 fibroblast growth factor 7 Drugs 0.000 description 13
- 210000004209 hair Anatomy 0.000 description 13
- 208000015181 infectious disease Diseases 0.000 description 13
- 239000002609 medium Substances 0.000 description 13
- 108090000765 processed proteins & peptides Proteins 0.000 description 13
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 12
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 12
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 12
- 238000011282 treatment Methods 0.000 description 12
- 230000035876 healing Effects 0.000 description 11
- 206010020718 hyperplasia Diseases 0.000 description 11
- 102000004196 processed proteins & peptides Human genes 0.000 description 11
- 241000894007 species Species 0.000 description 11
- 108090000367 Fibroblast growth factor 9 Proteins 0.000 description 10
- 102100037665 Fibroblast growth factor 9 Human genes 0.000 description 10
- 229940027941 immunoglobulin g Drugs 0.000 description 10
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 10
- 238000006467 substitution reaction Methods 0.000 description 10
- 201000011510 cancer Diseases 0.000 description 9
- 230000000694 effects Effects 0.000 description 9
- 229960000890 hydrocortisone Drugs 0.000 description 9
- 206010054949 Metaplasia Diseases 0.000 description 8
- 239000002537 cosmetic Substances 0.000 description 8
- 239000003814 drug Substances 0.000 description 8
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 8
- 230000015689 metaplastic ossification Effects 0.000 description 8
- 239000013642 negative control Substances 0.000 description 8
- 239000002245 particle Substances 0.000 description 8
- 102000014461 Ataxins Human genes 0.000 description 7
- 108010078286 Ataxins Proteins 0.000 description 7
- 206010008025 Cerebellar ataxia Diseases 0.000 description 7
- 108010035532 Collagen Proteins 0.000 description 7
- 208000035473 Communicable disease Diseases 0.000 description 7
- 108010061833 Integrases Proteins 0.000 description 7
- 208000009415 Spinocerebellar Ataxias Diseases 0.000 description 7
- 239000003242 anti bacterial agent Substances 0.000 description 7
- 201000004562 autosomal dominant cerebellar ataxia Diseases 0.000 description 7
- 210000004443 dendritic cell Anatomy 0.000 description 7
- 238000010362 genome editing Methods 0.000 description 7
- 238000001727 in vivo Methods 0.000 description 7
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 7
- 230000001737 promoting effect Effects 0.000 description 7
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 6
- 201000009030 Carcinoma Diseases 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 6
- 102000019197 Superoxide Dismutase Human genes 0.000 description 6
- 108010012715 Superoxide dismutase Proteins 0.000 description 6
- 108020004566 Transfer RNA Proteins 0.000 description 6
- 206010064930 age-related macular degeneration Diseases 0.000 description 6
- 239000012298 atmosphere Substances 0.000 description 6
- 229940079593 drug Drugs 0.000 description 6
- 230000005802 health problem Effects 0.000 description 6
- 108091027963 non-coding RNA Proteins 0.000 description 6
- 102000042567 non-coding RNA Human genes 0.000 description 6
- 229920001184 polypeptide Polymers 0.000 description 6
- 230000037452 priming Effects 0.000 description 6
- 108020004418 ribosomal RNA Proteins 0.000 description 6
- 230000008685 targeting Effects 0.000 description 6
- 102000008186 Collagen Human genes 0.000 description 5
- 201000004624 Dermatitis Diseases 0.000 description 5
- 101710121417 Envelope glycoprotein Proteins 0.000 description 5
- 241000282412 Homo Species 0.000 description 5
- 102100022745 Laminin subunit alpha-2 Human genes 0.000 description 5
- 229940088710 antibiotic agent Drugs 0.000 description 5
- 210000000234 capsid Anatomy 0.000 description 5
- 229920001436 collagen Polymers 0.000 description 5
- 208000035475 disorder Diseases 0.000 description 5
- 201000009338 distal myopathy Diseases 0.000 description 5
- 210000005175 epidermal keratinocyte Anatomy 0.000 description 5
- 238000009093 first-line therapy Methods 0.000 description 5
- 239000012634 fragment Substances 0.000 description 5
- 210000000642 hair follicle dermal papilla cell Anatomy 0.000 description 5
- 230000003053 immunization Effects 0.000 description 5
- 238000002649 immunization Methods 0.000 description 5
- 230000002458 infectious effect Effects 0.000 description 5
- 230000010354 integration Effects 0.000 description 5
- 230000005012 migration Effects 0.000 description 5
- 238000013508 migration Methods 0.000 description 5
- 230000008569 process Effects 0.000 description 5
- 230000009467 reduction Effects 0.000 description 5
- 229960005322 streptomycin Drugs 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- 241000712461 unidentified influenza virus Species 0.000 description 5
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 5
- 108020005345 3' Untranslated Regions Proteins 0.000 description 4
- 108020003589 5' Untranslated Regions Proteins 0.000 description 4
- 241001231757 Betaretrovirus Species 0.000 description 4
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 4
- 108091079001 CRISPR RNA Proteins 0.000 description 4
- 108010040467 CRISPR-Associated Proteins Proteins 0.000 description 4
- 208000024172 Cardiovascular disease Diseases 0.000 description 4
- 241001663879 Deltaretrovirus Species 0.000 description 4
- 102000003971 Fibroblast Growth Factor 1 Human genes 0.000 description 4
- 108090000386 Fibroblast Growth Factor 1 Proteins 0.000 description 4
- 102000004864 Fibroblast growth factor 10 Human genes 0.000 description 4
- 108090001047 Fibroblast growth factor 10 Proteins 0.000 description 4
- 102000003974 Fibroblast growth factor 2 Human genes 0.000 description 4
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 4
- 102000003967 Fibroblast growth factor 5 Human genes 0.000 description 4
- 108090000380 Fibroblast growth factor 5 Proteins 0.000 description 4
- 102000003745 Hepatocyte Growth Factor Human genes 0.000 description 4
- 108090000100 Hepatocyte Growth Factor Proteins 0.000 description 4
- 101000599951 Homo sapiens Insulin-like growth factor I Proteins 0.000 description 4
- 101001076292 Homo sapiens Insulin-like growth factor II Proteins 0.000 description 4
- 102000002265 Human Growth Hormone Human genes 0.000 description 4
- 108010000521 Human Growth Hormone Proteins 0.000 description 4
- 239000000854 Human Growth Hormone Substances 0.000 description 4
- 102100037852 Insulin-like growth factor I Human genes 0.000 description 4
- 102100025947 Insulin-like growth factor II Human genes 0.000 description 4
- 102000004371 Insulin-like growth factor binding protein 5 Human genes 0.000 description 4
- 108090000961 Insulin-like growth factor binding protein 5 Proteins 0.000 description 4
- 102100031413 L-dopachrome tautomerase Human genes 0.000 description 4
- 101710093778 L-dopachrome tautomerase Proteins 0.000 description 4
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 4
- 206010028561 Myeloid metaplasia Diseases 0.000 description 4
- 208000022873 Ocular disease Diseases 0.000 description 4
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 4
- 229930182555 Penicillin Natural products 0.000 description 4
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 4
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 description 4
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 description 4
- 201000004681 Psoriasis Diseases 0.000 description 4
- 108091028664 Ribonucleotide Proteins 0.000 description 4
- 108020004459 Small interfering RNA Proteins 0.000 description 4
- 238000010459 TALEN Methods 0.000 description 4
- 102000002933 Thioredoxin Human genes 0.000 description 4
- 108010009583 Transforming Growth Factors Proteins 0.000 description 4
- 102000009618 Transforming Growth Factors Human genes 0.000 description 4
- 108020000999 Viral RNA Proteins 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 208000035269 cancer or benign tumor Diseases 0.000 description 4
- 230000004663 cell proliferation Effects 0.000 description 4
- 201000006815 congenital muscular dystrophy Diseases 0.000 description 4
- 210000000805 cytoplasm Anatomy 0.000 description 4
- GYOZYWVXFNDGLU-XLPZGREQSA-N dTMP Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)C1 GYOZYWVXFNDGLU-XLPZGREQSA-N 0.000 description 4
- 239000005547 deoxyribonucleotide Substances 0.000 description 4
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 4
- 208000002169 ectodermal dysplasia Diseases 0.000 description 4
- 239000012894 fetal calf serum Substances 0.000 description 4
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 4
- 238000001415 gene therapy Methods 0.000 description 4
- 208000014951 hematologic disease Diseases 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 230000001976 improved effect Effects 0.000 description 4
- 230000006872 improvement Effects 0.000 description 4
- 230000006698 induction Effects 0.000 description 4
- 230000001939 inductive effect Effects 0.000 description 4
- 229940068935 insulin-like growth factor 2 Drugs 0.000 description 4
- 208000014018 liver neoplasm Diseases 0.000 description 4
- 239000002105 nanoparticle Substances 0.000 description 4
- 102000045246 noggin Human genes 0.000 description 4
- 108700007229 noggin Proteins 0.000 description 4
- 210000004940 nucleus Anatomy 0.000 description 4
- 201000002528 pancreatic cancer Diseases 0.000 description 4
- 230000001717 pathogenic effect Effects 0.000 description 4
- 229940049954 penicillin Drugs 0.000 description 4
- 230000002265 prevention Effects 0.000 description 4
- 239000002336 ribonucleotide Substances 0.000 description 4
- 125000002652 ribonucleotide group Chemical group 0.000 description 4
- 208000017520 skin disease Diseases 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 201000008205 supratentorial primitive neuroectodermal tumor Diseases 0.000 description 4
- 230000009885 systemic effect Effects 0.000 description 4
- 108060008226 thioredoxin Proteins 0.000 description 4
- 229940094937 thioredoxin Drugs 0.000 description 4
- 230000035897 transcription Effects 0.000 description 4
- 238000013518 transcription Methods 0.000 description 4
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 3
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 3
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 3
- 241001664176 Alpharetrovirus Species 0.000 description 3
- 108020005544 Antisense RNA Proteins 0.000 description 3
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 3
- 206010004593 Bile duct cancer Diseases 0.000 description 3
- 241001678559 COVID-19 virus Species 0.000 description 3
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 3
- 206010009944 Colon cancer Diseases 0.000 description 3
- 108020004635 Complementary DNA Proteins 0.000 description 3
- 206010010452 Congenital ectodermal dysplasia Diseases 0.000 description 3
- 206010010741 Conjunctivitis Diseases 0.000 description 3
- 206010014967 Ependymoma Diseases 0.000 description 3
- 102400001368 Epidermal growth factor Human genes 0.000 description 3
- 101800003838 Epidermal growth factor Proteins 0.000 description 3
- 241001663878 Epsilonretrovirus Species 0.000 description 3
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 3
- 208000032612 Glial tumor Diseases 0.000 description 3
- 206010018338 Glioma Diseases 0.000 description 3
- 102000003886 Glycoproteins Human genes 0.000 description 3
- 108090000288 Glycoproteins Proteins 0.000 description 3
- 108010050754 Halorhodopsins Proteins 0.000 description 3
- 101000883515 Homo sapiens Chitinase-3-like protein 1 Proteins 0.000 description 3
- 208000008839 Kidney Neoplasms Diseases 0.000 description 3
- 208000002569 Machado-Joseph Disease Diseases 0.000 description 3
- 208000001344 Macular Edema Diseases 0.000 description 3
- 241000699670 Mus sp. Species 0.000 description 3
- 208000021642 Muscular disease Diseases 0.000 description 3
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 3
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 3
- 201000009623 Myopathy Diseases 0.000 description 3
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 3
- 206010038389 Renal cancer Diseases 0.000 description 3
- 206010039491 Sarcoma Diseases 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 208000036834 Spinocerebellar ataxia type 3 Diseases 0.000 description 3
- 208000005718 Stomach Neoplasms Diseases 0.000 description 3
- 241000711975 Vesicular stomatitis virus Species 0.000 description 3
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 3
- 230000001154 acute effect Effects 0.000 description 3
- 230000002411 adverse Effects 0.000 description 3
- 239000013566 allergen Substances 0.000 description 3
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 description 3
- 210000004102 animal cell Anatomy 0.000 description 3
- 238000010804 cDNA synthesis Methods 0.000 description 3
- BQRGNLJZBFXNCZ-UHFFFAOYSA-N calcein am Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC(CN(CC(=O)OCOC(C)=O)CC(=O)OCOC(C)=O)=C(OC(C)=O)C=C1OC1=C2C=C(CN(CC(=O)OCOC(C)=O)CC(=O)OCOC(=O)C)C(OC(C)=O)=C1 BQRGNLJZBFXNCZ-UHFFFAOYSA-N 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 230000001684 chronic effect Effects 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 230000002500 effect on skin Effects 0.000 description 3
- 229940116977 epidermal growth factor Drugs 0.000 description 3
- 210000002919 epithelial cell Anatomy 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 206010017758 gastric cancer Diseases 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 201000004502 glycogen storage disease II Diseases 0.000 description 3
- 239000003102 growth factor Substances 0.000 description 3
- 230000003779 hair growth Effects 0.000 description 3
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 3
- 102000054350 human CHI3L1 Human genes 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 238000007918 intramuscular administration Methods 0.000 description 3
- 238000007912 intraperitoneal administration Methods 0.000 description 3
- 201000010982 kidney cancer Diseases 0.000 description 3
- 208000032839 leukemia Diseases 0.000 description 3
- 208000002780 macular degeneration Diseases 0.000 description 3
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 230000035772 mutation Effects 0.000 description 3
- 201000005962 mycosis fungoides Diseases 0.000 description 3
- 230000004770 neurodegeneration Effects 0.000 description 3
- 208000015122 neurodegenerative disease Diseases 0.000 description 3
- 208000018360 neuromuscular disease Diseases 0.000 description 3
- 208000008443 pancreatic carcinoma Diseases 0.000 description 3
- 229920000642 polymer Polymers 0.000 description 3
- 230000035935 pregnancy Effects 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 235000002639 sodium chloride Nutrition 0.000 description 3
- 201000011549 stomach cancer Diseases 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 230000009261 transgenic effect Effects 0.000 description 3
- 230000014616 translation Effects 0.000 description 3
- 238000002255 vaccination Methods 0.000 description 3
- KHWCHTKSEGGWEX-RRKCRQDMSA-N 2'-deoxyadenosine 5'-monophosphate Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(O)=O)O1 KHWCHTKSEGGWEX-RRKCRQDMSA-N 0.000 description 2
- NCMVOABPESMRCP-SHYZEUOFSA-N 2'-deoxycytosine 5'-monophosphate Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)C1 NCMVOABPESMRCP-SHYZEUOFSA-N 0.000 description 2
- LTFMZDNNPPEQNG-KVQBGUIXSA-N 2'-deoxyguanosine 5'-monophosphate Chemical compound C1=2NC(N)=NC(=O)C=2N=CN1[C@H]1C[C@H](O)[C@@H](COP(O)(O)=O)O1 LTFMZDNNPPEQNG-KVQBGUIXSA-N 0.000 description 2
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 2
- LKKMLIBUAXYLOY-UHFFFAOYSA-N 3-Amino-1-methyl-5H-pyrido[4,3-b]indole Chemical compound N1C2=CC=CC=C2C2=C1C=C(N)N=C2C LKKMLIBUAXYLOY-UHFFFAOYSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- WOVKYSAHUYNSMH-RRKCRQDMSA-N 5-bromodeoxyuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(Br)=C1 WOVKYSAHUYNSMH-RRKCRQDMSA-N 0.000 description 2
- 206010001233 Adenoma benign Diseases 0.000 description 2
- 102000010735 Adenomatous polyposis coli protein Human genes 0.000 description 2
- 108010038310 Adenomatous polyposis coli protein Proteins 0.000 description 2
- 102100032187 Androgen receptor Human genes 0.000 description 2
- 206010003571 Astrocytoma Diseases 0.000 description 2
- 206010060971 Astrocytoma malignant Diseases 0.000 description 2
- 102000007371 Ataxin-3 Human genes 0.000 description 2
- 108010032947 Ataxin-3 Proteins 0.000 description 2
- 102000004321 Atrophin-1 Human genes 0.000 description 2
- 108090000806 Atrophin-1 Proteins 0.000 description 2
- 241000711404 Avian avulavirus 1 Species 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 206010005949 Bone cancer Diseases 0.000 description 2
- 208000018084 Bone neoplasm Diseases 0.000 description 2
- 208000029402 Bulbospinal muscular atrophy Diseases 0.000 description 2
- 238000011746 C57BL/6J (JAX™ mouse strain) Methods 0.000 description 2
- 108010022366 Carcinoembryonic Antigen Proteins 0.000 description 2
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 description 2
- 206010007279 Carcinoid tumour of the gastrointestinal tract Diseases 0.000 description 2
- 208000031229 Cardiomyopathies Diseases 0.000 description 2
- 108090000994 Catalytic RNA Proteins 0.000 description 2
- 102000053642 Catalytic RNA Human genes 0.000 description 2
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 2
- 206010007953 Central nervous system lymphoma Diseases 0.000 description 2
- 201000003728 Centronuclear myopathy Diseases 0.000 description 2
- 108010009685 Cholinergic Receptors Proteins 0.000 description 2
- 208000005590 Choroidal Neovascularization Diseases 0.000 description 2
- 206010060823 Choroidal neovascularisation Diseases 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 102000000503 Collagen Type II Human genes 0.000 description 2
- 108010041390 Collagen Type II Proteins 0.000 description 2
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 2
- 206010010356 Congenital anomaly Diseases 0.000 description 2
- 206010055665 Corneal neovascularisation Diseases 0.000 description 2
- 241000711573 Coronaviridae Species 0.000 description 2
- 206010058202 Cystoid macular oedema Diseases 0.000 description 2
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 2
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 2
- 241000725619 Dengue virus Species 0.000 description 2
- 201000008163 Dentatorubral pallidoluysian atrophy Diseases 0.000 description 2
- 206010012442 Dermatitis contact Diseases 0.000 description 2
- 208000002699 Digestive System Neoplasms Diseases 0.000 description 2
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 2
- 206010013801 Duchenne Muscular Dystrophy Diseases 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 241000206602 Eukaryota Species 0.000 description 2
- 208000006168 Ewing Sarcoma Diseases 0.000 description 2
- 208000028506 Familial Exudative Vitreoretinopathies Diseases 0.000 description 2
- 102100040578 G antigen 7 Human genes 0.000 description 2
- 241000287828 Gallus gallus Species 0.000 description 2
- 208000008069 Geographic Atrophy Diseases 0.000 description 2
- 101000930822 Giardia intestinalis Dipeptidyl-peptidase 4 Proteins 0.000 description 2
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 208000032007 Glycogen storage disease due to acid maltase deficiency Diseases 0.000 description 2
- 208000032008 Glycogen storage disease due to glycogen debranching enzyme deficiency Diseases 0.000 description 2
- 208000032000 Glycogen storage disease due to muscle glycogen phosphorylase deficiency Diseases 0.000 description 2
- 206010053185 Glycogen storage disease type II Diseases 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 2
- 239000007995 HEPES buffer Substances 0.000 description 2
- 241000711549 Hepacivirus C Species 0.000 description 2
- 241000700721 Hepatitis B virus Species 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 201000002563 Histoplasmosis Diseases 0.000 description 2
- 208000017604 Hodgkin disease Diseases 0.000 description 2
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 2
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 2
- 101000775732 Homo sapiens Androgen receptor Proteins 0.000 description 2
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 description 2
- 101000893968 Homo sapiens G antigen 7 Proteins 0.000 description 2
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 2
- 101000628949 Homo sapiens Mitogen-activated protein kinase 10 Proteins 0.000 description 2
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 2
- 208000032177 Intestinal Polyps Diseases 0.000 description 2
- 206010061252 Intraocular melanoma Diseases 0.000 description 2
- 206010024380 Leukoderma Diseases 0.000 description 2
- 206010025323 Lymphomas Diseases 0.000 description 2
- 101710119980 Macrophage migration inhibitory factor Proteins 0.000 description 2
- 101710104939 Macrophage migration inhibitory factor homolog Proteins 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 241000712079 Measles morbillivirus Species 0.000 description 2
- 208000000172 Medulloblastoma Diseases 0.000 description 2
- 108700011259 MicroRNAs Proteins 0.000 description 2
- 208000025370 Middle East respiratory syndrome Diseases 0.000 description 2
- 102100026931 Mitogen-activated protein kinase 10 Human genes 0.000 description 2
- 208000026072 Motor neurone disease Diseases 0.000 description 2
- 208000034578 Multiple myelomas Diseases 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 108010000123 Myelin-Oligodendrocyte Glycoprotein Proteins 0.000 description 2
- 102100023302 Myelin-oligodendrocyte glycoprotein Human genes 0.000 description 2
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 2
- 102100035077 Myoblast determination protein 1 Human genes 0.000 description 2
- 101710133598 Myoblast determination protein 1 Proteins 0.000 description 2
- 208000010316 Myotonia congenita Diseases 0.000 description 2
- 206010068871 Myotonic dystrophy Diseases 0.000 description 2
- 241000894753 Natronomonas Species 0.000 description 2
- 208000034176 Neoplasms, Germ Cell and Embryonal Diseases 0.000 description 2
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 2
- 102000019040 Nuclear Antigens Human genes 0.000 description 2
- 108010051791 Nuclear Antigens Proteins 0.000 description 2
- 101710163270 Nuclease Proteins 0.000 description 2
- 241000712464 Orthomyxoviridae Species 0.000 description 2
- 206010033128 Ovarian cancer Diseases 0.000 description 2
- 206010061535 Ovarian neoplasm Diseases 0.000 description 2
- 206010061332 Paraganglion neoplasm Diseases 0.000 description 2
- 208000030852 Parasitic disease Diseases 0.000 description 2
- 208000000821 Parathyroid Neoplasms Diseases 0.000 description 2
- 208000007641 Pinealoma Diseases 0.000 description 2
- 208000007913 Pituitary Neoplasms Diseases 0.000 description 2
- 108091007412 Piwi-interacting RNA Proteins 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 208000033063 Progressive myoclonic epilepsy Diseases 0.000 description 2
- 206010060862 Prostate cancer Diseases 0.000 description 2
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 2
- 102100038358 Prostate-specific antigen Human genes 0.000 description 2
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 2
- 108010029485 Protein Isoforms Proteins 0.000 description 2
- 102000001708 Protein Isoforms Human genes 0.000 description 2
- 229940096437 Protein S Drugs 0.000 description 2
- 206010037575 Pustular psoriasis Diseases 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 102000018120 Recombinases Human genes 0.000 description 2
- 108010091086 Recombinases Proteins 0.000 description 2
- 241000725643 Respiratory syncytial virus Species 0.000 description 2
- 208000004453 Retinal Dysplasia Diseases 0.000 description 2
- 208000007135 Retinal Neovascularization Diseases 0.000 description 2
- 208000007014 Retinitis pigmentosa Diseases 0.000 description 2
- 201000000582 Retinoblastoma Diseases 0.000 description 2
- 206010038923 Retinopathy Diseases 0.000 description 2
- 241000711931 Rhabdoviridae Species 0.000 description 2
- 241000710799 Rubella virus Species 0.000 description 2
- 206010048810 Sebaceous hyperplasia Diseases 0.000 description 2
- 241000961587 Secoviridae Species 0.000 description 2
- 208000000453 Skin Neoplasms Diseases 0.000 description 2
- 108091007415 Small Cajal body-specific RNA Proteins 0.000 description 2
- 102000039471 Small Nuclear RNA Human genes 0.000 description 2
- 108020003224 Small Nucleolar RNA Proteins 0.000 description 2
- 102000042773 Small Nucleolar RNA Human genes 0.000 description 2
- 206010041067 Small cell lung cancer Diseases 0.000 description 2
- 108091027967 Small hairpin RNA Proteins 0.000 description 2
- 101710198474 Spike protein Proteins 0.000 description 2
- 208000032978 Structural Congenital Myopathies Diseases 0.000 description 2
- 108091046869 Telomeric non-coding RNA Proteins 0.000 description 2
- 201000009365 Thymic carcinoma Diseases 0.000 description 2
- 208000024770 Thyroid neoplasm Diseases 0.000 description 2
- 108091028113 Trans-activating crRNA Proteins 0.000 description 2
- 108091023040 Transcription factor Proteins 0.000 description 2
- 102000040945 Transcription factor Human genes 0.000 description 2
- 208000023915 Ureteral Neoplasms Diseases 0.000 description 2
- 206010046392 Ureteric cancer Diseases 0.000 description 2
- DJJCXFVJDGTHFX-UHFFFAOYSA-N Uridinemonophosphate Natural products OC1C(O)C(COP(O)(O)=O)OC1N1C(=O)NC(=O)C=C1 DJJCXFVJDGTHFX-UHFFFAOYSA-N 0.000 description 2
- 201000005969 Uveal melanoma Diseases 0.000 description 2
- 206010046851 Uveitis Diseases 0.000 description 2
- 108091093126 WHP Posttrascriptional Response Element Proteins 0.000 description 2
- 208000027418 Wounds and injury Diseases 0.000 description 2
- 208000006269 X-Linked Bulbo-Spinal Atrophy Diseases 0.000 description 2
- 108010017070 Zinc Finger Nucleases Proteins 0.000 description 2
- FHHZHGZBHYYWTG-INFSMZHSSA-N [(2r,3s,4r,5r)-5-(2-amino-7-methyl-6-oxo-3h-purin-9-ium-9-yl)-3,4-dihydroxyoxolan-2-yl]methyl [[[(2r,3s,4r,5r)-5-(2-amino-6-oxo-3h-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-hydroxyphosphoryl] phosphate Chemical group N1C(N)=NC(=O)C2=C1[N+]([C@H]1[C@@H]([C@H](O)[C@@H](COP([O-])(=O)OP(O)(=O)OP(O)(=O)OC[C@@H]3[C@H]([C@@H](O)[C@@H](O3)N3C4=C(C(N=C(N)N4)=O)N=C3)O)O1)O)=CN2C FHHZHGZBHYYWTG-INFSMZHSSA-N 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- 102000034337 acetylcholine receptors Human genes 0.000 description 2
- 208000009956 adenocarcinoma Diseases 0.000 description 2
- 230000000172 allergic effect Effects 0.000 description 2
- 108020004166 alternative oxidase Proteins 0.000 description 2
- 150000001413 amino acids Chemical class 0.000 description 2
- 239000002269 analeptic agent Substances 0.000 description 2
- 208000007502 anemia Diseases 0.000 description 2
- 239000002870 angiogenesis inducing agent Substances 0.000 description 2
- 210000004436 artificial bacterial chromosome Anatomy 0.000 description 2
- 208000010668 atopic eczema Diseases 0.000 description 2
- 230000003115 biocidal effect Effects 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 208000002458 carcinoid tumor Diseases 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 125000002091 cationic group Chemical group 0.000 description 2
- 238000001516 cell proliferation assay Methods 0.000 description 2
- 238000002659 cell therapy Methods 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 201000007335 cerebellar astrocytoma Diseases 0.000 description 2
- 206010072757 chronic spontaneous urticaria Diseases 0.000 description 2
- 208000024376 chronic urticaria Diseases 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 230000001276 controlling effect Effects 0.000 description 2
- 201000000159 corneal neovascularization Diseases 0.000 description 2
- 201000010206 cystoid macular edema Diseases 0.000 description 2
- IERHLVCPSMICTF-XVFCMESISA-N cytidine 5'-monophosphate Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](COP(O)(O)=O)O1 IERHLVCPSMICTF-XVFCMESISA-N 0.000 description 2
- IERHLVCPSMICTF-UHFFFAOYSA-N cytidine monophosphate Natural products O=C1N=C(N)C=CN1C1C(O)C(O)C(COP(O)(O)=O)O1 IERHLVCPSMICTF-UHFFFAOYSA-N 0.000 description 2
- 230000007812 deficiency Effects 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 201000001981 dermatomyositis Diseases 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 108700004025 env Genes Proteins 0.000 description 2
- 230000007613 environmental effect Effects 0.000 description 2
- 210000001808 exosome Anatomy 0.000 description 2
- 201000008819 extrahepatic bile duct carcinoma Diseases 0.000 description 2
- 201000006902 exudative vitreoretinopathy Diseases 0.000 description 2
- 208000024519 eye neoplasm Diseases 0.000 description 2
- 201000010103 fibrous dysplasia Diseases 0.000 description 2
- 238000000684 flow cytometry Methods 0.000 description 2
- 108700004026 gag Genes Proteins 0.000 description 2
- 230000001738 genotoxic effect Effects 0.000 description 2
- 201000007116 gestational trophoblastic neoplasm Diseases 0.000 description 2
- 210000004907 gland Anatomy 0.000 description 2
- 208000007345 glycogen storage disease Diseases 0.000 description 2
- 201000004543 glycogen storage disease III Diseases 0.000 description 2
- 201000004534 glycogen storage disease V Diseases 0.000 description 2
- 201000009339 glycogen storage disease VII Diseases 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- RQFCJASXJCIDSX-UUOKFMHZSA-N guanosine 5'-monophosphate Chemical compound C1=2NC(N)=NC(=O)C=2N=CN1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]1O RQFCJASXJCIDSX-UUOKFMHZSA-N 0.000 description 2
- 235000013928 guanylic acid Nutrition 0.000 description 2
- 201000009277 hairy cell leukemia Diseases 0.000 description 2
- 201000010536 head and neck cancer Diseases 0.000 description 2
- 208000014829 head and neck neoplasm Diseases 0.000 description 2
- 201000003535 hypohidrotic ectodermal dysplasia Diseases 0.000 description 2
- 208000035128 hypohidrotic/hair/tooth type autosomal recessive ectodermal dysplasia 10B Diseases 0.000 description 2
- 208000032771 hypohidrotic/hair/tooth type autosomal recessive ectodermal dysplasia 11B Diseases 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 201000008319 inclusion body myositis Diseases 0.000 description 2
- 230000002757 inflammatory effect Effects 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 239000007928 intraperitoneal injection Substances 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 210000004153 islets of langerhan Anatomy 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 201000007270 liver cancer Diseases 0.000 description 2
- 206010025135 lupus erythematosus Diseases 0.000 description 2
- 208000006178 malignant mesothelioma Diseases 0.000 description 2
- 208000037970 metastatic squamous neck cancer Diseases 0.000 description 2
- 208000005264 motor neuron disease Diseases 0.000 description 2
- 201000009340 myotonic dystrophy type 1 Diseases 0.000 description 2
- 210000000282 nail Anatomy 0.000 description 2
- 208000018795 nasal cavity and paranasal sinus carcinoma Diseases 0.000 description 2
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 2
- 201000008106 ocular cancer Diseases 0.000 description 2
- 201000002575 ocular melanoma Diseases 0.000 description 2
- 210000000287 oocyte Anatomy 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 201000001937 osteoporosis-pseudoglioma syndrome Diseases 0.000 description 2
- 208000007312 paraganglioma Diseases 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 208000010916 pituitary tumor Diseases 0.000 description 2
- 208000010626 plasma cell neoplasm Diseases 0.000 description 2
- 108700004029 pol Genes Proteins 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 208000016800 primary central nervous system lymphoma Diseases 0.000 description 2
- 230000001566 pro-viral effect Effects 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 230000002062 proliferating effect Effects 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 108091092562 ribozyme Proteins 0.000 description 2
- 238000005070 sampling Methods 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 201000000849 skin cancer Diseases 0.000 description 2
- 201000008261 skin carcinoma Diseases 0.000 description 2
- 208000000587 small cell lung carcinoma Diseases 0.000 description 2
- 108091029842 small nuclear ribonucleic acid Proteins 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 208000002320 spinal muscular atrophy Diseases 0.000 description 2
- 230000010473 stable expression Effects 0.000 description 2
- 210000000130 stem cell Anatomy 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000013589 supplement Substances 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- 108010057210 telomerase RNA Proteins 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- 201000011294 ureter cancer Diseases 0.000 description 2
- DJJCXFVJDGTHFX-XVFCMESISA-N uridine 5'-monophosphate Chemical compound O[C@@H]1[C@H](O)[C@@H](COP(O)(O)=O)O[C@H]1N1C(=O)NC(=O)C=C1 DJJCXFVJDGTHFX-XVFCMESISA-N 0.000 description 2
- SSOORFWOBGFTHL-OTEJMHTDSA-N (4S)-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[2-[(2S)-2-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-5-carbamimidamido-1-[[(2S)-5-carbamimidamido-1-[[(1S)-4-carbamimidamido-1-carboxybutyl]amino]-1-oxopentan-2-yl]amino]-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxohexan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]carbamoyl]pyrrolidin-1-yl]-2-oxoethyl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-[[(2S)-2-[[(2S)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino]-5-oxopentanoic acid Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O SSOORFWOBGFTHL-OTEJMHTDSA-N 0.000 description 1
- WEYNBWVKOYCCQT-UHFFFAOYSA-N 1-(3-chloro-4-methylphenyl)-3-{2-[({5-[(dimethylamino)methyl]-2-furyl}methyl)thio]ethyl}urea Chemical compound O1C(CN(C)C)=CC=C1CSCCNC(=O)NC1=CC=C(C)C(Cl)=C1 WEYNBWVKOYCCQT-UHFFFAOYSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- CHHHXKFHOYLYRE-UHFFFAOYSA-M 2,4-Hexadienoic acid, potassium salt (1:1), (2E,4E)- Chemical compound [K+].CC=CC=CC([O-])=O CHHHXKFHOYLYRE-UHFFFAOYSA-M 0.000 description 1
- KISWVXRQTGLFGD-UHFFFAOYSA-N 2-[[2-[[6-amino-2-[[2-[[2-[[5-amino-2-[[2-[[1-[2-[[6-amino-2-[(2,5-diamino-5-oxopentanoyl)amino]hexanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxypropanoyl]amino]-5-oxopentanoyl]amino]-5-(diaminomethylideneamino)p Chemical compound C1CCN(C(=O)C(CCCN=C(N)N)NC(=O)C(CCCCN)NC(=O)C(N)CCC(N)=O)C1C(=O)NC(CO)C(=O)NC(CCC(N)=O)C(=O)NC(CCCN=C(N)N)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(C(=O)NC(CC(C)C)C(O)=O)CC1=CC=C(O)C=C1 KISWVXRQTGLFGD-UHFFFAOYSA-N 0.000 description 1
- 101710169336 5'-deoxyadenosine deaminase Proteins 0.000 description 1
- 108091034151 7SK RNA Proteins 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 208000002008 AIDS-Related Lymphoma Diseases 0.000 description 1
- 208000010400 APUDoma Diseases 0.000 description 1
- 208000002874 Acne Vulgaris Diseases 0.000 description 1
- 206010000748 Acute febrile neutrophilic dermatosis Diseases 0.000 description 1
- 208000036762 Acute promyelocytic leukaemia Diseases 0.000 description 1
- 208000000583 Adenolymphoma Diseases 0.000 description 1
- 208000003200 Adenoma Diseases 0.000 description 1
- 208000002016 Adenosine monophosphate deaminase deficiency Diseases 0.000 description 1
- 101710137115 Adenylyl cyclase-associated protein 1 Proteins 0.000 description 1
- 102100021879 Adenylyl cyclase-associated protein 2 Human genes 0.000 description 1
- 101710137132 Adenylyl cyclase-associated protein 2 Proteins 0.000 description 1
- 206010061588 Adrenal neoplasm Diseases 0.000 description 1
- 208000005676 Adrenogenital syndrome Diseases 0.000 description 1
- 108700028369 Alleles Proteins 0.000 description 1
- 201000004384 Alopecia Diseases 0.000 description 1
- 102000003730 Alpha-catenin Human genes 0.000 description 1
- 108090000020 Alpha-catenin Proteins 0.000 description 1
- 102100023635 Alpha-fetoprotein Human genes 0.000 description 1
- 241000839461 Alphaendornavirus Species 0.000 description 1
- 241000961634 Alphaflexiviridae Species 0.000 description 1
- 208000024827 Alzheimer disease Diseases 0.000 description 1
- 102000052866 Amino Acyl-tRNA Synthetases Human genes 0.000 description 1
- 108700028939 Amino Acyl-tRNA Synthetases Proteins 0.000 description 1
- 206010002091 Anaesthesia Diseases 0.000 description 1
- 206010061424 Anal cancer Diseases 0.000 description 1
- 208000007195 Andersen Syndrome Diseases 0.000 description 1
- 201000006060 Andersen-Tawil syndrome Diseases 0.000 description 1
- 206010002329 Aneurysm Diseases 0.000 description 1
- 206010002383 Angina Pectoris Diseases 0.000 description 1
- 208000005034 Angiolymphoid Hyperplasia with Eosinophilia Diseases 0.000 description 1
- 201000003076 Angiosarcoma Diseases 0.000 description 1
- 208000001454 Anhidrotic Ectodermal Dysplasia 1 Diseases 0.000 description 1
- 208000007860 Anus Neoplasms Diseases 0.000 description 1
- 101100504181 Arabidopsis thaliana GCS1 gene Proteins 0.000 description 1
- 244000105624 Arachis hypogaea Species 0.000 description 1
- 241000180579 Arca Species 0.000 description 1
- 241000203069 Archaea Species 0.000 description 1
- 241000712892 Arenaviridae Species 0.000 description 1
- 200000000007 Arterial disease Diseases 0.000 description 1
- 241001292006 Arteriviridae Species 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 241001533362 Astroviridae Species 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 241000700663 Avipoxvirus Species 0.000 description 1
- 102100035526 B melanoma antigen 1 Human genes 0.000 description 1
- 208000004736 B-Cell Leukemia Diseases 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000003950 B-cell lymphoma Diseases 0.000 description 1
- 108010074708 B7-H1 Antigen Proteins 0.000 description 1
- WOVKYSAHUYNSMH-UHFFFAOYSA-N BROMODEOXYURIDINE Natural products C1C(O)C(CO)OC1N1C(=O)NC(=O)C(Br)=C1 WOVKYSAHUYNSMH-UHFFFAOYSA-N 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 108091032955 Bacterial small RNA Proteins 0.000 description 1
- 241001533460 Barnaviridae Species 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 201000006935 Becker muscular dystrophy Diseases 0.000 description 1
- 206010061692 Benign muscle neoplasm Diseases 0.000 description 1
- 206010004446 Benign prostatic hyperplasia Diseases 0.000 description 1
- 208000035821 Benign schwannoma Diseases 0.000 description 1
- 241001279892 Benyvirus Species 0.000 description 1
- 102000015735 Beta-catenin Human genes 0.000 description 1
- 108060000903 Beta-catenin Proteins 0.000 description 1
- 208000006304 Bethlem myopathy Diseases 0.000 description 1
- 208000003609 Bile Duct Adenoma Diseases 0.000 description 1
- 241000702628 Birnaviridae Species 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 208000019838 Blood disease Diseases 0.000 description 1
- 241000588807 Bordetella Species 0.000 description 1
- 241000776207 Bornaviridae Species 0.000 description 1
- 241000589968 Borrelia Species 0.000 description 1
- 208000013165 Bowen disease Diseases 0.000 description 1
- 208000019337 Bowen disease of the skin Diseases 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 206010006143 Brain stem glioma Diseases 0.000 description 1
- 102000004219 Brain-derived neurotrophic factor Human genes 0.000 description 1
- 108090000715 Brain-derived neurotrophic factor Proteins 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 241001533462 Bromoviridae Species 0.000 description 1
- 208000003170 Bronchiolo-Alveolar Adenocarcinoma Diseases 0.000 description 1
- 208000002908 Brown-Pearce carcinoma Diseases 0.000 description 1
- 208000011691 Burkitt lymphomas Diseases 0.000 description 1
- 238000010354 CRISPR gene editing Methods 0.000 description 1
- 102000000905 Cadherin Human genes 0.000 description 1
- 108050007957 Cadherin Proteins 0.000 description 1
- 241000714198 Caliciviridae Species 0.000 description 1
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 description 1
- 102100039510 Cancer/testis antigen 2 Human genes 0.000 description 1
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 1
- 241000701931 Canine parvovirus Species 0.000 description 1
- 206010007270 Carcinoid syndrome Diseases 0.000 description 1
- 206010007275 Carcinoid tumour Diseases 0.000 description 1
- 201000000274 Carcinosarcoma Diseases 0.000 description 1
- 206010007559 Cardiac failure congestive Diseases 0.000 description 1
- 241000520666 Carmotetraviridae Species 0.000 description 1
- 206010058892 Carnitine deficiency Diseases 0.000 description 1
- 206010050215 Carnitine palmitoyltransferase deficiency Diseases 0.000 description 1
- 208000005024 Castleman disease Diseases 0.000 description 1
- 208000007389 Cementoma Diseases 0.000 description 1
- 208000015374 Central core disease Diseases 0.000 description 1
- 206010008263 Cervical dysplasia Diseases 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 108010035848 Channelrhodopsins Proteins 0.000 description 1
- 208000010693 Charcot-Marie-Tooth Disease Diseases 0.000 description 1
- 201000006868 Charcot-Marie-Tooth disease type 3 Diseases 0.000 description 1
- 241001218361 Cheravirus Species 0.000 description 1
- 241001502567 Chikungunya virus Species 0.000 description 1
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 description 1
- 241000606161 Chlamydia Species 0.000 description 1
- 206010008642 Cholesteatoma Diseases 0.000 description 1
- 206010008724 Chondroectodermal dysplasia Diseases 0.000 description 1
- 208000005243 Chondrosarcoma Diseases 0.000 description 1
- 201000009047 Chordoma Diseases 0.000 description 1
- 208000016216 Choristoma Diseases 0.000 description 1
- 208000002691 Choroiditis Diseases 0.000 description 1
- 201000000915 Chronic Progressive External Ophthalmoplegia Diseases 0.000 description 1
- 241001060419 Chrysoviridae Species 0.000 description 1
- 108010005939 Ciliary Neurotrophic Factor Proteins 0.000 description 1
- 102100031614 Ciliary neurotrophic factor Human genes 0.000 description 1
- 206010073140 Clear cell sarcoma of soft tissue Diseases 0.000 description 1
- 201000000304 Cleidocranial dysplasia Diseases 0.000 description 1
- 241000973027 Closteroviridae Species 0.000 description 1
- 241000193449 Clostridium tetani Species 0.000 description 1
- 201000007408 Clouston syndrome Diseases 0.000 description 1
- 208000021089 Coats disease Diseases 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 108010022452 Collagen Type I Proteins 0.000 description 1
- 102000012422 Collagen Type I Human genes 0.000 description 1
- 102100033601 Collagen alpha-1(I) chain Human genes 0.000 description 1
- 102100036213 Collagen alpha-2(I) chain Human genes 0.000 description 1
- 206010061045 Colon neoplasm Diseases 0.000 description 1
- 241000702669 Coltivirus Species 0.000 description 1
- 206010010144 Completed suicide Diseases 0.000 description 1
- 208000002330 Congenital Heart Defects Diseases 0.000 description 1
- 208000004117 Congenital Myasthenic Syndromes Diseases 0.000 description 1
- 208000008448 Congenital adrenal hyperplasia Diseases 0.000 description 1
- 206010010719 Conjunctival haemorrhage Diseases 0.000 description 1
- 208000009798 Craniopharyngioma Diseases 0.000 description 1
- 108010051219 Cre recombinase Proteins 0.000 description 1
- 241001337994 Cryptococcus <scale insect> Species 0.000 description 1
- 108010025464 Cyclin-Dependent Kinase 4 Proteins 0.000 description 1
- 102100036252 Cyclin-dependent kinase 4 Human genes 0.000 description 1
- 201000005171 Cystadenoma Diseases 0.000 description 1
- 241000702221 Cystoviridae Species 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 101710088194 Dehydrogenase Proteins 0.000 description 1
- 208000005335 Dentin Dysplasia Diseases 0.000 description 1
- 206010012438 Dermatitis atopic Diseases 0.000 description 1
- 206010012688 Diabetic retinal oedema Diseases 0.000 description 1
- 206010012689 Diabetic retinopathy Diseases 0.000 description 1
- 206010052337 Diastolic dysfunction Diseases 0.000 description 1
- 241000615461 Dicistroviridae Species 0.000 description 1
- 101100216227 Dictyostelium discoideum anapc3 gene Proteins 0.000 description 1
- 108700043208 Dimauro disease Proteins 0.000 description 1
- 208000003556 Dry Eye Syndromes Diseases 0.000 description 1
- 206010013774 Dry eye Diseases 0.000 description 1
- 208000006402 Ductal Carcinoma Diseases 0.000 description 1
- 208000005373 Dyshidrotic Eczema Diseases 0.000 description 1
- 101150029707 ERBB2 gene Proteins 0.000 description 1
- 241001115402 Ebolavirus Species 0.000 description 1
- 208000006586 Ectromelia Diseases 0.000 description 1
- 208000003468 Ehrlich Tumor Carcinoma Diseases 0.000 description 1
- 201000002650 Ellis-van Creveld syndrome Diseases 0.000 description 1
- 206010014522 Embolism venous Diseases 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 102100034239 Emerin Human genes 0.000 description 1
- 201000009344 Emery-Dreifuss muscular dystrophy Diseases 0.000 description 1
- 102100038132 Endogenous retrovirus group K member 6 Pro protein Human genes 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 241000224431 Entamoeba Species 0.000 description 1
- 101800001467 Envelope glycoprotein E2 Proteins 0.000 description 1
- 241000702955 Enzootic nasal tumour virus of goats Species 0.000 description 1
- 206010014989 Epidermolysis bullosa Diseases 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 206010015278 Erythrodermic psoriasis Diseases 0.000 description 1
- 241000588722 Escherichia Species 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 208000012468 Ewing sarcoma/peripheral primitive neuroectodermal tumor Diseases 0.000 description 1
- 108091029865 Exogenous DNA Proteins 0.000 description 1
- 208000005163 Extra-Adrenal Paraganglioma Diseases 0.000 description 1
- 208000017259 Extragonadal germ cell tumor Diseases 0.000 description 1
- 206010015901 Exudative retinopathy Diseases 0.000 description 1
- 208000020564 Eye injury Diseases 0.000 description 1
- 101150095289 FGF7 gene Proteins 0.000 description 1
- 206010067141 Faciodigitogenital dysplasia Diseases 0.000 description 1
- 208000037149 Facioscapulohumeral dystrophy Diseases 0.000 description 1
- 108010080865 Factor XII Proteins 0.000 description 1
- 102000000429 Factor XII Human genes 0.000 description 1
- 241000150358 Feraviridae Species 0.000 description 1
- 108010049003 Fibrinogen Proteins 0.000 description 1
- 102000008946 Fibrinogen Human genes 0.000 description 1
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 1
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 1
- 208000000571 Fibrocystic breast disease Diseases 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- 208000008961 Fibrous Dysplasia of Bone Diseases 0.000 description 1
- 241000711950 Filoviridae Species 0.000 description 1
- 241000150357 Fimoviridae Species 0.000 description 1
- 241001064127 Finkel-Biskis-Jinkins murine sarcoma virus Species 0.000 description 1
- 241000710781 Flaviviridae Species 0.000 description 1
- 208000000901 Focal Epithelial Hyperplasia Diseases 0.000 description 1
- 206010073655 Freeman-Sheldon syndrome Diseases 0.000 description 1
- 208000024412 Friedreich ataxia Diseases 0.000 description 1
- 201000011240 Frontotemporal dementia Diseases 0.000 description 1
- 206010017533 Fungal infection Diseases 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 102100039717 G antigen 1 Human genes 0.000 description 1
- 102100039699 G antigen 4 Human genes 0.000 description 1
- 102100039698 G antigen 5 Human genes 0.000 description 1
- 101710092267 G antigen 5 Proteins 0.000 description 1
- 102100039713 G antigen 6 Human genes 0.000 description 1
- 101710092269 G antigen 6 Proteins 0.000 description 1
- 102000040452 GAGE family Human genes 0.000 description 1
- 108091072337 GAGE family Proteins 0.000 description 1
- 101150066002 GFP gene Proteins 0.000 description 1
- 102100029974 GTPase HRas Human genes 0.000 description 1
- 101710091881 GTPase HRas Proteins 0.000 description 1
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 1
- 102100030525 Gap junction alpha-4 protein Human genes 0.000 description 1
- 241000714171 Gardner-Arnstein feline sarcoma virus Species 0.000 description 1
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 1
- 208000015872 Gaucher disease Diseases 0.000 description 1
- 208000007569 Giant Cell Tumors Diseases 0.000 description 1
- 241000224466 Giardia Species 0.000 description 1
- 208000009693 Gingival Hyperplasia Diseases 0.000 description 1
- 208000010412 Glaucoma Diseases 0.000 description 1
- 108010061711 Gliadin Proteins 0.000 description 1
- 102000034615 Glial cell line-derived neurotrophic factor Human genes 0.000 description 1
- 108091010837 Glial cell line-derived neurotrophic factor Proteins 0.000 description 1
- 201000005618 Glomus Tumor Diseases 0.000 description 1
- 102100031132 Glucose-6-phosphate isomerase Human genes 0.000 description 1
- 108010070600 Glucose-6-phosphate isomerase Proteins 0.000 description 1
- 102100035857 Glutamate decarboxylase 2 Human genes 0.000 description 1
- 102000006587 Glutathione peroxidase Human genes 0.000 description 1
- 108700016172 Glutathione peroxidases Proteins 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102000007390 Glycogen Phosphorylase Human genes 0.000 description 1
- 108010046163 Glycogen Phosphorylase Proteins 0.000 description 1
- 208000031926 Glycogen storage disease due to muscle phosphofructokinase deficiency Diseases 0.000 description 1
