WO2023245092A2 - ÉDITION DE STRESS DE CAMKIIδ - Google Patents
ÉDITION DE STRESS DE CAMKIIδ Download PDFInfo
- Publication number
- WO2023245092A2 WO2023245092A2 PCT/US2023/068480 US2023068480W WO2023245092A2 WO 2023245092 A2 WO2023245092 A2 WO 2023245092A2 US 2023068480 W US2023068480 W US 2023068480W WO 2023245092 A2 WO2023245092 A2 WO 2023245092A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- vector
- sequence
- cell
- promoter
- sgrna
- Prior art date
Links
- 239000000203 mixture Substances 0.000 claims abstract description 65
- 238000000034 method Methods 0.000 claims abstract description 51
- 210000005260 human cell Anatomy 0.000 claims abstract description 11
- 210000004027 cell Anatomy 0.000 claims description 184
- 239000013598 vector Substances 0.000 claims description 159
- 108090000623 proteins and genes Proteins 0.000 claims description 153
- 108091033409 CRISPR Proteins 0.000 claims description 141
- 230000014509 gene expression Effects 0.000 claims description 97
- 150000007523 nucleic acids Chemical group 0.000 claims description 97
- 102000039446 nucleic acids Human genes 0.000 claims description 87
- 108020004707 nucleic acids Proteins 0.000 claims description 87
- 239000013607 AAV vector Substances 0.000 claims description 67
- 241000282414 Homo sapiens Species 0.000 claims description 67
- GFFGJBXGBJISGV-UHFFFAOYSA-N adenyl group Chemical group N1=CN=C2N=CNC2=C1N GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 claims description 57
- 101710163270 Nuclease Proteins 0.000 claims description 55
- 229930024421 Adenine Natural products 0.000 claims description 49
- 229960000643 adenine Drugs 0.000 claims description 49
- 210000004413 cardiac myocyte Anatomy 0.000 claims description 45
- 210000004263 induced pluripotent stem cell Anatomy 0.000 claims description 45
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 36
- 208000028867 ischemia Diseases 0.000 claims description 36
- 239000007924 injection Substances 0.000 claims description 35
- 238000002347 injection Methods 0.000 claims description 35
- 230000001105 regulatory effect Effects 0.000 claims description 33
- 239000013603 viral vector Substances 0.000 claims description 31
- 230000000747 cardiac effect Effects 0.000 claims description 27
- 230000002861 ventricular Effects 0.000 claims description 27
- 108020005004 Guide RNA Proteins 0.000 claims description 25
- 230000003612 virological effect Effects 0.000 claims description 25
- 241000580270 Adeno-associated virus - 4 Species 0.000 claims description 20
- 230000004217 heart function Effects 0.000 claims description 20
- 239000013612 plasmid Substances 0.000 claims description 20
- 241000193996 Streptococcus pyogenes Species 0.000 claims description 19
- 241000202702 Adeno-associated virus - 3 Species 0.000 claims description 18
- 241001634120 Adeno-associated virus - 5 Species 0.000 claims description 18
- 241000972680 Adeno-associated virus - 6 Species 0.000 claims description 18
- 241001164823 Adeno-associated virus - 7 Species 0.000 claims description 18
- 241001164825 Adeno-associated virus - 8 Species 0.000 claims description 18
- 206010063837 Reperfusion injury Diseases 0.000 claims description 18
- 241000649045 Adeno-associated virus 10 Species 0.000 claims description 16
- 241000649046 Adeno-associated virus 11 Species 0.000 claims description 16
- 238000010453 CRISPR/Cas method Methods 0.000 claims description 16
- 241001147687 Staphylococcus auricularis Species 0.000 claims description 14
- 230000010076 replication Effects 0.000 claims description 14
- 230000002950 deficient Effects 0.000 claims description 12
- 238000004904 shortening Methods 0.000 claims description 12
- 230000001413 cellular effect Effects 0.000 claims description 10
- 230000003247 decreasing effect Effects 0.000 claims description 10