- 208000014324 Glycogen storage disease due to phosphorylase kinase deficiency Diseases 0.000 description 1
- 206010053250 Glycogen storage disease type III Diseases 0.000 description 1
- 206010018462 Glycogen storage disease type V Diseases 0.000 description 1
- 201000003200 Goldenhar Syndrome Diseases 0.000 description 1
- 208000005234 Granulosa Cell Tumor Diseases 0.000 description 1
- 208000035773 Gynandroblastoma Diseases 0.000 description 1
- 241000606790 Haemophilus Species 0.000 description 1
- 208000002927 Hamartoma Diseases 0.000 description 1
- 206010058898 Hand dermatitis Diseases 0.000 description 1
- 241000150362 Hantaviridae Species 0.000 description 1
- 241001533465 Hardy-Zuckerman feline sarcoma virus Species 0.000 description 1
- 241000713858 Harvey murine sarcoma virus Species 0.000 description 1
- 206010019280 Heart failures Diseases 0.000 description 1
- 208000002125 Hemangioendothelioma Diseases 0.000 description 1
- 208000006050 Hemangiopericytoma Diseases 0.000 description 1
- 208000001258 Hemangiosarcoma Diseases 0.000 description 1
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 1
- 208000031220 Hemophilia Diseases 0.000 description 1
- 208000009292 Hemophilia A Diseases 0.000 description 1
- 206010019695 Hepatic neoplasm Diseases 0.000 description 1
- 241000724675 Hepatitis E virus Species 0.000 description 1
- 241000709721 Hepatovirus A Species 0.000 description 1
- 241001122120 Hepeviridae Species 0.000 description 1
- 208000006411 Hereditary Sensory and Motor Neuropathy Diseases 0.000 description 1
- 208000031916 Hidrotic ectodermal dysplasia Diseases 0.000 description 1
- 102000006947 Histones Human genes 0.000 description 1
- 108010033040 Histones Proteins 0.000 description 1
- 206010050469 Holt-Oram syndrome Diseases 0.000 description 1
- 101000874316 Homo sapiens B melanoma antigen 1 Proteins 0.000 description 1
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 description 1
- 101000889345 Homo sapiens Cancer/testis antigen 2 Proteins 0.000 description 1
- 101000875067 Homo sapiens Collagen alpha-2(I) chain Proteins 0.000 description 1
- 101001060261 Homo sapiens Fibroblast growth factor 7 Proteins 0.000 description 1
- 101001027380 Homo sapiens Fibroblast growth factor 9 Proteins 0.000 description 1
- 101000886137 Homo sapiens G antigen 1 Proteins 0.000 description 1
- 101000886678 Homo sapiens G antigen 2D Proteins 0.000 description 1
- 101000886136 Homo sapiens G antigen 4 Proteins 0.000 description 1
- 101000873786 Homo sapiens Glutamate decarboxylase 2 Proteins 0.000 description 1
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 1
- 101001139134 Homo sapiens Krueppel-like factor 4 Proteins 0.000 description 1
- 101001057156 Homo sapiens Melanoma-associated antigen C2 Proteins 0.000 description 1
- 101001057159 Homo sapiens Melanoma-associated antigen C3 Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 description 1
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 description 1
- 101001114057 Homo sapiens P antigen family member 1 Proteins 0.000 description 1
- 101000583175 Homo sapiens Prolactin-inducible protein Proteins 0.000 description 1
- 101000880770 Homo sapiens Protein SSX2 Proteins 0.000 description 1
- 101001062222 Homo sapiens Receptor-binding cancer antigen expressed on SiSo cells Proteins 0.000 description 1
- 101000808011 Homo sapiens Vascular endothelial growth factor A Proteins 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 241000713310 Human T-cell lymphotropic virus type 4 Species 0.000 description 1
- 241000714260 Human T-lymphotropic virus 1 Species 0.000 description 1
- 241000714259 Human T-lymphotropic virus 2 Species 0.000 description 1
- 241001136003 Human T-lymphotropic virus 3 Species 0.000 description 1
- 241000700588 Human alphaherpesvirus 1 Species 0.000 description 1
- 241000701074 Human alphaherpesvirus 2 Species 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 101900297506 Human immunodeficiency virus type 1 group M subtype B Reverse transcriptase/ribonuclease H Proteins 0.000 description 1
- 241000701806 Human papillomavirus Species 0.000 description 1
- 241000341655 Human papillomavirus type 16 Species 0.000 description 1
- 101000954519 Human papillomavirus type 18 Protein E6 Proteins 0.000 description 1
- 101000767629 Human papillomavirus type 18 Protein E7 Proteins 0.000 description 1
- 208000023105 Huntington disease Diseases 0.000 description 1
- 208000019758 Hypergammaglobulinemia Diseases 0.000 description 1
- 206010020772 Hypertension Diseases 0.000 description 1
- 206010020880 Hypertrophy Diseases 0.000 description 1
- 206010021042 Hypopharyngeal cancer Diseases 0.000 description 1
- 206010056305 Hypopharyngeal neoplasm Diseases 0.000 description 1
- 241001533448 Hypoviridae Species 0.000 description 1
- 241001533403 Idaeovirus Species 0.000 description 1
- 208000031814 IgA Vasculitis Diseases 0.000 description 1
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 1
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 1
- 108010043496 Immunoglobulin Idiotypes Proteins 0.000 description 1
- 241001481495 Indiana vesiculovirus Species 0.000 description 1
- 241000711450 Infectious bronchitis virus Species 0.000 description 1
- 208000002979 Influenza in Birds Diseases 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 208000005016 Intestinal Neoplasms Diseases 0.000 description 1
- 206010060711 Intravascular papillary endothelial hyperplasia Diseases 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 206010065630 Iris neovascularisation Diseases 0.000 description 1
- PIWKPBJCKXDKJR-UHFFFAOYSA-N Isoflurane Chemical compound FC(F)OC(Cl)C(F)(F)F PIWKPBJCKXDKJR-UHFFFAOYSA-N 0.000 description 1
- 241000150360 Jonviridae Species 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- 208000027747 Kennedy disease Diseases 0.000 description 1
- 208000001126 Keratosis Diseases 0.000 description 1
- 206010066295 Keratosis pilaris Diseases 0.000 description 1
- 241000713863 Kirsten murine sarcoma virus Species 0.000 description 1
- 102100020677 Krueppel-like factor 4 Human genes 0.000 description 1
- 108700006394 Lactate Dehydrogenase Deficiency Proteins 0.000 description 1
- 201000010743 Lambert-Eaton myasthenic syndrome Diseases 0.000 description 1
- 108010085895 Laminin Proteins 0.000 description 1
- 206010023825 Laryngeal cancer Diseases 0.000 description 1
- 241000712902 Lassa mammarenavirus Species 0.000 description 1
- 201000003533 Leber congenital amaurosis Diseases 0.000 description 1
- 208000018142 Leiomyosarcoma Diseases 0.000 description 1
- 241000222722 Leishmania <genus> Species 0.000 description 1
- 241000222727 Leishmania donovani Species 0.000 description 1
- 201000004462 Leydig Cell Tumor Diseases 0.000 description 1
- 206010024503 Limb reduction defect Diseases 0.000 description 1
- 206010024612 Lipoma Diseases 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 208000016604 Lyme disease Diseases 0.000 description 1
- 208000004138 Lymphangiomyoma Diseases 0.000 description 1
- 206010062044 Lymphatic system neoplasm Diseases 0.000 description 1
- 206010025312 Lymphoma AIDS related Diseases 0.000 description 1
- 208000030289 Lymphoproliferative disease Diseases 0.000 description 1
- 102100033448 Lysosomal alpha-glucosidase Human genes 0.000 description 1
- 102000043136 MAP kinase family Human genes 0.000 description 1
- 108091054455 MAP kinase family Proteins 0.000 description 1
- 108010010995 MART-1 Antigen Proteins 0.000 description 1
- 208000012423 MYH7-related skeletal myopathy Diseases 0.000 description 1
- 241001533339 Machlomovirus Species 0.000 description 1
- 206010025415 Macular oedema Diseases 0.000 description 1
- 208000004059 Male Breast Neoplasms Diseases 0.000 description 1
- 208000008095 Malignant Carcinoid Syndrome Diseases 0.000 description 1
- 208000030070 Malignant epithelial tumor of ovary Diseases 0.000 description 1
- 206010025557 Malignant fibrous histiocytoma of bone Diseases 0.000 description 1
- 206010073059 Malignant neoplasm of unknown primary site Diseases 0.000 description 1
- 208000032271 Malignant tumor of penis Diseases 0.000 description 1
- 241001115401 Marburgvirus Species 0.000 description 1
- 241001661687 Marnaviridae Species 0.000 description 1
- 201000001853 McCune-Albright syndrome Diseases 0.000 description 1
- 206010071308 Melanocytic hyperplasia Diseases 0.000 description 1
- 206010027145 Melanocytic naevus Diseases 0.000 description 1
- 102100028389 Melanoma antigen recognized by T-cells 1 Human genes 0.000 description 1
- 102100027252 Melanoma-associated antigen C2 Human genes 0.000 description 1
- 102100027248 Melanoma-associated antigen C3 Human genes 0.000 description 1
- 208000002030 Merkel cell carcinoma Diseases 0.000 description 1
- 208000010153 Mesonephroma Diseases 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- 241001112067 Metaviridae Species 0.000 description 1
- 108010008445 Microbial Rhodopsins Proteins 0.000 description 1
- 201000002169 Mitochondrial myopathy Diseases 0.000 description 1
- 208000003430 Mitral Valve Prolapse Diseases 0.000 description 1
- 208000009376 Miyoshi myopathy Diseases 0.000 description 1
- 241000712045 Morbillivirus Species 0.000 description 1
- 102100034256 Mucin-1 Human genes 0.000 description 1
- 102100023123 Mucin-16 Human genes 0.000 description 1
- 208000010164 Multifocal Choroiditis Diseases 0.000 description 1
- 208000005647 Mumps Diseases 0.000 description 1
- 241000711386 Mumps virus Species 0.000 description 1
- 208000007727 Muscle Tissue Neoplasms Diseases 0.000 description 1
- 206010028424 Myasthenic syndrome Diseases 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 208000031888 Mycoses Diseases 0.000 description 1
- 102000047918 Myelin Basic Human genes 0.000 description 1
- 101710107068 Myelin basic protein Proteins 0.000 description 1
- 102100038610 Myeloperoxidase Human genes 0.000 description 1
- 108090000235 Myeloperoxidases Proteins 0.000 description 1
- 208000014767 Myeloproliferative disease Diseases 0.000 description 1
- 201000007224 Myeloproliferative neoplasm Diseases 0.000 description 1
- 241000456230 Mymonaviridae Species 0.000 description 1
- 208000009525 Myocarditis Diseases 0.000 description 1
- 201000004458 Myoma Diseases 0.000 description 1
- 206010028643 Myopathy endocrine Diseases 0.000 description 1
- 208000005927 Myosarcoma Diseases 0.000 description 1
- 206010028703 Nail psoriasis Diseases 0.000 description 1
- 241000150352 Nairoviridae Species 0.000 description 1
- 241001112477 Narnaviridae Species 0.000 description 1
- 208000001894 Nasopharyngeal Neoplasms Diseases 0.000 description 1
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 1
- 101000903581 Natronomonas pharaonis Halorhodopsin Proteins 0.000 description 1
- 241000588653 Neisseria Species 0.000 description 1
- 208000034965 Nemaline Myopathies Diseases 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 206010029113 Neovascularisation Diseases 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 201000009053 Neurodermatitis Diseases 0.000 description 1
- 206010029266 Neuroendocrine carcinoma of the skin Diseases 0.000 description 1
- 201000004404 Neurofibroma Diseases 0.000 description 1
- 208000009905 Neurofibromatoses Diseases 0.000 description 1
- 208000005890 Neuroma Diseases 0.000 description 1
- 208000007256 Nevus Diseases 0.000 description 1
- 244000061176 Nicotiana tabacum Species 0.000 description 1
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 1
- 241000723741 Nodaviridae Species 0.000 description 1
- 206010051081 Nodular regenerative hyperplasia Diseases 0.000 description 1
- 108090001074 Nucleocapsid Proteins Proteins 0.000 description 1
- 241000439378 Nyamiviridae Species 0.000 description 1
- 206010051934 Oculoauriculovertebral dysplasia Diseases 0.000 description 1
- 208000008909 Oculodentodigital dysplasia Diseases 0.000 description 1
- 201000009110 Oculopharyngeal muscular dystrophy Diseases 0.000 description 1
- 208000004910 Odontodysplasia Diseases 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 206010050171 Oesophageal dysplasia Diseases 0.000 description 1
- 241000922889 Ophioviridae Species 0.000 description 1
- 206010031096 Oropharyngeal cancer Diseases 0.000 description 1
- 206010057444 Oropharyngeal neoplasm Diseases 0.000 description 1
- 241001112506 Ourmiavirus Species 0.000 description 1
- 208000007571 Ovarian Epithelial Carcinoma Diseases 0.000 description 1
- 206010061328 Ovarian epithelial cancer Diseases 0.000 description 1
- 206010033268 Ovarian low malignant potential tumour Diseases 0.000 description 1
- 102100023219 P antigen family member 1 Human genes 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 108060006580 PRAME Proteins 0.000 description 1
- 102000036673 PRAME Human genes 0.000 description 1
- 102100034640 PWWP domain-containing DNA repair factor 3A Human genes 0.000 description 1
- 108050007154 PWWP domain-containing DNA repair factor 3A Proteins 0.000 description 1
- 201000010183 Papilledema Diseases 0.000 description 1
- 206010033712 Papilloedema Diseases 0.000 description 1
- 241000711504 Paramyxoviridae Species 0.000 description 1
- 208000017787 Paraneoplastic neurologic syndrome Diseases 0.000 description 1
- 208000002774 Paraproteinemias Diseases 0.000 description 1
- 208000018737 Parkinson disease Diseases 0.000 description 1
- 241000710936 Partitiviridae Species 0.000 description 1
- 206010073286 Pathologic myopia Diseases 0.000 description 1
- 208000013234 Pearson syndrome Diseases 0.000 description 1
- 206010061336 Pelvic neoplasm Diseases 0.000 description 1
- 206010034277 Pemphigoid Diseases 0.000 description 1
- 241000721454 Pemphigus Species 0.000 description 1
- 208000002471 Penile Neoplasms Diseases 0.000 description 1
- 206010034299 Penile cancer Diseases 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102100040283 Peptidyl-prolyl cis-trans isomerase B Human genes 0.000 description 1
- 241000150350 Peribunyaviridae Species 0.000 description 1
- 208000009675 Perioral Dermatitis Diseases 0.000 description 1
- 201000005702 Pertussis Diseases 0.000 description 1
- 206010057249 Phagocytosis Diseases 0.000 description 1
- 241000150356 Phasmaviridae Species 0.000 description 1
- 241000150354 Phenuiviridae Species 0.000 description 1
- 108700010203 Phosphoglycerate Kinase 1 Deficiency Proteins 0.000 description 1
- 102000009097 Phosphorylases Human genes 0.000 description 1
- 108010073135 Phosphorylases Proteins 0.000 description 1
- 208000002163 Phyllodes Tumor Diseases 0.000 description 1
- 206010071776 Phyllodes tumour Diseases 0.000 description 1
- 241000709664 Picornaviridae Species 0.000 description 1
- 208000007452 Plasmacytoma Diseases 0.000 description 1
- 241000224016 Plasmodium Species 0.000 description 1
- 201000008199 Pleuropulmonary blastoma Diseases 0.000 description 1
- 241000711904 Pneumoviridae Species 0.000 description 1
- 241000209504 Poaceae Species 0.000 description 1
- 208000037062 Polyps Diseases 0.000 description 1
- 206010036229 Post inflammatory pigmentation change Diseases 0.000 description 1
- 208000003971 Posterior uveitis Diseases 0.000 description 1
- 241001533393 Potyviridae Species 0.000 description 1
- 208000009052 Precursor T-Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 1
- 208000024777 Prion disease Diseases 0.000 description 1
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 1
- 206010036802 Progressive external ophthalmoplegia Diseases 0.000 description 1
- 108010076181 Proinsulin Proteins 0.000 description 1
- 102100030350 Prolactin-inducible protein Human genes 0.000 description 1
- 208000033759 Prolymphocytic T-Cell Leukemia Diseases 0.000 description 1
- 208000033826 Promyelocytic Acute Leukemia Diseases 0.000 description 1
- 102000007327 Protamines Human genes 0.000 description 1
- 108010007568 Protamines Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 101710150344 Protein Rev Proteins 0.000 description 1
- 102100037686 Protein SSX2 Human genes 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 108010010974 Proteolipids Proteins 0.000 description 1
- 102000016202 Proteolipids Human genes 0.000 description 1
- 208000032952 Pseudoepitheliomatous hyperplasia Diseases 0.000 description 1
- 241001112091 Pseudoviridae Species 0.000 description 1
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 1
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 1
- 206010037549 Purpura Diseases 0.000 description 1
- 241001672981 Purpura Species 0.000 description 1
- LCTONWCANYUPML-UHFFFAOYSA-M Pyruvate Chemical compound CC(=O)C([O-])=O LCTONWCANYUPML-UHFFFAOYSA-M 0.000 description 1
- 108091008103 RNA aptamers Proteins 0.000 description 1
- 238000011529 RT qPCR Methods 0.000 description 1
- 241000711798 Rabies lyssavirus Species 0.000 description 1
- 101100247004 Rattus norvegicus Qsox1 gene Proteins 0.000 description 1
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 1
- 101710100968 Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 102100029165 Receptor-binding cancer antigen expressed on SiSo cells Human genes 0.000 description 1
- 208000015634 Rectal Neoplasms Diseases 0.000 description 1
- 241000702247 Reoviridae Species 0.000 description 1
- 206010038802 Reticuloendothelial system stimulated Diseases 0.000 description 1
- 208000008709 Retinal Telangiectasis Diseases 0.000 description 1
- 201000007737 Retinal degeneration Diseases 0.000 description 1
- 208000017442 Retinal disease Diseases 0.000 description 1
- 206010038910 Retinitis Diseases 0.000 description 1
- 206010038926 Retinopathy hypertensive Diseases 0.000 description 1
- 206010038933 Retinopathy of prematurity Diseases 0.000 description 1
- 108090000621 Ribonuclease P Proteins 0.000 description 1
- 102000004167 Ribonuclease P Human genes 0.000 description 1
- 102000002278 Ribosomal Proteins Human genes 0.000 description 1
- 108010000605 Ribosomal Proteins Proteins 0.000 description 1
- 241001534527 Roniviridae Species 0.000 description 1
- 241001303601 Rosacea Species 0.000 description 1
- 241000702670 Rotavirus Species 0.000 description 1
- 101150086694 SLC22A3 gene Proteins 0.000 description 1
- 241001596272 Sadwavirus Species 0.000 description 1
- 208000004337 Salivary Gland Neoplasms Diseases 0.000 description 1
- 206010061934 Salivary gland cancer Diseases 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 208000034189 Sclerosis Diseases 0.000 description 1
- 206010039793 Seborrhoeic dermatitis Diseases 0.000 description 1
- 208000003274 Sertoli cell tumor Diseases 0.000 description 1
- 208000002669 Sex Cord-Gonadal Stromal Tumors Diseases 0.000 description 1
- 208000009359 Sezary Syndrome Diseases 0.000 description 1
- 208000021388 Sezary disease Diseases 0.000 description 1
- 101001010097 Shigella phage SfV Bactoprenol-linked glucose translocase Proteins 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 241000525425 Simian T-cell lymphotropic virus 4 Species 0.000 description 1
- 241001466984 Simian T-lymphotropic virus 1 Species 0.000 description 1
- 241000713309 Simian immunodeficiency virus - agm Species 0.000 description 1
- 241000714229 Simian retrovirus 1 Species 0.000 description 1
- 241001529481 Simian retrovirus 2 Species 0.000 description 1
- 108010052160 Site-specific recombinase Proteins 0.000 description 1
- 208000021386 Sjogren Syndrome Diseases 0.000 description 1
- 108091092920 SmY RNA Proteins 0.000 description 1
- 241000714179 Snyder-Theilen feline sarcoma virus Species 0.000 description 1
- 241000710119 Sobemovirus Species 0.000 description 1
- 206010068771 Soft tissue neoplasm Diseases 0.000 description 1
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 1
- 208000000277 Splenic Neoplasms Diseases 0.000 description 1
- 108020003213 Spliced Leader RNA Proteins 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 206010041955 Stasis dermatitis Diseases 0.000 description 1
- 241000194017 Streptococcus Species 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- 238000000692 Student's t-test Methods 0.000 description 1
- 241000489711 Sunviridae Species 0.000 description 1
- 101800001271 Surface protein Proteins 0.000 description 1
- 206010042658 Sweat gland tumour Diseases 0.000 description 1
- 208000010265 Sweet syndrome Diseases 0.000 description 1
- 101710143177 Synaptonemal complex protein 1 Proteins 0.000 description 1
- 102100036234 Synaptonemal complex protein 1 Human genes 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 208000031673 T-Cell Cutaneous Lymphoma Diseases 0.000 description 1
- 208000029052 T-cell acute lymphoblastic leukemia Diseases 0.000 description 1
- 208000026651 T-cell prolymphocytic leukemia Diseases 0.000 description 1
- 102100033082 TNF receptor-associated factor 3 Human genes 0.000 description 1
- 206010043189 Telangiectasia Diseases 0.000 description 1
- 206010043276 Teratoma Diseases 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- 206010043376 Tetanus Diseases 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 208000035954 Thomsen and Becker disease Diseases 0.000 description 1
- 208000009832 Thoracic Neoplasms Diseases 0.000 description 1
- 208000005485 Thrombocytosis Diseases 0.000 description 1
- 208000000728 Thymus Neoplasms Diseases 0.000 description 1
- 102100033504 Thyroglobulin Human genes 0.000 description 1
- 108010034949 Thyroglobulin Proteins 0.000 description 1
- 102100029337 Thyrotropin receptor Human genes 0.000 description 1
- 101710114011 Thyrotropin receptor Proteins 0.000 description 1
- 241000710924 Togaviridae Species 0.000 description 1
- 241001533336 Tombusviridae Species 0.000 description 1
- 241000150367 Tospoviridae Species 0.000 description 1
- 241000710915 Totiviridae Species 0.000 description 1
- 241000223996 Toxoplasma Species 0.000 description 1
- 108010043645 Transcription Activator-Like Effector Nucleases Proteins 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 206010044407 Transitional cell cancer of the renal pelvis and ureter Diseases 0.000 description 1
- 108010020764 Transposases Proteins 0.000 description 1
- 102000008579 Transposases Human genes 0.000 description 1
- 108010030743 Tropomyosin Proteins 0.000 description 1
- 102000005937 Tropomyosin Human genes 0.000 description 1
- 241000223104 Trypanosoma Species 0.000 description 1
- 241001059845 Tymoviridae Species 0.000 description 1
- 102000003425 Tyrosinase Human genes 0.000 description 1
- 108060008724 Tyrosinase Proteins 0.000 description 1
- 201000006814 Ullrich congenital muscular dystrophy Diseases 0.000 description 1
- 241001533358 Umbravirus Species 0.000 description 1
- 206010046431 Urethral cancer Diseases 0.000 description 1
- 206010046458 Urethral neoplasms Diseases 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 206010046751 Urticaria physical Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 208000001445 Uveomeningoencephalitic Syndrome Diseases 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- 206010047115 Vasculitis Diseases 0.000 description 1
- 102000013127 Vimentin Human genes 0.000 description 1
- 108010065472 Vimentin Proteins 0.000 description 1
- 108020005202 Viral DNA Proteins 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 241000961586 Virgaviridae Species 0.000 description 1
- 206010047642 Vitiligo Diseases 0.000 description 1
- 208000025749 Vogt-Koyanagi-Harada disease Diseases 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 208000004354 Vulvar Neoplasms Diseases 0.000 description 1
- 201000006793 Walker-Warburg syndrome Diseases 0.000 description 1
- 208000021146 Warthin tumor Diseases 0.000 description 1
- 241000710886 West Nile virus Species 0.000 description 1
- 208000000208 Wet Macular Degeneration Diseases 0.000 description 1
- 208000008383 Wilms tumor Diseases 0.000 description 1
- 241001492404 Woodchuck hepatitis virus Species 0.000 description 1
- 108091029474 Y RNA Proteins 0.000 description 1
- 241000710772 Yellow fever virus Species 0.000 description 1
- 241000907316 Zika virus Species 0.000 description 1
- 101710185494 Zinc finger protein Proteins 0.000 description 1
- 102100023597 Zinc finger protein 816 Human genes 0.000 description 1
- 210000001015 abdomen Anatomy 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 102000005421 acetyltransferase Human genes 0.000 description 1
- 108020002494 acetyltransferase Proteins 0.000 description 1
- 206010000496 acne Diseases 0.000 description 1
- 208000009621 actinic keratosis Diseases 0.000 description 1
- 201000011186 acute T cell leukemia Diseases 0.000 description 1
- 201000004471 adenofibroma Diseases 0.000 description 1
- UDMBCSSLTHHNCD-KQYNXXCUSA-N adenosine 5'-monophosphate Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]1O UDMBCSSLTHHNCD-KQYNXXCUSA-N 0.000 description 1
- 208000018234 adnexal spiradenoma/cylindroma of a sweat gland Diseases 0.000 description 1
- 208000020990 adrenal cortex carcinoma Diseases 0.000 description 1
- 201000005188 adrenal gland cancer Diseases 0.000 description 1
- 208000024447 adrenal gland neoplasm Diseases 0.000 description 1
- 208000007128 adrenocortical carcinoma Diseases 0.000 description 1
- 208000002029 allergic contact dermatitis Diseases 0.000 description 1
- 208000004631 alopecia areata Diseases 0.000 description 1
- 108010029483 alpha 1 Chain Collagen Type I Proteins 0.000 description 1
- 108010026331 alpha-Fetoproteins Proteins 0.000 description 1
- 229940037003 alum Drugs 0.000 description 1
- PNEYBMLMFCGWSK-UHFFFAOYSA-N aluminium oxide Inorganic materials [O-2].[O-2].[O-2].[Al+3].[Al+3] PNEYBMLMFCGWSK-UHFFFAOYSA-N 0.000 description 1
- CEGOLXSVJUTHNZ-UHFFFAOYSA-K aluminium tristearate Chemical compound [Al+3].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CEGOLXSVJUTHNZ-UHFFFAOYSA-K 0.000 description 1
- 229940063655 aluminum stearate Drugs 0.000 description 1
- 208000010029 ameloblastoma Diseases 0.000 description 1
- 210000001691 amnion Anatomy 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 230000037005 anaesthesia Effects 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 229940035674 anesthetics Drugs 0.000 description 1
- 201000009431 angiokeratoma Diseases 0.000 description 1
- 208000000252 angiomatosis Diseases 0.000 description 1
- 230000001772 anti-angiogenic effect Effects 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000001028 anti-proliverative effect Effects 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 201000011165 anus cancer Diseases 0.000 description 1
- 206010003119 arrhythmia Diseases 0.000 description 1
- 230000006793 arrhythmia Effects 0.000 description 1
- 208000028922 artery disease Diseases 0.000 description 1
- 210000001106 artificial yeast chromosome Anatomy 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 238000003149 assay kit Methods 0.000 description 1
- 201000008937 atopic dermatitis Diseases 0.000 description 1
- 201000003639 autosomal recessive cerebellar ataxia Diseases 0.000 description 1
- 206010064097 avian influenza Diseases 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 210000000270 basal cell Anatomy 0.000 description 1
- 208000003373 basosquamous carcinoma Diseases 0.000 description 1
- 208000001119 benign fibrous histiocytoma Diseases 0.000 description 1
- 208000021592 benign granular cell tumor Diseases 0.000 description 1
- 208000026900 bile duct neoplasm Diseases 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 238000004061 bleaching Methods 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 208000010217 blepharitis Diseases 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 208000012172 borderline epithelial tumor of ovary Diseases 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 208000011803 breast fibrocystic disease Diseases 0.000 description 1
- 206010006475 bronchopulmonary dysplasia Diseases 0.000 description 1
- 201000002143 bronchus adenoma Diseases 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 230000005907 cancer growth Effects 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 208000005761 carcinoid heart disease Diseases 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000022131 cell cycle Effects 0.000 description 1
- 230000012292 cell migration Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 201000007303 central core myopathy Diseases 0.000 description 1
- 208000025997 central nervous system neoplasm Diseases 0.000 description 1
- 201000005667 central retinal vein occlusion Diseases 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 208000030239 cerebral astrocytoma Diseases 0.000 description 1
- 230000002490 cerebral effect Effects 0.000 description 1
- 208000026106 cerebrovascular disease Diseases 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 208000007287 cheilitis Diseases 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 208000006990 cholangiocarcinoma Diseases 0.000 description 1
- 201000005217 chondroblastoma Diseases 0.000 description 1
- 239000013611 chromosomal DNA Substances 0.000 description 1
- 208000030949 chronic idiopathic urticaria Diseases 0.000 description 1
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 1
- 108091006007 citrullinated proteins Proteins 0.000 description 1
- 208000009060 clear cell adenocarcinoma Diseases 0.000 description 1
- 201000000292 clear cell sarcoma Diseases 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 239000008119 colloidal silica Substances 0.000 description 1
- 201000011024 colonic benign neoplasm Diseases 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 208000028831 congenital heart disease Diseases 0.000 description 1
- 208000011425 congenital myotonic dystrophy Diseases 0.000 description 1
- 210000002808 connective tissue Anatomy 0.000 description 1
- 108010015408 connexin 37 Proteins 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 208000010247 contact dermatitis Diseases 0.000 description 1
- 201000007241 cutaneous T cell lymphoma Diseases 0.000 description 1
- 201000010305 cutaneous fibrous histiocytoma Diseases 0.000 description 1
- 208000004921 cutaneous lupus erythematosus Diseases 0.000 description 1
- 208000030381 cutaneous melanoma Diseases 0.000 description 1
- 208000017763 cutaneous neuroendocrine carcinoma Diseases 0.000 description 1
- 108010048032 cyclophilin B Proteins 0.000 description 1
- 208000002445 cystadenocarcinoma Diseases 0.000 description 1
- 238000004163 cytometry Methods 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 210000003298 dental enamel Anatomy 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 201000011190 diabetic macular edema Diseases 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 208000024558 digestive system cancer Diseases 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- GXGAKHNRMVGRPK-UHFFFAOYSA-N dimagnesium;dioxido-bis[[oxido(oxo)silyl]oxy]silane Chemical compound [Mg+2].[Mg+2].[O-][Si](=O)O[Si]([O-])([O-])O[Si]([O-])=O GXGAKHNRMVGRPK-UHFFFAOYSA-N 0.000 description 1
- ZPWVASYFFYYZEW-UHFFFAOYSA-L dipotassium hydrogen phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 1
- 229910000396 dipotassium phosphate Inorganic materials 0.000 description 1
- 235000019797 dipotassium phosphate Nutrition 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 201000001088 distal myopathy 1 Diseases 0.000 description 1
- 238000011143 downstream manufacturing Methods 0.000 description 1
- 208000011325 dry age related macular degeneration Diseases 0.000 description 1
- 239000000428 dust Substances 0.000 description 1
- 208000031068 ectodermal dysplasia syndrome Diseases 0.000 description 1
- 230000000431 effect on proliferation Effects 0.000 description 1
- 235000013601 eggs Nutrition 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 230000013020 embryo development Effects 0.000 description 1
- 238000005538 encapsulation Methods 0.000 description 1
- 206010014665 endocarditis Diseases 0.000 description 1
- 210000003372 endocrine gland Anatomy 0.000 description 1
- 201000006828 endometrial hyperplasia Diseases 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 101150030339 env gene Proteins 0.000 description 1
- 239000003822 epoxy resin Substances 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 210000000744 eyelid Anatomy 0.000 description 1
- 208000008570 facioscapulohumeral muscular dystrophy Diseases 0.000 description 1
- 208000030503 familial ossifying fibroma Diseases 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 201000007741 female breast cancer Diseases 0.000 description 1
- 201000002276 female breast carcinoma Diseases 0.000 description 1
- 102000013370 fibrillin Human genes 0.000 description 1
- 108060002895 fibrillin Proteins 0.000 description 1
- 229940012952 fibrinogen Drugs 0.000 description 1
- 229940126864 fibroblast growth factor Drugs 0.000 description 1
- 206010016629 fibroma Diseases 0.000 description 1
- 208000008487 fibromuscular dysplasia Diseases 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 208000003341 florid cemento-osseous dysplasia Diseases 0.000 description 1
- 108010006620 fodrin Proteins 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- ZZUFCTLCJUWOSV-UHFFFAOYSA-N furosemide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(C(O)=O)=C1NCC1=CC=CO1 ZZUFCTLCJUWOSV-UHFFFAOYSA-N 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 101150098622 gag gene Proteins 0.000 description 1
- 201000010175 gallbladder cancer Diseases 0.000 description 1
- 102000054078 gamma Catenin Human genes 0.000 description 1
- 108010084448 gamma Catenin Proteins 0.000 description 1
- 201000008361 ganglioneuroma Diseases 0.000 description 1
- 150000002270 gangliosides Chemical class 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 201000010231 gastrointestinal system cancer Diseases 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 239000003193 general anesthetic agent Substances 0.000 description 1
- 231100000025 genetic toxicology Toxicity 0.000 description 1
- 231100000024 genotoxic Toxicity 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 201000005626 glomangioma Diseases 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- 229960002449 glycine Drugs 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 206010018797 guttate psoriasis Diseases 0.000 description 1
- 230000037308 hair color Effects 0.000 description 1
- 210000003780 hair follicle Anatomy 0.000 description 1
- 208000024963 hair loss Diseases 0.000 description 1
- 230000003676 hair loss Effects 0.000 description 1
- LNEPOXFFQSENCJ-UHFFFAOYSA-N haloperidol Chemical compound C1CC(O)(C=2C=CC(Cl)=CC=2)CCN1CCCC(=O)C1=CC=C(F)C=C1 LNEPOXFFQSENCJ-UHFFFAOYSA-N 0.000 description 1
- 208000029427 heart-hand syndrome Diseases 0.000 description 1
- 201000011066 hemangioma Diseases 0.000 description 1
- 208000018706 hematopoietic system disease Diseases 0.000 description 1
- 208000014845 hemimelia Diseases 0.000 description 1
- 208000002557 hidradenitis Diseases 0.000 description 1
- 201000007162 hidradenitis suppurativa Diseases 0.000 description 1
- 208000029824 high grade glioma Diseases 0.000 description 1
- 210000003630 histaminocyte Anatomy 0.000 description 1
- 201000009379 histiocytoid hemangioma Diseases 0.000 description 1
- 201000008298 histiocytosis Diseases 0.000 description 1
- 238000000265 homogenisation Methods 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 102000046699 human CD14 Human genes 0.000 description 1
- 102000057239 human FGF7 Human genes 0.000 description 1
- 102000057240 human FGF9 Human genes 0.000 description 1
- 102000058223 human VEGFA Human genes 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 208000017819 hyperplastic polyp Diseases 0.000 description 1
- 201000001948 hypertensive retinopathy Diseases 0.000 description 1
- 206010020871 hypertrophic cardiomyopathy Diseases 0.000 description 1
- 201000006866 hypopharynx cancer Diseases 0.000 description 1
- 230000002267 hypothalamic effect Effects 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 229940124644 immune regulator Drugs 0.000 description 1
- 208000023692 inborn mitochondrial myopathy Diseases 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 208000000509 infertility Diseases 0.000 description 1
- 230000036512 infertility Effects 0.000 description 1
- 208000021267 infertility disease Diseases 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 230000010189 intracellular transport Effects 0.000 description 1
- 208000020082 intraepithelial neoplasia Diseases 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 201000008893 intraocular retinoblastoma Diseases 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 208000001875 irritant dermatitis Diseases 0.000 description 1
- 208000028867 ischemia Diseases 0.000 description 1
- 229960002725 isoflurane Drugs 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 210000002510 keratinocyte Anatomy 0.000 description 1
- 230000029774 keratinocyte migration Effects 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 210000000244 kidney pelvis Anatomy 0.000 description 1
- 206010023841 laryngeal neoplasm Diseases 0.000 description 1
- 239000004816 latex Substances 0.000 description 1
- 229920000126 latex Polymers 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 201000010260 leiomyoma Diseases 0.000 description 1
- 208000002741 leukoplakia Diseases 0.000 description 1
- 201000011486 lichen planus Diseases 0.000 description 1
- 208000012987 lip and oral cavity carcinoma Diseases 0.000 description 1
- 206010024627 liposarcoma Diseases 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 201000000966 lung oat cell carcinoma Diseases 0.000 description 1
- 208000012804 lymphangiosarcoma Diseases 0.000 description 1
- 230000000329 lymphopenic effect Effects 0.000 description 1
- 230000006674 lysosomal degradation Effects 0.000 description 1
- 201000000564 macroglobulinemia Diseases 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 201000010230 macular retinal edema Diseases 0.000 description 1
- 239000000391 magnesium silicate Substances 0.000 description 1
- 229940099273 magnesium trisilicate Drugs 0.000 description 1
- 229910000386 magnesium trisilicate Inorganic materials 0.000 description 1
- 235000019793 magnesium trisilicate Nutrition 0.000 description 1
- 201000004792 malaria Diseases 0.000 description 1
- 201000003175 male breast cancer Diseases 0.000 description 1
- 208000010907 male breast carcinoma Diseases 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 208000030883 malignant astrocytoma Diseases 0.000 description 1
- 208000026045 malignant tumor of parathyroid gland Diseases 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 210000005015 mediastinal lymph node Anatomy 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 206010027191 meningioma Diseases 0.000 description 1
- 208000004197 mesenchymoma Diseases 0.000 description 1
- 208000011831 mesonephric neoplasm Diseases 0.000 description 1
- 208000030159 metabolic disease Diseases 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 230000006510 metastatic growth Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 208000005135 methemoglobinemia Diseases 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000010232 migration assay Methods 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 108010068249 mitochondrial RNA-processing endoribonuclease Proteins 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 208000008084 monostotic fibrous dysplasia Diseases 0.000 description 1
- 206010051747 multiple endocrine neoplasia Diseases 0.000 description 1
- 208000010805 mumps infectious disease Diseases 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 201000002077 muscle cancer Diseases 0.000 description 1
- 208000011042 muscle-eye-brain disease Diseases 0.000 description 1
- 201000006938 muscular dystrophy Diseases 0.000 description 1
- 206010028417 myasthenia gravis Diseases 0.000 description 1
- 206010028537 myelofibrosis Diseases 0.000 description 1
- 201000004130 myoblastoma Diseases 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- 208000002086 myofibrillar myopathy Diseases 0.000 description 1
- 230000003274 myotonic effect Effects 0.000 description 1
- 208000009091 myxoma Diseases 0.000 description 1
- 208000001611 myxosarcoma Diseases 0.000 description 1
- PUPNJSIFIXXJCH-UHFFFAOYSA-N n-(4-hydroxyphenyl)-2-(1,1,3-trioxo-1,2-benzothiazol-2-yl)acetamide Chemical compound C1=CC(O)=CC=C1NC(=O)CN1S(=O)(=O)C2=CC=CC=C2C1=O PUPNJSIFIXXJCH-UHFFFAOYSA-N 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 208000025426 neoplasm of thorax Diseases 0.000 description 1
- 201000003142 neovascular glaucoma Diseases 0.000 description 1
- 201000011682 nervous system cancer Diseases 0.000 description 1
- 206010061311 nervous system neoplasm Diseases 0.000 description 1
- 208000007538 neurilemmoma Diseases 0.000 description 1
- 208000029986 neuroepithelioma Diseases 0.000 description 1
- 201000004931 neurofibromatosis Diseases 0.000 description 1
- 239000002858 neurotransmitter agent Substances 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 208000017920 oculo-auriculo-vertebral spectrum Diseases 0.000 description 1
- 208000004128 odontoma Diseases 0.000 description 1
- 201000006958 oropharynx cancer Diseases 0.000 description 1
- 208000008798 osteoma Diseases 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 208000021284 ovarian germ cell tumor Diseases 0.000 description 1
- 201000010198 papillary carcinoma Diseases 0.000 description 1
- 208000003154 papilloma Diseases 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 201000003913 parathyroid carcinoma Diseases 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 235000020232 peanut Nutrition 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 108010044156 peptidyl-prolyl cis-trans isomerase b Proteins 0.000 description 1
- 208000029308 periodic paralysis Diseases 0.000 description 1
- 201000005528 peripheral nervous system neoplasm Diseases 0.000 description 1
- 208000010918 peritoneal neoplasm Diseases 0.000 description 1
- 230000008782 phagocytosis Effects 0.000 description 1
- 208000028591 pheochromocytoma Diseases 0.000 description 1
- 235000021317 phosphate Nutrition 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 201000002881 physical urticaria Diseases 0.000 description 1
- 208000024724 pineal body neoplasm Diseases 0.000 description 1
- 201000004123 pineal gland cancer Diseases 0.000 description 1
- 201000003113 pineoblastoma Diseases 0.000 description 1
- 201000002511 pituitary cancer Diseases 0.000 description 1
- 206010035111 pityriasis alba Diseases 0.000 description 1
- 101150088264 pol gene Proteins 0.000 description 1
- 229920000058 polyacrylate Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000647 polyepoxide Polymers 0.000 description 1
- 102000054765 polymorphisms of proteins Human genes 0.000 description 1
- 208000005987 polymyositis Diseases 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 208000001061 polyostotic fibrous dysplasia Diseases 0.000 description 1
- 208000014081 polyp of colon Diseases 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 235000010241 potassium sorbate Nutrition 0.000 description 1
- 239000004302 potassium sorbate Substances 0.000 description 1
- 229940069338 potassium sorbate Drugs 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000001855 preneoplastic effect Effects 0.000 description 1
- 208000025638 primary cutaneous T-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 208000003476 primary myelofibrosis Diseases 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 229950008679 protamine sulfate Drugs 0.000 description 1
- 235000019419 proteases Nutrition 0.000 description 1
- 208000009305 pseudorabies Diseases 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 201000010914 pustulosis of palm and sole Diseases 0.000 description 1
- 208000011797 pustulosis palmaris et plantaris Diseases 0.000 description 1
- 239000002510 pyrogen Substances 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 238000003762 quantitative reverse transcription PCR Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 206010038038 rectal cancer Diseases 0.000 description 1
- 201000001275 rectum cancer Diseases 0.000 description 1
- 230000000306 recurrent effect Effects 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 208000016691 refractory malignant neoplasm Diseases 0.000 description 1
- 208000030859 renal pelvis/ureter urothelial carcinoma Diseases 0.000 description 1
- 230000008439 repair process Effects 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 201000006845 reticulosarcoma Diseases 0.000 description 1
- 208000029922 reticulum cell sarcoma Diseases 0.000 description 1
- 230000004258 retinal degeneration Effects 0.000 description 1
- 230000002207 retinal effect Effects 0.000 description 1
- 208000004644 retinal vein occlusion Diseases 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 201000004700 rosacea Diseases 0.000 description 1
- 102220036548 rs140382474 Human genes 0.000 description 1
- 201000007416 salivary gland adenoid cystic carcinoma Diseases 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 201000000306 sarcoidosis Diseases 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 206010039667 schwannoma Diseases 0.000 description 1
- 238000007790 scraping Methods 0.000 description 1
- 208000008742 seborrheic dermatitis Diseases 0.000 description 1
- 210000002374 sebum Anatomy 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 208000002477 septooptic dysplasia Diseases 0.000 description 1
- 235000015170 shellfish Nutrition 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 230000037075 skin appearance Effects 0.000 description 1
- 201000010088 skin benign neoplasm Diseases 0.000 description 1
- 230000037394 skin elasticity Effects 0.000 description 1
- 208000000649 small cell carcinoma Diseases 0.000 description 1
- 201000002314 small intestine cancer Diseases 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 201000002471 spleen cancer Diseases 0.000 description 1
- 208000021550 spleen neoplasm Diseases 0.000 description 1
- 206010041823 squamous cell carcinoma Diseases 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 208000016505 systemic primary carnitine deficiency disease Diseases 0.000 description 1
- 208000009056 telangiectasis Diseases 0.000 description 1
- 210000002435 tendon Anatomy 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 208000001644 thecoma Diseases 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 210000000115 thoracic cavity Anatomy 0.000 description 1
- 206010043554 thrombocytopenia Diseases 0.000 description 1
- 201000005990 thymic dysplasia Diseases 0.000 description 1
- 208000008732 thymoma Diseases 0.000 description 1
- 229960002175 thyroglobulin Drugs 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 210000001685 thyroid gland Anatomy 0.000 description 1
- 208000013066 thyroid gland cancer Diseases 0.000 description 1
- 208000013076 thyroid tumor Diseases 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 206010044412 transitional cell carcinoma Diseases 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 230000000472 traumatic effect Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 230000001228 trophic effect Effects 0.000 description 1
- 208000029387 trophoblastic neoplasm Diseases 0.000 description 1
- 208000017997 tumor of parathyroid gland Diseases 0.000 description 1
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 1
- 238000005199 ultracentrifugation Methods 0.000 description 1
- 208000018417 undifferentiated high grade pleomorphic sarcoma of bone Diseases 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 150000003673 urethanes Chemical class 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 208000037965 uterine sarcoma Diseases 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 206010046885 vaginal cancer Diseases 0.000 description 1
- 208000013139 vaginal neoplasm Diseases 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 210000001048 venom Anatomy 0.000 description 1
- 239000002435 venom Substances 0.000 description 1
- 231100000611 venom Toxicity 0.000 description 1
- 208000004043 venous thromboembolism Diseases 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 210000005048 vimentin Anatomy 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 210000002845 virion Anatomy 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 210000000239 visual pathway Anatomy 0.000 description 1
- 230000004400 visual pathway Effects 0.000 description 1
- 208000006542 von Hippel-Lindau disease Diseases 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- 208000010484 vulvovaginitis Diseases 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
- 210000002268 wool Anatomy 0.000 description 1
- 230000037373 wrinkle formation Effects 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- 229940051021 yellow-fever virus Drugs 0.000 description 1
- 150000003751 zinc Chemical class 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/60—Sugars; Derivatives thereof
- A61K8/606—Nucleosides; Nucleotides; Nucleic acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
- A61Q19/08—Anti-ageing preparations
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q7/00—Preparations for affecting hair growth
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
- C12N2740/15041—Use of virus, viral particle or viral elements as a vector
- C12N2740/15043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16045—Special targeting system for viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2830/00—Vector systems having a special element relevant for transcription
Definitions
- the present invention relates to means and methods for robust transient RNA expression.
- Transferring genetic information to a cell typically requires the design of vectors capable of delivering this genetic information to the cell.
- vectors capable of delivering this genetic information to the cell.
- non-viral vectors and viral vectors, each of which is capable of transferring information, either in the form of DNA or RNA.
- non-integrating DNA vectors or RNA vectors are excellent candidates.
- non-integrating DNA vectors can induce adverse genotoxic effects due to the non-zero probability of any DNA molecule to recombine with another DNA molecule, for instance, with the DNA genome of the host cell.
- RNA vectors do not exhibit this risk of genotoxicity, since RNA cannot recombine with DNA. Nonetheless, current RNA vectors are not devoid of drawbacks, in particular in terms of efficacy.
- non-viral RNA vectors are underperforming, due to a low degree of RNA protection against degradation, and often, a low transfection rate. Hence, the few RNA molecules which ultimately reach the cytoplasm of a cell induce only poor transgene expression.
- Retroviridae or retroviruses, is a family of RNA viruses which are capable of inserting a copy of their genome - after reverse transcription using their own reverse transcriptase enzyme (RT) - into the chromosomal DNA of the host cells that they invade. The host cells then treat the viral DNA as part of their own genome, transcribing and translating the viral genes along with their own genes.
- This ability of Retroviridae has made them (and more particularly viruses from the Gammaretrovirus and Lentivirus genera) a benchmark tool for therapeutic gene delivery and transfer into cells since the early 1980’ s.
- these RNA vectors have been engineered to allow transient expression of therapeutic proteins. Such engineered vectors were described in WO 2005/116225 Al, WO 2013/060819 A2 or Mock etal., 2014 (Sci Rep. 4:6409) relating to retroviral vectors with detective RT activity.
- RT-defective retroviral vectors although offering a transient expression of therapeutic proteins from their mRNA without the need of a DNA intermediate, are not devoid of drawbacks. Indeed, they typically package only up to two copies of their RNA genome, into which the transgene of interest (e.g., a therapeutic mRNA) is inserted. In other words, one retroviral vector transducing a host cell can only deliver two copies of a transgene of interest.
- RNAs are very labile molecules - and thus rapidly degraded in the host cell, this solution was considered somehow ineffective, unless high vector doses are repeatedly administered in order to outweigh these issues. For in vivo applications, this is not desirable. For instance, Mock et al. (2014. Sci Rep. 4:6409) came to this conclusion, stating that they “observed very weak cap-dependent translation initiation from standard lentiviral vector genomes”, and called for further improvements.
- RNA vectors capable of inducing high transient expression levels in host cells, but without requiring the administration of high loads of vector.
- RNA Booster an artificial 9-nucleotide sequence, that they have named “RNA Booster”.
- the Inventors have surprisingly observed that the presence of this RNA Booster upstream or downstream of a transgene highly improved transgene expression in various host cells.
- the present invention relates to a ribonucleic acid (RNA) or deoxyribonucleic acid (DNA) molecule comprising: an RNA Booster sequence comprising or consisting of the ribonucleic acid or deoxyribonucleic acid sequence mmsknkkkm or its reverse sequence mkkknksmm, wherein:
- m indicates an adenine (a) or cytosine (c);
- s indicates a guanine (g) or a cytosine (c);
- k indicates a guanine (g) or a uracyl/thymine (u/t);
- n indicates any nucleotide
- the RNA Booster sequence comprises or consists of a ribonucleic acid or a deoxyribonucleic acid sequence mmskngkkm or its reverse sequence mkkgnksmm, preferably mmskngkgm or its reverse sequence mgkgnksmm, more preferably cmskhgkgm or its reverse mgkghksmc, even more preferably cmskwgkgm or its reverse sequence mgkgwksmc, yet even more preferably ccsuwgggm or its reverse sequence mgggwuscc, wherein:
- ⁇ “m” indicates an adenine (a) or cytosine (c);
- ⁇ “s” indicates a guanine (g) or a cytosine (c);
- ⁇ “k” indicates a guanine (g) or a uracyl/thymine (u/t);
- ⁇ “h” indicates an adenine (a) or a cytosine (c) or a uracyl/thymine (u/t);
- ⁇ “w” indicates an adenine (a) or a uracyl/thymine (u/t);
- n indicates any nucleotide
- the RNA Booster sequence is selected from the group consisting of:
- RNA Booster 9 comprising or consisting of the sequence ccguaggga or its reverse sequence agggaugcc;
- RNA Booster 8 comprising or consisting of the sequence cccuugggc or its reverse sequence cggguuccc;
- RNA Booster 7 comprising or consisting of the sequence cacgugugc or its reverse sequence cgugugcac;
- RNA Booster 6 comprising or consisting of the sequence cccucgggc or its reverse sequence cgggcuccc;
- RNA Booster 5 comprising or consisting of the sequence aacuggggc or its reverse sequence cggggucaa;
- RNA Booster 4 comprising or consisting of the sequence ccguggugc or its reverse sequence cguggugcc;
- RNA Booster 3 comprising or consisting of the sequence cccuaggua or its reverse sequence auggauccc;
- RNA Booster 2 comprising or consisting of the sequence aaguuuggc or its reverse sequence cgguuugaa;
- RNA Booster 1 comprising or consisting of the sequence cccgugugc or its reverse sequence cgugugccc.
- the RNA molecule is comprised within a non-viral vector.
- the RNA molecule is packaged into an RNA virus vector derived from a Group III, Group IV, Group V or Group VI RNA virus.
- the RNA molecule is packaged into RNA virus vector derived from a Group VI RNA virus. More preferably, the RNA molecule is packaged into a Retroviridae vector.
- the Retroviridae vector is an Orthoretrovirinae or a Spumaretrovirinae .
- the Retroviridae vector is an Orthoretrovirinae.
- the Retroviridae vector is selected from the group consisting of human immunodeficiency viruses (HIV), simian immunodeficiency viruses (SIV), feline immunodeficiency virus (FIV), bovine immunodeficiency virus (BIV), puma lentivirus (PLV), equine infectious anemia virus (EIAV), caprine arthritis encephalitis virus (CAEV), Visna-maedi virus, Jembrana disease virus, avian sarcoma leukosis virus (ASLV), Rous sarcoma virus (RSV), avian myeloblastosis virus (AMV), mouse mammary tumor virus (MMTV), Jaagsiekte sheep retrovirus (JSRV), enzootic nasal tumor viruses
- HCV human immunodeficiency viruses
- the Retroviridae vector is a lentiviral vector.
- the Retroviridae vector is a lentiviral vector selected from the group consisting of human immunodeficiency virus-1 (HIV-1) and HIV-2. More preferably, the Retroviridae vector is HIV- 1.
- the Group VI RNA virus vector (preferably the Retroviridae vector) is reverse transcriptase (RT)-defective.
- the Group VI RNA virus vector (preferably the Retroviridae vector) does not comprise a gene encoding a reverse transcriptase or wherein the retroviral vector comprises a gene encoding a mutated reverse transcriptase with abolished reverse transcription activity.
- the RNA molecule when the RNA molecule is packaged into an RNA virus vector, the RNA molecule further comprises one or several of: a 5’ long terminal repeat (LTR), a packaging sequence, a Rev-response element sequence, a post-transcriptional regulation element sequence, and a 3’ LTR.
- LTR long terminal repeat
- the present invention also relates to a pharmaceutical composition
- a pharmaceutical composition comprising the RNA or DNA molecule of the invention, optionally comprised within a non-viral vector or packaged into an RNA virus vector, and at least one pharmaceutically acceptable excipient or carrier.
- the present invention also relates to the RNA or DNA molecule of the invention, optionally comprised within a non-viral vector or packaged into an RNA virus vector, or to the pharmaceutical composition comprising the same, for use in therapy.
- the present invention also relates to an in vitro method of transiently expressing a sequence of interest in a cell, comprising transfecting or transducing the cell with the RNA molecule of the invention, optionally comprised within a non-viral vector or packaged into an RNA virus vector.
- the present invention also relates to a nucleic acid system comprising: (i) a t least one first nucleic acid sequence encoding a Retroviridae genome comprising at least a retroviral gag and pol sequence; optionally wherein the pol sequence encodes a defective reverse-transcriptase (RT) or wherein the pol sequence lacks a RT gene;
- a nucleic acid system comprising: (i) a t least one first nucleic acid sequence encoding a Retroviridae genome comprising at least a retroviral gag and pol sequence; optionally wherein the pol sequence encodes a defective reverse-transcriptase (RT) or wherein the pol sequence lacks a RT gene;
- RNA Booster sequence comprising or consisting of the following ribonucleic acid or deoxyribonucleic acid sequence mmsknkkkm or its reverse sequence mkkknksmm, wherein:
- ⁇ “m” indicates an adenine (a) or cytosine (c);
- ⁇ “s” indicates a guanine (g) or a cytosine (c);
- ⁇ “k” indicates a guanine (g) or a uracyl/thymine (u/t);
- n indicates any nucleotide, optionally, a multiple cloning site, optionally, a sequence of interest; wherein the first and second nucleic acid sequences are trans-complementation sequences lacking a functional packaging sequence; preferably wherein the RNA Booster sequence comprises or consists of a nucleic acid sequence mmskngkkm or its reverse sequence mkkgnksmm, preferably of mmskngkgm or its reverse sequence mgkgnksmm, more preferably cmskhgkgm or its reverse sequence mgkghksmc, even more preferably cmskwgkgm or its reverse sequence mgkgwksmc, yet even more preferably ccsuwgggm or its reverse sequence mgggwuscc, wherein:
- ⁇ “m” indicates an adenine (a) or cytosine (c);
- ⁇ “s” indicates a guanine (g) or a cytosine (c);
- ⁇ “k” indicates a guanine (g) or a uracyl/thymine (u/t);
- ⁇ “h” indicates an adenine (a) or a cytosine (c) or a uracyl/thymine (u/t);
- ⁇ “w” indicates an adenine (a) or a uracyl/thymine (u/t);
- RNA Booster sequence is selected from the group consisting of:
- RNA Booster 9 comprising or consisting of the sequence ccguaggga or its reverse sequence agggaugcc;
- RNA Booster 8 comprising or consisting of the sequence cccuugggc or its reverse sequence cggguuccc;
- RNA Booster 7 comprising or consisting of the sequence cacgugugc or its reverse sequence cgugugcac;
- RNA Booster 6 comprising or consisting of the sequence cccucgggc or its reverse sequence cgggcuccc;
- RNA Booster 5 comprising or consisting of the sequence aacuggggc or its reverse sequence cggggucaa;
- RNA Booster 4 comprising or consisting of the sequence ccguggugc or its reverse sequence cguggugcc;
- RNA Booster 3 comprising or consisting of the sequence cccuaggua or its reverse sequence auggauccc;
- RNA Booster 2 comprising or consisting of the sequence aaguuuggc or its reverse sequence cgguuugaa;
- RNA Booster 1 comprising or consisting of the sequence cccgugugc or its reverse sequence cgugugccc.
- each at least one nucleic acid sequence (i), (ii) and (iii) is independently from each other a linear nucleic acid or a plasmid.
- the present invention also relates to a cell or cell population comprising the RNA or DNA molecule of the invention or the nucleic acid system of the invention.
- the present invention also relates to a method of producing a Retroviridae vector comprising the RNA molecule of the invention, comprising: transfecting a cell or cell population with at least one RNA or DNA molecule of the invention, with the nucleic acid system of the invention, or providing a cell or cell population comprising the nucleic acid system of the invention; culturing the cell or cell population of a period of time sufficient for the production of the Retroviridae vector; recovering, and optionally purifying, the Retroviridae vector.
- the present invention also relates to another nucleic acid system comprising at least one nucleic acid sequence encoding a recombinant expression cassette comprising:
- RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm
- MCS multiple cloning site
- ORI origin of replication
- an element means one element or more than one element.
- Antigen also termed “immunogen”, refers to any substance that induces a state of sensitivity and/or immune responsiveness after any latent period (normally, days to weeks in humans) and that reacts in a demonstrable way with antibodies and/or immune cells of the sensitized subject in vivo or in vitro.
- Collagen induction therapy also known as “microneedling”, “dermarolling”, or “skin needling” refers to a cosmetic procedure which involves repeatedly puncturing the skin of a subject with microneedles (z.e., needles having a length typically ranging from about 100 pm to 1 000 pm).
- Consist essentially of’ and any declension thereof, with reference to a composition means that the RNA or DNA molecule (or the vector comprising said RNA or DNA molecule), is the only one therapeutic agent or agent with a biological activity within said composition or pharmaceutical composition.
- Encoding refers to the inherent property of a specific sequence of nucleotides in a nucleic acid, such as a gene, a complementary DNA (cDNA), or a messenger RNA (mRNA), to serve as template for the synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (e.g., ribosomal RNA (rRNA), transfer RNA (tRNA) and mRNA) or a defined sequence of amino acids (e.g., polypeptide or protein) and the biological properties resulting therefrom.
- rRNA ribosomal RNA
- tRNA transfer RNA
- mRNA a defined sequence of amino acids
- Exogenous refers to a molecule that is not naturally present in a cell, but can be introduced into the cell by one or more genetic, biochemical or other methods. Natural presence in the cell may be determined with respect to the particular developmental stage and environmental conditions of the cell. For instance, a molecule that is present only in a cell during embryonic development is exogenous with respect to a cell in an adult subject. Similarly, a molecule induced by heat shock of a cell is exogenous with respect to a non-heat- shocked cell.
- “Expression” refers to the transcription and/or translation of a particular nucleotide sequence, such as a gene.
- the expression “has/having a sequence as set forth in SEQ ID NO: X” means that the given sequence comprises or consists of the sequence as set forth in SEQ ID NO: X.
- the given sequence implicitly refers to a nucleic acid sequence (DNA or RNA sequence) or an amino acid sequence.
- isolated'' with reference to a nucleic acid refers to a nucleic acid altered or removed from the natural state.
- a nucleic acid naturally present in a living organism is not “isolated” but the nucleic acid partially or completely separated from the coexisting materials of its natural state is “isolated”.
- An “isolated nucleic acid” is thus a nucleic acid that is substantially separated from other nucleic acid sequences, such as genomic DNA or RNA, as well as proteins or complexes such as ribosomes and polymerases, which naturally accompany a native sequence.
- An isolated nucleic acid can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
- a preparation of an isolated nucleic acid may comprise the nucleic acid at least about 80% pure, at least about 85% pure, at least about 90% pure, at least about 95% pure, greater than about 95% pure, greater than about 96% pure, greater than about 97% pure, greater than about 98% pure, or greater than about 99% pure.
- Isolated nucleic acids thus include nucleic acids purified by standard purification methods, and encompass nucleic acid sequences that have been removed from their naturally occurring environment. Isolated nucleic acids also include chemically synthesized nucleic acids and nucleic acids biologically synthesized by heterologous systems.
- LTRs Long-terminal repeats refer to sequences of several hundred base pairs long. In RNA viruses, their genome is flanked by LTRs (a 5’ LTR and a 3’ LTR), typically having identical sequences.
- Rev-response element refers to a highly structured RNA segment interacting with the Rev protein, allowing the viral genome to be exported to the cytoplasm for downstream processing, including virion packaging.
- Rev-response elements are typically characteristic of lentiviruses, but other RNA viruses of Group VI comprise similar systems, such as the Rem-response element in Betaretroviruses, the Rex-response element in Deltaretroviruses, or the constitutive transport element (CTE). These are also encompassed when mentioning Rev-response element herein, even if not explicitly cited.
- Nucleic acid refers to a polymer of nucleotides (z.e., polynucleotides) covalently linked by phosphodiester bonds, such as deoxyribonucleic acids (DNA) or ribonucleic acids (RNA), in either single- or double- stranded form.
- DNA deoxyribonucleic acids
- RNA ribonucleic acids
- a nucleic acid may thus be single-stranded, partially double-stranded, or fully doublestranded.
- the nucleotides making up nucleic acids of the present disclosure may be unmodified (natural) nucleotides or non-natural or modified nucleotides.
- Unmodified (or natural or naturally occurring) nucleotides include adenosine monophosphate (AMP), deoxyadenosine monophosphate (dAMP), cytidine monophosphate (CMP), deoxycytidine monophosphate (dCMP), guanosine monophosphate (GMP), deoxyguanosine monophosphate (dGMP), thymidine monophosphate (TMP), deoxythymidine monophosphate (dTMP), and uridine monophosphate (UMP).
- AMP adenosine monophosphate
- dAMP deoxyadenosine monophosphate
- CMP cytidine monophosphate
- dCMP deoxycytidine monophosphate
- GMP guanosine monophosphate
- dGMP deoxyguanosine monophosphate
- TMP thymidine monophosphate
- dTMP deoxythymidine monophosphate
- UMP uridine monophosphate
- nucleic acid sequence or “nucleotide sequence” refers to a contiguous sequence of nucleotides in a single nucleic acid. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs (single-nucleotide polymorphisms), and complementary sequences as well as the sequence explicitly indicated. Notably, a particular nucleic acid sequence described herein implicitly comprises its corresponding complementary sequence, named reverse sequence. It should be noted that a particular nucleic acid sequence described herein implicitly comprises the DNA sequence and the corresponding RNA sequence.
- “Operatively linked” refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence, e.g., a gene, resulting in a regulation of the expression of the latter by the former.
- a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
- a promoter is operably linked to a gene if the promoter affects the transcription or expression of the gene.
- an RNA Booster is operably linked to a gene if the RNA Booster affects the expression of the gene.
- a regulatory sequence is operably linked to a gene if the regulatory sequence affects (z.e., either induces or inhibits (or represses)) the expression of the gene.
- Operably linked sequences can be contiguous with each other.
- Packaging sequence refers to a stem-loop structured cz'.s- acting nucleic acid sequence, which regulates the process of packaging inside a viral capsid. This packaging sequence may be referred in the art to as “packaging signal” denoted “y”, or “encapsidation signal” denoted “E”. Packaging sequences may be of viral origin (z.e., wild-type viral packaging sequences) or may be synthetic. [0042] “Pharmaceutically acceptable excipient” and “pharmaceutically acceptable carrier” include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, that are physiologically compatible.
- excipient or carrier does not produce any adverse, allergic or other untoward reaction when administered to a subject, preferably to a human.
- a pharmaceutically acceptable excipient or carrier is typically a non-toxic solid, semi-solid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type.
- preparations should meet sterility, pyrogenicity, and general safety and purity standards as required by regulatory offices, such as, for example, the FDA (US Food and Drug Administration) or EMA (European Medicines Agency).
- Post-transcriptional regulation elements refer to czs-acting RNA sequences that can increase the accumulation of cytoplasmic mRNA by promoting mRNA exportation from the nucleus to the cytoplasm, enhancing 3’-end processing and stability.
- Gene broadly refers to an encoding nucleic acid sequence that can be transcribed into an RNA molecule, either a coding RNA molecule such as a mRNA which can be subsequently translated into a polypeptide or protein, or a non-coding RNA molecule such as a rRNA or a tRNA.
- the term “gene” may refer to an encoding nucleic acid sequence comprising a coding sequence (or CDS) and at least one regulatory element that is transcribed but not translated, such as a 3’-UTR, a 5’-UTR and/or an intron.
- sequence of interest refers to as “transgene (of interest)”, refers to any nucleic acid sequence encoding a product of interest.
- the product of interest may be a protein or a fragment thereof; in this case, the sequence of interest is said to be a coding nucleic acid sequence.
- the transgenes refers in particular to a gene originating from one species which is to be introduced into an organism belonging to a different species. It should thus be noted that a gene may or may not encompass a coding sequence (or CDS), that is to say a nucleic acid sequence that actually codes for a protein.
- a gene in particular a gene encompassing a CDS, may also preferably encompass untranslated transcribed regions (UTRs), such as a 3’-UTR and/or a 5’-UTR and other sequences, such as regulatory elements and/or introns, which are transcribed but not translated.
- UTRs untranslated transcribed regions
- other sequences such as regulatory elements and/or introns, which are transcribed but not translated.
- the term also encompasses non-coding nucleic acid sequences, i.e., nucleic acid sequences that do not encode a protein or a fragment thereof, but rather express an “RNA gene” (or “non-coding RNA”), such as, e.g., a transfer RNA, a ribosomal RNA, a small RNA, a long non-coding RNA, etc.
- RNA gene or “non-coding RNA”
- sequence of interest refers to a DNA or an RNA sequence.
- Transgenesis refers to the process of introducing one or several transgenes from one organism into another, with the intent of enabling the latter to transmit this transgene to its offspring.
- Treating” or “treatment” or “alleviation” refers to both therapeutic treatment and prophylactic measures; wherein the object is to slow down (lessen) the targeted pathologic condition or disorder.
- a subject or mammal is successfully "treated” for an infection if, after receiving a therapeutic amount of an RNA or DNA molecule of the present invention, the patient shows observable and/or measurable reduction in or absence of one or more of the following: reduction in the number of pathogenic cells; reduction in the percent of total cells that are pathogenic; and/or relief to some extent, one or more of the symptoms associated with the specific disease or condition; reduced morbidity and mortality, and improvement in quality of life issues.
- the above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
- Vector refers to a vehicle by which a nucleic acid sequence e.g., a DNA or RNA molecule), for example a nucleic acid encoding an RNA or a polypeptide or protein of interest, can be introduced into a host cell, so as to transform, transfect or transduce the host cell and promote expression (e.g., transcription and/or translation) of the introduced nucleic acid sequence.
- a nucleic acid sequence e.g., a DNA or RNA molecule
- a nucleic acid encoding an RNA or a polypeptide or protein of interest can be introduced into a host cell, so as to transform, transfect or transduce the host cell and promote expression (e.g., transcription and/or translation) of the introduced nucleic acid sequence.
- “Expression vector” refers to a vector comprising regulatory elements (or regulatory sequences) operatively linked or to be operatively linked to a nucleic acid sequence of interest to be expressed, such as a gene of interest.
- An expression vector thus comprises sufficient cis-acting regulatory elements for controlling the expression of a nucleic acid sequence of interest (present or to be inserted in the expression vector); other elements that may be required for controlling the expression of the nucleic acid sequence of interest may be supplied by a host cell or an in vitro expression system.
- a first object of the invention is a ribonucleic acid (RNA) molecule or deoxyribonucleic acid (DNA) molecule, corresponding to nucleic acid molecule.
- RNA ribonucleic acid
- DNA deoxyribonucleic acid
- the RNA or DNA molecule comprises, from 5’ to 3’: an RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm, and a sequence of interest.
- the RNA or DNA molecule comprises, from 3’ to 5’:
- RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm
- the RNA or DNA molecule comprises an RNA Booster sequence.
- RAA Booster refers to an artificial 9-nucleotide sequence, which comprises or consists of a sequence mmsknkkkm or its reverse sequence mkkknksmm, wherein:
- m indicates an adenine (a) or a cytosine (c);
- s indicates a guanine (g) or a cytosine (c);
- k indicates a guanine (g) or a thymine/uracyl (t/u);
- n indicates any nucleotide.
- the RNA Booster sequence comprises or consists of a sequence mmskngkkm or its reverse sequence mkkgnksmm, wherein:
- m indicates an adenine (a) or a cytosine (c);
- s indicates a guanine (g) or a cytosine (c);
- k indicates a guanine (g) or a thymine/uracyl (t/u);
- n indicates any nucleotide.
- the RNA Booster sequence comprises or consists of a sequence of mmskngkgm or its reverse sequence mgkgnksmm, wherein:
- m indicates an adenine (a) or a cytosine (c);
- s indicates a guanine (g) or a cytosine (c);
- k indicates a guanine (g) or a thymine/uracyl (t/u);
- n indicates any nucleotide.
- the RNA Booster sequence comprises or consists of a sequence cmskhgkgm or its reverse sequence mgkghksmc, wherein:
- m indicates an adenine (a) or a cytosine (c);
- s indicates a guanine (g) or a cytosine (c);
- k indicates a guanine (g) or a thymine/uracyl (t/u);
- h indicates an adenine (a) or a cytosine (c) or a thymine/uracyl (t/u).
- the RNA Booster sequence comprises or consists of a sequence cmskwgkgm or its reverse sequence mgkgwksmc, wherein:
- m indicates an adenine (a) or a cytosine (c);
- s indicates a guanine (g) or a cytosine (c);
- w indicates an adenine (a) or a thymine/uracyl (t/u);
- h indicates an adenine (a) or a cytosine (c) or a thymine/uracyl (t/u).
- the RNA Booster sequence comprises or consists of a sequence ccsuwgggm or its reverse sequence mgggwuscc, wherein:
- s indicates a guanine (g) or a cytosine (c);
- w indicates an adenine (a) or a thymine/uracyl (t/u);
- m indicates an adenine (a) or a cytosine (c).
- RNA Booster sequences in RNA molecule include, but are not limited to:
- RNA Booster 1 cccgugugc, or its reverse sequence
- RNA Booster 10 cgugugccc
- RNA Booster 2 aaguuuggc, or its reverse sequence RNA Booster 11: cgguuugaa RNA Booster 3: cccuaggua, or its reverse sequence RNA Booster 12'. auggauccc
- RNA Booster 4 ccguggugc, or its reverse sequence RNA Booster 13: cguggugcc
- RNA Booster 5 aacuggggc, or its reverse sequence RNA Booster 14: cggggucaa
- RNA Booster 6 cccucgggc, or its reverse sequence RNA Booster 15: cgggcuccc
- RNA Booster 7 cacgugugc, or its reverse sequence
- RNA Booster 16 cgugugcac
- RNA Booster 8 cccuugggc, or its reverse sequence RNA Booster 17: cggguuccc
- RNA Booster 9 ccguaggga, or its reverse sequence RNA Booster 18: agggaugcc
- RNA Booster sequences in DNA molecule include, but are not limited to:
- RNA Booster 1 cccgtgtgc, or its reverse sequence RNA Booster 10: cgtgtgccc
- RNA Booster 2 aagtttggc, or its reverse sequence RNA Booster 11: cggtttgaa
- RNA Booster 3 ccctaggta, or its reverse sequence RNA Booster 12: atggatccc
- RNA Booster 4 ccgtggtgc, or its reverse sequence RNA Booster 13: cgtggtgcc
- RNA Booster 5 aactggggc, or its reverse sequence RNA Booster 14: cggggtcaa
- RNA Booster 6 ccctcgggc, or its reverse sequence RNA Booster 15: cgggctccc
- RNA Booster 7 cacgtgtgc, or its reverse sequence RNA Booster 16: cgtgtgcac
- RNA Booster 8 cccttgggc, or its reverse sequence RNA Booster 17: cgggttccc
- RNA Booster 9 ccgtaggga, or its reverse sequence RNA Booster 18: agggatgcc
- the RNA Booster is described as forward sequence, meaning the RNA Booster sequence is oriented from 5’ to 3’.
- RNA Booster forward are selected in the group of RNA Booster 1 to 9.
- the RNA Booster is described as reverse sequence, meaning the RNA Booster sequence is oriented from 3’ to 5’.
- RNA Booster reverse are selected in the group of RNA Booster 10 to 18.
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting RNA Booster 9, RNA Booster 8, RNA Booster 7, RNA Booster 6, RNA Booster 5, RNA Booster 4, RNA Booster 3, RNA Booster 2, and RNA Booster 1.
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10,
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7 , RNA Booster 6, RNA Booster 5, RNA Booster 4, RNA Booster 3, and RNA Booster 2.
- RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7 , RNA Booster 6, RNA Booster 5, RNA Booster 4, RNA Booster 3, and RNA Booster 2.
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7 , RNA Booster 6, RNA Booster 5, RNA Booster 4, and RNA Booster 3.
- RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7 , RNA Booster 6, RNA Booster 5, RNA Booster 4, and RNA Booster 3.
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7 , RNA Booster 6, RNA Booster 5, and RNA Booster 4.
- RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7 , RNA Booster 6, RNA Booster 5, and RNA Booster 4.
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7 , RNA Booster 6, and RNA Booster 5.
- RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7 , RNA Booster 6, and RNA Booster 5.
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11 , RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7 , and RNA Booster 6.
- RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11 , RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7 , and RNA Booster 6.
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, and RNA Booster 7.
- RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, and RNA Booster 7.
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, and RNA Booster 8.
- RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, and RNA Booster 8.
- the RNA or DNA molecule comprises RNA Booster 9. In some embodiments, the RNA or DNA molecule comprises RNA Booster 8.
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10 and RNA Booster 9.
- RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10 and RNA Booster 9.
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11 and RNA Booster 10.
- RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11 and RNA Booster 10.
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12 and RNA Booster 11.
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13 and RNA Booster 12.
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14 and RNA Booster 13.
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15 and RNA Booster 14.
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16 and RNA Booster 15.
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17 and RNA Booster 16.
- the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18 and RNA Booster 17.
- the RNA or DNA molecule comprises RNA Booster 18. In some embodiments, the RNA or DNA molecule comprises RNA Booster 17.
- the RNA Booster is located in 5’ of a sequence of interest, meaning that the RNA Booster is located upstream of a sequence of interest.
- the RNA Booster is located in 5’ of a sequence of interest. [0087] In some embodiments, the RNA Booster is located in 3’ of a sequence of interest, meaning that the RNA Booster is located downstream of a sequence of interest.
- the RNA Booster is capable to increase the expression of a gene of interest, as the transgene.
- the RNA Booster is operably linked to the gene of interest.
- the RNA Booster is located from 50 ribonucleotides or deoxyribonucleotide (50 nt) to 1000 ribonucleotides or deoxyribonucleotide (1 knt) upstream or downstream of a sequence of interest; such as, e.g., about 50+25 nt, 100+25 nt, 150+25 nt, 200+25 nt, 250+25 nt, 300+25 nt, 350+25 nt, 400+25 nt,
- the RNA Booster is located about 500+25 nt upstream or downstream of a sequence of interest.
- the RNA Booster is located from 5 ribonucleotides or deoxyribonucleotide (5 nt) to 2000 ribonucleotides or deoxyribonucleotide (2 knt) upstream or downstream of a sequence of interest; such as, e.g., about 50+25 nt, 100+25 nt, 150+25 nt, 200+25 nt, 250+25 nt, 300+25 nt, 350+25 nt, 400+25 nt,
- RNA Booster is located about 2+0.025 knt upstream or downstream of a sequence of interest.
- the RNA or DNA molecule comprises a sequence of interest.
- the sequence of interest can be a sequence encoding a peptide or protein (e.g., without limitation, an enzyme, a transcription factor, a growth factor, a trophic factor, a hormone, a cytokine, an antibody, an antigen, a receptor, an immune regulator, a differentiation factor, a suicide protein, a cell-cycle modifying protein, an anti-proliferative protein, an angiogenic factor, an anti-angiogenic factor, a genome editor, a nuclease, a recombinase, a transposase, a neurotransmitter, and a reporter, including any precursor thereof, as well as fusion proteins).
- the sequence of interest may typically be (or be derived from) an mRNA, a cDNA, a synthetic nucleic acid, or any combinations thereof.
- sequence of interest can alternatively be a sequence of a non-coding RNA.
- RNAs examples include, but are not limited to, transfer RNAs (tRNAs), ribosomal RNAs (rRNAs), small nuclear RNAs (snRNAs), small nucleolar RNAs (snoRNAs), SmY RNAs, small Cajal body-specific RNAs (scaRNAs), guide RNAs (gRNAs), Y RNAs, telomerase RNA component (TERC), spliced leader RNAs (SL RNAs), catalytic RNAs (z.e., ribozymes; such as, e.g., ribonuclease P, ribonuclease MRP, and the like), antisense RNAs (aRNAs), c/.y-natural antisense transcript (cis-NAT), CRISPR RNAs (crRNAs), long non-coding RNAs (IncRNAs), microRNAs (miRNAs), piwi-interacting RNAs (p
- sequences of interest include any nucleic acid sequence encoding a molecule of therapeutic interest, such as any nucleic acid sequence encoding a peptide or protein, or a non-coding RNA, that is lacking, deficient and/or non-functional in a subject affected with a disease or condition.
- sequences of interest include nucleic acid sequence encoding a CRISPR element (such as, e.g., Cas9, Casl2 or a gRNA), a zinc finger protein, a transcription activator-like effector nuclease (TALEN), a meganuclease, a spike protein of an enveloped virus (such as the spike protein of a Coronaviridae, e.g., of SARS-CoV-2; of an Orthomyxoviridae, e.g., of an Influenza virus; or of a Retroviridae), a fibroblast growth factor (such as, e.g., the glia-activating factor FGF9), a vascular endothelial growth factor (VEGF, including its isoforms, e.g., VEGF121, VEGFmb, VEGF145, VEGF165, VEGFiesb, VEGF189, VEGF206),
- a CRISPR element such as,
- the sequence of interest is an antigen
- the RNA or DNA molecule of the invention is particularly suitable for vaccination purposes.
- the sequence of interest is a genome editor, and the RNA or DNA molecule of the invention is particularly suitable for genome editing purposes.
- the sequence of interest is FGF9 or FGF7, preferably FGF7, and the RNA or DNA molecule of the invention is particularly suitable for cosmetic purposes.
- the expression of the sequence of interest is transient (i.e., not permanent or sustained).
- the duration and amount of expression may be increased, e.g., by inserting a post-transcriptional regulatory element in 3’ (i.e., downstream) of the sequence of interest.
- post-transcriptional regulatory element include, but are not limited to, the post-transcriptional regulatory element of Woodchuck hepatitis virus (WPRE) and the post-transcriptional regulatory element of hepatitis B virus (HPRE).
- the duration of expression of the sequence of interest in a cell may be at most 7 days (Fig. IB).
- the RNA or DNA molecule encodes for an mRNA molecule.
- the mRNA molecule is comprised within a non-viral vector.
- the present invention encompasses thus a non-viral vector comprising the RNA or DNA molecule described herein.
- the mRNA molecule may further comprise:
- RNA Booster sequence Upstream of the RNA Booster sequence: a 5’-UTR sequence comprising a cap structure, and downstream of the sequence of interest, a 3’-UTR and a 3’-polyA.
- the mRNA molecule may further comprise:
- the mRNA molecule is encoded by a DNA molecule.
- the DNA molecule is comprised within a non-viral vector selected in the group of: plasmid, cosmid, phage, Bacterial Artificial Chromosome (BAC), Yeast Artificial Chromosome, liposomes, exosomes, lipid nanoparticles, polypeptide nanoparticles, stable nucleic acid lipid particle (SNALP), and cationic lipoplexes.
- a non-viral vector selected in the group of: plasmid, cosmid, phage, Bacterial Artificial Chromosome (BAC), Yeast Artificial Chromosome, liposomes, exosomes, lipid nanoparticles, polypeptide nanoparticles, stable nucleic acid lipid particle (SNALP), and cationic lipoplexes.
- the cap structure is a 5 ’-terminal m 7 G(5’)ppp(5’)G.
- the cap structure may be an analog of m 7 G(5’)ppp(5’)G, such as, e.g., 3’-O-Me-m 7 G(5’)ppp(5’)G (called anti-reverse cap analog or ARCA), m 7 G(5’)ppp(5’)A, G(5’)ppp(5’)G or G(5’)ppp(5’)A.
- the non-viral vector l has efficient encapsulation and protection on mRNAs from nuclease-based degradation upon administration to a subject; 2) prolongs the mRNAs half-life by preventing rapid clearance by a subject’s kidney and phagocytosis by the subject’s liver or spleen upon administration; 3) enhances targeted tissue/organ penetration and accumulation; 4) facilitates targeted cell internalization;
- Typical examples of non-viral RNA vectors include, but are not limited to, liposomes, exosomes, lipid nanoparticles, polypeptide nanoparticles, stable nucleic acid lipid particle (SNALP), and cationic lipoplexes.
- SNALP stable nucleic acid lipid particle
- the RNA or DNA molecule may be packaged into or otherwise comprised within a viral vector.
- the present invention encompasses thus a viral vector comprising the RNA or DNA molecule described herein.
- the RNA or DNA molecule is packaged into or otherwise comprised within an DNA virus vector, i.e., an engineered viral particle derived from an DNA virus.
- the RNA or DNA molecule is packaged into or otherwise comprised within an RNA virus vector, i.e., an engineered viral particle derived from an RNA virus.
- engineered viral particle it is implied that (i) at least one exogenous nucleic acid sequence is introduced into the genome of the RNA virus, and/or (ii) at least one endogenous gene from the RNA virus is be mutated or deleted, either partially or totally.
- RNA viruses are viruses that have ribonucleic acid as their genetic material. RNA viruses can be classified into four groups according to the Baltimore classification system:
- Double-stranded RNA viruses including the following families: Birnaviridae , Chrysoviridae, Cystoviridae, Hypoviridae, Partitiviridae, Reoviridae, Totiviridae and Endornavirus .
- Exemplary genera of double- stranded RNA viruses that can infect humans include, without limitation, Rotavirus and Coltivirus.
- Group IV positive-sense single-stranded RNA viruses
- Arteriviridae Coronaviridae , Roniviridae, Astroviridae , Barnaviridae , Bromoviridae, Caliciviridae , Closteroviridae, Comoviridae, Dicistroviridae , Flaviviridae , Flexiviridae, Hepeviridae, Eeviviridae, Euteoviridae , Marnaviridae, Narnaviridae, Nodaviridae, Picornaviridae, Potyviridae, Sequiviridae, Tetraviridae, Togaviridae, Tombusviridae, Tymoviridae, Virgaviridae, Benyvirus, Cheravirus, Idaeovirus, Machlomovirus , Ourmiavirus, Sadwavirus Sobemovirus and Umbravirus.
- Exemplary species of positive-sense single-stranded RNA viruses that can infect humans include, without limitation, hepatitis C virus, yellow fever virus, West Nile virus, dengue virus, Zika virus, Chikungunya virus, rubella virus, MERS, SARS, and SARS-CoV-2.
- Group V negative- sense single- stranded RNA viruses
- groups including the following families: Qinviridae, Aspiviridae, Chuviridae, Bornaviridae, Filoviridae, Mymonaviridae , Nyamiviridae, Paramyxoviridae, Pneumoviridae , Rhabdoviridae, Sunviridae, Yueviridae, Arenaviridae , Cruliviridae, Feraviridae, Fimoviridae, Hantaviridae, Jonviridae, Nairoviridae, Peribunyaviridae, Phasmaviridae, Phenuiviridae , Tospoviridae, Amnoonviridae and Orthomyxoviridae .
- Exemplary species of negative- sense single-stranded RNA viruses that can infect humans include, without limitation, Ebola virus, Lassa virus, Marburg virus, measles virus, rabies virus, mumps virus, Influenza viruses, and respiratory syncytial virus.
- Group VI negative-strand single-stranded RNA-reverse transcriptase viruses
- Metaviridae Pseudoviridae and Retroviridae
- Exemplary species of negative- strand single-stranded RNA-reverse transcriptase viruses that can infect humans include, without limitation, human immunodeficiency virus (HIV), and human T-cell leukemia-lymphoma virus (HTLV).
- HIV human immunodeficiency virus
- HTLV human T-cell leukemia-lymphoma virus
- the RNA molecule is packaged into or otherwise comprised within an RNA virus vector derived from a Group III, Group IV, Group V or Group VI RNA virus.
- the RNA molecule is packaged into or otherwise comprised within an RNA virus vector derived from a Group VI RNA virus.
- the RNA molecule may comprise a packaging sequence.
- Viral packaging sequences include bacteriophage packaging sequences (such as, e.g., DNA phage packaging sequences and RNA phage packaging sequences) and eukaryotic virus packaging sequences (such as, e.g., DNA virus packaging sequences and RNA virus packaging sequences).
- the packaging sequence may be:
- RNA virus (i) a wild-type packaging sequence from an RNA virus; or preferably
- RNA virus of the same genus as the one of the RNA virus into which the RNA molecule is to be packaged into, or yet even more preferably
- the packaging sequence may be a modified packaging sequence which shares more than 70 %, 75 %, 80 %, 85 %, 90 %, 95 % of sequence identity or even more with the wild-type packaging sequence of (i), (ii), (iii), (iv) or (v) above, while retaining its ability to trigger the process of packaging inside a viral capsid.