- 230000008685 targeting Effects 0.000 claims description 10
- 230000017730 intein-mediated protein splicing Effects 0.000 claims description 9
- 102000055025 Adenosine deaminases Human genes 0.000 claims description 8
- 102000004987 Troponin T Human genes 0.000 claims description 8
- 108090001108 Troponin T Proteins 0.000 claims description 8
- 206010003119 arrhythmia Diseases 0.000 claims description 8
- 230000006793 arrhythmia Effects 0.000 claims description 8
- 210000004962 mammalian cell Anatomy 0.000 claims description 8
- 101710169336 5'-deoxyadenosine deaminase Proteins 0.000 claims description 7
- 210000005003 heart tissue Anatomy 0.000 claims description 7
- 230000001771 impaired effect Effects 0.000 claims description 7
- 230000001976 improved effect Effects 0.000 claims description 7
- 208000013875 Heart injury Diseases 0.000 claims description 6
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 claims description 6
- 241000191967 Staphylococcus aureus Species 0.000 claims description 6
- 241001134656 Staphylococcus lugdunensis Species 0.000 claims description 6
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 claims description 6
- 210000003205 muscle Anatomy 0.000 claims description 6
- 239000004474 valine Substances 0.000 claims description 6
- 206010016654 Fibrosis Diseases 0.000 claims description 5
- 230000004761 fibrosis Effects 0.000 claims description 5
- 238000001802 infusion Methods 0.000 claims description 5
- 210000000130 stem cell Anatomy 0.000 claims description 5
- 239000004475 Arginine Substances 0.000 claims description 4
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 claims description 4
- 230000004094 calcium homeostasis Effects 0.000 claims description 4
- 239000003937 drug carrier Substances 0.000 claims description 4
- 230000008482 dysregulation Effects 0.000 claims description 4
- 230000000903 blocking effect Effects 0.000 claims description 3
- 230000010339 dilation Effects 0.000 claims description 3
- 238000001990 intravenous administration Methods 0.000 claims description 3
- 230000006907 apoptotic process Effects 0.000 claims description 2
- 230000011506 response to oxidative stress Effects 0.000 claims description 2
- 241000699670 Mus sp. Species 0.000 abstract description 123
- 230000036542 oxidative stress Effects 0.000 abstract description 7
- 230000006698 induction Effects 0.000 abstract description 2
- 108010003721 Calcium-Calmodulin-Dependent Protein Kinase Type 2 Proteins 0.000 description 87
- 102000004657 Calcium-Calmodulin-Dependent Protein Kinase Type 2 Human genes 0.000 description 86
- 239000002585 base Substances 0.000 description 82
- 208000002267 Anti-neutrophil cytoplasmic antibody-associated vasculitis Diseases 0.000 description 72
- 102000053602 DNA Human genes 0.000 description 72
- 108020004414 DNA Proteins 0.000 description 72
- 102000004169 proteins and genes Human genes 0.000 description 67
- 235000018102 proteins Nutrition 0.000 description 66
- 239000002773 nucleotide Substances 0.000 description 61
- 125000003729 nucleotide group Chemical group 0.000 description 61
- 210000002216 heart Anatomy 0.000 description 52
- 230000000694 effects Effects 0.000 description 47
- 241000699666 Mus <mouse, genus> Species 0.000 description 44
- 241000700605 Viruses Species 0.000 description 44
- 108090000765 processed proteins & peptides Proteins 0.000 description 41
- 238000010354 CRISPR gene editing Methods 0.000 description 40
- 229920002477 rna polymer Polymers 0.000 description 38
- 238000004458 analytical method Methods 0.000 description 34
- 108020004705 Codon Proteins 0.000 description 33
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 33
- 102000004196 processed proteins & peptides Human genes 0.000 description 32
- 229920001184 polypeptide Polymers 0.000 description 28