- packaging sequences include, but are not limited to, the psi ( ) packaging signal of HIV or SIV; the core encapsidation signal from Gammaretrovirus; the epsilon (s) encapsidation signal from HBV, and the encapsidation signal from BLV.
- the RNA molecule is packaged into or otherwise comprised within an RNA virus vector derived from a Group VI RNA virus of the Retroviridae family.
- the present invention encompasses thus a retroviral vector comprising the RNA molecule described herein.
- Retroviruses are enveloped viruses from the Retroviridae family. They package two identical single-stranded ribonucleic acid (RNA) molecules of typically 7 to 10 kb in length, forming their genome.
- the genome of retroviruses typically comprises gag, pol and env genes flanked by two long terminal repeat (LTRs) sequences. Each of these genes encodes for numerous peptides, which are initially expressed in the form of a single precursor polypeptide.
- the gag gene encodes for the internal structure proteins (matrix, capsid and nucleocapsid); the pol gene encodes for retroviral enzymes reverse transcriptase, integrase and protease; and the env gene encodes for viral envelope glycoprotein.
- the genome of retroviruses can further contain cA-acting elements, e.g., elements responsible for exporting out of the nucleus the unspliced viral genomic RNA which will be packaged, such as a Rev-response element (RRE) sequence.
- RRE Rev-response element
- the 5’ and 3’ LTRs serve to promote transcription and also serve as a poly adenylation sequence of the viral RNAs. Sequences necessary for the initiation of reverse transcription of the genome and for the encapsidation of viral RNA in particles (psi [ ] packaging element) are typically adjacent to the 5’ LTR.
- the genome of more complex retroviruses may comprise additional genes encoding accessory and/or regulatory proteins such as src, sag, tax, vif, vpr, vpx, vpu, nef, tat, rev, tmx, tas and/or bet.
- the HIV-1 genome contains 7 accessory genes: vif, vpr, vpx, vpu, nef, tat and rev.
- Retroviridae family is subdivided into two subfamilies: Orthoretrovirinae and Spumaretrovirinae.
- the retroviral vector is (or is derived from) an Orthoretrovirinae or a Spumaretrovirinae.
- the retroviral vector is (or is derived from) an Orthoretrovirinae .
- the Orthoretrovirinae subfamily is subdivided into six genera: Alpharetrovirus, Betaretrovirus, Deltaretrovirus, Epsilonretrovirus, Gammaretrovirus, and Lentivirus.
- Alpharetrovirus examples include, but are not limited to, avian sarcoma leukosis virus (ASLV), Rous sarcoma virus (RSV), and avian myeloblastosis virus (AMV).
- ASLV avian sarcoma leukosis virus
- RSV Rous sarcoma virus
- AMV avian myeloblastosis virus
- Betaretrovirus examples include, but are not limited to, mouse mammary tumor virus (MMTV), Jaagsiekte sheep retrovirus (JSRV), enzootic nasal tumor viruses (ENTV; including ENTV-1 and ENTV-2), simian retroviruses (SRV; including SRV-1 and SRV-2), and Mason-Pfizer monkey virus (M-PMV; formerly known as SRV-3).
- MMTV mouse mammary tumor virus
- JSRV Jaagsiekte sheep retrovirus
- ENTV enzootic nasal tumor viruses
- SRV simian retroviruses
- M-PMV Mason-Pfizer monkey virus
- Exemplary species of Deltaretrovirus include, but are not limited to, human T-lymphotropic viruses (HTLV; including HTLV-1, HTLV-2, HTLV-3 and HTLV-4), simian T-lymphotropic viruses (STLV; including STLV-1, STLV-2, STLV-3, and STLV-4), and bovine leukemia virus (BLV).
- HTLV human T-lymphotropic viruses
- STLV simian T-lymphotropic viruses
- BLV bovine leukemia virus
- Epsilonretrovirus examples include, but are not limited to, Walleye dermal sarcoma virus (WDSV), and Walleye epidermal hyperplasia viruses (WEHV; including WEHV-1 and WEHV-2).
- WDSV Walleye dermal sarcoma virus
- WEHV Walleye epidermal hyperplasia viruses
- Exemplary species of Gammaretrovirus include, but are not limited to, murine leukemia viruses (MLV), Abelson murine leukemia virus (AMLV), Friend virus (FV), feline leukemia virus (FeLV), koala retrovirus (KoRV), xenotropic murine leukemia virus-related virus (XMRV), chick syncytial virus (CSV), murine sarcoma viruses (MSV; including Finkel-Biskis-Jinkins murine sarcoma virus, Harvey murine sarcoma virus, Kirsten murine sarcoma virus and Moloney murine sarcoma virus), feline sarcoma viruses (FSV; including Gardner- Arnstein feline sarcoma virus, Hardy-Zuckerman feline sarcoma virus and Snyder- Theilen feline sarcoma virus), Gibbon ape leukemia virus (GaLV), guinea pig type-C oncovirus, porc
- Lentivirus examples include, but are not limited to, human immunodeficiency viruses (HIV; including HIV-1 and HIV-2), simian immunodeficiency viruses (SIV), feline immunodeficiency virus (FIV), bovine immunodeficiency virus (BIV), puma lentivirus (PLV), equine infectious anemia virus (EIAV), caprine arthritis encephalitis virus (CAEV), Visna-maedi virus, and Jembrana disease virus.
- HSV human immunodeficiency viruses
- SIV simian immunodeficiency viruses
- FV feline immunodeficiency virus
- BIV bovine immunodeficiency virus
- PLV puma lentivirus
- EIAV equine infectious anemia virus
- CAEV caprine arthritis encephalitis virus
- Visna-maedi virus and Jembrana disease virus.
- the retroviral vector is (or is derived from) an Alpharetrovirus, a Betaretrovirus, a Deltaretrovirus, an Epsilonretrovirus, a Gammaretrovirus or a Lentivirus.
- the retroviral vector is (or is derived from) a Lentivirus.
- the retroviral vector is (or is derived from) a Lentivirus selected from the group comprising or consisting of human immunodeficiency viruses (HIV; including HIV-1 and HIV-2), simian immunodeficiency viruses (SIV), feline immunodeficiency virus (FIV), bovine immunodeficiency virus (BIV), puma lentivirus (PLV), equine infectious anemia virus (EIAV), caprine arthritis encephalitis virus (CAEV), Visna-maedi virus (VMV), and Jembrana disease virus (JDV).
- HCV human immunodeficiency viruses
- SIV simian immunodeficiency viruses
- FV feline immunodeficiency virus
- BIV bovine immunodeficiency virus
- PLV puma lentivirus
- EIAV equine infectious anemia virus
- CAEV caprine arthritis encephalitis virus
- the retroviral vector is (or is derived from) a human immunodeficiency virus, such as HIV-1 and HIV-2; more preferably HIV-1.
- a retroviral vector as described herein packages two RNA molecules, each comprising an RNA Booster sequence and a sequence of interest, as described above.
- the two RNA molecules may comprise the same sequence of interest, or different sequences of interest.
- retroviral vector comprising a recombinant ribonucleic genome, itself comprising, from 5’ to 3 ’or from 3’ to 5’: an RNA Booster sequence, and a sequence of interest.
- the retroviral vector comprises a recombinant ribonucleic genome, itself comprising, from 5’ to 3 ’or from 3’ to 5’: a packaging sequence, an RNA Booster sequence, and a sequence of interest.
- the retroviral vector comprises a recombinant ribonucleic genome, itself comprising, from 5’ to 3’: a 5’ LTR, a packaging sequence, an RNA Booster sequence, a sequence of interest, and a 3’ LTR.
- the retroviral vector comprises a recombinant ribonucleic genome, itself comprising, from 5’ to 3’: a 5’ LTR, a packaging sequence, a Rev-response element, an RNA Booster sequence, a sequence of interest, and a 3’ LTR.
- the retroviral vector comprises a recombinant ribonucleic genome, itself comprising, from 5’ to 3’: a 5’ LTR, a packaging sequence, a Rev-response element, an RNA Booster sequence, a sequence of interest, a post-transcriptional regulatory element, and a 3’ LTR.
- the retroviral vector is reverse transcriptase-defective.
- the gene encoding the reverse transcriptase may be mutated or deleted, so that the reverse transcription process is altered and cannot be completed, cannot give rise to a full-length retroviral double-stranded DNA intermediate molecule upon infection of a target cell, and consequently, cannot generate a proviral vector genome.
- This inability in the context of the invention, can result either from (i) an absence of the reverse transcriptase gene in the retroviral vector, or (ii) at least one mutation in the reverse transcriptase gene in the retroviral vector.
- a HIV-1 reverse transcriptase with SEQ ID NO: 4 may comprise a D110E substitution resulting in an abolished reverse transcriptase activity.
- the retroviral vector might further be integrase-defective.
- the gene encoding the integrase might be mutated or deleted, so that the integration process is altered and cannot be completed, i.e., a proviral vector genome cannot be integrated into the genome of a target cell.
- This inability can result either from (i) an absence of the integrase gene in the retroviral vector, or (ii) at least one mutation in the integrase gene in the retroviral vector.
- the RNA or DNA molecule in particular when packaged into or otherwise comprised within an RNA virus vector, may further comprise one or several elements, in particular one or several of long terminal repeats (LTR), including a 5’ LTR and a 3’ LTR; a Rev -response element (RRE) sequence; and a post-transcriptional regulation element sequence.
- LTR long terminal repeats
- RRE Rev -response element
- the RNA or DNA molecule comprises a 5’ LTR, located in 5’ of the packaging sequence (in other words, before the packaging sequence).
- the RNA or DNA molecule comprises a Rev-response element (RRE) sequence, located in 3’ of the packaging sequence but in 5’ of the RNA Booster sequence (in other words, between the packaging sequence and the RNA Booster sequence).
- RRE Rev-response element
- the RNA or DNA molecule comprises a post-transcriptional regulation element sequence, located in 3’ of the sequence of interest (in other words, after the sequence of interest).
- the RNA or DNA molecule comprises a 3’ LTR, located in 3’ of the sequence of interest (in other words, after the sequence of interest).
- the 3’ LTR is located in 3’ of this post-transcriptional regulation element sequence.
- the RNA or DNA molecule may thus comprise, from 5’ to 3’: optionally, a 5’ LTR, optionally, a packaging sequence, optionally, a Rev-response element, compulsorily, an RNA Booster sequence, compulsorily, a sequence of interest, optionally, a post-transcriptional regulatory element, and optionally, a 3’ LTR.
- the RNA or DNA molecule may thus comprise, from 5’ to 3’: optionally, a 5’ LTR, compulsorily, a packaging sequence, optionally, a Rev-response element, compulsorily, an RNA Booster sequence, compulsorily, a sequence of interest, optionally, a post-transcriptional regulatory element, and optionally, a 3’ LTR.
- the RNA or DNA molecule may thus comprise, from 5’ to 3’: optionally, a 5’ LTR, optionally, a packaging sequence, optionally, a Rev-response element, compulsorily, a sequence of interest, optionally, a post-transcriptional regulatory element, optionally, a 3’ LTR, and compulsorily, an RNA Booster sequence.
- the RNA or DNA molecule may thus comprise, from 5’ to 3’: optionally, a 5’ LTR, compulsorily, a packaging sequence, optionally, a Rev-response element, compulsorily, a sequence of interest, optionally, a post-transcriptional regulatory element, optionally, a 3’ LTR, and compulsorily, an RNA Booster sequence.
- a second object of the invention is a composition comprising, consisting of, or consisting essentially of, the RNA or DNA molecule described above.
- an object of the invention is a composition comprising, consisting of, or consisting essentially of, the non- viral vector described above, or the viral vector, in particular the retroviral vector, described above.
- the composition is a pharmaceutical composition and further comprises at least one pharmaceutically acceptable excipient or carrier.
- compositions or pharmaceutical composition include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, serum proteins (such as human serum albumin), buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances (for example sodium carboxymethylcellulose), polyethylene glycol, poly acrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol and wool fat.
- ion exchangers alumina, aluminum stearate, lecithin
- serum proteins such as human serum albumin
- buffer substances such as phosphates, glycine, sorbic acid, potassium
- a third object of the invention relates to the various uses and applications of the RNA or DNA molecule, in particular of the non-viral vector or viral vector, in particular the retroviral vector, or of the composition, as described above.
- the eukaryote is an animal, preferably a mammal, even more preferably a human.
- a method in particular an in vitro or ex vivo method, of transiently expressing at least one sequence of interest in a cell, which method comprises contacting or otherwise transfecting or transducing the cell with the RNA or DNA molecule, or with the non-viral vector or viral vector, in particular the retroviral vector, as described above.
- RNA or DNA molecule is under control of promoter noninducible.
- RNA or DNA molecule is under control of promoter inducible.
- RNA or DNA molecule is under control of strong promoter.
- RNA or DNA molecule, or the non-viral vector or viral vector, in particular the retroviral vector, or of the composition for use in therapy, as a drug or as a medicament.
- RNA or DNA molecule, or the non-viral vector or viral vector, in particular the retroviral vector, or the composition for use in preventing or treating a disease in a subject in need thereof; or a method of preventing or treating a disease, comprising administering to a subject in need thereof the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition.
- the disease is selected from the group consisting of cancer, infectious diseases, neuromuscular diseases, ocular diseases, blood diseases, cardiovascular diseases, skin diseases, and neurodegenerative diseases.
- the disease is cancer.
- cancers include those listed in the 11 th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 02 “Neoplasms”.
- ICD International Statistical Classification of Diseases and Related Health Problems
- cancers include, but are not limited to, recurrent, metastatic or multi-drug resistant cancer.
- cancers include, but are not limited to, adenofibroma, adenoma, agnogenic myeloid metaplasia, AIDS-related malignancies, ameloblastoma, anal cancer, angiofollicular mediastinal lymph node hyperplasia, angiokeratoma, angiolymphoid hyperplasia with eosinophilia, angiomatosis, anhidrotic ectodermal dysplasia, anterofacial dysplasia, apocrine metaplasia, apudoma, asphyxiating thoracic dysplasia, astrocytoma (including, e.g., cerebellar astrocytoma and cerebral astrocytoma), atriodigital dysplasia, atypical melanocytic hyperplasia, atypical metaplasia, autoparenchymatous metaplasia, basal cell hyperplasia, benign giant lymph
- the disease is an infectious disease.
- infectious diseases include those listed in the 11 th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 01 “Certain infectious or parasitic diseases”.
- ICD International Statistical Classification of Diseases and Related Health Problems
- infectious diseases include, but are not limited to, bacterial infections, viral infections, fungal infections, parasitic infections, ectoparasitic infections, and the like.
- the disease is a neuromuscular disease.
- neuromuscular diseases include, but are not limited to, acid maltase deficiency, amyotrophic lateral sclerosis, Andersen-Tawil syndrome, Becker muscular dystrophy, Becker myotonia congenita, Bethlem myopathy, bulbospinal muscular atrophy, carnitine deficiency, carnitine palmityl transferase deficiency, central core disease, centronuclear myopathy, Charcot-Marie-Tooth disease, congenital muscular dystrophy, congenital myasthenic syndromes, congenital myotonic dystrophy, Cori disease, Debrancher enzyme deficiency, Dejerine- Sottas disease, dermatomyositis, distal muscular dystrophy, Duchenne muscular dystrophy, dystrophia myotonica, Emery- Dreifuss muscular dystrophy, endocrine myopathies, Eulenberg disease, facioscapulohumeral muscular dystrophy,
- the disease is an ocular disease.
- Examples of ocular diseases include those listed in the 11 th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 09 “Diseases of the visual system”.
- ICD International Statistical Classification of Diseases and Related Health Problems
- ocular diseases include, but are not limited to, age-related macular degeneration (AMD, e.g., wet AMD, dry AMD, intermediate AMD, advanced AMD, and geographic atrophy (GA)), macular degeneration, macular edema, diabetic macular edema (DME, e.g., focal, non-center DME and diffuse, center-involved DME), retinopathy, diabetic retinopathy (DR, e.g., proliferative DR (PDR), non-proliferative DR (NPDR), and high-altitude DR), other ischemia-related retinopathies, ROP, retinal vein occlusion (RVO, e.g., central (CRVO) and branched (BRVO) forms), choroidal neovascularization (CNV, e.g., myopic CNV), corneal neovascularization, diseases associated with corneal neovascularization, retinal neovascularization, retinal
- uveitis e.g., infectious or non- infectious uveitis
- choroiditis e.g., multifocal choroiditis
- ocular histoplasmosis blepharitis, dry eye, traumatic eye injury, and Sjogren’s disease.
- the disease is a blood disease.
- Examples of blood diseases include those listed in the 11 th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 03 “Diseases of the blood or blood-forming organs”.
- ICD International Statistical Classification of Diseases and Related Health Problems
- blood diseases include, but are not limited to, acute myeloid leukemia, acute promyelocytic leukemia, acute lymphoblastic leukemia, chronic myelogenous leukemia, myelodysplastic syndromes, anemia, methaemoglobinaemia, hemophilia, non-thrombocytopenic purpura, thrombocytosis, and thrombocytopenia.
- the disease is a cardiovascular disease.
- cardiovascular diseases include those listed in the 11 th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 11 “Diseases of the circulatory system”.
- ICD International Statistical Classification of Diseases and Related Health Problems
- cardiovascular diseases include, but are not limited to, aneurysm, angina, arrhythmia, atherosclerosis, cardiomyopathy, stroke, cerebrovascular disease, congenital heart disease, congestive heart failure, myocarditis, valve disease coronary, artery disease dilated, cardiomyopathy, diastolic dysfunction, endocarditis, hypertension, hypertrophic cardiomyopathy, mitral valve prolapse, myocardial infarction, and venous thromboembolism.
- the disease is a skin disease.
- Examples of skin diseases include those listed in the 11 th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 14 “Diseases of the skin”.
- ICD International Statistical Classification of Diseases and Related Health Problems
- skin diseases include, but are not limited to, atopic dermatitis, hand dermatitis, contact dermatitis, allergic contact dermatitis, irritant contact dermatitis, neurodermatitis, perioral dermatitis, stasis dermatitis, dyshidrotic eczema, xerotic dermatitis, nummalar dermatitis, seborrheic dermatitis, eyelid dermatitis, diaper dermatitis, dermatomyositis, lichen planus, lichen sclerosis, alopecia areata, vitiligo, rosacea, epidermolysis bullosa, keratosis pilaris, pityriasis alba, pemphigus, vulvovaginitis, acne, chronic spontaneous urticaria, chronic idiopathic urticaria, chronic physical urticaria, Vogt-Koyanagi-Harada disease, Sutton
- the disease is a neurodegenerative disease.
- neurodegenerative diseases include, but are not limited to, Alzheimer’s disease, Parkinson’s disease, amyotrophic lateral sclerosis (ALS), frontotemporal dementia, spinocerebellar ataxia (SCA) type 1, SCA type 2, SCA type 6, SCA type 7, SCA type 17, Machado -Joseph disease/SCA type 3 (MJD/SCA3), Huntington’s disease, dentatorubral pallidoluysian atrophy (DRPLA), spinal and bulbar muscular atrophy (SBMA), prion disease, and motor neuron disease.
- ALS amyotrophic lateral sclerosis
- SCA spinocerebellar ataxia
- SCA spinocerebellar ataxia
- SCA spinocerebellar ataxia
- SCA spinocerebellar ataxia
- SCA spinocerebellar ataxia
- SCA spinocerebellar ataxia
- SCA spinocerebellar ataxia
- RNA molecule or DNA molecule or the non- viral vector or viral vector in particular the retroviral vector, or the composition
- skin and/or skin appendages such as hair, nails or skin glands
- a method of treating skin and/or skin appendages such as hair, nails or skin glands in a subject in need thereof against, comprising administering to the subject in need thereof the RNA molecule or DNA molecule or the non- viral vector or viral vector, in particular the retroviral vector, or the composition.
- these uses and methods are preferably non-therapeutic uses and methods, a cosmetic use or method.
- these non-therapeutic uses and methods are applicable to substantially healthy subject.
- a “substantially healthy subject” is a subject who has not been previously diagnosed or identified as suffering from skin and/or hair and/or nails diseases
- a “substantially healthy subject” is a subject who has not been previously diagnosed or identified as suffering from skin and/or hair and/or nails diseases.
- a “substantially healthy subject” is a subject who does not suffer from any known disease, disorder or condition.
- a “substantially healthy subject” is a subject who is not seeking medical attention.
- Examples of treatments of skin and/or skin appendages include for instance any or several of induction of hair growth, prevention of hair loss, induction of hair removal, hair coloring or bleaching, prevention of hair graying, promotion of hair thickening, promotion of or prevention of hair curling, promotion of skin healing, promotion of skin repairing, promoting skin appearance, prevention of wrinkle formation, improvement of skin elasticity, induction of skin tone homogenization, and reduction of sebum secretion.
- the non-therapeutic treatment corresponds to promoting skin healing by improving the appearance of the skin.
- inducing hair growth and/or promoting skin healing can be achieved using the RNA or DNA molecule, in particular the retroviral vector, of the invention, in particular wherein the sequence of interest encodes the glia-activating factor (aka FGF9).
- FGF9 glia-activating factor
- the skilled artisan will readily recognize that other sequences of interest can be used for cosmetic purposes, including, for instance, sequences coding for growth factors.
- sequences of interest that can be used for cosmetic purposes include, but are not limited to, sequences encoding the hepatocyte growth factor (HGF), the platelet-derived growth factor (PDGF), the fibroblast growth factor 5 (FGF5) (including FGF5-short [FGF5s] and FGF5-long [FGF51]), the fibroblast growth factor 7 (FGF7), the fibroblast growth factor 10 (FGF10), the transforming growth factor pi (TGFpi), the transforming growth factor a (TGFa), the keratinocyte growth factor (KGF), the insulin-like growth factor 1 (IGF-1), the insulin-like growth factor 2 (IGF-2), the insulin-like growth factor-binding protein 5 (IGFBP5), the vascular endothelial growth factor (VEGF), the acidic fibroblast growth factor (aFGF), the basic fibroblast growth factor (bFGF), the epidermal growth factor (EGF), the collagen genes (COL1A1, COL1A
- the RNA molecule, the non- viral vector or viral vector, in particular the retroviral vector, or the composition is in non-therapeutic concentration, in particular in a concentration low enough not to induce a therapeutic effect. Therefore, the non-therapeutic concentration is depending of the RNA molecule and more specifically, on the sequence of interest. The skilled artisan is familiar with the non-therapeutic concentrations.
- the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition is to be administered topically, in particular cutaneously or transdermally.
- the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition is to be administered topically after collagen induction therapy (CIT).
- CIT collagen induction therapy
- the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition is used as an epidermal and/or dermal stimulating agent, preferably as an epidermal agent.
- collagen induction therapy also known as “microneedling”, “dermarolling”, or “skin needling” refers to a cosmetic procedure which involves repeatedly puncturing the skin of a subject with microneedles (z.e., needles having a length typically ranging from about 100 pm to 1 000 pm).
- kits comprising a microneedling device and the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
- the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition is to be administered topically though application onto the skin of a transdermal patch, in particular of a microneedle transdermal patch, comprising said RNA molecule or DNA molecule or non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
- transdermal patch in particular a microneedle transdermal patch, comprising the RNA molecule or DNA molecule the non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
- these uses and methods are preferably therapeutic uses and/or methods.
- these non-therapeutic uses and methods are applicable to substantially sick subject.
- a “substantially sick subject” is a subject who has been previously diagnosed or identified as suffering from skin and/or hair and/or nails diseases
- a “substantially sick subject” is a subject who has been previously diagnosed or identified as suffering from skin and/or hair and/or nails diseases.
- a “substantially sick subject” is a subject who does suffer from any known disease, disorder or condition.
- a “substantially sick subject” is a subject who is seeking medical attention.
- Examples of therapies of skin and/or skin appendages, in particular of therapeutic treatments, include for instance any or several of induction of promotion of skin and/or hair and/or nail healing.
- RNA molecule in particular the retroviral vector, of the invention.
- sequences of interest can be used for therapeutic purposes, as promoting skin and/or hair healing including, for instance, sequences coding for growth factors.
- sequences of interest that can be used for cosmetic purposes include, but are not limited to, sequences encoding the hepatocyte growth factor (HGF), the platelet-derived growth factor (PDGF), the fibroblast growth factor 5 (FGF5) (including FGF5-short [FGF5s] and FGF5-long [FGF51]), the fibroblast growth factor 7 (FGF 7), the fibroblast growth factor 10 (FGF10), the transforming growth factor pi (TGFpi), the transforming growth factor a (TGFa), the keratinocyte growth factor (KGF), the insulin-like growth factor 1 (IGF-1), the insulin-like growth factor 2 (IGF-2), the insulin-like growth factor-binding protein 5 (IGFBP5), the vascular endothelial growth factor (VEGF), the acidic fibroblast growth factor (aFGF), the basic fibroblast growth factor (bFGF), the epidermal growth factor (EGF), the collagen genes (COE1A1, COE1
- HGF hepatocyte growth
- the RNA molecule, the non- viral vector or viral vector, in particular the retroviral vector, or the composition is in therapeutic concentration, in particular in a concentration high enough to induce a therapeutic effect. Therefore, the therapeutic concentration is depending of the RNA molecule and more specifically, on the sequence of interest. The skilled artisan is familiar with the therapeutic concentrations.
- the RNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition is to be administered topically, in particular cutaneously, transdermally or subdermally, and prefereably transdermally or subdermally, more preferably subdermally.
- administration to the subject may be carried out by systemic injection.
- systemic injections include, but are not limited to, intravenous (iv), subcutaneous (sc), intramuscular (im), intradermal (id), intraperitoneal (ip), and intranasal (in) injection.
- Injections can be performed subcutaneously, intramuscularly, intranasally or intraperitoneally, with various combinations for the prime and boost injection.
- the RNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition is to be administered topically after collagen induction therapy (CIT).
- CIT collagen induction therapy
- the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition is used as an epidermal and/or dermal stimulating agent, preferably as an dermal agent.
- collagen induction therapy also known as “microneedling”, “dermarolling”, or “skin needling” refers to a cosmetic procedure which involves repeatedly puncturing the skin of a subject with microneedles (z.e., needles having a length typically ranging from about 100 pm to 1 000 pm).
- kits comprising a microneedling device and the RNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
- the RNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition is to be administered topically though application onto the skin of a transdermal patch, in particular of a microneedle transdermal patch, comprising said RNA molecule, non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
- a transdermal patch, in particular a microneedle transdermal patch comprising the RNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
- RNA molecule or DNA molecule or the non-viral vector or viral vector in particular the retroviral vector, or the composition
- a method of vaccinating a subject in need thereof against an infectious disease or against cancer comprising administering to the subject in need thereof the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition.
- vaccinating a subject can be efficiently achieved using the RNA molecule, in particular the retroviral vector, of the invention.
- sequence of interest in this instance should encode an antigen against which an immunization is desired.
- antigens include, without limitation, pathogen-related antigens (such as, e.g., antigens of microorganisms or parasites, such as viruses, fungi or bacteria, or archaea, or immunogenic molecules derived from them), self-antigens (such as, e.g., cellular antigens including cells containing normal transplantation antigens and/or tumor-related antigens, RR-Rh antigens, and antigens characteristic of, or specific to particular cells or tissues or body fluids), and allergen-related antigens (such as, e.g., those associated with environmental allergens, including grasses, pollens, molds, dust, insects, dander, venoms, and the like; occupational allergens, including latex, dander, urethanes, epoxy resins, and the like; food, including shellfish, peanuts, eggs, milk products, and the like; and drugs, including antibiotics, anesthetics, and the like).
- pathogen-related antigens include, but are not limited to, antigens derived from vaccinia, avipox virus, turkey influenza virus, bovine leukemia virus, feline leukemia virus, avian influenza, chicken pneumovirosis virus, canine parvovirus, equine influenza, FHV, Newcastle disease virus (NDV), Chicken/Pennsylvania/1/83 influenza virus, infectious bronchitis virus, Dengue virus, measles virus, Rubella virus, pseudorabies, Epstein-Barr virus, HIV, SIV, EHV, BHV, HCMV, MERS, SARS, SARS-CoV-2, Hantaan, C.
- tetani mumps, Morbillivirus, Herpes Simplex virus type 1, Herpes Simplex virus type 2, Human cytomegalovirus, hepatitis A virus, hepatitis B virus, hepatitis C virus, hepatitis E virus, respiratory syncytial virus, human papilloma virus, Influenza virus, Salmonella, Neisseria, Borrelia, Chlamydia, Bordetella, Plasmodium, Toxoplasma, Cryptococcus, Streptococcus, Staphylococcus, Haemophilus, Diptheria, Tetanus, Pertussis, Escherichia, Candida, Aspergillus, Entamoeba, Giardia, Trypanosoma, Leishmania, and Malaria.
- Suitable examples of self-antigens include, but are not limited to, lupus autoantigen, Smith, Ro, La, Ul-RNP, fibrillin, nuclear antigens, histones, glycoprotein gp70, ribosomal proteins, pyruvate dehydrogenase, dehydrolipoamide acetyltransferase (PCD-E2), hair follicle antigens, human tropomyosin isoform 5 (hTM5), proinsulin, insulin, IA2, GAD65, collagen type II, human cartilage gp 39 (HCgp39), gpl30-RAPS, dnaJpl, citrullinated proteins and peptides (including citrullinated type II collagen, citrullinated vimentin and citrullinated fibrinogen), myelin basic protein, proteolipid protein (PLP), myelin oligodendrocyte glycoprotein (MOG), thyroid stimulating factor receptor (TSH-R), acet
- tumor-related antigens include, but are not limited to, MART-l/Melan-A, gplOO, dipeptidyl peptidase IV (DPPIV), adenosine deaminase-binding protein (ADAbp), cyclophilin b, colorectal associated antigen (CRC)-CO17-1A/GA733, carcinoembryonic antigen (CEA) and its immunogenic epitopes CAP-1 and CAP-2, etv6, amll, prostate specific antigen (PSA) and its immunogenic epitopes PSA-1, PSA-2, and PSA-3, prostate-specific membrane antigen (PSMA), T-cell receptor/CD3-zeta chain, MAGE-family of tumor antigens (e.g., MAGE-A1, MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A5, MAGE-A6, MAGE-A7, MAGE-A8, MAGE-A9, MAGE-
- HER2/neu p21ras, RCAS1, alpha-fetoprotein, E-cadherin, alpha-catenin, beta-catenin and gamma-catenin, pl20ctn, gpl00.sup.Pmelll7, PRAME, NY-ESO-1, cdc27, adenomatous polyposis coli protein (APC), fodrin, connexin 37, Ig-idiotype, pl5, gp75, GM2 and GD2 gangliosides, Smad family of cancer antigens brain glycogen phosphorylase, SSX-1, SSX-2 (HOM-MEL-40), SSX-1, SSX-4, SSX-5, SCP-1 and CT-7, and c-erbB-2 and viral antigens such as the HPV-16 and HPV-18 E6 and E7 antigens and the EBV-encoded nuclear antigen (EBNA)-l, and the like
- tumor-related antigens are described in, e.g., Li et al., 2004. Cancer Immunol Immunother. 53(3): 139-43; Novellino et al., 2005. Cancer Immunol Immunother. 54(3):187-20; which are herein incorporated by reference in their entirety.
- the RNA molecule, DNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition can be administered to a subject in need thereof once, twice, or more.
- the first administration is typically referred to as “priming step”, and the subsequent administration(s) are referred to as “boosting step”.
- the boosting step can be carried out once, twice, three times, four times or more.
- the period of time between the priming step and the boosting step and/or between each iteration of the “boosting step” ranges from about 1 day to about 6 months, preferably from about 1 week to about 3 months, more preferably from about 2 weeks to about 1 month.
- the period of time between the priming step and the boosting step and/or between each iteration of the “boosting step” is about 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, or 6 months.
- administration to the subject may be carried out by systemic injection.
- systemic injections include, but are not limited to, intravenous (iv), subcutaneous (sc), intramuscular (im), intradermal (id), intraperitoneal (ip), and intranasal (in) injection.
- each injection may be carried out via the same route, or by different route.
- the priming step can be carried out by intramuscular injection and the boosting step can be carried out by intranasal injection; or the priming step can be carried out by intraperitoneal injection and boosting step by intranasal injection.
- both the priming and boosting steps can be carried out by intraperitoneal injection.
- RNA molecule or DNA molecule or the non- viral vector or viral vector in particular the retroviral vector, or the composition, for use in genome engineering; or a method of genome engineering, comprising administering to a subject in need thereof the RNA molecule or DNA molecule or the non- viral vector or viral vector, in particular the retroviral vector, or the composition.
- Such genome engineering applications are useful, in particular in the field of bioproduction, or in methods of therapeutic treatment such as cell therapy or gene therapy.
- RNA molecules or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition is contacted ex vivo with a cell or a population of cells from a subject, and optionally the cell or population of cells is then administered back to said subject.
- sequence of interest in this instance should encode a genome editor.
- Examples of genome editors include, but are not limited to, CRISPR-associated proteins (Cas), zinc finger nucleases (ZNFs), transcription activator-like effector nucleases (TALEN), and site-specific recombinases (such as, e.g., a Cre recombinase or flippase [Flp]).
- Cas CRISPR-associated proteins
- ZNFs zinc finger nucleases
- TALEN transcription activator-like effector nucleases
- site-specific recombinases such as, e.g., a Cre recombinase or flippase [Flp]).
- CRISPR-associated proteins include, without limitation, class 2 Cas proteins such as, e.g., Cas9, Casl2 (including Casl2a (or Cpfl), Cas 12b (or C2cl), Casl2c (or C2c3), Casl2d (or CasY), Casl2e (or CasX), Casl2f (or Casl4 or C2cl0), Cas 12g, Casl2h, Casl2i, and Cas 12k (or C2c5)), and Cas 13 (including Cas 13a (or C2c2), Casl3b, Casl3c, and Casl3d).
- the nucleic acid coding for CRISPR-associated proteins can be fused with at least another nucleic acid sequence, such as prime editing guide RNA (pegRNA) and/or base editing RNA.
- pegRNA prime editing guide RNA
- base editing RNA base editing RNA
- genome editors may require at least one RNA or DNA molecule, in particular in the case of CRISPR-associated proteins, which RNA or DNA molecule is capable of interacting with the genome editor and targeting it to a locus of interest in a cell’s genome.
- Said RNA molecule may be known in the art as guide RNA (gRNA) and/or prime editing guide RNA (pegRNA) and/or base editing RNA.
- gRNA guide RNA
- pegRNA prime editing guide RNA
- base editing RNA RNA molecules
- two RNA molecules a CRISPR RNA named crRNA and a trans-activating CRISPR RNA named tracrRNA
- crRNA a CRISPR RNA named crRNA
- tracrRNA trans-activating CRISPR RNA
- the uses and methods may thus comprise contacting the cell or administering to the subject such gRNA, or a mix of crRNA and tracrRNA, before, concomitantly with or after, the RNA molecule or DNA molecule or the non- viral vector or viral vector, in particular the retroviral vector, or the composition.
- genome editors may further require at least one exogenous nucleic acid, in particular at least one exogenous DNA, which is to be inserted in the genome of a target cell.
- This exogenous nucleic acid may comprise, for instance, the sequence of a gene of interest to be inserted in the genome of a target cell.
- This gene of interest may be, for instance, a functional version of a malfunctioning endogenous gene, or alternatively, a malfunctional version of a normally functioning endogenous gene. It can also be any other gene which expression is desired in a cell, depending on the purpose.
- the method of genome engineering may be particularly suitable for the transgenesis of an organism.
- the organism may be a plant or an animal. In some embodiments, the animal is not a human.
- the method comprises the steps of transfecting or transducing an animal cell with the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition; collecting the animal cell’s nucleus; inserting the animal cell’s nucleus into an unfertilized oocyte; allowing the oocyte to develop, thereby obtaining a transgenic animal, preferably wherein the transgenic animal is not a human.
- sequence of interest of the RNA or DNA molecule is a genome editor, and the nucleic acid sequence encoding the transgene of interest is brought to the cell in addition to the RNA or DNA molecule of the invention, for stable integration into the genome of said cell and development of a transgenic organism.
- the method of genome engineering may be particularly suitable for bioproduction (or recombinant production), in particular for the generation of stable expression systems.
- Such method is applicable, for instance, to the production of recombinant proteins of interest in any suitable expression system, including without limitation, bacterial cells, yeast cells, insect cells, mammalian cells, and human cells.
- the method comprises the steps of transfecting or transducing a cell or a population of cells with the RNA molecule or the DNA molecule or the RNA molecule vectorized or DNA molecule vectorized in a non- viral vector or in a viral vector, in particular the retroviral vector, or the composition; culturing the cell or population of cells for a period of time sufficient to allow the production by said cell or population of cells of a protein of interest encoded by the RNA or DNA molecule; recovering the protein of interest; optionally, purifying the protein of interest.
- sequence of interest of the RNA or DNA molecule is a genome editor, and the nucleic acid sequence encoding the protein of interest is brought to the cell or population of cells in addition to the RNA or DNA molecule of the invention, for stable integration into the genome of said cell or population of cells and recombinant production of the protein of interest.
- a fourth object of the invention is a nucleic acid system comprising at least one nucleic acid sequence comprising the RNA Booster.
- Another object of the invention is a kit comprising said nucleic acid system or RNA or DNA molecule; a cell or cell population comprising said nucleic acid system or RNA or DNA molecule; and/or a method of producing said nucleic acid system or the RNA molecule or the DNA molecule as described herein.
- the invention can be a nucleic acid system; a kit comprising said nucleic acid system; a cell or cell population comprising said nucleic acid system; and a method of producing an RNA virus vector, in particular a retroviral vector, as described above, using said nucleic acid system or said cell or cell population.
- the nucleic acid system comprises at least one nucleic acid sequence encoding a recombinant expression cassette comprising:
- RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm, and/or - a multiple cloning site (MCS) or a sequence of interest, and/or
- an origin of replication ORI
- ORI origin of replication
- the nucleic acid system is in DNA form.
- the first nucleic acid system can be provided in a single linear nucleic acid or plasmid.
- the purpose of the selectable marker is to allow for the selection or identification of cells or organisms that have taken up the gene of interest.
- the selectable marker is an antibiotic resistance gene.
- the antibiotic resistance gene is selected in the group of: ampicillin, kanamycin, neomycin, tetracycline, bleomycin, chloramphenicol, streptomycin resistance gene.
- the origin of replication is selected in the group of: oriC, pl5A, ColEl, SV40.
- the nucleic acid system comprises:
- At least one first nucleic acid sequence encoding an RNA virus genome in particular a retrovirus genome comprising at least a viral, preferably retroviral, gag and pol sequence; optionally wherein the pol sequence encodes a defective reverse-transcriptase (RT) or wherein the pol sequence lacks a RT gene;
- At least one third nucleic acid sequence encoding a recombinant expression cassette comprising: optionally, a promoter, optionally, a 5’ long terminal repeat (LTR), optionally, a packaging sequence, optionally, a Rev-response element, an RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm, optionally, a multiple cloning site (MCS), optionally, a sequence of interest, optionally, an origin of replication (ORI), optionally a selectable marker, optionally, a post-transcriptional regulatory element, and optionally, a 3’ LTR; wherein the first and second nucleic acid sequences lack a functional packaging sequence.
- LTR long terminal repeat
- a packaging sequence optionally, a Rev-response element
- an RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm, optionally, a multiple
- the nucleic acid system comprises:
- At least one first nucleic acid sequence encoding an RNA virus genome in particular a retrovirus genome comprising at least a viral, preferably retroviral, gag and pol sequence; optionally wherein the pol sequence encodes a defective reverse-transcriptase (RT) or wherein the pol sequence lacks a RT gene;
- At least one third nucleic acid sequence encoding a recombinant expression cassette comprising: optionally, a 5’ long terminal repeat (LTR), a packaging sequence, optionally, a Rev-response element, an RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm, optionally, a multiple cloning site (MCS), optionally, a sequence of interest, optionally, a post-transcriptional regulatory element, and optionally, a 3’ LTR; wherein the first and second nucleic acid sequences lack a functional packaging sequence.
- LTR long terminal repeat
- MCS multiple cloning site
- Each nucleic acid sequence (i), (ii) and (iii) defined above is a DNA nucleic acid sequence.
- the RNA Booster sequence in DNA form will comprise thymine in lieu o/uracyl defined above for the RNA molecule.
- RNA Booster sequences in the third nucleic acid sequence include thus, but are not limited to: a deoxyribonucleic acid sequence mmskngkkm or its reverse sequence mkkgnksmm, preferably mmskngkgm or its reverse sequence mgkgnksmm, more preferably cmskhgkgm or its reverse mgkghksmc, even more cmskwgkgm or its reverse sequence mgkgwksmc, yet even more preferably ccsuwgggm or its reverse sequence mgggwuscc, wherein:
- ⁇ “m” indicates an adenine (a) or cytosine (c);
- ⁇ “s” indicates a guanine (g) or a cytosine (c);
- ⁇ “k” indicates a guanine (g) or a thymine (t);
- ⁇ “h” indicates an adenine (a) or a cytosine (c) or a thymine (t);
- ⁇ “w” indicates an adenine (a) or a thymine (t);
- n indicates any nucleotide
- RNA Booster 1 cccgtgtgc, or its reverse sequence RNA Booster 10: cgtgtgccc
- RNA Booster 2 aagtttggc, or its reverse sequence RNA Booster 11: cggtttgaa RNA Booster 3: ccctaggta, or its reverse sequence RNA Booster 12: atggatccc RNA Booster 4: ccgtggtgc, or its reverse sequence RNA Booster 13: cgtggtgcc RNA Booster 5: aactggggc, or its reverse sequence RNA Booster 14: cggggtcaa RNA Booster 6: ccctcgggc, or its reverse sequence RNA Booster 15: cgggctccc RNA Booster 7: cacgtgtgc, or its reverse sequence RNA Booster 16: cgtgtgcac RNA Booster 8: cccttgggc, or its reverse sequence RNA Booster 17: cgggttccc RNA Booster 9
- the at least one first and the at least one second nucleic acid sequences are trans-complementation sequences, i.e., sequences encoding trans-complementation proteins or peptides which are intended to be part of the RNA viral vector, preferably the retroviral vector, as proteins or peptides, but not as nucleic acid information in its ribonucleic genome.
- trans-complementation proteins or peptides are thus typically expressed in trans within a cell or population of cell during the production of the RNA viral vector, preferably the retroviral vector.
- trans-complementation sequences should be present in nucleic acid sequences lacking a functional packaging sequence.
- each at least one nucleic acid sequence (i), (ii) and (iii) defined above may, independently from each other, be a linear nucleic acid or a plasmid.
- the first nucleic acid sequence encoding the RNA virus genome, preferably the retrovirus genome can be provided in a single linear nucleic acid or plasmid, or in two or more linear nucleic acids or plasmids.
- the at least one second nucleic acid sequence encodes an envelope glycoprotein, such as an envelope glycoprotein from (or derived from) an enveloped virus, possibly from a Retroviridae or from any other enveloped virus, such as, e.g., from a Rhabdoviridae, or a cellular glycoprotein or a synthetic glycoprotein.
- an envelope glycoprotein such as an envelope glycoprotein from (or derived from) an enveloped virus, possibly from a Retroviridae or from any other enveloped virus, such as, e.g., from a Rhabdoviridae, or a cellular glycoprotein or a synthetic glycoprotein.
- the at least one second nucleic acid sequence encodes an envelope glycoprotein from Indiana vesiculovirus (formerly known as vesicular stomatitis virus or VSV).
- the at least one third nucleic acid sequence does not comprise a sequence of interest. If so, it is desirable however that the at least one third nucleic acid sequence comprises at least one restriction site (and preferably at least two different restriction sites), or any other means suitable for introducing a gene of interest downstream the RNA Booster sequence.
- the method of producing an RNA viral vector comprises the steps of:
- RNA viral vector preferably the retroviral vector
- RNA viral vector preferably the retroviral vector.
- the method of producing a RNA viral vector alternatively comprises the steps of:
- RNA viral vector preferably the retroviral vector
- the kit comprising at least one nucleic acid system as described above may comprise at least one first, second and third nucleic acid sequences in separate vials or containers.
- two of the first, second and third nucleic acid sequences can be mixed in a single vial or container; in this case, the first and second nucleic acid sequences can preferably be mixed in a single vial or container, and the third nucleic acid sequence can be provided in a separate vial or container.
- the kit may further comprise instructions for use, in particular, instructions for performing the method of producing a RNA viral vector, preferably a retroviral vector, as described above.
- Figures 1A-B show the expression of GFP in 293T cells transduced with an RNA vector derived from lentivirus expressing GFP and comprising one of RNA Booster 1 to RNA Booster 9, or without RNA Booster (0 RNA Booster).
- the RNA Booster being located about 500 nt upstream of GFP.
- Figure 1A is a histogram showing the relative efficacy of GFP expression in 293T cells. The relative expression based on the level of expression after transduction with an RNA vector derived from lentivirus without RNA Booster is shown.
- Figure IB is a histogram showing the transientness of GFP expression in 293T cells. Results are shown as a percentage of 293T cells expressing GFP at day 3 (D3) and day 7 (D7) post-transduction.