- 230000006870 function Effects 0.000 description 24
- 208000010125 myocardial infarction Diseases 0.000 description 23
- 241000701161 unidentified adenovirus Species 0.000 description 23
- 108010077850 Nuclear Localization Signals Proteins 0.000 description 21
- 230000006378 damage Effects 0.000 description 21
- 238000010362 genome editing Methods 0.000 description 21
- 102000040430 polynucleotide Human genes 0.000 description 21
- 108091033319 polynucleotide Proteins 0.000 description 21
- 239000002157 polynucleotide Substances 0.000 description 21
- 238000012163 sequencing technique Methods 0.000 description 21
- 238000001727 in vivo Methods 0.000 description 20
- 102000019027 Ryanodine Receptor Calcium Release Channel Human genes 0.000 description 19
- 230000004913 activation Effects 0.000 description 19
- 230000010410 reperfusion Effects 0.000 description 19
- 208000027418 Wounds and injury Diseases 0.000 description 18
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 18
- 208000014674 injury Diseases 0.000 description 18
- 210000001519 tissue Anatomy 0.000 description 18
- 101150063416 add gene Proteins 0.000 description 17
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 17
- 238000010356 CRISPR-Cas9 genome editing Methods 0.000 description 16
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 16
- 230000015572 biosynthetic process Effects 0.000 description 16
- 238000006467 substitution reaction Methods 0.000 description 16
- 230000035897 transcription Effects 0.000 description 16
- 238000013518 transcription Methods 0.000 description 16
- 238000011282 treatment Methods 0.000 description 16
- 238000010217 densitometric analysis Methods 0.000 description 15
- 201000010099 disease Diseases 0.000 description 15
- 239000003623 enhancer Substances 0.000 description 15
- 208000024172 Cardiovascular disease Diseases 0.000 description 14
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 14
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 14
- 108091028113 Trans-activating crRNA Proteins 0.000 description 14
- 235000001014 amino acid Nutrition 0.000 description 14
- 230000000295 complement effect Effects 0.000 description 14
- 238000002592 echocardiography Methods 0.000 description 14
- 239000007925 intracardiac injection Substances 0.000 description 14
- 238000001543 one-way ANOVA Methods 0.000 description 14
- 125000006850 spacer group Chemical group 0.000 description 14
- 238000001262 western blot Methods 0.000 description 14
- 108091093088 Amplicon Proteins 0.000 description 13
- 241000702421 Dependoparvovirus Species 0.000 description 13
- 108010029485 Protein Isoforms Proteins 0.000 description 13
- 102000001708 Protein Isoforms Human genes 0.000 description 13
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 13
- 108700019146 Transgenes Proteins 0.000 description 13
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 13
- 239000002245 particle Substances 0.000 description 13
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 12
- 108020004999 messenger RNA Proteins 0.000 description 12
- 230000035772 mutation Effects 0.000 description 12
- 238000004806 packaging method and process Methods 0.000 description 12
- 239000000047 product Substances 0.000 description 12
- 238000012360 testing method Methods 0.000 description 12
- 230000001225 therapeutic effect Effects 0.000 description 12
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 11
- 108091027544 Subgenomic mRNA Proteins 0.000 description 11
- 239000003795 chemical substances by application Substances 0.000 description 11
- 239000002299 complementary DNA Substances 0.000 description 11
- 239000003814 drug Substances 0.000 description 11
- 238000000338 in vitro Methods 0.000 description 11
- 235000006109 methionine Nutrition 0.000 description 11
- 239000000243 solution Substances 0.000 description 11
- 238000012546 transfer Methods 0.000 description 11
- 241000701022 Cytomegalovirus Species 0.000 description 10
- 102000004190 Enzymes Human genes 0.000 description 10
- 108090000790 Enzymes Proteins 0.000 description 10
- 150000001413 amino acids Chemical class 0.000 description 10
- 229940088598 enzyme Drugs 0.000 description 10
- 238000001415 gene therapy Methods 0.000 description 10
- 238000007480 sanger sequencing Methods 0.000 description 10
- 241001430294 unidentified retrovirus Species 0.000 description 10
- 101000910035 Streptococcus pyogenes serotype M1 CRISPR-associated endonuclease Cas9/Csn1 Proteins 0.000 description 9
- 125000003275 alpha amino acid group Chemical group 0.000 description 9
- 238000013459 approach Methods 0.000 description 9
- 238000003556 assay Methods 0.000 description 9
- 230000004069 differentiation Effects 0.000 description 9
- 238000005516 engineering process Methods 0.000 description 9
- 238000002474 experimental method Methods 0.000 description 9
- 230000002068 genetic effect Effects 0.000 description 9
- 208000019622 heart disease Diseases 0.000 description 9
- 239000003112 inhibitor Substances 0.000 description 9
- 230000010354 integration Effects 0.000 description 9
- 239000002502 liposome Substances 0.000 description 9
- 230000004048 modification Effects 0.000 description 9
- 238000012986 modification Methods 0.000 description 9
- 108090000565 Capsid Proteins Proteins 0.000 description 8
- 101710132601 Capsid protein Proteins 0.000 description 8
- 101710197658 Capsid protein VP1 Proteins 0.000 description 8
- 102100023321 Ceruloplasmin Human genes 0.000 description 8
- -1 Csm2 Proteins 0.000 description 8
- 101001077352 Homo sapiens Calcium/calmodulin-dependent protein kinase type II subunit beta Proteins 0.000 description 8
- 241001465754 Metazoa Species 0.000 description 8
- 101710118046 RNA-directed RNA polymerase Proteins 0.000 description 8
- 101710108545 Viral protein 1 Proteins 0.000 description 8
- 229940079593 drug Drugs 0.000 description 8
- 230000001939 inductive effect Effects 0.000 description 8
- 238000003780 insertion Methods 0.000 description 8
- 230000037431 insertion Effects 0.000 description 8
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 8
- 230000036961 partial effect Effects 0.000 description 8
- 238000003752 polymerase chain reaction Methods 0.000 description 8
- 239000000523 sample Substances 0.000 description 8
- 238000011144 upstream manufacturing Methods 0.000 description 8
- 108091026890 Coding region Proteins 0.000 description 7
- 101710081079 Minor spike protein H Proteins 0.000 description 7
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 7
- 230000002411 adverse Effects 0.000 description 7
- 230000008901 benefit Effects 0.000 description 7
- 230000034994 death Effects 0.000 description 7
- 231100000517 death Toxicity 0.000 description 7
- 239000013604 expression vector Substances 0.000 description 7
- 239000005090 green fluorescent protein Substances 0.000 description 7
- 230000001965 increasing effect Effects 0.000 description 7
- 230000026731 phosphorylation Effects 0.000 description 7
- 238000006366 phosphorylation reaction Methods 0.000 description 7
- 238000002360 preparation method Methods 0.000 description 7
- 102000005962 receptors Human genes 0.000 description 7
- 108020003175 receptors Proteins 0.000 description 7
- 239000011780 sodium chloride Substances 0.000 description 7
- 101000805768 Banna virus (strain Indonesia/JKT-6423/1980) mRNA (guanine-N(7))-methyltransferase Proteins 0.000 description 6
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 6
- 102100033093 Calcium/calmodulin-dependent protein kinase type II subunit alpha Human genes 0.000 description 6
- 208000020446 Cardiac disease Diseases 0.000 description 6