- Figure 2 is a histogram showing the percentage of GFP-positive human PBMC after transduction with an integrating lentiviral vector expressing GFP [Integrating LV-GFP], or a RNA vector derived from lentivirus with a mutated reverse transcriptase (D110E substitution) expressing GFP and comprising RNA Booster 8 at two different doses, as indicated [LV-RNA Booster 8/GFP], versus negative control without any transduction [0 vector].
- the RNA Booster being located about 500 nt upstream of GFP.
- Figure 3 is a histogram showing the percentage of GFP-positive human dendritic cells after transduction with an integrating lentiviral vector expressing GFP [Integrating LV-GFP], a non-integrating lentiviral vector expressing GFP [Non-integrating LV-GFP], or a RNA vector derived from lentivirus with a mutated reverse transcriptase (D110E substitution) expressing GFP and comprising RNA Booster 8 [LV-RAA Booster 8/GFP], versus negative control without any transduction [0 vector].
- the RNA Booster being located about 500 nt upstream of GFP.
- Figure 4 is an histogram showing the percentage of GFP-positive human hematopoietic stem cells after transduction with an integrating lentiviral vector expressing GFP [Integrating LV-GFP], or a non-integrating lentiviral vector expressing GFP [Non-integrating LV-GFP], or a RNA vector derived from lentivirus with a mutated reverse transcriptase (D110E substitution) expressing GFP and comprising RNA Booster 8 at two different doses (Multiplicity Of Infection (MOI)), as indicated [LV-RAA Booster 8/GFP], versus negative control without any transduction [0 vector].
- the RNA Booster being located about 500 nt upstream of GFP.
- Figure 5 is a histogram showing the results of a cell proliferation assay of human hair follicle dermal papilla cells transduced or not with different doses (as indicated) of a RNA vector derived from lentivirus with a mutated reverse transcriptase (D110E substitution) expressing FGF9 and comprising RNA Booster 8 [LV-RAA Booster 8/FGF9], and cultured in presence or absence of cortisol and/or VEGF (as indicated).
- the RNA Booster being located about 500 nt upstream of FGF9.
- Figure 6 is a histogram showing the quantification of immunoglobulin G (IgG) against ovalbumin (OVA) in C57BL/6J mice after prime/boost immunization with unadjuvanted ovalbumin [Pos Unadj OVA], adjuvanted OVA [Pos Adj OVA (Alun)], or with a RNA vector derived from lentivirus with a mutated reverse transcriptase (D110E substitution) expressing ovalbumin and comprising RNA Booster 8 [LV-RNA-OVA], or with a non-integrating lentiviral vector expressing ovalbumin, which does not comprise RNA Booster [LV-DNA-OVA], versus negative control without any transduction [Neg C].
- IgG immunoglobulin G
- OVA ovalbumin
- RNA Booster being located about 500 nt upstream of the gene of interest. Prime and boost injections were performed by various routes as indicated [prime/boost]: subcutaneously [SC], intramuscularly [IM], intranasally [IN], intraperitoneally [IP].
- Figure ? is a histogram showing the percentage of GFP-positive HeLa cells constitutively expressing GFP after a co-transduction with a RNA vector derived from lentivirus with a mutated reverse transcriptase (DI 10E substitution) expressing Cas9 and comprising RNA Booster 8 [LV-RAA Booster 8/Cas9] and a non-integrating lentiviral vector expressing a guide RNA targeting the GFP [Non-integrating LV-gRNA], versus a co-transduction with a non-integrating lentiviral vector expressing Cas9 [Non-integrating LV-Cas9] and a non-integrating lentiviral vector expressing a guide RNA targeting GFP [Non-integrating LV-gRNA], versus negative control without any transduction [0 vector].
- the RNA Booster being located about 500 nt upstream of Cas9.
- Figure 8 is a histogram showing the expression of GFP in 293T cells transduced with an RNA vector derived from lentivirus expressing GFP, and comprising the RNA Booster 9 forward or its reverse sequence RNA Booster 9 reverse corresponding to RNA Booster 18, versus negative control corresponding to an RNA vector without RNA Booster (0 RNA Booster).
- the RNA Booster being located about 2000 nt upstream (5’) of GFP.
- Figure 9 is a histogram showing the expression of GFP in 293T cells transduced with an RNA vector derived from lentivirus expressing GFP, and comprising the RNA Booster 9 forward or its reverse sequence RNA Booster 9 reverse corresponding to RNA Booster 18, versus a negative control corresponding to an RNA vector without RNA Booster (0 RNA Booster).
- the RNA Booster being located about 500 nt downstream (3’) of GFP.
- Figure 10 shows the skin healing by the human epidermal keratinocyte migration kinetic.
- Figure 10A shows a model of skin healing without treatment (control), with EGF at 10 ng/ml in the medium of culture or transduced with a RNA vector derived from lentivirus expressing FGF7, and comprising the RNA Booster 8.
- the RNA Booster being located about 500 nt upstream of FGF7.
- Figure 10B is a histogram showing the human epidermal keratinocytes migration kinetic representing by the percentage of healing without treatment (control), with EGF at 10 ng/ml in the medium of culture or transduced with a RNA vector derived from lentivirus expressing FGF7, and comprising the RNA Booster 8.
- the RNA Booster being located about 500 nt upstream of FGF7.
- the envelope trans-complementation plasmid encodes the vesicular stomatitis virus envelope glycoprotein (VSV-G) with SEQ ID NO: 1, under control of a cytomegalovirus-immediate early (CMV-IE) promoter.
- VSV-G vesicular stomatitis virus envelope glycoprotein
- CMV-IE cytomegalovirus-immediate early
- the capsid trans-complementation plasmid encodes a functional integrase (with SEQ ID NO: 2) and a functional reverse transcriptase (with SEQ ID NO: 4) of HIV-1; or a mutant integrase with abolished integrase activity (SEQ ID NO: 2 comprising a D64V substitution, as set forth in SEQ ID NO: 3); or a mutant reverse transcriptase with abolished reverse transcriptase activity (SEQ ID NO: 4 comprising a D110E substitution, as set forth in SEQ ID NO: 5).
- the vector plasmid encodes a recombinant expression cassette comprising a 5’ LTR (with SEQ ID NO: 6) and a 3’ LTR (with SEQ ID NO: 7) flanking a transgene (z.e., a sequence of interest), either GFP including a tobacco extension signal sequence (with SEQ ID NO: 8, encoding SEQ ID NO: 9), human fibroblast growth factor 9 (FGF9) (with SEQ ID NO: 10 encoding SEQ ID NO: 11), human fibroblast growth factor 7 (FGF7) (with SEQ ID NO: 19 encoding SEQ ID NO: 20), ovalbumin (with SEQ ID NO: 12 encoding SEQ ID NO: 13), or Cas9 (with SEQ ID NO: 14 encoding SEQ ID NO: 15), with or without a RNA Booster sequence in 5’ or in 3’ of the transgene (RNA Booster 1 to RNA Booster 18, according in part to Table 1) inserted in a Sall restriction site.
- Lentiviral vectors were generated by the transient transfection of 293T cells by using the calcium phosphate precipitation method. Briefly, cells were co-transfected with the VSV-G trans-complementation plasmid, the capsid trans-complementation plasmid and a vector plasmid. Supernatant was collected 48 hours after transfection, treated with DNasel and filtered. Viral particles were then concentrated by ultracentrifugation and resuspended in 0.1 M PBS. The genome of particles was quantified for each stock by RT-qPCR to determine a titer of gRNA by pL. Cell culture
- 293T cells were grown in Dulbecco’s modified medium supplemented with antibiotics (lOO U/mL penicillin and 100 mg/mL streptomycin) and 10 % heat-inactivated fetal calf serum. The cells were plated and cultured in a humidified incubator at 37°C in a 5 % CO2 and 90 % air atmosphere.
- Human PBMC were grown in RPMI-160 + L-G1U medium supplemented with 1 % HEPES 5 M, 0.1 % P-mercaptoethanol 55 mM, antibiotics (100 U/mL penicillin and 100 mg/mL streptomycin) and 10 % heat- inactivated fetal calf serum.
- the cells were plated and cultured in a humidified incubator at 37 °C in a 5 % CO2 and 90 % air atmosphere.
- Human dendritic cells were grown in RPMI-160 + L-G1U medium supplemented with 1 % HEPES 5 M, 100 ng/mL GM-CSF, 50 ng/mL IL-4, antibiotics (100 U/mL penicillin and 100 mg/mL streptomycin) and 10 % heat-inactivated fetal calf serum. The cells were plated and cultured in a humidified incubator at 37°C in a 5 % CO2 and 90 % air atmosphere.
- HSC Human hematopoietic stem cells
- Human hair follicle dermal papilla cells were grown in HFDPC Basal culture medium with HFDPC supplement mix. The cells were plated and cultured in a humidified incubator at 37°C in a 5 % CO2 and 90 % air atmosphere.
- GFP + HeLa cells were generated with an integrating lentiviral vector expressing GFP. A clonal population with one integration and a stable expression of GFP was selected for the experiments.
- GFP + HeLa cells were grown in Dulbecco’s modified medium supplemented with antibiotics (100 U/mL penicillin and 100 mg/mL streptomycin) and 10 % heat- inactivated fetal calf serum. The cells were plated and cultured in a humidified incubator at 37°C in a 5 % CO2 and 90 % air atmosphere.
- RNA vector derived from lentivirus with a mutated D110E reverse transcriptase
- GFP GFP
- RNA Booster 1 to 18, or without RNA Booster one of RNA Booster 1 to 18, or without RNA Booster.
- PBMC peripheral blood mononuclear cells
- RNA vector derived from lentivirus with a mutated D110E reverse transcriptase
- GFP expression was measured by FACS 96 hours after transduction.
- HSC Human hematopoietic stem cells
- RNA vector derived from lentivirus with a mutated D110E reverse transcriptase
- FGF9 or FGF7 with RNA Booster 8.
- RNA Booster 8 RNA Booster 8.
- the cells were treated with 300 nM of cortisol (which has a negative effect on proliferation).
- a control with or without VEGF (which inhibits the cortisol effect) was performed.
- Cell proliferation was measured through BrdU (5-bromo-2’-deoxyuridine) incorporation.
- GFP + HeLa cells were contacted and co-transduced with an RNA vector derived from lentivirus (with a mutated D110E reverse transcriptase) expressing Cas9 with RNA Booster 8 and a non-integrating lentiviral vector expressing a guide RNA targeting the GFP (without RNA Booster), or co-transduced with a non-integrating lentiviral vector expressing Cas9 (without RNA Booster) and a non-integrating lentiviral vector expressing a guide RNA targeting the GFP (without RNA Booster).
- GFP expression was measured by FACS 96 hours after.
- GFP expression was analyzed by flow cytometry to determine the percentage of GFP-positive cells. Transduced cells were harvested, trypsinized, and fixed with 1 % formaldehyde before analysis.
- RNA vector derived from lentivirus with a mutated DI 10E reverse transcriptase
- RNA Booster 8 expressing ovalbumin
- RNA Booster 8 expressing ovalbumin
- RNA Booster 8 a non-integrating lentiviral vector expressing ovalbumin
- IgG ovalbumin-specific immunoglobulin G
- Ovalbumin-specific IgG were measured from thawed blood samples using the “Mouse anti-OVA IgG antibody assay kit” (Chondrex, Inc.; Ref. 3011).
- the keratinocytes have been seeded in culture medium in 24-well plates previously coated with a collagen I solution. After 24 hours of incubation, the medium will be replaced by test medium then a mechanical scraping has been carried out and the cells have been characterized with calcein-AM. After 30 minutes of incubation, images have been taken (TO) then the medium has been replaced by test medium containing or not (control) the test vector or the reference (EGF at 10 ng/ml). For the test vector, 15 pl of vector and 200 pl of test medium have been added and incubated for 5 hours then medium has been added (qsp 600 pl).
- the cells have been incubated until the next morning and again labeled with calcein-AM (30 minutes incubation) to produce the 24- hour time images.
- the cells have been incubated again for another 24 to 48 hours and then again labeled with calcein-AM and photographed according to a similar protocol.
- the cell migration area has been monitored with a high-resolution imaging system, INCell AnalyzerTM2200 automated microscope (GE Healthcare) and the artificial wound surface has been analyzed with Image J software. Representative images will be inserted in the report and all images will be provided via a secure sharing site.
- RNA vector derived from lentivirus expressing GFP was compared at a same Multiplicity Of Infection (MOI).
- RNA Booster 1-9 in 5’ of the transgene of interest in the RNA vector derived from lentivirus improved the efficacy of GFP expression in transduced 293T cells, as compared to a lentiviral vector without RNA Booster.
- the RNA Booster sequences were shown to enhance GFP expression by at least a factor 2 (for RNA Booster 1) and increasingly, up to a factor 12 (for RNA Booster 9).
- Figure 2 shows that the RNA vector derived from lentivirus expressing GFP, in presence of RNA Booster 8, and both at 10 pF and 15 pF doses, enabled to transduce human PBMC with high efficacy and induced an increase of the GFP expression by a factor 2.7-2.9, as compared to the integrating vector without RNA Booster.
- RNA Booster as defined herein, in 5’ of a transgene of interest, is able to improve the efficacy of expression of this transgene of interest in human PBMC.
- RNA vector derived from lentivirus comprising such RNA Booster could be good candidates to induce transient expression of a gene of interest in PBMC, which cells are of interest in a wide range of immunotherapy strategies and gene therapy.
- Figure 3 shows that the RNA vector derived from lentivirus expressing GFP, in presence of RNA Booster 8, enabled to transduce human dendritic cells with high efficacy and induced an increase of the GFP expression 5.75 to 22 times higher than when using an integrative lentiviral vector or a non-integrative lentiviral vector in absence of RNA Booster, respectively.
- RNA vectors derived from lentivirus comprising such RNA Booster could be good candidates to induce transient expression of a gene of interest in primary cells such as dendritic cells.
- Figure 4 shows that the RNA vector derived from lentivirus expressing GFP, in presence of RNA Booster 8, enabled to transduce human hematopoietic stem cells with a higher efficacy than DNA integrating lentiviral vectors at a MOI 10 to 20 times lower, and induced an increase of the GFP expression around 35-42 times higher than when using a non-integrating lentiviral vector in absence of RNA Booster.
- RNA vectors derived from lentivirus comprising such RNA Booster could be good candidates to induce transient expression of a gene of interest in human HSC, which cells are of interest in a wide range of immunotherapy strategies and gene therapy.
- Figure 5 shows that cortisol decreased cell proliferation, as compared to the non-treated condition (without cortisol, VEGF or vector), while adding VEGF and cortisol restored cell proliferation (with cortisol and VEGF, without vector).
- RNA vectors derived from lentivirus comprising such RNA Booster could be useful for treating a variety of diseases, for example promoting skin healing, or in non-therapeutic indications, for example in dermatology or cosmetology, to induce hair growth.
- Figure 6 shows that an RNA vector derived from lentivirus expressing ovalbumin, in presence of RNA Booster 8, induced high levels of OVA- specific IgG when administered intramuscularly/intranasally, intraperitoneally/intraperitoneally, or intraperitoneally/intranasally (prime/boost - 5 x 10 8 transducing units (TU) per injection).
- this RNA vector derived from lentivirus induced higher levels of OVA-specific IgG as compared to a non-integrative lentiviral vector expressing ovalbumin administered by the same routes.
- RNA vectors derived from lentivirus comprising such RNA Booster can improve immunization in mice, and suggest that these RNA vectors derived from lentivirus could be useful for vaccination.
- Figure 7 shows that an RNA vector derived from lentivirus expressing Cas9, in presence of RNA Booster 8, combined with a guide RNA targeting GFP brought to the cell using a non-integrating lentiviral vector, induces the knock-out of the GFP gene in HeLa cells with an efficacy close than 100 %.
- non-integrating lentiviral vectors expressing Cas9 and a gRNA yield similar results, using these vectors in ex vivo or in vivo therapy is not desirable since DNA molecules have a non-zero probability of recombination with another DNA molecule, such as with a DNA genome. This would induce adverse effects.
- non-integrating lentiviral vectors have been shown in the art to exhibit a residual level of integration of 0.1-0.5 %.
- RNA vectors derived from lentivirus do not show any risk of reverse transcriptase activity leakage, which ensures thus 100 % of information transfer in the form of RNA, which cannot recombine with DNA.
- the data shows the RNA vector comprising the RNA Booster performs at least as well as a DNA vector.
- RNA vectors derived from lentivirus comprising such RNA Booster could be good candidates to induce transient expression of a genome editor, and could thus be useful for genome engineering in the field of bioproduction, cell therapy, gene therapy and transgenesis.
- RNA vector derived from lentivirus expressing GFP with the forward and reverse sequence of the RNA Booster 9 at 2 different positions than initially, or without RNA Booster was compared at a same Multiplicity Of Infection (MOI).
- RNA Booster 9 As shown in Figure 8, the presence of the forward and reverse RNA Booster 9 in 5’ and remote side of 2kb of the transgene of interest in the RNA vector derived from lentivirus improved the efficacy of GFP expression in transduced 293T cells, as compared to a lentiviral vector without RNA Booster.
- the RNA Booster sequences were shown to enhance GFP expression by a factor 2,5 for forward RNA Booster 9 and by a factor 2,2 for reverse RNA Booster 9.
- RNA Booster 9 As shown in Figure 9, the presence of the forward and reverse RNA Booster 9 in 3’ of the transgene of interest in the RNA vector derived from lentivirus improved the efficacy of GFP expression in transduced 293T cells, as compared to a lentiviral vector without RNA Booster.
- the RNA Booster sequences were shown to enhance GFP expression by a factor 6.1 for forward RNA Booster 9 and by a factor 6.9 for reverse RNA Booster 9.
- SEQ ID NO 20 MHKWIETWIEPTEEYRSCFHIICEVGTISEACNDMTPEQMATNVNCSSPERHTRS
Abstract
The present invention relates to means and methods for robust transient RNA expression.
Description
TRANSIENT EXPRESSION SYSTEM FOR RNA
FIELD OF INVENTION
[0001] The present invention relates to means and methods for robust transient RNA expression.
BACKGROUND OF INVENTION
[0002] Transferring genetic information to a cell typically requires the design of vectors capable of delivering this genetic information to the cell. There exist two main types of vectors: non-viral vectors and viral vectors, each of which is capable of transferring information, either in the form of DNA or RNA.
[0003] When transient - rather than sustained - effects are desired, non-integrating DNA vectors or RNA vectors are excellent candidates. However, non-integrating DNA vectors can induce adverse genotoxic effects due to the non-zero probability of any DNA molecule to recombine with another DNA molecule, for instance, with the DNA genome of the host cell. RNA vectors do not exhibit this risk of genotoxicity, since RNA cannot recombine with DNA. Nonetheless, current RNA vectors are not devoid of drawbacks, in particular in terms of efficacy. For instance, non-viral RNA vectors are underperforming, due to a low degree of RNA protection against degradation, and often, a low transfection rate. Hence, the few RNA molecules which ultimately reach the cytoplasm of a cell induce only poor transgene expression.
[0004] Retroviridae, or retroviruses, is a family of RNA viruses which are capable of inserting a copy of their genome - after reverse transcription using their own reverse transcriptase enzyme (RT) - into the chromosomal DNA of the host cells that they invade. The host cells then treat the viral DNA as part of their own genome, transcribing and translating the viral genes along with their own genes. This ability of Retroviridae has made them (and more particularly viruses from the Gammaretrovirus and Lentivirus genera) a benchmark tool for therapeutic gene delivery and transfer into cells since the early 1980’ s. More recently, these RNA vectors have been engineered to allow transient
expression of therapeutic proteins. Such engineered vectors were described in WO 2005/116225 Al, WO 2013/060819 A2 or Mock etal., 2014 (Sci Rep. 4:6409) relating to retroviral vectors with detective RT activity.
[0005] Yet, these RT-defective retroviral vectors, although offering a transient expression of therapeutic proteins from their mRNA without the need of a DNA intermediate, are not devoid of drawbacks. Indeed, they typically package only up to two copies of their RNA genome, into which the transgene of interest (e.g., a therapeutic mRNA) is inserted. In other words, one retroviral vector transducing a host cell can only deliver two copies of a transgene of interest. Given that RNAs are very labile molecules - and thus rapidly degraded in the host cell, this solution was considered somehow ineffective, unless high vector doses are repeatedly administered in order to outweigh these issues. For in vivo applications, this is not desirable. For instance, Mock et al. (2014. Sci Rep. 4:6409) came to this conclusion, stating that they “observed very weak cap-dependent translation initiation from standard lentiviral vector genomes”, and called for further improvements.
[0006] There remains thus a need for RNA vectors, capable of inducing high transient expression levels in host cells, but without requiring the administration of high loads of vector.
[0007] Here, the Inventors have identified an artificial 9-nucleotide sequence, that they have named “RNA Booster”. The Inventors have surprisingly observed that the presence of this RNA Booster upstream or downstream of a transgene highly improved transgene expression in various host cells.
SUMMARY
[0008] The present invention relates to a ribonucleic acid (RNA) or deoxyribonucleic acid (DNA) molecule comprising: an RNA Booster sequence comprising or consisting of the ribonucleic acid or deoxyribonucleic acid sequence mmsknkkkm or its reverse sequence mkkknksmm, wherein:
“m” indicates an adenine (a) or cytosine (c);
“s” indicates a guanine (g) or a cytosine (c);
“k” indicates a guanine (g) or a uracyl/thymine (u/t);
“n” indicates any nucleotide; and a sequence of interest.
[0009] In some embodiments, the RNA Booster sequence comprises or consists of a ribonucleic acid or a deoxyribonucleic acid sequence mmskngkkm or its reverse sequence mkkgnksmm, preferably mmskngkgm or its reverse sequence mgkgnksmm, more preferably cmskhgkgm or its reverse mgkghksmc, even more preferably cmskwgkgm or its reverse sequence mgkgwksmc, yet even more preferably ccsuwgggm or its reverse sequence mgggwuscc, wherein:
■ “m” indicates an adenine (a) or cytosine (c);
■ “s” indicates a guanine (g) or a cytosine (c);
■ “k” indicates a guanine (g) or a uracyl/thymine (u/t);
■ “h” indicates an adenine (a) or a cytosine (c) or a uracyl/thymine (u/t);
■ “w” indicates an adenine (a) or a uracyl/thymine (u/t);
■ “n” indicates any nucleotide;
[0010] In some embodiments, the RNA Booster sequence is selected from the group consisting of:
RNA Booster 9 comprising or consisting of the sequence ccguaggga or its reverse sequence agggaugcc;
RNA Booster 8 comprising or consisting of the sequence cccuugggc or its reverse sequence cggguuccc;
RNA Booster 7 comprising or consisting of the sequence cacgugugc or its reverse sequence cgugugcac;
RNA Booster 6 comprising or consisting of the sequence cccucgggc or its reverse sequence cgggcuccc;
RNA Booster 5 comprising or consisting of the sequence aacuggggc or its reverse sequence cggggucaa;
RNA Booster 4 comprising or consisting of the sequence ccguggugc or its reverse sequence cguggugcc;
RNA Booster 3 comprising or consisting of the sequence cccuaggua or its reverse sequence auggauccc;
RNA Booster 2 comprising or consisting of the sequence aaguuuggc or its reverse sequence cgguuugaa; and
RNA Booster 1 comprising or consisting of the sequence cccgugugc or its reverse sequence cgugugccc.
[0011] In some embodiments, the RNA molecule is comprised within a non-viral vector.
[0012] In some embodiments, the RNA molecule is packaged into an RNA virus vector derived from a Group III, Group IV, Group V or Group VI RNA virus. Preferably, the RNA molecule is packaged into RNA virus vector derived from a Group VI RNA virus. More preferably, the RNA molecule is packaged into a Retroviridae vector.
[0013] In some embodiments, the Retroviridae vector is an Orthoretrovirinae or a Spumaretrovirinae . Preferably, the Retroviridae vector is an Orthoretrovirinae. More preferably, the Retroviridae vector is selected from the group consisting of human immunodeficiency viruses (HIV), simian immunodeficiency viruses (SIV), feline immunodeficiency virus (FIV), bovine immunodeficiency virus (BIV), puma lentivirus (PLV), equine infectious anemia virus (EIAV), caprine arthritis encephalitis virus (CAEV), Visna-maedi virus, Jembrana disease virus, avian sarcoma leukosis virus (ASLV), Rous sarcoma virus (RSV), avian myeloblastosis virus (AMV), mouse mammary tumor virus (MMTV), Jaagsiekte sheep retrovirus (JSRV), enzootic nasal tumor viruses (ENTV), simian retroviruses (SRV), Mason-Pfizer monkey virus (M-PMV), human T-lymphotropic viruses (HTLV), simian T-lympho tropic viruses (STLV), bovine leukemia virus (BLV), Walleye dermal sarcoma virus (WDSV), Walleye epidermal hyperplasia viruses (WEHV), murine leukemia viruses (MLV), Abelson murine leukemia virus (AMLV), Friend virus (FV), feline leukemia virus (FeLV), koala retrovirus (KoRV), xenotropic murine leukemia virus-related virus (XMRV), chick syncytial virus (CSV), murine sarcoma viruses (MSV), feline sarcoma viruses (FSV), Gibbon ape leukemia virus (GaLV), guinea pig type-C oncovirus, porcine type-C oncovirus, reticuloendotheliosis virus, Trager duck spleen necrosis virus, viper retrovirus, and Woolly monkey sarcoma virus.
[0014] In some embodiments, the Retroviridae vector is a lentiviral vector. Preferably, the Retroviridae vector is a lentiviral vector selected from the group consisting of human immunodeficiency virus-1 (HIV-1) and HIV-2. More preferably, the Retroviridae vector is HIV- 1.
[0015] In some embodiments, the Group VI RNA virus vector (preferably the Retroviridae vector) is reverse transcriptase (RT)-defective. Preferably, the Group VI RNA virus vector (preferably the Retroviridae vector) does not comprise a gene encoding a reverse transcriptase or wherein the retroviral vector comprises a gene encoding a mutated reverse transcriptase with abolished reverse transcription activity.
[0016] In some embodiments, when the RNA molecule is packaged into an RNA virus vector, the RNA molecule further comprises one or several of: a 5’ long terminal repeat (LTR), a packaging sequence, a Rev-response element sequence, a post-transcriptional regulation element sequence, and a 3’ LTR.
[0017] The present invention also relates to a pharmaceutical composition comprising the RNA or DNA molecule of the invention, optionally comprised within a non-viral vector or packaged into an RNA virus vector, and at least one pharmaceutically acceptable excipient or carrier.
[0018] The present invention also relates to the RNA or DNA molecule of the invention, optionally comprised within a non-viral vector or packaged into an RNA virus vector, or to the pharmaceutical composition comprising the same, for use in therapy.
[0019] The present invention also relates to an in vitro method of transiently expressing a sequence of interest in a cell, comprising transfecting or transducing the cell with the RNA molecule of the invention, optionally comprised within a non-viral vector or packaged into an RNA virus vector.
[0020] The present invention also relates to a nucleic acid system comprising:
(i) a t least one first nucleic acid sequence encoding a Retroviridae genome comprising at least a retroviral gag and pol sequence; optionally wherein the pol sequence encodes a defective reverse-transcriptase (RT) or wherein the pol sequence lacks a RT gene;
(ii) at least one second nucleic acid sequence encoding a viral envelope glycoprotein; and
(iii) at least one third nucleic acid sequence encoding an expression cassette comprising: a packaging sequence,
- an RNA Booster sequence comprising or consisting of the following ribonucleic acid or deoxyribonucleic acid sequence mmsknkkkm or its reverse sequence mkkknksmm, wherein:
■ “m” indicates an adenine (a) or cytosine (c);
■ “s” indicates a guanine (g) or a cytosine (c);
■ “k” indicates a guanine (g) or a uracyl/thymine (u/t);
■ “n” indicates any nucleotide, optionally, a multiple cloning site, optionally, a sequence of interest; wherein the first and second nucleic acid sequences are trans-complementation sequences lacking a functional packaging sequence; preferably wherein the RNA Booster sequence comprises or consists of a nucleic acid sequence mmskngkkm or its reverse sequence mkkgnksmm, preferably of mmskngkgm or its reverse sequence mgkgnksmm, more preferably cmskhgkgm or its reverse sequence mgkghksmc, even more preferably cmskwgkgm or its reverse sequence mgkgwksmc, yet even more preferably ccsuwgggm or its reverse sequence mgggwuscc, wherein:
■ “m” indicates an adenine (a) or cytosine (c);
■ “s” indicates a guanine (g) or a cytosine (c);
■ “k” indicates a guanine (g) or a uracyl/thymine (u/t);
■ “h” indicates an adenine (a) or a cytosine (c) or a uracyl/thymine (u/t);
■ “w” indicates an adenine (a) or a uracyl/thymine (u/t);
■ “n” indicates any nucleotide;
more preferably the RNA Booster sequence is selected from the group consisting of:
RNA Booster 9 comprising or consisting of the sequence ccguaggga or its reverse sequence agggaugcc;
RNA Booster 8 comprising or consisting of the sequence cccuugggc or its reverse sequence cggguuccc;
RNA Booster 7 comprising or consisting of the sequence cacgugugc or its reverse sequence cgugugcac;
RNA Booster 6 comprising or consisting of the sequence cccucgggc or its reverse sequence cgggcuccc;
RNA Booster 5 comprising or consisting of the sequence aacuggggc or its reverse sequence cggggucaa;
RNA Booster 4 comprising or consisting of the sequence ccguggugc or its reverse sequence cguggugcc;
RNA Booster 3 comprising or consisting of the sequence cccuaggua or its reverse sequence auggauccc;
RNA Booster 2 comprising or consisting of the sequence aaguuuggc or its reverse sequence cgguuugaa; and
RNA Booster 1 comprising or consisting of the sequence cccgugugc or its reverse sequence cgugugccc.
[0021] In some embodiment, each at least one nucleic acid sequence (i), (ii) and (iii) is independently from each other a linear nucleic acid or a plasmid.
[0022] The present invention also relates to a cell or cell population comprising the RNA or DNA molecule of the invention or the nucleic acid system of the invention.
[0023] The present invention also relates to a method of producing a Retroviridae vector comprising the RNA molecule of the invention, comprising: transfecting a cell or cell population with at least one RNA or DNA molecule of the invention, with the nucleic acid system of the invention, or providing a cell or cell population comprising the nucleic acid system of the invention;
culturing the cell or cell population of a period of time sufficient for the production of the Retroviridae vector; recovering, and optionally purifying, the Retroviridae vector.
[0024] The present invention also relates to another nucleic acid system comprising at least one nucleic acid sequence encoding a recombinant expression cassette comprising:
- optionally, a promoter, and
- an RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm, and
- a multiple cloning site (MCS) or a sequence of interest, and
- optionally, an origin of replication (ORI), and
- optionally, a selectable marker.
DEFINITIONS
[0025] In the present invention, the following terms have the following meanings:
[0026] The terms “a” and “an” refer to one or to more than one (z.e., to at least one) of the grammatical object of the article. By way of example, “an element” means one element or more than one element.
[0027] “About” preceding a number encompasses plus or minus 10%, or less, of the value of said number. It is to be understood that the value to which the term “about” refers is itself also specifically, and preferably, disclosed.
[0028] “Antigen”, also termed “immunogen”, refers to any substance that induces a state of sensitivity and/or immune responsiveness after any latent period (normally, days to weeks in humans) and that reacts in a demonstrable way with antibodies and/or immune cells of the sensitized subject in vivo or in vitro.
[0029] “Collagen induction therapy”, also known as “microneedling”, “dermarolling”, or “skin needling”, refers to a cosmetic procedure which involves repeatedly puncturing the skin of a subject with microneedles (z.e., needles having a length typically ranging from about 100 pm to 1 000 pm).
[0030] “Consist essentially of’ and any declension thereof, with reference to a composition, means that the RNA or DNA molecule (or the vector comprising said RNA or DNA molecule), is the only one therapeutic agent or agent with a biological activity within said composition or pharmaceutical composition.
[0031] “Encoding”, as in encoding sequence, refers to the inherent property of a specific sequence of nucleotides in a nucleic acid, such as a gene, a complementary DNA (cDNA), or a messenger RNA (mRNA), to serve as template for the synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (e.g., ribosomal RNA (rRNA), transfer RNA (tRNA) and mRNA) or a defined sequence of amino acids (e.g., polypeptide or protein) and the biological properties resulting therefrom.
[0032] “Exogenous” refers to a molecule that is not naturally present in a cell, but can be introduced into the cell by one or more genetic, biochemical or other methods. Natural presence in the cell may be determined with respect to the particular developmental stage and environmental conditions of the cell. For instance, a molecule that is present only in a cell during embryonic development is exogenous with respect to a cell in an adult subject. Similarly, a molecule induced by heat shock of a cell is exogenous with respect to a non-heat- shocked cell.
[0033] “Expression” refers to the transcription and/or translation of a particular nucleotide sequence, such as a gene.
[0034] As used herein, when referring to a given sequence, the expression “has/having a sequence as set forth in SEQ ID NO: X” means that the given sequence comprises or consists of the sequence as set forth in SEQ ID NO: X. The given sequence implicitly refers to a nucleic acid sequence (DNA or RNA sequence) or an amino acid sequence.
[0035] "Isolated'' with reference to a nucleic acid refers to a nucleic acid altered or removed from the natural state. For example, a nucleic acid naturally present in a living organism is not "isolated" but the nucleic acid partially or completely separated from the coexisting materials of its natural state is “isolated”. An “isolated nucleic acid” is thus a nucleic acid that is substantially separated from other nucleic acid sequences, such as genomic DNA or RNA, as well as proteins or complexes such as ribosomes and
polymerases, which naturally accompany a native sequence. An isolated nucleic acid can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell. Typically, a preparation of an isolated nucleic acid may comprise the nucleic acid at least about 80% pure, at least about 85% pure, at least about 90% pure, at least about 95% pure, greater than about 95% pure, greater than about 96% pure, greater than about 97% pure, greater than about 98% pure, or greater than about 99% pure. Isolated nucleic acids thus include nucleic acids purified by standard purification methods, and encompass nucleic acid sequences that have been removed from their naturally occurring environment. Isolated nucleic acids also include chemically synthesized nucleic acids and nucleic acids biologically synthesized by heterologous systems.
[0036] “Long-terminal repeats” refer to sequences of several hundred base pairs long. In RNA viruses, their genome is flanked by LTRs (a 5’ LTR and a 3’ LTR), typically having identical sequences.
[0037] “Rev-response element” refers to a highly structured RNA segment interacting with the Rev protein, allowing the viral genome to be exported to the cytoplasm for downstream processing, including virion packaging. Rev-response elements are typically characteristic of lentiviruses, but other RNA viruses of Group VI comprise similar systems, such as the Rem-response element in Betaretroviruses, the Rex-response element in Deltaretroviruses, or the constitutive transport element (CTE). These are also encompassed when mentioning Rev-response element herein, even if not explicitly cited.
[0038] “Nucleic acid” refers to a polymer of nucleotides (z.e., polynucleotides) covalently linked by phosphodiester bonds, such as deoxyribonucleic acids (DNA) or ribonucleic acids (RNA), in either single- or double- stranded form. A used herein, a nucleic acid may thus be single-stranded, partially double-stranded, or fully doublestranded. The nucleotides making up nucleic acids of the present disclosure may be unmodified (natural) nucleotides or non-natural or modified nucleotides. Unmodified (or natural or naturally occurring) nucleotides include adenosine monophosphate (AMP), deoxyadenosine monophosphate (dAMP), cytidine monophosphate (CMP), deoxycytidine monophosphate (dCMP), guanosine monophosphate (GMP),
deoxyguanosine monophosphate (dGMP), thymidine monophosphate (TMP), deoxythymidine monophosphate (dTMP), and uridine monophosphate (UMP). The term “nucleic acid” also encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides.
[0039] “Nucleic acid sequence” or “nucleotide sequence” refers to a contiguous sequence of nucleotides in a single nucleic acid. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs (single-nucleotide polymorphisms), and complementary sequences as well as the sequence explicitly indicated. Notably, a particular nucleic acid sequence described herein implicitly comprises its corresponding complementary sequence, named reverse sequence. It should be noted that a particular nucleic acid sequence described herein implicitly comprises the DNA sequence and the corresponding RNA sequence.
[0040] “Operatively linked” refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence, e.g., a gene, resulting in a regulation of the expression of the latter by the former. For example, a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence. In some embodiments, a promoter is operably linked to a gene if the promoter affects the transcription or expression of the gene. In some embodiments, an RNA Booster is operably linked to a gene if the RNA Booster affects the expression of the gene. Similarly, a regulatory sequence is operably linked to a gene if the regulatory sequence affects (z.e., either induces or inhibits (or represses)) the expression of the gene. Operably linked sequences can be contiguous with each other.
[0041] “Packaging sequence” refers to a stem-loop structured cz'.s- acting nucleic acid sequence, which regulates the process of packaging inside a viral capsid. This packaging sequence may be referred in the art to as “packaging signal” denoted “y”, or “encapsidation signal” denoted “E”. Packaging sequences may be of viral origin (z.e., wild-type viral packaging sequences) or may be synthetic.
[0042] “Pharmaceutically acceptable excipient” and “pharmaceutically acceptable carrier” include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, that are physiologically compatible. The excipient or carrier does not produce any adverse, allergic or other untoward reaction when administered to a subject, preferably to a human. A pharmaceutically acceptable excipient or carrier is typically a non-toxic solid, semi-solid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type. For human administration, preparations should meet sterility, pyrogenicity, and general safety and purity standards as required by regulatory offices, such as, for example, the FDA (US Food and Drug Administration) or EMA (European Medicines Agency).
[0043] “Post-transcriptional regulation elements” refer to czs-acting RNA sequences that can increase the accumulation of cytoplasmic mRNA by promoting mRNA exportation from the nucleus to the cytoplasm, enhancing 3’-end processing and stability.
[0044] “Gene” broadly refers to an encoding nucleic acid sequence that can be transcribed into an RNA molecule, either a coding RNA molecule such as a mRNA which can be subsequently translated into a polypeptide or protein, or a non-coding RNA molecule such as a rRNA or a tRNA. Thus, as used herein, the term “gene” may refer to an encoding nucleic acid sequence comprising a coding sequence (or CDS) and at least one regulatory element that is transcribed but not translated, such as a 3’-UTR, a 5’-UTR and/or an intron.
[0045] “Sequence of interest” refers to as “transgene (of interest)”, refers to any nucleic acid sequence encoding a product of interest. The product of interest may be a protein or a fragment thereof; in this case, the sequence of interest is said to be a coding nucleic acid sequence. In this embodiment, the transgenes refers in particular to a gene originating from one species which is to be introduced into an organism belonging to a different species. It should thus be noted that a gene may or may not encompass a coding sequence (or CDS), that is to say a nucleic acid sequence that actually codes for a protein. A gene, in particular a gene encompassing a CDS, may also preferably encompass untranslated transcribed regions (UTRs), such as a 3’-UTR and/or a 5’-UTR and other sequences, such as regulatory elements and/or introns, which are transcribed but not
translated. However, the term also encompasses non-coding nucleic acid sequences, i.e., nucleic acid sequences that do not encode a protein or a fragment thereof, but rather express an “RNA gene” (or “non-coding RNA”), such as, e.g., a transfer RNA, a ribosomal RNA, a small RNA, a long non-coding RNA, etc. The context will indicate whether the term “sequence of interest” refers to a DNA or an RNA sequence.
[0046] “Transgenesis” refers to the process of introducing one or several transgenes from one organism into another, with the intent of enabling the latter to transmit this transgene to its offspring.
[0047] "Treating" or "treatment" or "alleviation" refers to both therapeutic treatment and prophylactic measures; wherein the object is to slow down (lessen) the targeted pathologic condition or disorder. A subject or mammal is successfully "treated" for an infection if, after receiving a therapeutic amount of an RNA or DNA molecule of the present invention, the patient shows observable and/or measurable reduction in or absence of one or more of the following: reduction in the number of pathogenic cells; reduction in the percent of total cells that are pathogenic; and/or relief to some extent, one or more of the symptoms associated with the specific disease or condition; reduced morbidity and mortality, and improvement in quality of life issues. The above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
[0048] “Vector” refers to a vehicle by which a nucleic acid sequence e.g., a DNA or RNA molecule), for example a nucleic acid encoding an RNA or a polypeptide or protein of interest, can be introduced into a host cell, so as to transform, transfect or transduce the host cell and promote expression (e.g., transcription and/or translation) of the introduced nucleic acid sequence.
[0049] “Expression vector” refers to a vector comprising regulatory elements (or regulatory sequences) operatively linked or to be operatively linked to a nucleic acid sequence of interest to be expressed, such as a gene of interest. An expression vector thus comprises sufficient cis-acting regulatory elements for controlling the expression of a nucleic acid sequence of interest (present or to be inserted in the expression vector); other
elements that may be required for controlling the expression of the nucleic acid sequence of interest may be supplied by a host cell or an in vitro expression system.
DETAILED DESCRIPTION
[0050] A first object of the invention is a ribonucleic acid (RNA) molecule or deoxyribonucleic acid (DNA) molecule, corresponding to nucleic acid molecule.
[0051] According to the invention, the RNA or DNA molecule comprises, from 5’ to 3’: an RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm, and a sequence of interest.
[0052] According to the invention, the RNA or DNA molecule comprises, from 3’ to 5’:
- an RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm, and
- a sequence of interest.
[0053] According to the invention, the RNA or DNA molecule comprises an RNA Booster sequence. The term “RAA Booster” as used herein refers to an artificial 9-nucleotide sequence, which comprises or consists of a sequence mmsknkkkm or its reverse sequence mkkknksmm, wherein:
“m” indicates an adenine (a) or a cytosine (c);
“s” indicates a guanine (g) or a cytosine (c);
“k” indicates a guanine (g) or a thymine/uracyl (t/u);
“n” indicates any nucleotide.
[0054] In some embodiments, the RNA Booster sequence comprises or consists of a sequence mmskngkkm or its reverse sequence mkkgnksmm, wherein:
“m” indicates an adenine (a) or a cytosine (c);
“s” indicates a guanine (g) or a cytosine (c);
“k” indicates a guanine (g) or a thymine/uracyl (t/u);
“n” indicates any nucleotide.
[0055] In some embodiments, the RNA Booster sequence comprises or consists of a sequence of mmskngkgm or its reverse sequence mgkgnksmm, wherein:
“m” indicates an adenine (a) or a cytosine (c);
“s” indicates a guanine (g) or a cytosine (c);
“k” indicates a guanine (g) or a thymine/uracyl (t/u);
“n” indicates any nucleotide.
[0056] In some embodiments, the RNA Booster sequence comprises or consists of a sequence cmskhgkgm or its reverse sequence mgkghksmc, wherein:
“m” indicates an adenine (a) or a cytosine (c);
“s” indicates a guanine (g) or a cytosine (c);
“k” indicates a guanine (g) or a thymine/uracyl (t/u);
“h” indicates an adenine (a) or a cytosine (c) or a thymine/uracyl (t/u).
[0057] In some embodiments, the RNA Booster sequence comprises or consists of a sequence cmskwgkgm or its reverse sequence mgkgwksmc, wherein:
“m” indicates an adenine (a) or a cytosine (c);
“s” indicates a guanine (g) or a cytosine (c);
“w” indicates an adenine (a) or a thymine/uracyl (t/u);
“h” indicates an adenine (a) or a cytosine (c) or a thymine/uracyl (t/u).
[0058] In some embodiments, the RNA Booster sequence comprises or consists of a sequence ccsuwgggm or its reverse sequence mgggwuscc, wherein:
“s” indicates a guanine (g) or a cytosine (c);
“w” indicates an adenine (a) or a thymine/uracyl (t/u);
“m” indicates an adenine (a) or a cytosine (c).
[0059] Exemplary RNA Booster sequences in RNA molecule include, but are not limited to:
RNA Booster 1: cccgugugc, or its reverse sequence RNA Booster 10: cgugugccc
RNA Booster 2: aaguuuggc, or its reverse sequence RNA Booster 11: cgguuugaa
RNA Booster 3: cccuaggua, or its reverse sequence RNA Booster 12'. auggauccc
RNA Booster 4: ccguggugc, or its reverse sequence RNA Booster 13: cguggugcc
RNA Booster 5: aacuggggc, or its reverse sequence RNA Booster 14: cggggucaa
RNA Booster 6: cccucgggc, or its reverse sequence RNA Booster 15: cgggcuccc
RNA Booster 7: cacgugugc, or its reverse sequence RNA Booster 16: cgugugcac
RNA Booster 8: cccuugggc, or its reverse sequence RNA Booster 17: cggguuccc
RNA Booster 9: ccguaggga, or its reverse sequence RNA Booster 18: agggaugcc
[0060] Exemplary RNA Booster sequences in DNA molecule include, but are not limited to:
RNA Booster 1: cccgtgtgc, or its reverse sequence RNA Booster 10: cgtgtgccc
RNA Booster 2: aagtttggc, or its reverse sequence RNA Booster 11: cggtttgaa
RNA Booster 3: ccctaggta, or its reverse sequence RNA Booster 12: atggatccc
RNA Booster 4: ccgtggtgc, or its reverse sequence RNA Booster 13: cgtggtgcc
RNA Booster 5: aactggggc, or its reverse sequence RNA Booster 14: cggggtcaa
RNA Booster 6: ccctcgggc, or its reverse sequence RNA Booster 15: cgggctccc
RNA Booster 7: cacgtgtgc, or its reverse sequence RNA Booster 16: cgtgtgcac
RNA Booster 8: cccttgggc, or its reverse sequence RNA Booster 17: cgggttccc
RNA Booster 9: ccgtaggga, or its reverse sequence RNA Booster 18: agggatgcc
[0061] In some embodiments, the RNA Booster is described as forward sequence, meaning the RNA Booster sequence is oriented from 5’ to 3’.