- 101000686790 Chaetoceros protobacilladnavirus 2 Replication-associated protein Proteins 0.000 description 6
- 101000864475 Chlamydia phage 1 Internal scaffolding protein VP3 Proteins 0.000 description 6
- 101000803553 Eumenes pomiformis Venom peptide 3 Proteins 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 6
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 6
- 101000583961 Halorubrum pleomorphic virus 1 Matrix protein Proteins 0.000 description 6
- 206010019280 Heart failures Diseases 0.000 description 6
- 241000282412 Homo Species 0.000 description 6
- 101000944249 Homo sapiens Calcium/calmodulin-dependent protein kinase type II subunit alpha Proteins 0.000 description 6
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 6
- 241000124008 Mammalia Species 0.000 description 6
- 108090000157 Metallothionein Proteins 0.000 description 6
- 108700026244 Open Reading Frames Proteins 0.000 description 6
- 241000283973 Oryctolagus cuniculus Species 0.000 description 6
- 241000700584 Simplexvirus Species 0.000 description 6
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 6
- 239000004473 Threonine Substances 0.000 description 6
- 108020004566 Transfer RNA Proteins 0.000 description 6
- 230000001580 bacterial effect Effects 0.000 description 6
- 230000027455 binding Effects 0.000 description 6
- 239000011575 calcium Substances 0.000 description 6
- 229910052791 calcium Inorganic materials 0.000 description 6
- 238000013184 cardiac magnetic resonance imaging Methods 0.000 description 6
- 230000002939 deleterious effect Effects 0.000 description 6
- 238000011156 evaluation Methods 0.000 description 6
- 230000001404 mediated effect Effects 0.000 description 6
- 230000003647 oxidation Effects 0.000 description 6
- 238000007254 oxidation reaction Methods 0.000 description 6
- 230000001590 oxidative effect Effects 0.000 description 6
- 230000037361 pathway Effects 0.000 description 6
- 230000008569 process Effects 0.000 description 6
- 150000003839 salts Chemical class 0.000 description 6
- 238000001356 surgical procedure Methods 0.000 description 6
- 208000024891 symptom Diseases 0.000 description 6
- 238000003786 synthesis reaction Methods 0.000 description 6
- 238000001890 transfection Methods 0.000 description 6
- DIGQNXIGRZPYDK-WKSCXVIASA-N (2R)-6-amino-2-[[2-[[(2S)-2-[[2-[[(2R)-2-[[(2S)-2-[[(2R,3S)-2-[[2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2R)-2-[[(2S,3S)-2-[[(2R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2R)-2-[[2-[[2-[[2-[(2-amino-1-hydroxyethylidene)amino]-3-carboxy-1-hydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1,5-dihydroxy-5-iminopentylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]hexanoic acid Chemical compound C[C@@H]([C@@H](C(=N[C@@H](CS)C(=N[C@@H](C)C(=N[C@@H](CO)C(=NCC(=N[C@@H](CCC(=N)O)C(=NC(CS)C(=N[C@H]([C@H](C)O)C(=N[C@H](CS)C(=N[C@H](CO)C(=NCC(=N[C@H](CS)C(=NCC(=N[C@H](CCCCN)C(=O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)N=C([C@H](CS)N=C([C@H](CO)N=C([C@H](CO)N=C([C@H](C)N=C(CN=C([C@H](CO)N=C([C@H](CS)N=C(CN=C(C(CS)N=C(C(CC(=O)O)N=C(CN)O)O)O)O)O)O)O)O)O)O)O)O DIGQNXIGRZPYDK-WKSCXVIASA-N 0.000 description 5
- 229940043709 CaM kinase II inhibitor Drugs 0.000 description 5
- 102100025232 Calcium/calmodulin-dependent protein kinase type II subunit beta Human genes 0.000 description 5
- 102000000584 Calmodulin Human genes 0.000 description 5
- 108010041952 Calmodulin Proteins 0.000 description 5
- 230000004568 DNA-binding Effects 0.000 description 5
- 229930010555 Inosine Natural products 0.000 description 5
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 5
- 102000003792 Metallothionein Human genes 0.000 description 5
- 208000009869 Neu-Laxova syndrome Diseases 0.000 description 5
- 238000003559 RNA-seq method Methods 0.000 description 5
- 210000004369 blood Anatomy 0.000 description 5
- 239000008280 blood Substances 0.000 description 5