[0062] The sequence of RNA Booster forward are selected in the group of RNA Booster 1 to 9.
[0063] In some embodiments, the RNA Booster is described as reverse sequence, meaning the RNA Booster sequence is oriented from 3’ to 5’.
[0064] The sequence of RNA Booster reverse are selected in the group of RNA Booster 10 to 18.
[0065] In order of preference, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting RNA Booster 9,
RNA Booster 8, RNA Booster 7, RNA Booster 6, RNA Booster 5, RNA Booster 4, RNA Booster 3, RNA Booster 2, and RNA Booster 1.
[0066] In order of preference, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10,
[0067] In some embodiments, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7 , RNA Booster 6, RNA Booster 5, RNA Booster 4, RNA Booster 3, and RNA Booster 2.
[0068] In some embodiments, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7 , RNA Booster 6, RNA Booster 5, RNA Booster 4, and RNA Booster 3.
[0069] In some embodiments, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7 , RNA Booster 6, RNA Booster 5, and RNA Booster 4.
[0070] In some embodiments, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7 , RNA Booster 6, and RNA Booster 5.
[0071] In some embodiments, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11 , RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7 , and RNA Booster 6.
[0072] In some embodiments, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, and RNA Booster 7.
[0073] In some embodiments, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, and RNA Booster 8.
[0074] In some embodiments, the RNA or DNA molecule comprises RNA Booster 9. In some embodiments, the RNA or DNA molecule comprises RNA Booster 8.
[0075] In some embodiments, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10 and RNA Booster 9.
[0076] In some embodiments, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11 and RNA Booster 10.
[0077] In some embodiments, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12 and RNA Booster 11.
[0078] In some embodiments, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13 and RNA Booster 12.
[0079] In some embodiments, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14 and RNA Booster 13.
[0080] In some embodiments, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15 and RNA Booster 14.
[0081] In some embodiments, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16 and RNA Booster 15.
[0082] In some embodiments, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17 and RNA Booster 16.
[0083] In some embodiments, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18 and RNA Booster 17.
[0084] In some embodiments, the RNA or DNA molecule comprises RNA Booster 18. In some embodiments, the RNA or DNA molecule comprises RNA Booster 17.
[0085] In some embodiments, the RNA Booster is located in 5’ of a sequence of interest, meaning that the RNA Booster is located upstream of a sequence of interest.
[0086] According to the invention, the RNA Booster is located in 5’ of a sequence of interest.
[0087] In some embodiments, the RNA Booster is located in 3’ of a sequence of interest, meaning that the RNA Booster is located downstream of a sequence of interest.
[0088] According to the invention, the RNA Booster is capable to increase the expression of a gene of interest, as the transgene. The RNA Booster is operably linked to the gene of interest.
[0089] In some embodiments, the RNA Booster is located from 50 ribonucleotides or deoxyribonucleotide (50 nt) to 1000 ribonucleotides or deoxyribonucleotide (1 knt) upstream or downstream of a sequence of interest; such as, e.g., about 50+25 nt, 100+25 nt, 150+25 nt, 200+25 nt, 250+25 nt, 300+25 nt, 350+25 nt, 400+25 nt,
450+25 nt, 500+25 nt, 550+25 nt, 600+25 nt, 650+25 nt, 700+25 nt, 750+25 nt,
800+25 nt, 850+25 nt, 900+25 nt, 950+25 nt or 1+0.025 knt upstream of a sequence of interest. In some preferred embodiments, the RNA Booster is located about 500+25 nt upstream or downstream of a sequence of interest.
[0090] In some embodiments, the RNA Booster is located from 5 ribonucleotides or deoxyribonucleotide (5 nt) to 2000 ribonucleotides or deoxyribonucleotide (2 knt) upstream or downstream of a sequence of interest; such as, e.g., about 50+25 nt, 100+25 nt, 150+25 nt, 200+25 nt, 250+25 nt, 300+25 nt, 350+25 nt, 400+25 nt,
450+25 nt, 500+25 nt, 550+25 nt, 600+25 nt, 650+25 nt, 700+25 nt, 750+25 nt,
800+25 nt, 850+25 nt, 900+25 nt, 950+25 nt or 1+0.025 knt or 1.1+0.025 knt or 1.2+0.025 knt or 1.3+0.025 knt or 1.4+0.025 knt or 1.5+0.025 knt or 1.6+0.025 knt or 1.7+0.025 knt or 1.8+0.025 knt or 1.9+0.025 knt or 2+0.025 knt upstream of a sequence of interest, preferably from about 10 to about 2000, more preferably from about 10 to about 1000; even more preferably from about 50 to about 1000. In some preferred embodiments, the RNA Booster is located about 2+0.025 knt upstream or downstream of a sequence of interest.
[0091] According to the invention, the RNA or DNA molecule comprises a sequence of interest.
[0092] The sequence of interest can be a sequence encoding a peptide or protein (e.g., without limitation, an enzyme, a transcription factor, a growth factor, a trophic factor, a
hormone, a cytokine, an antibody, an antigen, a receptor, an immune regulator, a differentiation factor, a suicide protein, a cell-cycle modifying protein, an anti-proliferative protein, an angiogenic factor, an anti-angiogenic factor, a genome editor, a nuclease, a recombinase, a transposase, a neurotransmitter, and a reporter, including any precursor thereof, as well as fusion proteins). In this case, the sequence of interest may typically be (or be derived from) an mRNA, a cDNA, a synthetic nucleic acid, or any combinations thereof.
[0093] The sequence of interest can alternatively be a sequence of a non-coding RNA.
[0094] Examples of non-coding RNAs include, but are not limited to, transfer RNAs (tRNAs), ribosomal RNAs (rRNAs), small nuclear RNAs (snRNAs), small nucleolar RNAs (snoRNAs), SmY RNAs, small Cajal body-specific RNAs (scaRNAs), guide RNAs (gRNAs), Y RNAs, telomerase RNA component (TERC), spliced leader RNAs (SL RNAs), catalytic RNAs (z.e., ribozymes; such as, e.g., ribonuclease P, ribonuclease MRP, and the like), antisense RNAs (aRNAs), c/.y-natural antisense transcript (cis-NAT), CRISPR RNAs (crRNAs), long non-coding RNAs (IncRNAs), microRNAs (miRNAs), piwi-interacting RNAs (piRNAs), small interfering RNAs (siRNAs), short hairpin RNAs (shRNAs), Zrans-acting siRNAs (tasiRNAs), repeat- associated siRNAs (rasiRNAs), 7SK RNAs (7SK), enhancer RNAs (eRNAs), pegRNA, base editing RNA and RNA aptamers.
[0095] Examples of sequences of interest include any nucleic acid sequence encoding a molecule of therapeutic interest, such as any nucleic acid sequence encoding a peptide or protein, or a non-coding RNA, that is lacking, deficient and/or non-functional in a subject affected with a disease or condition.
[0096] Some specific, non-limiting, examples of sequences of interest include nucleic acid sequence encoding a CRISPR element (such as, e.g., Cas9, Casl2 or a gRNA), a zinc finger protein, a transcription activator-like effector nuclease (TALEN), a meganuclease, a spike protein of an enveloped virus (such as the spike protein of a Coronaviridae, e.g., of SARS-CoV-2; of an Orthomyxoviridae, e.g., of an Influenza virus; or of a Retroviridae), a fibroblast growth factor (such as, e.g., the glia-activating factor FGF9),
a vascular endothelial growth factor (VEGF, including its isoforms, e.g., VEGF121, VEGFmb, VEGF145, VEGF165, VEGFiesb, VEGF189, VEGF206), a neutrophic factor (such as, e.g., a brain-derived neurotrophic factor BDNF, a ciliary neurotrophic factor CNTF, or a glial cell line-derived neurotrophic factor GDNF), an antibody or an antigen-binding fragment thereof, a chimeric antigen receptor, a fluorescent reporter (such as, e.g., GFP, RFP or YFP), luciferase, an alternative oxidase (AOX), a recombinase (such as, e.g., Cre or Flp), a glutathione peroxidase, a myoblast determination protein 1 (MyoD), a superoxide dismutase (SOD), a transcription factor (such as, e.g., Oct3/4, c-Myc, Kruppel-like factor 4 KLF4, or Sox2), a tumor antigen (such as, e.g., p53), an immune checkpoint (such as, e.g., PD-1 or PD-L1), a microbial rhodopsin (such as, e.g., a halorhodopsin, in particular the halorhodopsin from Natronomonas [NpHR] and more particularly the engineered halorhodopsin from Natronomonas [eNpHR3.0], or a channelrhodopsin, in particular ChR2), a MAP kinase (such as, e.g., MAPK10, in particular the MAPK10 from Leishmania donovani [LmjMAPKIO]), and an interleukin (such as, e.g., IL-7 or IL-2).
[0097] In some preferred embodiments, the sequence of interest is an antigen, and the RNA or DNA molecule of the invention is particularly suitable for vaccination purposes.
[0098] In some preferred embodiments, the sequence of interest is a genome editor, and the RNA or DNA molecule of the invention is particularly suitable for genome editing purposes.
[0099] In some preferred embodiments, the sequence of interest is FGF9 or FGF7, preferably FGF7, and the RNA or DNA molecule of the invention is particularly suitable for cosmetic purposes.
[0100] In some embodiments, the expression of the sequence of interest is transient (i.e., not permanent or sustained). The duration and amount of expression may be increased, e.g., by inserting a post-transcriptional regulatory element in 3’ (i.e., downstream) of the sequence of interest.
[0101] Examples of post-transcriptional regulatory element include, but are not limited to, the post-transcriptional regulatory element of Woodchuck hepatitis virus (WPRE) and the post-transcriptional regulatory element of hepatitis B virus (HPRE).
[0102] As demonstrated in the Examples, the duration of expression of the sequence of interest in a cell, in particular in the presence of a post-transcriptional regulatory element, may be at most 7 days (Fig. IB).
[0103] In some embodiments, the RNA or DNA molecule encodes for an mRNA molecule.
[0104] In some embodiments, the mRNA molecule is comprised within a non-viral vector. The present invention encompasses thus a non-viral vector comprising the RNA or DNA molecule described herein.
[0105] In some embodiments, the mRNA molecule may further comprise:
Upstream of the RNA Booster sequence: a 5’-UTR sequence comprising a cap structure, and downstream of the sequence of interest, a 3’-UTR and a 3’-polyA.
[0106] In some embodiments, the mRNA molecule may further comprise:
- upstream of a 5’-UTR sequence comprising a cap structure, of the sequence of interest, a 3’-UTR and a 3’-polyA; and
- downstream the RNA Booster sequence.
[0107] In some embodiments, the mRNA molecule is encoded by a DNA molecule.
[0108] In some embodiments, the DNA molecule is comprised within a non-viral vector selected in the group of: plasmid, cosmid, phage, Bacterial Artificial Chromosome (BAC), Yeast Artificial Chromosome, liposomes, exosomes, lipid nanoparticles, polypeptide nanoparticles, stable nucleic acid lipid particle (SNALP), and cationic lipoplexes.
[0109] In some embodiments, the cap structure is a 5 ’-terminal m7G(5’)ppp(5’)G. In some embodiments, the cap structure may be an analog of m7G(5’)ppp(5’)G, such as,
e.g., 3’-O-Me-m7G(5’)ppp(5’)G (called anti-reverse cap analog or ARCA), m7G(5’)ppp(5’)A, G(5’)ppp(5’)G or G(5’)ppp(5’)A.
[0110] In some embodiments, the non-viral vector l) has efficient encapsulation and protection on mRNAs from nuclease-based degradation upon administration to a subject; 2) prolongs the mRNAs half-life by preventing rapid clearance by a subject’s kidney and phagocytosis by the subject’s liver or spleen upon administration; 3) enhances targeted tissue/organ penetration and accumulation; 4) facilitates targeted cell internalization;
5) avoids lysosomal degradation during intracellular trafficking pathway; and/or
6) enhances the release of mRNAs in a subject’s cell cytoplasm to exert gene effects.
[0111] Typical examples of non-viral RNA vectors include, but are not limited to, liposomes, exosomes, lipid nanoparticles, polypeptide nanoparticles, stable nucleic acid lipid particle (SNALP), and cationic lipoplexes.
[0112] Alternatively, the RNA or DNA molecule may be packaged into or otherwise comprised within a viral vector. The present invention encompasses thus a viral vector comprising the RNA or DNA molecule described herein.
[0113] In some embodiments, the RNA or DNA molecule is packaged into or otherwise comprised within an DNA virus vector, i.e., an engineered viral particle derived from an DNA virus.
[0114] In some embodiments, the RNA or DNA molecule is packaged into or otherwise comprised within an RNA virus vector, i.e., an engineered viral particle derived from an RNA virus. By “engineered viral particle”, it is implied that (i) at least one exogenous nucleic acid sequence is introduced into the genome of the RNA virus, and/or (ii) at least one endogenous gene from the RNA virus is be mutated or deleted, either partially or totally.
[0115] RNA viruses are viruses that have ribonucleic acid as their genetic material. RNA viruses can be classified into four groups according to the Baltimore classification system:
Group III (double-stranded RNA viruses), including the following families: Birnaviridae , Chrysoviridae, Cystoviridae, Hypoviridae, Partitiviridae,
Reoviridae, Totiviridae and Endornavirus . Exemplary genera of double- stranded RNA viruses that can infect humans include, without limitation, Rotavirus and Coltivirus.
Group IV (positive-sense single-stranded RNA viruses), including the following families: Arteriviridae, Coronaviridae , Roniviridae, Astroviridae , Barnaviridae , Bromoviridae, Caliciviridae , Closteroviridae, Comoviridae, Dicistroviridae , Flaviviridae , Flexiviridae, Hepeviridae, Eeviviridae, Euteoviridae , Marnaviridae, Narnaviridae, Nodaviridae, Picornaviridae, Potyviridae, Sequiviridae, Tetraviridae, Togaviridae, Tombusviridae, Tymoviridae, Virgaviridae, Benyvirus, Cheravirus, Idaeovirus, Machlomovirus , Ourmiavirus, Sadwavirus Sobemovirus and Umbravirus. Exemplary species of positive-sense single-stranded RNA viruses that can infect humans include, without limitation, hepatitis C virus, yellow fever virus, West Nile virus, dengue virus, Zika virus, Chikungunya virus, rubella virus, MERS, SARS, and SARS-CoV-2.
Group V (negative- sense single- stranded RNA viruses), including the following families: Qinviridae, Aspiviridae, Chuviridae, Bornaviridae, Filoviridae, Mymonaviridae , Nyamiviridae, Paramyxoviridae, Pneumoviridae , Rhabdoviridae, Sunviridae, Yueviridae, Arenaviridae , Cruliviridae, Feraviridae, Fimoviridae, Hantaviridae, Jonviridae, Nairoviridae, Peribunyaviridae, Phasmaviridae, Phenuiviridae , Tospoviridae, Amnoonviridae and Orthomyxoviridae . Exemplary species of negative- sense single-stranded RNA viruses that can infect humans include, without limitation, Ebola virus, Lassa virus, Marburg virus, measles virus, rabies virus, mumps virus, Influenza viruses, and respiratory syncytial virus.
Group VI (negative-strand single-stranded RNA-reverse transcriptase viruses), including the following families: Metaviridae, Pseudoviridae and Retroviridae . Exemplary species of negative- strand single-stranded RNA-reverse transcriptase viruses that can infect humans include, without limitation, human immunodeficiency virus (HIV), and human T-cell leukemia-lymphoma virus (HTLV).
[0116] In some embodiments, the RNA molecule is packaged into or otherwise comprised within an RNA virus vector derived from a Group III, Group IV, Group V or Group VI RNA virus.
[0117] In some preferred embodiments, the RNA molecule is packaged into or otherwise comprised within an RNA virus vector derived from a Group VI RNA virus.
[0118] In order to be packaged into or otherwise comprised within an RNA virus vector, the RNA molecule may comprise a packaging sequence.
[0119] Viral packaging sequences include bacteriophage packaging sequences (such as, e.g., DNA phage packaging sequences and RNA phage packaging sequences) and eukaryotic virus packaging sequences (such as, e.g., DNA virus packaging sequences and RNA virus packaging sequences).
[0120] When of viral origin, the packaging sequence may be:
(i) a wild-type packaging sequence from an RNA virus; or preferably
(ii) a wild-type packaging sequence from an RNA virus of the same group as the one of the RNA virus into which the RNA molecule is to be packaged into, or more preferably
(iii) a wild-type packaging sequence from an RNA virus of the same family as the one of the RNA virus into which the RNA molecule is to be packaged into, or even more preferably
(iv) a wild-type packaging sequence from an RNA virus of the same genus as the one of the RNA virus into which the RNA molecule is to be packaged into, or yet even more preferably
(v) the wild-type packaging sequence from the RNA virus into which the RNA molecule is to be packaged into.
[0121] In some embodiments, the packaging sequence may be a modified packaging sequence which shares more than 70 %, 75 %, 80 %, 85 %, 90 %, 95 % of sequence identity or even more with the wild-type packaging sequence of (i), (ii), (iii), (iv) or (v) above, while retaining its ability to trigger the process of packaging inside a viral capsid.
[0122] Examples of packaging sequences include, but are not limited to, the psi ( ) packaging signal of HIV or SIV; the core encapsidation signal from Gammaretrovirus; the epsilon (s) encapsidation signal from HBV, and the encapsidation signal from BLV.
[0123] In some preferred embodiments, the RNA molecule is packaged into or otherwise comprised within an RNA virus vector derived from a Group VI RNA virus of the Retroviridae family. The present invention encompasses thus a retroviral vector comprising the RNA molecule described herein.
[0124] Retroviruses are enveloped viruses from the Retroviridae family. They package two identical single-stranded ribonucleic acid (RNA) molecules of typically 7 to 10 kb in length, forming their genome. The genome of retroviruses typically comprises gag, pol and env genes flanked by two long terminal repeat (LTRs) sequences. Each of these genes encodes for numerous peptides, which are initially expressed in the form of a single precursor polypeptide. The gag gene encodes for the internal structure proteins (matrix, capsid and nucleocapsid); the pol gene encodes for retroviral enzymes reverse transcriptase, integrase and protease; and the env gene encodes for viral envelope glycoprotein. The genome of retroviruses can further contain cA-acting elements, e.g., elements responsible for exporting out of the nucleus the unspliced viral genomic RNA which will be packaged, such as a Rev-response element (RRE) sequence. The 5’ and 3’ LTRs serve to promote transcription and also serve as a poly adenylation sequence of the viral RNAs. Sequences necessary for the initiation of reverse transcription of the genome and for the encapsidation of viral RNA in particles (psi [ ] packaging element) are typically adjacent to the 5’ LTR. If the sequences necessary for encapsidation are absent from the viral genome, the genomic RNA will not be actively packaged; it can, however, be passively packaged although with a lower yield. The genome of more complex retroviruses may comprise additional genes encoding accessory and/or regulatory proteins such as src, sag, tax, vif, vpr, vpx, vpu, nef, tat, rev, tmx, tas and/or bet. For example, the HIV-1 genome contains 7 accessory genes: vif, vpr, vpx, vpu, nef, tat and rev.
[0125] The Retroviridae family is subdivided into two subfamilies: Orthoretrovirinae and Spumaretrovirinae. In some embodiments, the retroviral vector is (or is derived from)
an Orthoretrovirinae or a Spumaretrovirinae. In some preferred embodiments, the retroviral vector is (or is derived from) an Orthoretrovirinae .
[0126] The Orthoretrovirinae subfamily is subdivided into six genera: Alpharetrovirus, Betaretrovirus, Deltaretrovirus, Epsilonretrovirus, Gammaretrovirus, and Lentivirus.
[0127] Exemplary species of Alpharetrovirus include, but are not limited to, avian sarcoma leukosis virus (ASLV), Rous sarcoma virus (RSV), and avian myeloblastosis virus (AMV).
[0128] Exemplary species of Betaretrovirus include, but are not limited to, mouse mammary tumor virus (MMTV), Jaagsiekte sheep retrovirus (JSRV), enzootic nasal tumor viruses (ENTV; including ENTV-1 and ENTV-2), simian retroviruses (SRV; including SRV-1 and SRV-2), and Mason-Pfizer monkey virus (M-PMV; formerly known as SRV-3).
[0129] Exemplary species of Deltaretrovirus include, but are not limited to, human T-lymphotropic viruses (HTLV; including HTLV-1, HTLV-2, HTLV-3 and HTLV-4), simian T-lymphotropic viruses (STLV; including STLV-1, STLV-2, STLV-3, and STLV-4), and bovine leukemia virus (BLV).
[0130] Exemplary species of Epsilonretrovirus include, but are not limited to, Walleye dermal sarcoma virus (WDSV), and Walleye epidermal hyperplasia viruses (WEHV; including WEHV-1 and WEHV-2).
[0131] Exemplary species of Gammaretrovirus include, but are not limited to, murine leukemia viruses (MLV), Abelson murine leukemia virus (AMLV), Friend virus (FV), feline leukemia virus (FeLV), koala retrovirus (KoRV), xenotropic murine leukemia virus-related virus (XMRV), chick syncytial virus (CSV), murine sarcoma viruses (MSV; including Finkel-Biskis-Jinkins murine sarcoma virus, Harvey murine sarcoma virus, Kirsten murine sarcoma virus and Moloney murine sarcoma virus), feline sarcoma viruses (FSV; including Gardner- Arnstein feline sarcoma virus, Hardy-Zuckerman feline sarcoma virus and Snyder- Theilen feline sarcoma virus), Gibbon ape leukemia virus (GaLV), guinea pig type-C oncovirus, porcine type-C oncovirus, reticuloendotheliosis
virus, Trager duck spleen necrosis virus, viper retrovirus, and Woolly monkey sarcoma virus.
[0132] Exemplary species of Lentivirus include, but are not limited to, human immunodeficiency viruses (HIV; including HIV-1 and HIV-2), simian immunodeficiency viruses (SIV), feline immunodeficiency virus (FIV), bovine immunodeficiency virus (BIV), puma lentivirus (PLV), equine infectious anemia virus (EIAV), caprine arthritis encephalitis virus (CAEV), Visna-maedi virus, and Jembrana disease virus.
[0133] In some embodiments, the retroviral vector is (or is derived from) an Alpharetrovirus, a Betaretrovirus, a Deltaretrovirus, an Epsilonretrovirus, a Gammaretrovirus or a Lentivirus.
[0134] In some preferred embodiments, the retroviral vector is (or is derived from) a Lentivirus. In some preferred embodiments, the retroviral vector is (or is derived from) a Lentivirus selected from the group comprising or consisting of human immunodeficiency viruses (HIV; including HIV-1 and HIV-2), simian immunodeficiency viruses (SIV), feline immunodeficiency virus (FIV), bovine immunodeficiency virus (BIV), puma lentivirus (PLV), equine infectious anemia virus (EIAV), caprine arthritis encephalitis virus (CAEV), Visna-maedi virus (VMV), and Jembrana disease virus (JDV).
[0135] In some preferred embodiments, the retroviral vector is (or is derived from) a human immunodeficiency virus, such as HIV-1 and HIV-2; more preferably HIV-1.
[0136] In some embodiments, a retroviral vector as described herein packages two RNA molecules, each comprising an RNA Booster sequence and a sequence of interest, as described above. According to this embodiment, the two RNA molecules may comprise the same sequence of interest, or different sequences of interest.
[0137] Also contemplated herein is therefore a retroviral vector comprising a recombinant ribonucleic genome, itself comprising, from 5’ to 3 ’or from 3’ to 5’: an RNA Booster sequence, and a sequence of interest.
[0138] In some embodiments, the retroviral vector comprises a recombinant ribonucleic genome, itself comprising, from 5’ to 3 ’or from 3’ to 5’: a packaging sequence, an RNA Booster sequence, and a sequence of interest.
[0139] In some embodiments, the retroviral vector comprises a recombinant ribonucleic genome, itself comprising, from 5’ to 3’: a 5’ LTR, a packaging sequence, an RNA Booster sequence, a sequence of interest, and a 3’ LTR.
[0140] In some embodiments, the retroviral vector comprises a recombinant ribonucleic genome, itself comprising, from 5’ to 3’: a 5’ LTR, a packaging sequence, a Rev-response element, an RNA Booster sequence, a sequence of interest, and a 3’ LTR.
[0141] In some embodiments, the retroviral vector comprises a recombinant ribonucleic genome, itself comprising, from 5’ to 3’: a 5’ LTR, a packaging sequence, a Rev-response element, an RNA Booster sequence, a sequence of interest, a post-transcriptional regulatory element, and a 3’ LTR.
[0142] In some embodiments, the retroviral vector is reverse transcriptase-defective.
[0143] In other words, the gene encoding the reverse transcriptase may be mutated or deleted, so that the reverse transcription process is altered and cannot be completed,
cannot give rise to a full-length retroviral double-stranded DNA intermediate molecule upon infection of a target cell, and consequently, cannot generate a proviral vector genome. This inability, in the context of the invention, can result either from (i) an absence of the reverse transcriptase gene in the retroviral vector, or (ii) at least one mutation in the reverse transcriptase gene in the retroviral vector.
[0144] Examples of mutations in the reverse transcriptase gene to abolish reverse transcription activity are known in the art. Reference is made, inter alia, to WO 2013/060819 A2, from page 15 line 31 to page 42 line 14, which selected passage is hereby incorporated by reference. For instance, a HIV-1 reverse transcriptase with SEQ ID NO: 4 may comprise a D110E substitution resulting in an abolished reverse transcriptase activity.
[0145] In some embodiments, the retroviral vector might further be integrase-defective.
[0146] In other words, the gene encoding the integrase might be mutated or deleted, so that the integration process is altered and cannot be completed, i.e., a proviral vector genome cannot be integrated into the genome of a target cell. This inability can result either from (i) an absence of the integrase gene in the retroviral vector, or (ii) at least one mutation in the integrase gene in the retroviral vector.
[0147] In some embodiments, the RNA or DNA molecule, in particular when packaged into or otherwise comprised within an RNA virus vector, may further comprise one or several elements, in particular one or several of long terminal repeats (LTR), including a 5’ LTR and a 3’ LTR; a Rev -response element (RRE) sequence; and a post-transcriptional regulation element sequence.
[0148] In some embodiments, the RNA or DNA molecule comprises a 5’ LTR, located in 5’ of the packaging sequence (in other words, before the packaging sequence).
[0149] In some embodiments, the RNA or DNA molecule comprises a Rev-response element (RRE) sequence, located in 3’ of the packaging sequence but in 5’ of the RNA Booster sequence (in other words, between the packaging sequence and the RNA Booster sequence).
[0150] In some embodiments, the RNA or DNA molecule comprises a post-transcriptional regulation element sequence, located in 3’ of the sequence of interest (in other words, after the sequence of interest).
[0151] In some embodiments, the RNA or DNA molecule comprises a 3’ LTR, located in 3’ of the sequence of interest (in other words, after the sequence of interest). When a post-transcriptional regulation element sequence is present, the 3’ LTR is located in 3’ of this post-transcriptional regulation element sequence.
[0152] In some embodiments, the RNA or DNA molecule may thus comprise, from 5’ to 3’: optionally, a 5’ LTR, optionally, a packaging sequence, optionally, a Rev-response element, compulsorily, an RNA Booster sequence, compulsorily, a sequence of interest, optionally, a post-transcriptional regulatory element, and optionally, a 3’ LTR.
[0153] In some embodiments, the RNA or DNA molecule may thus comprise, from 5’ to 3’: optionally, a 5’ LTR, compulsorily, a packaging sequence, optionally, a Rev-response element, compulsorily, an RNA Booster sequence, compulsorily, a sequence of interest, optionally, a post-transcriptional regulatory element, and optionally, a 3’ LTR.
[0154] In some embodiments, the RNA or DNA molecule may thus comprise, from 5’ to 3’: optionally, a 5’ LTR, optionally, a packaging sequence, optionally, a Rev-response element, compulsorily, a sequence of interest, optionally, a post-transcriptional regulatory element, optionally, a 3’ LTR, and compulsorily, an RNA Booster sequence.
[0155] In some embodiments, the RNA or DNA molecule may thus comprise, from 5’ to 3’: optionally, a 5’ LTR, compulsorily, a packaging sequence, optionally, a Rev-response element, compulsorily, a sequence of interest, optionally, a post-transcriptional regulatory element, optionally, a 3’ LTR, and compulsorily, an RNA Booster sequence.
[0156] A second object of the invention is a composition comprising, consisting of, or consisting essentially of, the RNA or DNA molecule described above. In particular, an object of the invention is a composition comprising, consisting of, or consisting essentially of, the non- viral vector described above, or the viral vector, in particular the retroviral vector, described above.
[0157] In some embodiment, the composition is a pharmaceutical composition and further comprises at least one pharmaceutically acceptable excipient or carrier.
[0158] Pharmaceutically acceptable excipients or carriers that may be used in the composition or pharmaceutical composition include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, serum proteins (such as human serum albumin), buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes,
such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances (for example sodium carboxymethylcellulose), polyethylene glycol, poly acrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol and wool fat.
[0159] A third object of the invention relates to the various uses and applications of the RNA or DNA molecule, in particular of the non-viral vector or viral vector, in particular the retroviral vector, or of the composition, as described above.
[0160] These uses and applications are particularly suitable in prokaryotes, whether in vitro, ex vivo or in vivo.
[0161] These uses and applications are particularly suitable in eukaryotes, whether in vitro, ex vivo or in vivo. In some embodiments, the eukaryote is an animal, preferably a mammal, even more preferably a human.
[0162] Encompassed in these uses and applications is a method, in particular an in vitro or ex vivo method, of transiently expressing at least one sequence of interest in a cell, which method comprises contacting or otherwise transfecting or transducing the cell with the RNA or DNA molecule, or with the non-viral vector or viral vector, in particular the retroviral vector, as described above.
[0163] In some embodiments, RNA or DNA molecule is under control of promoter noninducible.
[0164] In some embodiments, RNA or DNA molecule is under control of promoter inducible.
[0165] In some embodiments, RNA or DNA molecule is under control of strong promoter.
[0166] Also encompassed in these uses and applications is the RNA or DNA molecule, or the non-viral vector or viral vector, in particular the retroviral vector, or of the composition, for use in therapy, as a drug or as a medicament.
[0167] Also encompassed in these uses and applications is the RNA or DNA molecule, or the non-viral vector or viral vector, in particular the retroviral vector, or the composition, for use in preventing or treating a disease in a subject in need thereof; or a method of preventing or treating a disease, comprising administering to a subject in need thereof the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition.
[0168] In some embodiments, the disease is selected from the group consisting of cancer, infectious diseases, neuromuscular diseases, ocular diseases, blood diseases, cardiovascular diseases, skin diseases, and neurodegenerative diseases.
[0169] In some embodiments, the disease is cancer.
[0170] Examples of cancers include those listed in the 11th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 02 “Neoplasms”.
[0171] Further examples of cancers include, but are not limited to, recurrent, metastatic or multi-drug resistant cancer.
[0172] Further examples of cancers include, but are not limited to, adenofibroma, adenoma, agnogenic myeloid metaplasia, AIDS-related malignancies, ameloblastoma, anal cancer, angiofollicular mediastinal lymph node hyperplasia, angiokeratoma, angiolymphoid hyperplasia with eosinophilia, angiomatosis, anhidrotic ectodermal dysplasia, anterofacial dysplasia, apocrine metaplasia, apudoma, asphyxiating thoracic dysplasia, astrocytoma (including, e.g., cerebellar astrocytoma and cerebral astrocytoma), atriodigital dysplasia, atypical melanocytic hyperplasia, atypical metaplasia, autoparenchymatous metaplasia, basal cell hyperplasia, benign giant lymph node hyperplasia, bile duct cancer (including, e.g., extrahepatic bile duct cancer), bladder cancer, bone cancer, brain tumor (including, e.g., brain stem glioma, cerebellar astrocytoma glioma, malignant glioma, supratentorial primitive neuroectodermal tumors, visual pathway and hypothalamic glioma, ependymoma, medulloblastoma, gestational trophoblastic tumor glioma, and paraganglioma), branchionia, female breast cancer, male breast cancer, bronchial adenomas/carcinoids, bronchopulmonary dysplasia, cancer
growths of epithelial cells, pre-cancerous growths of epithelial cells, metastatic growths of epithelial cells, carcinoid heart disease, carcinoid tumor (including, e.g., gastrointestinal carcinoid tumor), carcinoma (including, e.g., carcinoma of unknown primary origin, adrenocortical carcinoma, islet cells carcinoma, adeno carcinoma, adeoncortical carcinoma, basal cell carcinoma, basosquamous carcinoma, bronchiolar carcinoma, Brown-Pearce carcinoma, cystadenocarcinoma, ductal carcinoma, hepatocarcinoma, Krebs carcinoma, papillary carcinoma, oat cell carcinoma, small cell lung carcinoma, non-small cell lung carcinoma, squamous cell carcinoma, transitional cell carcinoma, Walker carcinoma, Merkel cell carcinoma, and skin carcinoma), cementoma, cementum hyperplasia, cerebral dysplasia, cervical cancer, cervical dysplasia, cholangioma, cholesteatoma, chondroblastoma, chondroectodermal dysplasia, chordoma, choristoma, chrondroma, cleidocranial dysplasia, colon cancer, colorectal cancer, local metastasized colorectal cancer, congenital adrenal hyperplasia, congenital ectodermal dysplasia, congenital sebaceous hyperplasia, connective tissue metaplasia, craniocarpotarsal dysplasia, craniodiaphysial dysplasia, craniometaphysial dysplasia, craniopharyngioma, cylindroma, cystadenoma, cystic hyperplasia (including, e.g., cystic hyperplasia of the breast), cystosarcoma phyllodes, dentin dysplasia, denture hyperplasia, diaphysial dysplasia, ductal hyperplasia, dysgenninoma, dysplasia epiphysialis hemimelia, dysplasia epiphysialis multiplex, dysplasia epiphysialis punctate, ectodermal dysplasia, Ehrlich tumor, enamel dysplasia, encephaloophthalmic dysplasia, endometrial cancer (including, e.g., ependymoma and endometrial hyperplasia), ependymoma, epithelial cancer, epithelial dysplasia, epithelial metaplasia, esophageal cancer, Ewing’s family of tumors (including, e.g., Ewing’s sarcoma), extrahepatic bile duct cancer, eye cancer (including, e.g., intraocular melanoma and retinoblastoma), faciodigitogenital dysplasia, familial fibrous dysplasia of jaws, familial white folded dysplasia, fibroma, fibromuscular dysplasia, fibromuscular hyperplasia, fibrous dysplasia of bone, florid osseous dysplasia, focal epithelial hyperplasia, gall bladder cancer, ganglioneuroma, gastric cancer (including, e.g., stomach cancer), gastrointestinal carcinoid tumor, gastrointestinal tract cancer, gastrointestinal tumors, Gaucher’s disease, germ cell tumors (including, e.g., extracranial germ cell tumors, extragonadal germ cell tumors, and ovarian germ cell tumors), giant cell tumor, gingival hyperplasia, glioblastoma, glomangioma, granulosa cell tumor, gynandroblastoma, hamartoma, head
and neck cancer, hemangioendothelioma, hemangioma, hemangiopericytoma, hepatocellular cancer, hepatoma, hereditary renal-retinal dysplasia, hidrotic ectodermal dysplasia, histiocytonia, histiocytosis, hypergammaglobulinemia, hypohidrotic ectodermal dysplasia, hypopharyngeal cancer, inflammatory fibrous hyperplasia, inflammatory papillary hyperplasia, intestinal cancers, intestinal metaplasia, intestinal polyps, intraocular melanoma, intravascular papillary endothelial hyperplasia, kidney cancer, laryngeal cancer, leiomyoma, leukemia (including, e.g., acute lymphoblastic leukemia, acute lymphocytic leukemia, acute myeloid leukemia, acute myelogenous leukemia, acute hairy cell leukemia, acute B-cell leukemia, acute T-cell leukemia, acute HTLV leukemia, chronic lymphoblastic leukemia, chronic lymphocytic leukemia, chronic myeloid leukemia, chronic myelogenous leukemia, chronic hairy cell leukemia, chronic B-cell leukemia, chronic T-cell leukemia, and chronic HTLV leukemia), Leydig cell tumor, lip and oral cavity cancer, lipoma, liver cancer, lung cancer (including, e.g., small cell lung cancer and non-small cell lung cancer), lymphangiomyoma, lymphaugioma, lymphoma (including, e.g., AIDS-related lymphoma, central nervous system lymphoma, primary central nervous system lymphoma, Hodgkin’s lymphoma, non-Hodgkin’s lymphoma, Hodgkin’s lymphoma during pregnancy, non-Hodgkin’s lymphoma during pregnancy, mast cell lymphoma, B-cell lymphoma, adenolymphoma, Burkitt’s lymphoma, cutaneous T-cell lymphoma, large cell lymphoma, and small cell lymphoma), lymphopenic thymic dysplasia, lymphoproliferative disorders, macroglobulinemia (including, e.g., Waldenstrom’s macroglobulinemia), malignant carcinoid syndrome, malignant mesothelioma, malignant thymoma, mammary dysplasia, mandibulofacial dysplasia, medulloblastoma, meningioma, mesenchymoma, mesonephroma, mesothelioma (including, e.g., malignant mesothelioma), metaphysial dysplasia, metaplastic anemia, metaplastic ossification, metaplastic polyps, metastatic squamous neck cancer (including, e.g., metastatic squamous neck cancer with occult primary), Mondini dysplasia, monostotic fibrous dysplasia, mucoepithelial dysplasia, multiple endocrine neoplasia syndrome, multiple epiphysial dysplasia, multiple myeloma/plasma cell neoplasm, mycosis fungoides, myelodysplastic syndrome, myeloid metaplasia, myeloproliferative disorders, chronic myeloproliferative disorders, myoblastoma, myoma, myxoma, nasal cavity and paranasal sinus cancer, nasopharyngeal cancer, prostatic neoplasm, colon neoplasm, abdomen neoplasm, bone neoplasm, breast
neoplasm, digestive system neoplasm, liver neoplasm, pancreas neoplasm, peritoneum neoplasm, endocrine glands neoplasm (including, e.g., adrenal neoplasm, parathyroid neoplasm, pituitary neoplasm, testicles neoplasm, ovary neoplasm, thymus neoplasm, and thyroid neoplasm), eye neoplasm, head and neck neoplasm, nervous system neoplasm (including, e.g., central nervous system neoplasm and peripheral nervous system neoplasm), lymphatic system neoplasm, pelvic neoplasm, skin neoplasm, soft tissue neoplasm, spleen neoplasm, thoracic neoplasm, urogenital tract neoplasm, neurilemmoma, neuroblastoma, neuroepithelioma, neurofibroma, neurofibromatosis, neuroma, nodular hyperplasia of prostate, nodular regenerative hyperplasia, oculoauriculovertebral dysplasia, oculodentodigital dysplasia, oculovertebral dysplasia, odontogenic dysplasia, odontoma, opthalmomandibulomelic dysplasia, oropharyngeal cancer, osteoma, ovarian cancer (including, e.g., ovarian epithelial cancer and ovarian low malignant potential tumor), pancreatic cancer (including, e.g., islet cell pancreatic cancer and exocrine pancreatic cancer), papilloma, paraganglioma, nonchromaffin paraganglioma, paranasal sinus and nasal cavity cancer, paraproteinemias, parathyroid cancer, periapical cemental dysplasia, pheochromocytoma (including, e.g., penile cancer), pineal and supratentorial primitive neuroectodermal tumors, pinealoma, pituitary tumor, plasma cell neoplasm/multiple myeloma, plasmacytoma, pleuropulmonary blastoma, polyostotic fibrous dysplasia, polyps, pregnancy cancer, pre-neoplastic disorders (including, e.g., benign dysproliferative disorders such as benign tumors, fibrocystic conditions, tissue hypertrophy, intestinal polyps, colon polyps, esophageal dysplasia, leukoplakia, keratoses, Bowen’s disease, Farmer’s skin, solar cheilitis, and solar keratosis), primary hepatocellular cancer, primary liver cancer, primary myeloid metaplasia, prostate cancer, pseudoachondroplastic spondyloepiphysial dysplasia, pseudoepitheliomatous hyperplasia, purpura, rectal cancer, renal cancer (including, e.g., kidney cancer, renal pelvis, ureter cancer, transitional cell cancer of the renal pelvis and ureter), reticuloendotheliosis, retinal dysplasia, retinoblastoma, salivary gland cancer, sarcomas (including, e.g., uterine sarcoma, soft tissue sarcoma, carcinosarcoma, chondrosarcoma, fibrosarcoma, hemangiosarcoma, Kaposi’s sarcoma, leiomyosarcoma, liposarcoma, lymphangiosarcoma, myosarcoma, myxosarcoma, rhabdosarcoma, sarcoidosis sarcoma, osteosarcoma, Ewing sarcoma, malignant fibrous histiocytoma of bone, and clear cell sarcoma of tendon sheaths), sclerosing angioma, secondary myeloid
metaplasia, senile sebaceous hyperplasia, septooptic dysplasia, Sertoli cell tumor, Sezary syndrome, skin cancer (including, e.g., melanoma skin cancer and non-melanoma skin cancer), small intestine cancer, spondyloepiphysial dysplasia, squamous metaplasia (including, e.g., squamous metaplasia of amnion), stomach cancer, supratentorial primitive neuroectodermal and pineal tumors, supratentorial primitive neuroectodermal tumors, symptomatic myeloid metaplasia, teratoma, testicular cancer, theca cell tumor, thymoma (including, e.g., malignant thymoma), thyroid cancer, trophoblastic tumors (including, e.g., gestational trophoblastic tumors), ureter cancer, urethral cancer, uterine cancer, vaginal cancer, ventriculoradial dysplasia, verrucous hyperplasia, vulvar cancer, Waldenstrom’s macroglobulinemia, and Wilms’ tumor.
[0173] In some embodiments, the disease is an infectious disease.
[0174] Examples of infectious diseases include those listed in the 11th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 01 “Certain infectious or parasitic diseases”.
[0175] Further examples of infectious diseases include, but are not limited to, bacterial infections, viral infections, fungal infections, parasitic infections, ectoparasitic infections, and the like.
[0176] In some embodiments, the disease is a neuromuscular disease.
[0177] Examples of neuromuscular diseases include, but are not limited to, acid maltase deficiency, amyotrophic lateral sclerosis, Andersen-Tawil syndrome, Becker muscular dystrophy, Becker myotonia congenita, Bethlem myopathy, bulbospinal muscular atrophy, carnitine deficiency, carnitine palmityl transferase deficiency, central core disease, centronuclear myopathy, Charcot-Marie-Tooth disease, congenital muscular dystrophy, congenital myasthenic syndromes, congenital myotonic dystrophy, Cori disease, Debrancher enzyme deficiency, Dejerine- Sottas disease, dermatomyositis, distal muscular dystrophy, Duchenne muscular dystrophy, dystrophia myotonica, Emery- Dreifuss muscular dystrophy, endocrine myopathies, Eulenberg disease, facioscapulohumeral muscular dystrophy, tibial distal myopathy, Friedreich's ataxia, Fukuyuma congenital muscular dystrophy, glycogenosis type 2, glycogenosis type 3,
glycogenosis type 5, glycogenosis type 7, glycogenosis type 9, glycogenosis type 10, glycogenosis type 11, Gowers-Laing distal myopathy, hereditary inclusion-body myositis, hypothyroid myopathy, inclusion-body myositis, inherited myopathies, integrin-deficient congenital muscular dystrophy, spinal-bulbar muscular atrophy, spinal muscular atrophy, lactate dehydrogenase deficiency, Lambert-Eaton myasthenic syndrome, McArdei disease, merosin-deficient congenital muscular dystrophy, metabolic diseases of muscle, mitochondrial myopathy, Miyoshi distal myopathy, motor neuron disease, muscle-eye-brain disease, myasthenia gravis, myoadenylate deaminase deficiency, myofibrillar myopathy, myophosphorylase deficiency, myotonia congenital, myotonic muscular dystrophy, myotubular myopathy, nemaline myopathy, Nonaka distal myopathy, oculopharyngeal muscular dystrophy, paramyotonia congenital, Pearson syndrome, periodic paralysis, phosphofructokinase deficiency, phosphoglycerate kinase deficiency, phosphoglycerate mutase deficiency, phosphorylase deficiency, polymyositis, Pompe disease, progressive external ophthalmoplegia, spinal muscular atrophy, Ullrich congenital muscular dystrophy, Weiander distal myopathy, and ZASP- related myopathy.
[0178] In some embodiments, the disease is an ocular disease.
[0179] Examples of ocular diseases include those listed in the 11th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 09 “Diseases of the visual system”.
[0180] Further examples of ocular diseases include, but are not limited to, age-related macular degeneration (AMD, e.g., wet AMD, dry AMD, intermediate AMD, advanced AMD, and geographic atrophy (GA)), macular degeneration, macular edema, diabetic macular edema (DME, e.g., focal, non-center DME and diffuse, center-involved DME), retinopathy, diabetic retinopathy (DR, e.g., proliferative DR (PDR), non-proliferative DR (NPDR), and high-altitude DR), other ischemia-related retinopathies, ROP, retinal vein occlusion (RVO, e.g., central (CRVO) and branched (BRVO) forms), choroidal neovascularization (CNV, e.g., myopic CNV), corneal neovascularization, diseases associated with corneal neovascularization, retinal neovascularization, diseases associated with retinal/choroidal neovascularization, pathologic myopia, von Hippel-
Lindau disease, histoplasmosis of the eye, familial exudative vitreoretinopathy (FEVR), Coats’ disease, Nome disease, osteoporosis-pseudoglioma syndrome (OPPG), subconjunctival hemorrhage, rubeosis, ocular neovascular disease, neovascular glaucoma, retinitis pigmentosa (RP), hypertensive retinopathy, retinal angiomatous proliferation, macular telangiectasia, iris neovascularization, intraocular neovascularization, retinal degeneration, cystoid macular edema (CME), vasculitis, papilledema, retinitis, conjunctivitis (e.g., infectious conjunctivitis and non-infectious (e.g.. allergic) conjunctivitis), Leber congenital amaurosis, uveitis (e.g., infectious or non- infectious uveitis), choroiditis (e.g., multifocal choroiditis), ocular histoplasmosis, blepharitis, dry eye, traumatic eye injury, and Sjogren’s disease.
[0181] In some embodiments, the disease is a blood disease.
[0182] Examples of blood diseases include those listed in the 11th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 03 “Diseases of the blood or blood-forming organs”.
[0183] Further examples of blood diseases include, but are not limited to, acute myeloid leukemia, acute promyelocytic leukemia, acute lymphoblastic leukemia, chronic myelogenous leukemia, myelodysplastic syndromes, anemia, methaemoglobinaemia, hemophilia, non-thrombocytopenic purpura, thrombocytosis, and thrombocytopenia.
[0184] In some embodiments, the disease is a cardiovascular disease.
[0185] Examples of cardiovascular diseases include those listed in the 11th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 11 “Diseases of the circulatory system”.
[0186] Further examples of cardiovascular diseases include, but are not limited to, aneurysm, angina, arrhythmia, atherosclerosis, cardiomyopathy, stroke, cerebrovascular disease, congenital heart disease, congestive heart failure, myocarditis, valve disease coronary, artery disease dilated, cardiomyopathy, diastolic dysfunction, endocarditis, hypertension, hypertrophic cardiomyopathy, mitral valve prolapse, myocardial infarction, and venous thromboembolism.
[0187] In some embodiments, the disease is a skin disease.
[0188] Examples of skin diseases include those listed in the 11th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 14 “Diseases of the skin”.
[0189] Further examples of skin diseases include, but are not limited to, atopic dermatitis, hand dermatitis, contact dermatitis, allergic contact dermatitis, irritant contact dermatitis, neurodermatitis, perioral dermatitis, stasis dermatitis, dyshidrotic eczema, xerotic dermatitis, nummalar dermatitis, seborrheic dermatitis, eyelid dermatitis, diaper dermatitis, dermatomyositis, lichen planus, lichen sclerosis, alopecia areata, vitiligo, rosacea, epidermolysis bullosa, keratosis pilaris, pityriasis alba, pemphigus, vulvovaginitis, acne, chronic spontaneous urticaria, chronic idiopathic urticaria, chronic physical urticaria, Vogt-Koyanagi-Harada disease, Sutton nevus, post inflammatory hypopigmentation, senile leukoderma, chemical/drug-induced leukoderma, cutaneous lupus erythematosus, discoid lupus, palmoplantar pustulosis, pemphigoid, sweet's syndrome, hidradenitis suppurativa, psoriasis, plaque psoriasis, pustular psoriasis, nail psoriasis, flexural psoriasis, guttate psoriasis, psoriatic arthritis, erythrodermic psoriasis, or inverse psoriasis.
[0190] In some embodiments, the disease is a neurodegenerative disease.
[0191] Examples of neurodegenerative diseases include, but are not limited to, Alzheimer’s disease, Parkinson’s disease, amyotrophic lateral sclerosis (ALS), frontotemporal dementia, spinocerebellar ataxia (SCA) type 1, SCA type 2, SCA type 6, SCA type 7, SCA type 17, Machado -Joseph disease/SCA type 3 (MJD/SCA3), Huntington’s disease, dentatorubral pallidoluysian atrophy (DRPLA), spinal and bulbar muscular atrophy (SBMA), prion disease, and motor neuron disease.
[0192] Also encompassed in these uses and applications is the RNA molecule or DNA molecule or the non- viral vector or viral vector, in particular the retroviral vector, or the composition, for use in skin and/or skin appendages (such as hair, nails or skin glands) treatment; or a method of treating skin and/or skin appendages (such as hair, nails or skin glands) in a subject in need thereof against, comprising administering to the subject in
need thereof the RNA molecule or DNA molecule or the non- viral vector or viral vector, in particular the retroviral vector, or the composition.
[0193] In some embodiments, these uses and methods are preferably non-therapeutic uses and methods,
a cosmetic use or method.
[0194] In some embodiments, these non-therapeutic uses and methods are applicable to substantially healthy subject.
[0195] In some embodiments, a “substantially healthy subject” is a subject who has not been previously diagnosed or identified as suffering from skin and/or hair and/or nails diseases, a “substantially healthy subject” is a subject who has not been previously diagnosed or identified as suffering from skin and/or hair and/or nails diseases. In one embodiment, a “substantially healthy subject” is a subject who does not suffer from any known disease, disorder or condition. In one embodiment, a “substantially healthy subject” is a subject who is not seeking medical attention.
[0196] Examples of treatments of skin and/or skin appendages, in particular of non-therapeutic treatments, include for instance any or several of induction of hair growth, prevention of hair loss, induction of hair removal, hair coloring or bleaching, prevention of hair graying, promotion of hair thickening, promotion of or prevention of hair curling, promotion of skin healing, promotion of skin repairing, promoting skin appearance, prevention of wrinkle formation, improvement of skin elasticity, induction of skin tone homogenization, and reduction of sebum secretion.
[0197] In some embodiments, the non-therapeutic treatment corresponds to promoting skin healing by improving the appearance of the skin.
[0198] As exemplified herein, inducing hair growth and/or promoting skin healing can be achieved using the RNA or DNA molecule, in particular the retroviral vector, of the invention, in particular wherein the sequence of interest encodes the glia-activating factor (aka FGF9).
[0199] However, the skilled artisan will readily recognize that other sequences of interest can be used for cosmetic purposes, including, for instance, sequences coding for growth factors.
[0200] In some embodiments, other sequences of interest that can be used for cosmetic purposes include, but are not limited to, sequences encoding the hepatocyte growth factor (HGF), the platelet-derived growth factor (PDGF), the fibroblast growth factor 5 (FGF5) (including FGF5-short [FGF5s] and FGF5-long [FGF51]), the fibroblast growth factor 7 (FGF7), the fibroblast growth factor 10 (FGF10), the transforming growth factor pi (TGFpi), the transforming growth factor a (TGFa), the keratinocyte growth factor (KGF), the insulin-like growth factor 1 (IGF-1), the insulin-like growth factor 2 (IGF-2), the insulin-like growth factor-binding protein 5 (IGFBP5), the vascular endothelial growth factor (VEGF), the acidic fibroblast growth factor (aFGF), the basic fibroblast growth factor (bFGF), the epidermal growth factor (EGF), the collagen genes (COL1A1, COL1A2, etc....), the L-dopachrome tautomerase (TRP2), noggin (NOG), protaetiamycine, thioredoxin (TRX), superoxide dismutase (SOD1), the stem cell factor (SCF), and the human growth hormone (hGH).
[0201] In some embodiment, the RNA molecule, the non- viral vector or viral vector, in particular the retroviral vector, or the composition is in non-therapeutic concentration, in particular in a concentration low enough not to induce a therapeutic effect. Therefore, the non-therapeutic concentration is depending of the RNA molecule and more specifically, on the sequence of interest. The skilled artisan is familiar with the non-therapeutic concentrations.
[0202] In some embodiments, the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition, is to be administered topically, in particular cutaneously or transdermally.
[0203] In some embodiments, the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition, is to be administered topically after collagen induction therapy (CIT).
[0204] In some embodiments, the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition, is used as an epidermal and/or dermal stimulating agent, preferably as an epidermal agent.
[0205] As used herein, the term “collagen induction therapy”, also known as “microneedling”, “dermarolling”, or “skin needling”, refers to a cosmetic procedure which involves repeatedly puncturing the skin of a subject with microneedles (z.e., needles having a length typically ranging from about 100 pm to 1 000 pm).
[0206] Also encompassed herein is therefore a kit comprising a microneedling device and the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
[0207] Alternatively, the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition, is to be administered topically though application onto the skin of a transdermal patch, in particular of a microneedle transdermal patch, comprising said RNA molecule or DNA molecule or non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
[0208] Also encompassed herein is therefore a transdermal patch, in particular a microneedle transdermal patch, comprising the RNA molecule or DNA molecule the non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
[0209] In some embodiments, these uses and methods are preferably therapeutic uses and/or methods.
[0210] In some embodiments, these non-therapeutic uses and methods are applicable to substantially sick subject.
[0211] In some embodiments, a “substantially sick subject” is a subject who has been previously diagnosed or identified as suffering from skin and/or hair and/or nails diseases, a “substantially sick subject” is a subject who has been previously diagnosed or identified as suffering from skin and/or hair and/or nails diseases. In one embodiment, a
“substantially sick subject” is a subject who does suffer from any known disease, disorder or condition. In one embodiment, a “substantially sick subject” is a subject who is seeking medical attention.
[0212] Examples of therapies of skin and/or skin appendages, in particular of therapeutic treatments, include for instance any or several of induction of promotion of skin and/or hair and/or nail healing.
[0213] As exemplified herein, promoting skin and/or hair healing can be achieved using the RNA molecule, in particular the retroviral vector, of the invention.
[0214] However, the skilled artisan will readily recognize that other sequences of interest can be used for therapeutic purposes, as promoting skin and/or hair healing including, for instance, sequences coding for growth factors.
[0215] In some embodiments, other sequences of interest that can be used for cosmetic purposes include, but are not limited to, sequences encoding the hepatocyte growth factor (HGF), the platelet-derived growth factor (PDGF), the fibroblast growth factor 5 (FGF5) (including FGF5-short [FGF5s] and FGF5-long [FGF51]), the fibroblast growth factor 7 (FGF 7), the fibroblast growth factor 10 (FGF10), the transforming growth factor pi (TGFpi), the transforming growth factor a (TGFa), the keratinocyte growth factor (KGF), the insulin-like growth factor 1 (IGF-1), the insulin-like growth factor 2 (IGF-2), the insulin-like growth factor-binding protein 5 (IGFBP5), the vascular endothelial growth factor (VEGF), the acidic fibroblast growth factor (aFGF), the basic fibroblast growth factor (bFGF), the epidermal growth factor (EGF), the collagen genes (COE1A1, COE1A2, etc....), the L-dopachrome tautomerase (TRP2), noggin (NOG), protaetiamycine, thioredoxin (TRX), superoxide dismutase (SOD1), the stem cell factor (SCF), and the human growth hormone (hGH).
[0216] In some embodiment, the RNA molecule, the non- viral vector or viral vector, in particular the retroviral vector, or the composition is in therapeutic concentration, in particular in a concentration high enough to induce a therapeutic effect. Therefore, the therapeutic concentration is depending of the RNA molecule and more specifically, on the sequence of interest. The skilled artisan is familiar with the therapeutic concentrations.
[0217] In some embodiments, the RNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition, is to be administered topically, in particular cutaneously, transdermally or subdermally, and prefereably transdermally or subdermally, more preferably subdermally.
[0218] In some embodiments, administration to the subject may be carried out by systemic injection. Examples of systemic injections include, but are not limited to, intravenous (iv), subcutaneous (sc), intramuscular (im), intradermal (id), intraperitoneal (ip), and intranasal (in) injection.
[0219] Injections can be performed subcutaneously, intramuscularly, intranasally or intraperitoneally, with various combinations for the prime and boost injection.
[0220] In some embodiments, the RNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition, is to be administered topically after collagen induction therapy (CIT).
[0221] In some embodiments, the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition, is used as an epidermal and/or dermal stimulating agent, preferably as an dermal agent.
[0222] As used herein, the term “collagen induction therapy”, also known as “microneedling”, “dermarolling”, or “skin needling”, refers to a cosmetic procedure which involves repeatedly puncturing the skin of a subject with microneedles (z.e., needles having a length typically ranging from about 100 pm to 1 000 pm).
[0223] Also encompassed herein is therefore a kit comprising a microneedling device and the RNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
[0224] Alternatively, the RNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition, is to be administered topically though application onto the skin of a transdermal patch, in particular of a microneedle transdermal patch, comprising said RNA molecule, non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
[0225] Also encompassed herein is therefore a transdermal patch, in particular a microneedle transdermal patch, comprising the RNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
[0226] Also encompassed in these uses and applications is the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition, for use in vaccinating a subject in need thereof against an infectious disease or against cancer; or a method of vaccinating a subject in need thereof against an infectious disease or against cancer, comprising administering to the subject in need thereof the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition.
[0227] As exemplified herein, vaccinating a subject can be efficiently achieved using the RNA molecule, in particular the retroviral vector, of the invention.
[0228] As will be readily understood by the skilled artisan, the sequence of interest in this instance should encode an antigen against which an immunization is desired.
[0229] Examples of antigens include, without limitation, pathogen-related antigens (such as, e.g., antigens of microorganisms or parasites, such as viruses, fungi or bacteria, or archaea, or immunogenic molecules derived from them), self-antigens (such as, e.g., cellular antigens including cells containing normal transplantation antigens and/or tumor-related antigens, RR-Rh antigens, and antigens characteristic of, or specific to particular cells or tissues or body fluids), and allergen-related antigens (such as, e.g., those associated with environmental allergens, including grasses, pollens, molds, dust, insects, dander, venoms, and the like; occupational allergens, including latex, dander, urethanes, epoxy resins, and the like; food, including shellfish, peanuts, eggs, milk products, and the like; and drugs, including antibiotics, anesthetics, and the like).
[0230] Suitable examples of pathogen-related antigens include, but are not limited to, antigens derived from vaccinia, avipox virus, turkey influenza virus, bovine leukemia virus, feline leukemia virus, avian influenza, chicken pneumovirosis virus, canine parvovirus, equine influenza, FHV, Newcastle disease virus (NDV), Chicken/Pennsylvania/1/83 influenza virus, infectious bronchitis virus, Dengue virus,
measles virus, Rubella virus, pseudorabies, Epstein-Barr virus, HIV, SIV, EHV, BHV, HCMV, MERS, SARS, SARS-CoV-2, Hantaan, C. tetani, mumps, Morbillivirus, Herpes Simplex virus type 1, Herpes Simplex virus type 2, Human cytomegalovirus, hepatitis A virus, hepatitis B virus, hepatitis C virus, hepatitis E virus, respiratory syncytial virus, human papilloma virus, Influenza virus, Salmonella, Neisseria, Borrelia, Chlamydia, Bordetella, Plasmodium, Toxoplasma, Cryptococcus, Streptococcus, Staphylococcus, Haemophilus, Diptheria, Tetanus, Pertussis, Escherichia, Candida, Aspergillus, Entamoeba, Giardia, Trypanosoma, Leishmania, and Malaria.
[0231] Suitable examples of self-antigens include, but are not limited to, lupus autoantigen, Smith, Ro, La, Ul-RNP, fibrillin, nuclear antigens, histones, glycoprotein gp70, ribosomal proteins, pyruvate dehydrogenase, dehydrolipoamide acetyltransferase (PCD-E2), hair follicle antigens, human tropomyosin isoform 5 (hTM5), proinsulin, insulin, IA2, GAD65, collagen type II, human cartilage gp 39 (HCgp39), gpl30-RAPS, dnaJpl, citrullinated proteins and peptides (including citrullinated type II collagen, citrullinated vimentin and citrullinated fibrinogen), myelin basic protein, proteolipid protein (PLP), myelin oligodendrocyte glycoprotein (MOG), thyroid stimulating factor receptor (TSH-R), acetylcholine receptor (AchR), gliadin, PLP, glucose-6-phosphate isomerase, thyroglobulin, various tRNA synthetases, proteinase-3, and myeloperoxidase, and the like, including fragments thereof.
[0232] Suitable examples of tumor-related antigens include, but are not limited to, MART-l/Melan-A, gplOO, dipeptidyl peptidase IV (DPPIV), adenosine deaminase-binding protein (ADAbp), cyclophilin b, colorectal associated antigen (CRC)-CO17-1A/GA733, carcinoembryonic antigen (CEA) and its immunogenic epitopes CAP-1 and CAP-2, etv6, amll, prostate specific antigen (PSA) and its immunogenic epitopes PSA-1, PSA-2, and PSA-3, prostate-specific membrane antigen (PSMA), T-cell receptor/CD3-zeta chain, MAGE-family of tumor antigens (e.g., MAGE-A1, MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A5, MAGE-A6, MAGE-A7, MAGE-A8, MAGE-A9, MAGE-A10, MAGE-A11, MAGE-A12, MAGE-Xp2 (MAGE-B2), MAGE-Xp3 (MAGE-B3), MAGE-Xp4 (MAGE-B4), MAGE-CI, MAGE-C2, MAGE-C3, MAGE-C4, MAGE-C5), GAGE-family of tumor antigens (e.g.,
GAGE-1, GAGE-2, GAGE-3, GAGE-4, GAGE-5, GAGE-6, GAGE-7, GAGE-8, GAGE-9), BAGE, RAGE, LAGE-1, NAG, GnT-V, MUM-1, CDK4, tyrosinase, p53, MUC family (e.g. MUC1, MUC16, etc.), HER2/neu, p21ras, RCAS1, alpha-fetoprotein, E-cadherin, alpha-catenin, beta-catenin and gamma-catenin, pl20ctn, gpl00.sup.Pmelll7, PRAME, NY-ESO-1, cdc27, adenomatous polyposis coli protein (APC), fodrin, connexin 37, Ig-idiotype, pl5, gp75, GM2 and GD2 gangliosides, Smad family of cancer antigens brain glycogen phosphorylase, SSX-1, SSX-2 (HOM-MEL-40), SSX-1, SSX-4, SSX-5, SCP-1 and CT-7, and c-erbB-2 and viral antigens such as the HPV-16 and HPV-18 E6 and E7 antigens and the EBV-encoded nuclear antigen (EBNA)-l, and the like, including fragments thereof. Further examples of tumor-related antigens are described in, e.g., Li et al., 2004. Cancer Immunol Immunother. 53(3): 139-43; Novellino et al., 2005. Cancer Immunol Immunother. 54(3):187-20; which are herein incorporated by reference in their entirety.
[0233] In some embodiments, the RNA molecule, DNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition, can be administered to a subject in need thereof once, twice, or more.
[0234] When administered twice or more, the first administration is typically referred to as “priming step”, and the subsequent administration(s) are referred to as “boosting step”. In some embodiments, the boosting step can be carried out once, twice, three times, four times or more.
[0235] In some embodiments, the period of time between the priming step and the boosting step and/or between each iteration of the “boosting step” ranges from about 1 day to about 6 months, preferably from about 1 week to about 3 months, more preferably from about 2 weeks to about 1 month.
[0236] In one embodiment, the period of time between the priming step and the boosting step and/or between each iteration of the “boosting step” is about 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, or 6 months.
[0237] In some embodiments, administration to the subject may be carried out by systemic injection. Examples of systemic injections include, but are not limited to, intravenous (iv), subcutaneous (sc), intramuscular (im), intradermal (id), intraperitoneal (ip), and intranasal (in) injection.
[0238] In case of prime/boosting administration, each injection may be carried out via the same route, or by different route. By way of non-limiting example, the priming step can be carried out by intramuscular injection and the boosting step can be carried out by intranasal injection; or the priming step can be carried out by intraperitoneal injection and boosting step by intranasal injection. Alternatively, both the priming and boosting steps can be carried out by intraperitoneal injection.
[0239] Also encompassed in these uses and applications is the RNA molecule or DNA molecule or the non- viral vector or viral vector, in particular the retroviral vector, or the composition, for use in genome engineering; or a method of genome engineering, comprising administering to a subject in need thereof the RNA molecule or DNA molecule or the non- viral vector or viral vector, in particular the retroviral vector, or the composition.
[0240] Such genome engineering applications are useful, in particular in the field of bioproduction, or in methods of therapeutic treatment such as cell therapy or gene therapy.
[0241] These uses and methods may be in vivo or in vitro.
[0242] They may also be ex vivo, wherein the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition, is contacted ex vivo with a cell or a population of cells from a subject, and optionally the cell or population of cells is then administered back to said subject.
[0243] As will be readily understood by the skilled artisan, the sequence of interest in this instance should encode a genome editor.
[0244] Examples of genome editors include, but are not limited to, CRISPR-associated proteins (Cas), zinc finger nucleases (ZNFs), transcription activator-like effector
nucleases (TALEN), and site-specific recombinases (such as, e.g., a Cre recombinase or flippase [Flp]).
[0245] Examples of CRISPR-associated proteins include, without limitation, class 2 Cas proteins such as, e.g., Cas9, Casl2 (including Casl2a (or Cpfl), Cas 12b (or C2cl), Casl2c (or C2c3), Casl2d (or CasY), Casl2e (or CasX), Casl2f (or Casl4 or C2cl0), Cas 12g, Casl2h, Casl2i, and Cas 12k (or C2c5)), and Cas 13 (including Cas 13a (or C2c2), Casl3b, Casl3c, and Casl3d). The nucleic acid coding for CRISPR-associated proteins can be fused with at least another nucleic acid sequence, such as prime editing guide RNA (pegRNA) and/or base editing RNA.
[0246] In some embodiments, genome editors may require at least one RNA or DNA molecule, in particular in the case of CRISPR-associated proteins, which RNA or DNA molecule is capable of interacting with the genome editor and targeting it to a locus of interest in a cell’s genome. Said RNA molecule may be known in the art as guide RNA (gRNA) and/or prime editing guide RNA (pegRNA) and/or base editing RNA. Alternatively, two RNA molecules (a CRISPR RNA named crRNA and a trans-activating CRISPR RNA named tracrRNA) may be used in lieu of a single gRNA.
[0247] In these embodiments, the uses and methods may thus comprise contacting the cell or administering to the subject such gRNA, or a mix of crRNA and tracrRNA, before, concomitantly with or after, the RNA molecule or DNA molecule or the non- viral vector or viral vector, in particular the retroviral vector, or the composition.
[0248] In some embodiments, genome editors may further require at least one exogenous nucleic acid, in particular at least one exogenous DNA, which is to be inserted in the genome of a target cell.
[0249] This exogenous nucleic acid may comprise, for instance, the sequence of a gene of interest to be inserted in the genome of a target cell. This gene of interest may be, for instance, a functional version of a malfunctioning endogenous gene, or alternatively, a malfunctional version of a normally functioning endogenous gene. It can also be any other gene which expression is desired in a cell, depending on the purpose.
[0250] In some embodiments, the method of genome engineering may be particularly suitable for the transgenesis of an organism.
[0251] The organism may be a plant or an animal. In some embodiments, the animal is not a human.
[0252] The skilled artisan is familiar with means and methods for transgenesis.
[0253] In some embodiments, the method comprises the steps of transfecting or transducing an animal cell with the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition; collecting the animal cell’s nucleus; inserting the animal cell’s nucleus into an unfertilized oocyte; allowing the oocyte to develop, thereby obtaining a transgenic animal, preferably wherein the transgenic animal is not a human.
[0254] In particular, the sequence of interest of the RNA or DNA molecule is a genome editor, and the nucleic acid sequence encoding the transgene of interest is brought to the cell in addition to the RNA or DNA molecule of the invention, for stable integration into the genome of said cell and development of a transgenic organism.
[0255] In some embodiments, the method of genome engineering may be particularly suitable for bioproduction (or recombinant production), in particular for the generation of stable expression systems.
[0256] Such method is applicable, for instance, to the production of recombinant proteins of interest in any suitable expression system, including without limitation, bacterial cells, yeast cells, insect cells, mammalian cells, and human cells.
[0257] The skilled artisan is familiar with means and methods for recombinant protein production.
[0258] In some embodiments, the method comprises the steps of
transfecting or transducing a cell or a population of cells with the RNA molecule or the DNA molecule or the RNA molecule vectorized or DNA molecule vectorized in a non- viral vector or in a viral vector, in particular the retroviral vector, or the composition; culturing the cell or population of cells for a period of time sufficient to allow the production by said cell or population of cells of a protein of interest encoded by the RNA or DNA molecule; recovering the protein of interest; optionally, purifying the protein of interest.
[0259] In particular, the sequence of interest of the RNA or DNA molecule is a genome editor, and the nucleic acid sequence encoding the protein of interest is brought to the cell or population of cells in addition to the RNA or DNA molecule of the invention, for stable integration into the genome of said cell or population of cells and recombinant production of the protein of interest.
[0260] A fourth object of the invention is a nucleic acid system comprising at least one nucleic acid sequence comprising the RNA Booster.
[0261] Another object of the invention is a kit comprising said nucleic acid system or RNA or DNA molecule; a cell or cell population comprising said nucleic acid system or RNA or DNA molecule; and/or a method of producing said nucleic acid system or the RNA molecule or the DNA molecule as described herein.
[0262] The invention can be a nucleic acid system; a kit comprising said nucleic acid system; a cell or cell population comprising said nucleic acid system; and a method of producing an RNA virus vector, in particular a retroviral vector, as described above, using said nucleic acid system or said cell or cell population.
[0263] According to the invention, the nucleic acid system comprises at least one nucleic acid sequence encoding a recombinant expression cassette comprising:
- optionally, a promoter, and/or
- an RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm, and/or
- a multiple cloning site (MCS) or a sequence of interest, and/or
- optionally, an origin of replication (ORI), and/or
- optionally, a selectable marker.
[0264] In some embodiments, the nucleic acid system is in DNA form.
[0265] The skilled artisan will readily understand that the first nucleic acid system can be provided in a single linear nucleic acid or plasmid.
[0266] The purpose of the selectable marker is to allow for the selection or identification of cells or organisms that have taken up the gene of interest. In some embodiments, the selectable marker is an antibiotic resistance gene. In some embodiments, the antibiotic resistance gene is selected in the group of: ampicillin, kanamycin, neomycin, tetracycline, bleomycin, chloramphenicol, streptomycin resistance gene.
[0267] In some embodiments, the origin of replication is selected in the group of: oriC, pl5A, ColEl, SV40.
[0268] In some embodiments, the nucleic acid system comprises:
(i) At least one first nucleic acid sequence encoding an RNA virus genome, in particular a retrovirus genome comprising at least a viral, preferably retroviral, gag and pol sequence; optionally wherein the pol sequence encodes a defective reverse-transcriptase (RT) or wherein the pol sequence lacks a RT gene;
(ii) At least one second nucleic acid sequence encoding an envelope glycoprotein; and
(iii) At least one third nucleic acid sequence encoding a recombinant expression cassette comprising: optionally, a promoter, optionally, a 5’ long terminal repeat (LTR), optionally, a packaging sequence, optionally, a Rev-response element, an RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm, optionally, a multiple cloning site (MCS), optionally, a sequence of interest,
optionally, an origin of replication (ORI), optionally a selectable marker, optionally, a post-transcriptional regulatory element, and optionally, a 3’ LTR; wherein the first and second nucleic acid sequences lack a functional packaging sequence.
[0269] According to the invention, the nucleic acid system comprises:
(iv) At least one first nucleic acid sequence encoding an RNA virus genome, in particular a retrovirus genome comprising at least a viral, preferably retroviral, gag and pol sequence; optionally wherein the pol sequence encodes a defective reverse-transcriptase (RT) or wherein the pol sequence lacks a RT gene;
(v) At least one second nucleic acid sequence encoding an envelope glycoprotein; and
(vi) At least one third nucleic acid sequence encoding a recombinant expression cassette comprising: optionally, a 5’ long terminal repeat (LTR), a packaging sequence, optionally, a Rev-response element, an RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm, optionally, a multiple cloning site (MCS), optionally, a sequence of interest, optionally, a post-transcriptional regulatory element, and optionally, a 3’ LTR; wherein the first and second nucleic acid sequences lack a functional packaging sequence.
[0270] Each nucleic acid sequence (i), (ii) and (iii) defined above is a DNA nucleic acid sequence. Hence, the RNA Booster sequence in DNA form will comprise thymine in lieu o/uracyl defined above for the RNA molecule. Exemplary RNA Booster sequences in the third nucleic acid sequence include thus, but are not limited to: a deoxyribonucleic acid sequence mmskngkkm or its reverse sequence mkkgnksmm, preferably mmskngkgm or its reverse sequence mgkgnksmm, more preferably cmskhgkgm or its reverse mgkghksmc, even more cmskwgkgm
or its reverse sequence mgkgwksmc, yet even more preferably ccsuwgggm or its reverse sequence mgggwuscc, wherein:
■ “m” indicates an adenine (a) or cytosine (c);
■ “s” indicates a guanine (g) or a cytosine (c);
■ “k” indicates a guanine (g) or a thymine (t);
■ “h” indicates an adenine (a) or a cytosine (c) or a thymine (t);
■ “w” indicates an adenine (a) or a thymine (t);
■ “n” indicates any nucleotide; and in particular:
RNA Booster 1: cccgtgtgc, or its reverse sequence RNA Booster 10: cgtgtgccc
RNA Booster 2: aagtttggc, or its reverse sequence RNA Booster 11: cggtttgaa RNA Booster 3: ccctaggta, or its reverse sequence RNA Booster 12: atggatccc RNA Booster 4: ccgtggtgc, or its reverse sequence RNA Booster 13: cgtggtgcc RNA Booster 5: aactggggc, or its reverse sequence RNA Booster 14: cggggtcaa RNA Booster 6: ccctcgggc, or its reverse sequence RNA Booster 15: cgggctccc RNA Booster 7: cacgtgtgc, or its reverse sequence RNA Booster 16: cgtgtgcac RNA Booster 8: cccttgggc, or its reverse sequence RNA Booster 17: cgggttccc RNA Booster 9: ccgtaggga, or its reverse sequence RNA Booster 18: agggatgcc.
[0271] In some embodiment, the at least one first and the at least one second nucleic acid sequences are trans-complementation sequences, i.e., sequences encoding trans-complementation proteins or peptides which are intended to be part of the RNA viral vector, preferably the retroviral vector, as proteins or peptides, but not as nucleic acid information in its ribonucleic genome. These trans-complementation proteins or peptides are thus typically expressed in trans within a cell or population of cell during the production of the RNA viral vector, preferably the retroviral vector. In order to remain trans-complementary, trans-complementation sequences should be present in nucleic acid sequences lacking a functional packaging sequence.
[0272] In some embodiments, each at least one nucleic acid sequence (i), (ii) and (iii) defined above may, independently from each other, be a linear nucleic acid or a plasmid.
[0273] The skilled artisan will readily understand that the first nucleic acid sequence encoding the RNA virus genome, preferably the retrovirus genome, can be provided in a single linear nucleic acid or plasmid, or in two or more linear nucleic acids or plasmids.
[0274] In some embodiments, the at least one second nucleic acid sequence encodes an envelope glycoprotein, such as an envelope glycoprotein from (or derived from) an enveloped virus, possibly from a Retroviridae or from any other enveloped virus, such as, e.g., from a Rhabdoviridae, or a cellular glycoprotein or a synthetic glycoprotein.
[0275] In some preferred embodiments, the at least one second nucleic acid sequence encodes an envelope glycoprotein from Indiana vesiculovirus (formerly known as vesicular stomatitis virus or VSV).
[0276] In some embodiments, the at least one third nucleic acid sequence does not comprise a sequence of interest. If so, it is desirable however that the at least one third nucleic acid sequence comprises at least one restriction site (and preferably at least two different restriction sites), or any other means suitable for introducing a gene of interest downstream the RNA Booster sequence.
[0277] According to the invention, the method of producing an RNA viral vector, preferably a retroviral vector, comprises the steps of:
1) transfecting at least one cell or cell population with at least one RNA or DNA molecule as described above, or at least one nucleic acid system as described above;
2) culturing the cell or cell population of a period of time sufficient for the production of the RNA viral vector, preferably the retroviral vector; and
3) recovering, and optionally purifying, the RNA viral vector, preferably the retroviral vector.
[0278] According to the invention, the method of producing a RNA viral vector, preferably a retroviral vector alternatively comprises the steps of:
1) providing at least one cell or cell population as described above;
2) culturing the cell or cell population of a period of time sufficient for the production of the RNA viral vector, preferably the retroviral vector; and
3) recovering, and optionally purifying, the RNA viral vector, preferably the retroviral vector.
[0279] According to the invention, the kit comprising at least one nucleic acid system as described above may comprise at least one first, second and third nucleic acid sequences in separate vials or containers.
[0280] Alternatively, two of the first, second and third nucleic acid sequences can be mixed in a single vial or container; in this case, the first and second nucleic acid sequences can preferably be mixed in a single vial or container, and the third nucleic acid sequence can be provided in a separate vial or container.
[0281] In some embodiments, the kit may further comprise instructions for use, in particular, instructions for performing the method of producing a RNA viral vector, preferably a retroviral vector, as described above.
BRIEF DESCRIPTION OF THE DRAWINGS
[0282] Figures 1A-B show the expression of GFP in 293T cells transduced with an RNA vector derived from lentivirus expressing GFP and comprising one of RNA Booster 1 to RNA Booster 9, or without RNA Booster (0 RNA Booster). The RNA Booster being located about 500 nt upstream of GFP.
Figure 1A is a histogram showing the relative efficacy of GFP expression in 293T cells. The relative expression based on the level of expression after transduction with an RNA vector derived from lentivirus without RNA Booster is shown.
Figure IB is a histogram showing the transientness of GFP expression in 293T cells. Results are shown as a percentage of 293T cells expressing GFP at day 3 (D3) and day 7 (D7) post-transduction.
[0283] Figure 2 is a histogram showing the percentage of GFP-positive human PBMC after transduction with an integrating lentiviral vector expressing GFP [Integrating LV-GFP], or a RNA vector derived from lentivirus with a mutated reverse transcriptase (D110E substitution) expressing GFP and comprising RNA Booster 8 at two different
doses, as indicated [LV-RNA Booster 8/GFP], versus negative control without any transduction [0 vector]. The RNA Booster being located about 500 nt upstream of GFP.
[0284] Figure 3 is a histogram showing the percentage of GFP-positive human dendritic cells after transduction with an integrating lentiviral vector expressing GFP [Integrating LV-GFP], a non-integrating lentiviral vector expressing GFP [Non-integrating LV-GFP], or a RNA vector derived from lentivirus with a mutated reverse transcriptase (D110E substitution) expressing GFP and comprising RNA Booster 8 [LV-RAA Booster 8/GFP], versus negative control without any transduction [0 vector]. The RNA Booster being located about 500 nt upstream of GFP.
[0285] Figure 4 is an histogram showing the percentage of GFP-positive human hematopoietic stem cells after transduction with an integrating lentiviral vector expressing GFP [Integrating LV-GFP], or a non-integrating lentiviral vector expressing GFP [Non-integrating LV-GFP], or a RNA vector derived from lentivirus with a mutated reverse transcriptase (D110E substitution) expressing GFP and comprising RNA Booster 8 at two different doses (Multiplicity Of Infection (MOI)), as indicated [LV-RAA Booster 8/GFP], versus negative control without any transduction [0 vector]. The RNA Booster being located about 500 nt upstream of GFP.
[0286] Figure 5 is a histogram showing the results of a cell proliferation assay of human hair follicle dermal papilla cells transduced or not with different doses (as indicated) of a RNA vector derived from lentivirus with a mutated reverse transcriptase (D110E substitution) expressing FGF9 and comprising RNA Booster 8 [LV-RAA Booster 8/FGF9], and cultured in presence or absence of cortisol and/or VEGF (as indicated). The RNA Booster being located about 500 nt upstream of FGF9.
[0287] Figure 6 is a histogram showing the quantification of immunoglobulin G (IgG) against ovalbumin (OVA) in C57BL/6J mice after prime/boost immunization with unadjuvanted ovalbumin [Pos Unadj OVA], adjuvanted OVA [Pos Adj OVA (Alun)], or with a RNA vector derived from lentivirus with a mutated reverse transcriptase (D110E substitution) expressing ovalbumin and comprising RNA Booster 8 [LV-RNA-OVA], or with a non-integrating lentiviral vector expressing ovalbumin, which does not comprise
RNA Booster [LV-DNA-OVA], versus negative control without any transduction [Neg C]. The RNA Booster being located about 500 nt upstream of the gene of interest. Prime and boost injections were performed by various routes as indicated [prime/boost]: subcutaneously [SC], intramuscularly [IM], intranasally [IN], intraperitoneally [IP].
[0288] Figure ? is a histogram showing the percentage of GFP-positive HeLa cells constitutively expressing GFP after a co-transduction with a RNA vector derived from lentivirus with a mutated reverse transcriptase (DI 10E substitution) expressing Cas9 and comprising RNA Booster 8 [LV-RAA Booster 8/Cas9] and a non-integrating lentiviral vector expressing a guide RNA targeting the GFP [Non-integrating LV-gRNA], versus a co-transduction with a non-integrating lentiviral vector expressing Cas9 [Non-integrating LV-Cas9] and a non-integrating lentiviral vector expressing a guide RNA targeting GFP [Non-integrating LV-gRNA], versus negative control without any transduction [0 vector]. The RNA Booster being located about 500 nt upstream of Cas9.
[0289] Figure 8 is a histogram showing the expression of GFP in 293T cells transduced with an RNA vector derived from lentivirus expressing GFP, and comprising the RNA Booster 9 forward or its reverse sequence RNA Booster 9 reverse corresponding to RNA Booster 18, versus negative control corresponding to an RNA vector without RNA Booster (0 RNA Booster). The RNA Booster being located about 2000 nt upstream (5’) of GFP.
[0290] Figure 9 is a histogram showing the expression of GFP in 293T cells transduced with an RNA vector derived from lentivirus expressing GFP, and comprising the RNA Booster 9 forward or its reverse sequence RNA Booster 9 reverse corresponding to RNA Booster 18, versus a negative control corresponding to an RNA vector without RNA Booster (0 RNA Booster). The RNA Booster being located about 500 nt downstream (3’) of GFP.
[0291] Figure 10 shows the skin healing by the human epidermal keratinocyte migration kinetic.
Figure 10A shows a model of skin healing without treatment (control), with EGF at 10 ng/ml in the medium of culture or transduced with a RNA vector derived from lentivirus
expressing FGF7, and comprising the RNA Booster 8. The RNA Booster being located about 500 nt upstream of FGF7.
Figure 10B is a histogram showing the human epidermal keratinocytes migration kinetic representing by the percentage of healing without treatment (control), with EGF at 10 ng/ml in the medium of culture or transduced with a RNA vector derived from lentivirus expressing FGF7, and comprising the RNA Booster 8. The RNA Booster being located about 500 nt upstream of FGF7.
EXAMPLES
[0292] The present invention is further illustrated by the following examples.
Materials and Methods
Plasmids
[0293] The envelope trans-complementation plasmid encodes the vesicular stomatitis virus envelope glycoprotein (VSV-G) with SEQ ID NO: 1, under control of a cytomegalovirus-immediate early (CMV-IE) promoter.
[0294] The capsid trans-complementation plasmid encodes a functional integrase (with SEQ ID NO: 2) and a functional reverse transcriptase (with SEQ ID NO: 4) of HIV-1; or a mutant integrase with abolished integrase activity (SEQ ID NO: 2 comprising a D64V substitution, as set forth in SEQ ID NO: 3); or a mutant reverse transcriptase with abolished reverse transcriptase activity (SEQ ID NO: 4 comprising a D110E substitution, as set forth in SEQ ID NO: 5).
[0295] The vector plasmid encodes a recombinant expression cassette comprising a 5’ LTR (with SEQ ID NO: 6) and a 3’ LTR (with SEQ ID NO: 7) flanking a transgene (z.e., a sequence of interest), either GFP including a tobacco extension signal sequence (with SEQ ID NO: 8, encoding SEQ ID NO: 9), human fibroblast growth factor 9 (FGF9) (with SEQ ID NO: 10 encoding SEQ ID NO: 11), human fibroblast growth
factor 7 (FGF7) (with SEQ ID NO: 19 encoding SEQ ID NO: 20), ovalbumin (with SEQ ID NO: 12 encoding SEQ ID NO: 13), or Cas9 (with SEQ ID NO: 14 encoding SEQ ID NO: 15), with or without a RNA Booster sequence in 5’ or in 3’ of the transgene (RNA Booster 1 to RNA Booster 18, according in part to Table 1) inserted in a Sall restriction site. Regulatory sequences such as retroviral psi packaging signal (with
SEQ ID NO: 16), Rev-response element (RRE, with SEQ ID NO: 17) and WHV post-transcriptional regulatory element (WPRE, with SEQ ID NO: 18), were also included.
[0297] Lentiviral vectors were generated by the transient transfection of 293T cells by using the calcium phosphate precipitation method. Briefly, cells were co-transfected with the VSV-G trans-complementation plasmid, the capsid trans-complementation plasmid and a vector plasmid. Supernatant was collected 48 hours after transfection, treated with DNasel and filtered. Viral particles were then concentrated by ultracentrifugation and resuspended in 0.1 M PBS. The genome of particles was quantified for each stock by RT-qPCR to determine a titer of gRNA by pL.
Cell culture
[0298] 293T cells were grown in Dulbecco’s modified medium supplemented with antibiotics (lOO U/mL penicillin and 100 mg/mL streptomycin) and 10 % heat-inactivated fetal calf serum. The cells were plated and cultured in a humidified incubator at 37°C in a 5 % CO2 and 90 % air atmosphere.
[0299] Human PBMC were grown in RPMI-160 + L-G1U medium supplemented with 1 % HEPES 5 M, 0.1 % P-mercaptoethanol 55 mM, antibiotics (100 U/mL penicillin and 100 mg/mL streptomycin) and 10 % heat- inactivated fetal calf serum. The cells were plated and cultured in a humidified incubator at 37 °C in a 5 % CO2 and 90 % air atmosphere.
[0300] Human dendritic cells were grown in RPMI-160 + L-G1U medium supplemented with 1 % HEPES 5 M, 100 ng/mL GM-CSF, 50 ng/mL IL-4, antibiotics (100 U/mL penicillin and 100 mg/mL streptomycin) and 10 % heat-inactivated fetal calf serum. The cells were plated and cultured in a humidified incubator at 37°C in a 5 % CO2 and 90 % air atmosphere.
[0301] Human hematopoietic stem cells (HSC) were grown in StemSpan™ SFEM medium supplemented with the StemSpan™ CD34+ Expansion Supplement (lOx). The cells were plated and cultured in a humidified incubator at 37°C in a 5 % CO2 and 90 % air atmosphere.
[0302] Human hair follicle dermal papilla cells were grown in HFDPC Basal culture medium with HFDPC supplement mix. The cells were plated and cultured in a humidified incubator at 37°C in a 5 % CO2 and 90 % air atmosphere.
[0303] GFP+ HeLa cells were generated with an integrating lentiviral vector expressing GFP. A clonal population with one integration and a stable expression of GFP was selected for the experiments. GFP+ HeLa cells were grown in Dulbecco’s modified medium supplemented with antibiotics (100 U/mL penicillin and 100 mg/mL streptomycin) and 10 % heat- inactivated fetal calf serum. The cells were plated and cultured in a humidified incubator at 37°C in a 5 % CO2 and 90 % air atmosphere.
Transduction
[0304] 293T cells were contacted and transduced with an RNA vector derived from lentivirus (with a mutated D110E reverse transcriptase) expressing GFP with one of RNA Booster 1 to 18, or without RNA Booster. During the transduction, the cells were incubated for 6 hours. GFP expression was measured 72 hours after transduction.
[0305] PBMC were contacted and transduced with an RNA vector derived from lentivirus (with a mutated D110E reverse transcriptase) expressing GFP with RNA Booster 8, or with an integrating lentiviral vector expressing GFP (without RNA Booster). GFP expression was measured by FACS 96 hours after transduction.
[0306] Human CD14+ monocytes were differentiated into dendritic cells during 4 days, before transduction, with GM-CSF (lOO ng/mE) and IE-4 (50 ng/mL). Differentiation was checked by cytometry with an anti-CDla antibody. Dendritic cells were then contacted and transduced with an RNA vector derived from lentivirus (with a mutated DI 10E reverse transcriptase) expressing GFP with RNA Booster 8, or with an integrating lentiviral vector expressing GFP (without RNA Booster), or with a non-integrating lentiviral vector expressing GFP (without RNA Booster). GFP expression was measured by FACS 96 hours after transduction.
[0307] Human hematopoietic stem cells (HSC) were contacted and transduced with an RNA vector derived from lentivirus (with a mutated D110E reverse transcriptase) expressing GFP with RNA Booster 8, or with an integrating lentiviral vector expressing GFP (without RNA Booster), or with a non-integrating lentiviral vector expressing GFP (without RNA Booster). GFP expression was measured by FACS 96 hours after transduction.
[0308] Human hair follicle dermal papilla cells were contacted and transduced with an RNA vector derived from lentivirus (with a mutated D110E reverse transcriptase) expressing FGF9 or FGF7 with RNA Booster 8. After transduction, the cells were treated with 300 nM of cortisol (which has a negative effect on proliferation). A control with or without VEGF (which inhibits the cortisol effect) was performed. Cell proliferation was measured through BrdU (5-bromo-2’-deoxyuridine) incorporation.
[0309] GFP+ HeLa cells were contacted and co-transduced with an RNA vector derived from lentivirus (with a mutated D110E reverse transcriptase) expressing Cas9 with RNA Booster 8 and a non-integrating lentiviral vector expressing a guide RNA targeting the GFP (without RNA Booster), or co-transduced with a non-integrating lentiviral vector expressing Cas9 (without RNA Booster) and a non-integrating lentiviral vector expressing a guide RNA targeting the GFP (without RNA Booster). GFP expression was measured by FACS 96 hours after.
Flow cytometry analysis
[0310] GFP expression was analyzed by flow cytometry to determine the percentage of GFP-positive cells. Transduced cells were harvested, trypsinized, and fixed with 1 % formaldehyde before analysis.
Mouse immunization
[0311] C57BL/6J mice were immunized with an RNA vector derived from lentivirus (with a mutated DI 10E reverse transcriptase) expressing ovalbumin with RNA Booster 8, or with a non-integrating lentiviral vector expressing ovalbumin (without RNA Booster). A boost injection with the same vector was administered 28 days after the prime injection. Injections were performed subcutaneously, intramuscularly, intranasally or intraperitoneally, with various combinations for the prime and boost injection. Immunization was measured through the dosage of ovalbumin- specific immunoglobulin G (IgG) 14 days after prime injection and again 14 days after boost injection.
[0312] Three controls were also carried out: a negative control, in which mice were administered saline; and two positive controls, in which mice were administered unadjuvanted ovalbumin or ovalbumin adjuvanted with alum.
Ovalbumin-specific IgG dosage
[0313] About 0.15 mL of blood were taken from each animal into dry capillaries from the mandibular vessels under isoflurane gas anesthesia. The blood samples were kept at room temperature for at least 30 minutes and serum was prepared within 60 minutes of
sampling by centrifugation for 10 minutes at 1500 g at 4°C ± 2°C). Serum was frozen within 120 minutes post-sampling and stored at -70°C.
[0314] Ovalbumin-specific IgG were measured from thawed blood samples using the “Mouse anti-OVA IgG antibody assay kit” (Chondrex, Inc.; Ref. 3011).
Human epidermal keratinocytes migration assay
Culture and treatment
[0315] The keratinocytes have been seeded in culture medium in 24-well plates previously coated with a collagen I solution. After 24 hours of incubation, the medium will be replaced by test medium then a mechanical scraping has been carried out and the cells have been characterized with calcein-AM. After 30 minutes of incubation, images have been taken (TO) then the medium has been replaced by test medium containing or not (control) the test vector or the reference (EGF at 10 ng/ml). For the test vector, 15 pl of vector and 200 pl of test medium have been added and incubated for 5 hours then medium has been added (qsp 600 pl). The cells have been incubated until the next morning and again labeled with calcein-AM (30 minutes incubation) to produce the 24- hour time images. The cells have been incubated again for another 24 to 48 hours and then again labeled with calcein-AM and photographed according to a similar protocol.
Migration analyze
[0316] The cell migration area has been monitored with a high-resolution imaging system, INCell Analyzer™2200 automated microscope (GE Healthcare) and the artificial wound surface has been analyzed with Image J software. Representative images will be inserted in the report and all images will be provided via a secure sharing site.
[0317] The surface of the artificial wound (area without cells) has been measured after 24, 48 and 72 hours of culture and compared to the initial surface measured at TO. The effect of the compounds on the migration has been compared to the untreated control.
Data processing
[0318] The raw data has been transferred and processed using Microsoft Excel software. Intergroup comparisons have been made using the unpaired two-tailed Student's t test. Statistical analyzes can be interpreted if n>5; however, for n<5, the calculated data is only provided as an indication.
Results
GFP in vitro expression in 293T cells (Figures 1A-B)
[0319] GFP expression from an RNA vector derived from lentivirus expressing GFP (with one of RNA Booster 1 to RNA Booster 9, or without RNA Booster) was compared at a same Multiplicity Of Infection (MOI).
[0320] As shown in Figure 1A, the presence of any of RNA Booster 1-9 in 5’ of the transgene of interest in the RNA vector derived from lentivirus improved the efficacy of GFP expression in transduced 293T cells, as compared to a lentiviral vector without RNA Booster. The RNA Booster sequences were shown to enhance GFP expression by at least a factor 2 (for RNA Booster 1) and increasingly, up to a factor 12 (for RNA Booster 9).
[0321] As seen in Figure IB, GFP was well expressed in 293T cells at day 3 posttransduction, but not at day 7 post-transduction anymore, confirming the transientness of this expression system.
[0322] These data demonstrate show that presence of a RNA Booster as defined herein, in 5’ of a transgene of interest, is able to improve the efficacy of transient expression of this transgene of interest in 293T cells.
GFP in vitro expression in human PBMC (Figure 2)
[0323] Figure 2 shows that the RNA vector derived from lentivirus expressing GFP, in presence of RNA Booster 8, and both at 10 pF and 15 pF doses, enabled to transduce human PBMC with high efficacy and induced an increase of the GFP expression by a factor 2.7-2.9, as compared to the integrating vector without RNA Booster.
[0324] These data demonstrate that presence of a RNA Booster as defined herein, in 5’ of a transgene of interest, is able to improve the efficacy of expression of this transgene of interest in human PBMC.
[0325] This suggests that an RNA vector derived from lentivirus comprising such RNA Booster could be good candidates to induce transient expression of a gene of interest in PBMC, which cells are of interest in a wide range of immunotherapy strategies and gene therapy.
GFP in vitro expression in human dendritic cells (Figure 3)
[0326] Figure 3 shows that the RNA vector derived from lentivirus expressing GFP, in presence of RNA Booster 8, enabled to transduce human dendritic cells with high efficacy and induced an increase of the GFP expression 5.75 to 22 times higher than when using an integrative lentiviral vector or a non-integrative lentiviral vector in absence of RNA Booster, respectively.
[0327] This suggests that RNA vectors derived from lentivirus comprising such RNA Booster could be good candidates to induce transient expression of a gene of interest in primary cells such as dendritic cells.
GFP in vitro expression in human hematopoietic stem cells (Figure 4)
[0328] Figure 4 shows that the RNA vector derived from lentivirus expressing GFP, in presence of RNA Booster 8, enabled to transduce human hematopoietic stem cells with a higher efficacy than DNA integrating lentiviral vectors at a MOI 10 to 20 times lower, and induced an increase of the GFP expression around 35-42 times higher than when using a non-integrating lentiviral vector in absence of RNA Booster.
[0329] These data suggest that RNA vectors derived from lentivirus comprising such RNA Booster could be good candidates to induce transient expression of a gene of interest in human HSC, which cells are of interest in a wide range of immunotherapy strategies and gene therapy.
In vitro proliferation assay of human hair follicle dermal papilla cells (Figure 5)
[0330] Figure 5 shows that cortisol decreased cell proliferation, as compared to the non-treated condition (without cortisol, VEGF or vector), while adding VEGF and cortisol restored cell proliferation (with cortisol and VEGF, without vector). The RNA vector derived from lentivirus expressing FGF9, in presence of RNA Booster 8, enabled human hair follicle dermal papilla cells treated with cortisol to be transduced and to restore cell proliferation at all doses (2 pL), to levels similar to the non-treated control (without cortisol, VEGF or vector).
[0331] These data suggest that these RNA vectors derived from lentivirus comprising such RNA Booster could be useful for treating a variety of diseases, for example promoting skin healing, or in non-therapeutic indications, for example in dermatology or cosmetology, to induce hair growth.
In vivo vaccination assay (Figure 6)
[0332] Figure 6 shows that an RNA vector derived from lentivirus expressing ovalbumin, in presence of RNA Booster 8, induced high levels of OVA- specific IgG when administered intramuscularly/intranasally, intraperitoneally/intraperitoneally, or intraperitoneally/intranasally (prime/boost - 5 x 108 transducing units (TU) per injection). In particular, this RNA vector derived from lentivirus induced higher levels of OVA-specific IgG as compared to a non-integrative lentiviral vector expressing ovalbumin administered by the same routes.
[0333] Interestingly, very high doses of OVA-specific IgG were obtained after an intramuscular prime injection of the RNA vector derived from lentivirus (and to a lesser extent, after an intraperitoneal prime injection), suggesting that a boost injection could not even be needed.
[0334] These data demonstrate that RNA vectors derived from lentivirus comprising such RNA Booster can improve immunization in mice, and suggest that these RNA vectors derived from lentivirus could be useful for vaccination.
Cas9 in vitro expression in HeLa cells constitutively expressing GFP (Figure 7)
[0335] Figure 7 shows that an RNA vector derived from lentivirus expressing Cas9, in
presence of RNA Booster 8, combined with a guide RNA targeting GFP brought to the cell using a non-integrating lentiviral vector, induces the knock-out of the GFP gene in HeLa cells with an efficacy close than 100 %.
[0336] Although non-integrating lentiviral vectors expressing Cas9 and a gRNA yield similar results, using these vectors in ex vivo or in vivo therapy is not desirable since DNA molecules have a non-zero probability of recombination with another DNA molecule, such as with a DNA genome. This would induce adverse effects. Moreover, non-integrating lentiviral vectors have been shown in the art to exhibit a residual level of integration of 0.1-0.5 %. Conversely, RNA vectors derived from lentivirus do not show any risk of reverse transcriptase activity leakage, which ensures thus 100 % of information transfer in the form of RNA, which cannot recombine with DNA.
[0337] The data shows the RNA vector comprising the RNA Booster performs at least as well as a DNA vector.
[0338] These data suggest that RNA vectors derived from lentivirus comprising such RNA Booster could be good candidates to induce transient expression of a genome editor, and could thus be useful for genome engineering in the field of bioproduction, cell therapy, gene therapy and transgenesis.
GFP in vitro expression in 293T cells (Figure 8 et 9)
[0339] GFP expression from an RNA vector derived from lentivirus expressing GFP with the forward and reverse sequence of the RNA Booster 9 at 2 different positions than initially, or without RNA Booster) was compared at a same Multiplicity Of Infection (MOI).
[0340] As shown in Figure 8, the presence of the forward and reverse RNA Booster 9 in 5’ and remote side of 2kb of the transgene of interest in the RNA vector derived from lentivirus improved the efficacy of GFP expression in transduced 293T cells, as compared to a lentiviral vector without RNA Booster. The RNA Booster sequences were shown to enhance GFP expression by a factor 2,5 for forward RNA Booster 9 and by a factor 2,2 for reverse RNA Booster 9.
[0341] As shown in Figure 9, the presence of the forward and reverse RNA Booster 9 in 3’ of the transgene of interest in the RNA vector derived from lentivirus improved the efficacy of GFP expression in transduced 293T cells, as compared to a lentiviral vector without RNA Booster. The RNA Booster sequences were shown to enhance GFP expression by a factor 6.1 for forward RNA Booster 9 and by a factor 6.9 for reverse RNA Booster 9.
Human epidermal keratinocytes migration (Figure 10A et B)
[0342] As shown in Figure 10, the reduction in scrape over time is condition-dependent. The lentivirus-derived RNA vector expressing FGF7, in the presence of RNA Booster 8, transduced human epidermal keratinocyte cells and stimulated their migration. With this construction, the percentage of healing reaches 100% in 72h. These data suggest that lentivirus-derived RNA vectors comprising such RNA boosters could be good candidates for inducing transient FGF7 expression for skin repair.
LIST OF SEQUENCE;
List of sequences used in the present invention (from 5’ to 3’):
List of the sequences with SEQ ID:
SEQ ID NO 1:
MKCLLYLAFLFIGVNCKFTIVFPHNQKGNWKNVPSNYHYCPSSSDLNWHNDLI GTALQVKMPKSHKAIQADGWMCHASKWVTTCDFRWYGPKYITHSIRSFTPSV EQCKESIEQTKQGTWLNPGFPPQSCGYATVTDAEAVIVQVTPHHVLVDEYTGE WVDSQFINGKCSNYICPTVHNSTTWHSDYKVKGLCDSNLISMDITFFSEDGELS SLGKEGTGFRSNYFAYETGGKACKMQYCKHWGVRLPSGVWFEMADKDLFAA ARFPECPEGSSISAPSQTSVDVSLIQDVERILDYSLCQETWSKIRAGLPISPVDLSY LAPKNPGTGPAFTIINGTLKYFETRYIRVDIAAPILSRMVGMISGTTTERELWDD WAPYEDVEIGPNGVLRTSSGYKFPLYMIGHGMLDSDLHLSSKAQVFEHPHIQD AASQLPDDESLFFGDTGLSKNPIELVEGWFSSWKSSIASFFFIIGLIIGLFLVLRVGI
HLCIKLKHTKKRQIYTDIEMNRLGK
SEQ ID NO 2:
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHG
QVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAG RWPVKTVHTDNGS NETS TTVKA AC WWAGIKQEFGIPYNPQSQG VIES MNKELK KIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQ KQITKIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKII RDYGKQMAGDDCVASRQDED
SEQ ID NO 3:
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHG
QVDCSPGIWQLVCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAG RWPVKTVHTDNGS NETS TTVKA AC WWAGIKQEFGIPYNPQSQG VIES MNKELK KIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQ KQITKIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKII RDYGKQMAGDDCVASRQDED
SEQ ID NO 4:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPY NTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVL DVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCS MTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTP DKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQ
IYAGIKVRQLCKLLRGTKALTEVVPLTEEAELELAENREILKEPVHGVYYDPSK DLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKGAHTNDVKQLTEAVQKI ATESIVIWGKTPKFKLPIQKETWEAW
SEQ ID NO 5:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPY NTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVL EVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCS
MTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTP DKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQ IYAGIKVRQLCKLLRGTKALTEVVPLTEEAELELAENREILKEPVHGVYYDPSK DLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKGAHTNDVKQLTEAVQKI ATESIVIWGKTPKFKLPIQKETWEAW
SEQ ID NO 6: tggaagggctaattcactcccaacgaagacaagatatccttgatctgtggatctaccacacacaaggctacttccctgattagca gaactacacaccagggccagggatcagatatccactgacctttggatggtgctacaagctagtaccagttgagccagagaagt tagaagaagccaacaaaggagagaacaccagcttgttacaacctgtgagcctgcatgggatggatgacccggagagagaa gtgttagagtggaggtttgacagccgcctagcatttcatcacggtggcccgagagctgcatccggagtacttcaagaactgctg atatcgagcttgctacaagggactttccgctgggggactttccagggaggcgtggcctgggcgggactggggagtggcgag ccctcagatcctgcatataagcagctgctttttgcctgtactgggtctctctggttagaccagatctgagcctgggagctctctgg ctaactagggaacccactgcttaagcctcaataaagcttgccttgagtgcttcaagtagtgtgtgcccgtctgttgtgtgactctg gtaactagagatccctcagacccttttagtcagtgtggaaaatctctagca
SEQ ID NO 7: tggaagggctaattcactcccaacgaagacaagatcgtcgagagatgctgcatataagcagctgctttttgcttgtactgggtct ctctggttagaccagatctgagcctgggagctctctggctaactagggaacccactgcttaagcctcaataaagcttgccttgag tgcttcaagtagtgtgtgcccgtctgttgtgtgactctggtaactagagatccctcagacccttttagtcagtgtggaaaatctcta gca
SEQ ID NO 8: atggtgagcaagggcgaggagctgttcaccggggtggtgcccatcctggtcgagctggacggcgacgtaaacggccacaa gttcagcgtgtccggcgagggcgagggcgatgccacctacggcaagctgaccctgaagttcatctgcaccaccggcaagct gcccgtgccctggcccaccctcgtgaccaccctgacctacggcgtgcagtgcttcagccgctaccccgaccacatgaagca gcacgacttcttcaagtccgccatgcccgaaggctacgtccaggagcgcaccatcttcttcaaggacgacggcaactacaag acccgcgccgaggtgaagttcgagggcgacaccctggtgaaccgcatcgagctgaagggcatcgacttcaaggaggacg gcaacatcctggggcacaagctggagtacaactacaacagccacaacgtctatatcatggccgacaagcagaagaacggca tcaaggtgaacttcaagatccgccacaacatcgaggacggcagcgtgcagctcgccgaccactaccagcagaacaccccc atcggcgacggccccgtgctgctgcccgacaaccactacctgagcacccagtccgccctgagcaaagaccccaacgagaa gcgcgatcacatggtcctgctggagttcgtgaccgccgccgggatcactctcggcatggacgagctgtacaag
SEQ ID NO 9:
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKL PVPWPTEVTTETYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNY KTRAEVKFEGDTEVNRIEEKGIDFKEDGNIEGHKEEYNYNSHNVYIMADKQKN GIKVNFKIRHNIEDGSVQEADHYQQNTPIGDGPVEEPDNHYESTQSAESKDPNE KRDHMVEEEFVTAAGITEGMDEEYK
SEQ ID NO 10: atggcacctctcggtgaagtcggaaactacttcggagtccaggatgccgtgcccttcggcaacgtgcctgtgctgccagtgga ttctccagtgctgctgtctgatcacctgggtcaaagcgaggctggaggcctgcccagaggtcctgcagtgactgatctggatca cctgaagggcattctcagacgcaggcaactgtactgcagaaccggattccatctcgaaatctttccaaatggcaccattcaagg aaccagaaaggatcactctcgctttggcatcctggagttcatttccatcgctgttggcctcgtctctatcagaggcgtggacagc ggtctgtacctcggaatgaacgagaagggtgagctgtatggttccgagaagctcacacaagaatgcgtgtttcgcgaacagttt gaagagaattggtacaacacctacagctccaatctgtacaagcatgtggatacaggtaggagatactatgtcgcactgaacaa agatggcactccacgcgagggtacacgcactaagaggcatcagaagttcacacatttcctgccaaggccagtggaccctgac aaggtgcctgagctctacaaggacatcctcagccagtcttga
SEQ ID NO 11:
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTD LDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGV DSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRY YVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
SEQ ID NO 12: atgggtagcattggagcagccagcatggagttctgctttgacgtcttcaaggaactcaaagtgcatcatgcaaacgagaacatc ttctactgtcccatcgcaatcatgagcgctctcgctatggtttacctgggagccaaagacagcaccaggacccagatcaacaa ggtggtccgcttcgataagctgcctggtttcggagacagcatcgaggcacagtgcggaacctccgtgaacgttcattcttctct gagggacattctgaatcagatcacaaagcctaacgacgtgtatagcttctctctggcctccaggctgtacgctgaggaacgcta ccctatcctccctgaatacctgcagtgtgtcaaagagctgtatagaggtggactggaacctatcaacttccaaactgcagcaga ccaggcacgcgagctgatcaattcttgggtggagtctcaaactaacggaatcatcaggaacgtgctccagccctccagcgtg gacagccagactgcaatggtgctggtcaacgccattgtcttcaagggactctgggagaagactttcaaggacgaggacacac
aggctatgcctttcagagttactgagcaggagagcaagcctgtccagatgatgtaccagatcggtctgttcagagtggcatctat ggccagcgagaagatgaagatcctggagctgcccttcgcaagcggaactatgtctatgctcgtgctgctgccagatgaggttt ctggactggaacaactggagtccatcatcaactttgagaagctgacagagtggacaagctctaacgtcatggaagagagaaa gatcaaggtgtacctcccaaggatgaagatggaagagaagtacaacctgactagcgtgctgatggcaatgggaatcacagat gtctttagctcttctgctaacctgtctggcatctcctccgcagagtccctgaagatttcccaggctgtccacgctgctcatgccga aatcaatgaagcaggtagggaagtggtcggatctgcagaggctggtgttgatgctgccagcgtctccgaagagtttagagctg accatccctttctgttctgtatcaaacatatcgccacaaatgcagtcctgttcttcggaagatgtgtgtctcct
SEQ ID NO 13:
MGSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTRTQI NKVVRFDKLPGFGDSIEAQCGTSVNVHSSLRDILNQITKPNDVYSFSLASRLYAE ERYPILPEYLQCVKELYRGGLEPINFQTAADQARELINSWVESQTNGIIRNVLQP SSVDSQTAMVLVNAIVFKGLWEKTFKDEDTQAMPFRVTEQESKPVQMMYQIG LFRVASMASEKMKILELPFASGTMSMLVLLPDEVSGLEQLESIINFEKLTEWTSS NVMEERKIKVYLPRMKMEEKYNLTSVLMAMGITDVFSSSANLSGISSAESLKIS
QAVHAAHAEINEAGREVVGSAEAGVDAASVSEEFRADHPFLFCIKHIATNAVLF FGRCVSP
SEQ ID NO 14: atggacaagaagtacagcatcggcctggacatcggcaccaactctgtgggctgggccgtgatcaccgacgagtacaaggtg cccagcaagaaattcaaggtgctgggcaacaccgaccggcacagcatcaagaagaacctgatcggcgccctgctgttcgac agcggagaaacagccgaggccacccggctgaagagaaccgccagaagaagatacaccagacggaagaaccggatctgc tatctgcaagagattttcagcaacgagatggccaaggtggacgacagcttcttccacagactggaagagtccttcctggtggaa gaggataagaagcacgagcggcaccccatcttcggcaacatcgtggacgaggtggcctaccacgagaagtaccccaccat ctaccacctgagaaagaaactggtggacagcaccgacaaggccgacctgcggctgatctatctggccctggcccacatgatc aagttccggggccacttcctgatcgagggcgacctgaaccccgacaacagcgacgtggacaagctgttcatccagctggtgc agacctacaaccagctgttcgaggaaaaccccatcaacgccagcggcgtggacgccaaggccatcctgtctgccagactga gcaagagcagacggctggaaaatctgatcgcccagctgcccggcgagaagaagaatggcctgttcggcaacctgattgccc tgagcctgggcctgacccccaacttcaagagcaacttcgacctggccgaggatgccaaactgcagctgagcaaggacacct acgacgacgacctggacaacctgctggcccagatcggcgaccagtacgccgacctgtttctggccgccaagaacctgtccg acgccatcctgctgagcgacatcctgagagtgaacaccgagatcaccaaggcccccctgagcgcctctatgatcaagagata cgacgagcaccaccaggacctgaccctgctgaaagctctcgtgcggcagcagctgcctgagaagtacaaagaaatcttcttc
gaccagagcaagaacggctacgccggctacatcgatggcggagccagccaggaagagttctacaagttcatcaagcccatc ctggaaaagatggacggcaccgaggaactgctcgtgaagctgaacagagaggacctgctgcggaagcagcggaccttcga caacggcagcatcccccaccagatccacctgggagagctgcacgccattctgcggcggcaggaagatttttacccattcctg aaggacaaccgggaaaagatcgagaagatcctgaccttccgcatcccctactacgtgggccctctggccaggggaaacagc agattcgcctggatgaccagaaagagcgaggaaaccatcaccccctggaacttcgaggaagtggtggacaagggcgccag cgcccagagcttcatcgagcggatgaccaacttcgataagaacctgcccaacgagaaggtgctgcccaagcacagcctgct gtacgagtacttcaccgtgtacaacgagctgaccaaagtgaaatacgtgaccgagggaatgagaaagcccgccttcctgagc ggcgagcagaaaaaggccatcgtggacctgctgttcaagaccaaccggaaagtgaccgtgaagcagctgaaagaggacta cttcaagaaaatcgagtgcttcgactccgtggaaatctccggcgtggaagatcggttcaacgcctccctgggcacataccacg acctgctgaagattatcaaggacaaggacttcctggacaatgaggaaaacgaggacattctggaagatatcgtgctgaccctg acactgtttgaggacagagagatgatcgaggaacggctgaaaacctatgcccacctgttcgacgacaaagtgatgaagcagc tgaagcggcggagatacaccggctggggcaggctgagccggaagctgatcaacggcatccgggacaagcagtccggcaa gacaatcctggatttcctgaagtccgacggcttcgccaacagaaacttcatgcagctgatccacgacgacagcctgacctttaa agaggacatccagaaagcccaggtgtccggccagggcgatagcctgcacgagcacattgccaatctggccggatcccccg ccattaagaagggcatcctgcagacagtgaagattgtggacgagctcgtgaaagtgatgggccacaagcccgagaacatcg tgatcgaaatggccagagagaaccagaccacccagaagggacagaagaacagccgcgagagaatgaagcggatcgaag agggcatcaaagagctgggcagccagatcctgaaagaacaccccgtggaaaacacccagctgcagaacgagaagctgtac ctgtactacctgcagaatgggcgggatatgtacgtggaccaggaactggacatcaaccggctgtccgactacgatgtggacc acattgtgccccagtccttcatcaaggacgactccatcgataacaaagtgctgactcggagcgacaagaaccggggcaagag cgacaacgtgccctccgaagaggtcgtgaagaagatgaagaactactggcgccagctgctgaatgccaagctgattaccca gaggaagttcgacaatctgaccaaggccgagagaggcggcctgagcgaactggataaggccggcttcattaagcggcagc tggtggaaacccggcagatcacaaagcacgtggcacagatcctggactcccggatgaacactaagtacgacgagaacgac aaactgatccgggaagtgaaagtgatcaccctgaagtccaagctggtgtccgacttcagaaaggatttccagttttacaaagtg cgcgagatcaacaactaccaccacgcccacgacgcctacctgaacgccgtcgtgggaaccgccctgatcaaaaagtaccct aagctggaaagcgagttcgtgtacggcgattacaaggtgtacgacgtgcggaagatgatcgccaagagcgagcaggaaatc ggcaaggctaccgccaagtacttcttctacagcaacatcatgaactttttcaagaccgagatcacactggccaacggcgagatc agaaagcggcctctgatcgagacaaacggcgaaaccggggagatcgtgtgggataagggccgggattttgccacagtgcg gaaagtgctgtccatgccccaagtgaatatcgtgaaaaagaccgaggtgcagaccggcggcttcagcaaagagtctatcctg cccaagaggaactccgacaagctgatcgccagaaagaaggattgggaccctaagaagtacggcggctttgacagccccac cgtggcctactctgtgctggtggtggccaaagtggaaaagggcaagtccaagaaactgaagagtgtgaaagagctgctggg gatcaccatcatggaaagaagcagcttcgagaagaatcccatcgactttctggaagccaagggctacaaagaagtgaaaaag gacctgatcatcaagctgcctaagtactccctgttcgagctggaaaacggccggaagcggatgctggcttctgccggcgaact
gcagaagggaaacgagctggccctgccctccaaatatgtgaacttcctgtacctggccagccactatgagaagctgaagggc tcccccgaggataatgagcagaaacagctgtttgtggaacagcacaagcactacctggacgagatcatcgagcagattagcg agttctccaagcgcgtgatcctggccgatgccaacctggacaaggtgctgagcgcctacaacaagcaccgggataagccca tcagagagcaggccgagaatatcatccacctgtttaccctgaccaacctgggagcccctgccgccttcaagtactttgacacca ccatcgaccggaagaggtacaccagcaccaaagaggtgctggacgccaccctgatccaccagagcatcaccggcctgtac gagacacggatcgacctgtctcagctgggaggcgaccccaagaaaaagcgcaaagtgctcgagtga
SEQ ID NO 15:
MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFD
SGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVE
EDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMI
KFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLS
KSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTY
DDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYD
EHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILE
KMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKD
NREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQ SFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGE
QKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDL
LKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLK
RRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKE DIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKIVDELVKVMGHKPENIVIE MARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYY LQNGRDMYVDQELDINRLSDYDVDHIVPQSFIKDDSIDNKVLTRSDKNRGKSD
NVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQL
VETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKV
REINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQ
EIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFAT
VRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFD
SPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKE
VKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYE KLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKH
RDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSIT
GEYETRIDESQEGGDPKKKRKVEE
SEQ ID NO 16: tcgacgcaggactcggcttgctgaagcgcgcacggcaagaggcgaggggcggcgactggtgagtacgccaaaaattttga ctagcggaggctagaaggagagagatgggtgcgagagcgtcagtattaagcgggggag
SEQ ID NO 17: tccttgggttcttgggagcagcaggaagcactatgggcgcagcgtcaatgacgctgacggtacaggccagacaattattgtct ggtatagtgcagcagcagaacaatttgctgagggctattgaggcgcaacagcatctgttgcaactcacagtctggggcatcaa gcagctccaggcaagaatcctggctgtggaaagatacct
SEQ ID NO 18: ccgataatcaacctctggattacaaaatttgtgaaagattgactggtattcttaactatgttgctccttttacgctatgtggatacgct gctttaatgcctttgtatcatgctattgcttcccgtatggctttcattttctcctccttgtataaatcctggttgctgtctctttatgaggag ttgtggcccgttgtcaggcaacgtggcgtggtgtgcactgtgtttgctgacgcaacccccactggttggggcattgccaccacc tgtcagctcctttccgggactttcgctttccccctccctattgccacggcggaactcatcgccgcctgccttgcccgctgctggac aggggctcggctgttgggcactgacaattccgtggtgttgtcggggaagctgacgtcctttccatggctgctcgcctgtgttgcc acctggattctgcgcgggacgtccttctgctacgtcccttcggccctcaatccagcggaccttccttcccgcggcctgctgccg gctctgcggcctcttccgcgtcttcgccttcgccctcagacgagtcggatctccctttgggccgcctccccgcatcggg
SEQ ID NO 19: atgcacaaatggattctgacttggattctgcccaccctgctctatcgctcctgcttccacatcatctgtctcgtcggtacaatcagc ctggcttgtaacgacatgacaccagaacagatggctaccaacgtcaactgctccagccctgagagacacactcgctcttacga ctacatggaaggaggcgacattcgcgttagaaggctcttctgtcgcactcaatggtatctgaggattgacaagagaggcaagg tgaaaggcacccaggaaatgaagaacaactacaacatcatggaaatccgcactgtcgctgtcggtatcgttgccatcaaaggt gtcgaatccgagttctacctggctatgaacaaggagggcaagctgtacgcaaagaaggagtgcaacgaggattgcaacttca aggaactcattctggagaaccactacaacacttatgcttccgctaagtggactcacaacggtggtgaaatgttcgtcgcactga accagaagggcatccctgttagaggtaagaagacaaagaaggagcagaagaccgcacacttcctgcctatggcaatcacat aa
SEQ ID NO 20:
MHKWIETWIEPTEEYRSCFHIICEVGTISEACNDMTPEQMATNVNCSSPERHTRS
YDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGI
VAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHN
GGEMFVAENQKGIPVRGKKTKKEQKTAHFEPMAIT
Claims
CLAIMS A ribonucleic acid (RNA) or deoxyribonucleic acid (DNA) molecule comprising: an RNA Booster sequence comprising or consisting of the ribonucleic acid or deoxyribonucleic acid sequence mmsknkkkm or its reverse sequence mkkknksmm, wherein:
■ “m” indicates an adenine (a) or cytosine (c);
■ “s” indicates a guanine (g) or a cytosine (c);
■ “k” indicates a guanine (g) or a uracyl/thymine (u/t);
■ “n” indicates any nucleotide; and a sequence of interest. The RNA or DNA molecule according to claim 1, wherein the RNA Booster sequence comprises or consists of a ribonucleic acid or a deoxyribonucleic acid sequence mmskngkkm or its reverse sequence mkkgnksmm, preferably mmskngkgm or its reverse sequence mgkgnksmm, more preferably cmskhgkgm or its reverse mgkghksmc, even more preferably cmskwgkgm or its reverse sequence mgkgwksmc, yet even more preferably ccsuwgggm or its reverse sequence mgggwuscc, wherein:
■ “m” indicates an adenine (a) or cytosine (c);
■ “s” indicates a guanine (g) or a cytosine (c);
■ “k” indicates a guanine (g) or a uracyl/thymine (u/t);
■ “h” indicates an adenine (a) or a cytosine (c) or a uracyl/thymine (u/t);
■ “w” indicates an adenine (a) or a uracyl/thymine (u/t);
■ “n” indicates any nucleotide; preferably the RNA Booster sequence is selected from the group consisting of:
RNA Booster 9 comprising or consisting of the sequence ccguaggga or its reverse sequence agggaugcc;
RNA Booster 8 comprising or consisting of the sequence cccuugggc or its reverse sequence cggguuccc;
RNA Booster 7 comprising or consisting of the sequence cacgugugc or its reverse sequence cgugugcac;
RNA Booster 6 comprising or consisting of the sequence cccucgggc or its reverse sequence cgggcuccc;
RNA Booster 5 comprising or consisting of the sequence aacuggggc or its reverse sequence cggggucaa;
RNA Booster 4 comprising or consisting of the sequence ccguggugc or its reverse sequence cguggugcc;
RNA Booster 3 comprising or consisting of the sequence cccuaggua or its reverse sequence auggauccc;
RNA Booster 2 comprising or consisting of the sequence aaguuuggc or its reverse sequence cgguuugaa; and
RNA Booster 1 comprising or consisting of the sequence cccgugugc or its reverse sequence cgugugccc. The RNA or DNA molecule according to claim 1 or 2, comprised within a non- viral vector. The RNA molecule according to claim 1 or 2, packaged into an RNA virus vector derived from a Group III, Group IV, Group V or Group VI RNA virus; preferably packaged into RNA virus vector derived from a Group VI RNA virus; more preferably packaged into a Retroviridae vector. The RNA molecule according to claim 4, wherein the Retroviridae vector is an Orthoretrovirinae or a Spumaretrovirinae; preferably wherein the Retroviridae vector is an Orthoretrovirinae-, more preferably wherein the Retroviridae vector is selected from the group consisting of human immunodeficiency viruses (HIV), simian immunodeficiency viruses (SIV), feline immunodeficiency virus (FIV), bovine immunodeficiency virus (BIV), puma lentivirus (PLV), equine infectious anemia virus (EIAV), caprine arthritis encephalitis virus (CAEV), Visna-maedi virus, Jembrana disease virus, avian sarcoma leukosis virus (ASLV), Rous sarcoma virus (RSV), avian myeloblastosis virus (AMV), mouse mammary tumor virus (MMTV), Jaagsiekte
sheep retrovirus (JSRV), enzootic nasal tumor viruses (ENTV), simian retroviruses (SRV), Mason-Pfizer monkey virus (M-PMV), human T-lymphotropic viruses (HTLV), simian T-lymphotropic viruses (STLV), bovine leukemia virus (BLV), Walleye dermal sarcoma virus (WDSV), Walleye epidermal hyperplasia viruses (WEHV), murine leukemia viruses (MLV), Abelson murine leukemia virus (AMLV), Friend virus (FV), feline leukemia virus (FeLV), koala retrovirus (KoRV), xenotropic murine leukemia virus-related virus (XMRV), chick syncytial virus (CSV), murine sarcoma viruses (MSV), feline sarcoma viruses (FSV), Gibbon ape leukemia virus (GaLV), guinea pig type-C oncovirus, porcine type-C oncovirus, reticuloendotheliosis virus, Trager duck spleen necrosis virus, viper retrovirus, and Woolly monkey sarcoma virus. The RNA molecule according to claim 4 or 5, wherein the Retroviridae vector is a lentiviral vector, preferably selected from the group consisting of human immunodeficiency virus-1 (HIV-1) and HIV-2; more preferably the Retroviridae vector is HIV-1. The RNA molecule according to any one of claims 4 to 6, wherein the Group VI RNA virus vector, preferably the Retroviridae vector, is reverse transcriptase (RT)-defective; preferably wherein the Group VI RNA virus vector, preferably the Retroviridae vector does not comprise a gene encoding a reverse transcriptase or wherein the retroviral vector comprises a gene encoding a mutated reverse transcriptase with abolished reverse transcription activity. The RNA molecule according to any one of claims 4 to 7, further comprising one or several of: a 5’ long terminal repeat (LTR), a packaging sequence, a Rev-response element sequence, a post-transcriptional regulation element sequence, and a 3’ LTR.
A pharmaceutical composition comprising the RNA or DNA molecule according to any one of claims 1 to 8, and at least one pharmaceutically acceptable excipient or carrier. The RNA or DNA molecule according to any one of claims 1 to 8, or the pharmaceutical composition according to claim 9, for use in therapy. An in vitro method of transiently expressing at least one sequence of interest in a cell, comprising transfecting or transducing the cell with the RNA or DNA molecule according to any one of claims 1 to 8. A nucleic acid system comprising:
(i) At least one first nucleic acid sequence encoding a Retroviridae genome comprising at least a retroviral gag and pol sequence; optionally wherein the pol sequence encodes a defective reverse-transcriptase (RT) or wherein the pol sequence lacks a RT gene;
(ii) At least one second nucleic acid sequence encoding a viral envelope glycoprotein; and
(iii) At least one third nucleic acid sequence encoding an expression cassette comprising: a packaging sequence, an RNA Booster sequence comprising or consisting of the ribonucleic acid or deoxyribonucleic acid sequence mmsknkkkm or its reverse sequence mkkknksmm, wherein:
■ “m” indicates an adenine (a) or cytosine (c);
■ “s” indicates a guanine (g) or a cytosine (c);
■ “k” indicates a guanine (g) or a uracyl/thymine (u/t);
■ “n” indicates any nucleotide, optionally, a multiple cloning site, optionally, a sequence of interest; wherein the first and second nucleic acid sequences are trans-complementation sequences lacking a functional packaging sequence;
preferably wherein the RNA Booster sequence comprises or consists of a nucleic acid sequence mmskngkkm or its reverse sequence mkkgnksmm, preferably mmskngkgm or its reverse sequence mgkgnksmm, more preferably cmskhgkgm or its reverse sequence mgkghksmc, even more preferably cmskwgkgm or its reverse sequence mgkgwksmc, yet even more preferably ccsuwgggm or its reverse sequence mgggwuscc, wherein:
■ “m” indicates an adenine (a) or cytosine (c);
■ “s” indicates a guanine (g) or a cytosine (c);
■ “k” indicates a guanine (g) or a uracyl/thymine (u/t);
■ “h” indicates an adenine (a) or a cytosine (c) or a uracyl/thymine (u/t);
■ “w” indicates an adenine (a) or a uracyl/thymine (u/t);
■ “n” indicates any nucleotide; more preferably the RNA Booster sequence is selected from the group consisting of:
RNA Booster 9 comprising or consisting of the sequence ccguaggga or its reverse sequence agggaugcc;
RNA Booster 8 comprising or consisting of the sequence cccuugggc or its reverse sequence cggguuccc;
RNA Booster 7 comprising or consisting of the sequence cacgugugc or its reverse sequence cgugugcac;
RNA Booster 6 comprising or consisting of the sequence cccucgggc or its reverse sequence cgggcuccc;
RNA Booster 5 comprising or consisting of the sequence aacuggggc or its reverse sequence cggggucaa;
RNA Booster 4 comprising or consisting of the sequence ccguggugc or its reverse sequence cguggugcc;
RNA Booster 3 comprising or consisting of the sequence cccuaggua or its reverse sequence auggauccc;
RNA Booster 2 comprising or consisting of the sequence aaguuuggc or its reverse sequence cgguuugaa; and
RNA Booster 1 comprising or consisting of the sequence cccgugugc or its reverse sequence cgugugccc.
The nucleic acid system according to claim 12, wherein each at least one nucleic acid sequence (i), (ii) and (iii) is independently from each other a linear nucleic acid or a plasmid. A cell or cell population comprising at least one RNA or DNA molecule according to any of claims 1 to 8, or at least one nucleic acid system according to claim 12 or 13. A method of producing a Retroviridae vector according to any one of claims 4 to 8, comprising: transfecting at least one cell or cell population with at least one RNA or DNA molecule according to any of claims 1 to 8, or at least one nucleic acid system according to claim 12 or 13, or providing at least one cell or cell population according to claim 14; culturing the cell or cell population of a period of time sufficient for the production of the Retroviridae vector; recovering, and optionally purifying, the Retroviridae vector. A nucleic acid system comprising at least one nucleic acid sequence encoding a recombinant expression cassette comprising:
- optionally, a promoter, and
- an RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm, and
- a multiple cloning site (MCS) or a sequence of interest, and
- optionally, an origin of replication (ORI), and
- optionally, a selectable marker.
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/818,483 | 2022-08-09 | ||
EP22306196.1 | 2022-08-09 | ||
US17/818,483 US20240060084A1 (en) | 2022-08-09 | 2022-08-09 | Transient expression system for rna |
EP22306196 | 2022-08-09 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2024033441A1 true WO2024033441A1 (en) | 2024-02-15 |
Family
ID=87571816
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2023/072103 WO2024033441A1 (en) | 2022-08-09 | 2023-08-09 | Transient expression system for rna |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2024033441A1 (en) |
Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2003018828A2 (en) * | 2001-08-21 | 2003-03-06 | Isis Pharmaceuticals, Inc. | Molecular interaction sites of 16s ribosomal rna and methods of modulating the same |
WO2003106684A2 (en) * | 2002-06-14 | 2003-12-24 | Chromagenics B.V. | A method for simultaneous production of multiple proteins; vectors and cells for use therein |
WO2005116225A1 (en) | 2004-05-25 | 2005-12-08 | Children's Hospital Medical Center | Method for introducing and expressing rna in cells |
WO2007010221A2 (en) * | 2005-07-15 | 2007-01-25 | Medical Research Council | COMPOSITIONS AND METHODS RELATING TO ORTHOGONAL RIBOSOME mRNA PAIRS |
WO2009043353A2 (en) * | 2007-10-04 | 2009-04-09 | Santaris Pharma A/S | Micromirs |
WO2013060819A2 (en) | 2011-10-26 | 2013-05-02 | Newvectys | Transient expression vectors, preparation and uses thereof |
-
2023
- 2023-08-09 WO PCT/EP2023/072103 patent/WO2024033441A1/en unknown
Patent Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2003018828A2 (en) * | 2001-08-21 | 2003-03-06 | Isis Pharmaceuticals, Inc. | Molecular interaction sites of 16s ribosomal rna and methods of modulating the same |
WO2003106684A2 (en) * | 2002-06-14 | 2003-12-24 | Chromagenics B.V. | A method for simultaneous production of multiple proteins; vectors and cells for use therein |
WO2005116225A1 (en) | 2004-05-25 | 2005-12-08 | Children's Hospital Medical Center | Method for introducing and expressing rna in cells |
WO2007010221A2 (en) * | 2005-07-15 | 2007-01-25 | Medical Research Council | COMPOSITIONS AND METHODS RELATING TO ORTHOGONAL RIBOSOME mRNA PAIRS |
WO2009043353A2 (en) * | 2007-10-04 | 2009-04-09 | Santaris Pharma A/S | Micromirs |
WO2013060819A2 (en) | 2011-10-26 | 2013-05-02 | Newvectys | Transient expression vectors, preparation and uses thereof |
Non-Patent Citations (3)
Title |
---|
LI ET AL., CANCER IMMUNOL IMMUNOTHER, vol. 53, no. 3, 2004, pages 139 - 43 |
MOCK ET AL., SCI REP, vol. 4, 2014, pages 6409 |
NOVELLINO ET AL., CANCER IMMUNOL IMMUNOTHER, vol. 54, no. 3, 2005, pages 187 - 20 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2019202498B2 (en) | AADC polynucleotides for the treatment of Parkinson's Disease | |
RU2733424C2 (en) | Method for increasing the expression of encoded rna proteins | |
EA031321B1 (en) | Nucleic acids encoding influenza virus proteins, compositions based thereon and methods of prevention and treatment | |
CN114014937A (en) | Stabilized influenza hemagglutinin stem trimer and uses thereof | |
US20160367638A1 (en) | LEPTIN mRNA COMPOSITIONS AND FORMULATIONS | |
US20100285592A1 (en) | Single expression vector for generation of a virus with a segmented genome | |
JP2002512804A (en) | Use of triplex-structured DNA sequences for the introduction of nucleotide sequences | |
JPH06509344A (en) | Induction of cytotoxic T-lymphocyte responses | |
JP5264840B2 (en) | A plasmid having three complete transcription units and an immunogenic composition for eliciting an immune response against HIV | |
KR20150127586A (en) | Influenza nucleic acid molecules and vaccines made therefrom | |
US20220040329A1 (en) | Inducible expression cassette, and uses thereof | |
KR20200014780A (en) | Optimized Nucleic Acid Antibody Constructs | |
KR20220066225A (en) | Compositions and methods for selective gene regulation | |
TW202039855A (en) | Use of lentiviral vectors expressing factor ix | |
US20240060067A1 (en) | Transient expression system for rna, for cosmetic uses | |
US20240060084A1 (en) | Transient expression system for rna | |
US20240060085A1 (en) | Transient expression system for rna, for gene editing | |
US20240058430A1 (en) | Transient expression system for rna, for vaccination | |
WO2024033441A1 (en) | Transient expression system for rna | |
WO2024033448A1 (en) | Transient expression system for rna, for vaccination | |
WO2024033446A1 (en) | Transient expression system for rna, for gene editing | |
WO2024033444A1 (en) | Transient expression system for rna, for cosmetic uses | |
CN116096900A (en) | Compositions and methods for treating GJB 2-related hearing loss | |
US20090170800A1 (en) | Genetic constructs and compositions comprising rre and cte and uses thereof | |
Moens et al. | Green fluorescent protein modified to bind DNA initiates production of anti-DNA antibodies when expressed in vivo |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23754778 Country of ref document: EP Kind code of ref document: A1 |