- 230000037396 body weight Effects 0.000 description 5
- 210000004556 brain Anatomy 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 230000003197 catalytic effect Effects 0.000 description 5
- 230000004087 circulation Effects 0.000 description 5
- 238000003776 cleavage reaction Methods 0.000 description 5
- 238000010367 cloning Methods 0.000 description 5
- 150000001875 compounds Chemical class 0.000 description 5
- 208000029078 coronary artery disease Diseases 0.000 description 5
- 210000004351 coronary vessel Anatomy 0.000 description 5
- 230000007423 decrease Effects 0.000 description 5
- 230000001419 dependent effect Effects 0.000 description 5
- 239000006185 dispersion Substances 0.000 description 5
- 210000003527 eukaryotic cell Anatomy 0.000 description 5
- 230000004927 fusion Effects 0.000 description 5
- 238000009396 hybridization Methods 0.000 description 5
- 230000005764 inhibitory process Effects 0.000 description 5
- 230000000977 initiatory effect Effects 0.000 description 5
- 229960003786 inosine Drugs 0.000 description 5
- 210000004185 liver Anatomy 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- 210000004165 myocardium Anatomy 0.000 description 5
- 210000000056 organ Anatomy 0.000 description 5
- 238000000513 principal component analysis Methods 0.000 description 5
- 230000006798 recombination Effects 0.000 description 5
- 238000005215 recombination Methods 0.000 description 5
- 230000002829 reductive effect Effects 0.000 description 5
- 238000010839 reverse transcription Methods 0.000 description 5
- 230000002441 reversible effect Effects 0.000 description 5
- 108091052345 ryanodine receptor (TC 1.A.3.1) family Proteins 0.000 description 5
- 230000007017 scission Effects 0.000 description 5
- 235000000346 sugar Nutrition 0.000 description 5
- 230000014616 translation Effects 0.000 description 5
- 235000014393 valine Nutrition 0.000 description 5
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 4
- 241000283707 Capra Species 0.000 description 4
- 108091028732 Concatemer Proteins 0.000 description 4
- 230000004543 DNA replication Effects 0.000 description 4
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 4
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 4
- 206010021143 Hypoxia Diseases 0.000 description 4
- 102000004877 Insulin Human genes 0.000 description 4
- 108090001061 Insulin Proteins 0.000 description 4
- 102000043131 MHC class II family Human genes 0.000 description 4
- 108091054438 MHC class II family Proteins 0.000 description 4
- 108010059343 MM Form Creatine Kinase Proteins 0.000 description 4
- 102000001068 Neural Cell Adhesion Molecules Human genes 0.000 description 4
- 108010069196 Neural Cell Adhesion Molecules Proteins 0.000 description 4
- 102000035195 Peptidases Human genes 0.000 description 4
- 108091005804 Peptidases Proteins 0.000 description 4
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 description 4
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 description 4
- 108010071690 Prealbumin Proteins 0.000 description 4
- 239000004365 Protease Substances 0.000 description 4
- 102000054727 Serum Amyloid A Human genes 0.000 description 4
- 108700028909 Serum Amyloid A Proteins 0.000 description 4
- 108700026226 TATA Box Proteins 0.000 description 4
- 102000013394 Troponin I Human genes 0.000 description 4
- 108010065729 Troponin I Proteins 0.000 description 4
- 239000004480 active ingredient Substances 0.000 description 4
- 150000003838 adenosines Chemical class 0.000 description 4
- 230000001640 apoptogenic effect Effects 0.000 description 4
- 239000012736 aqueous medium Substances 0.000 description 4
- 239000007864 aqueous solution Substances 0.000 description 4
- 210000001367 artery Anatomy 0.000 description 4
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 4
- 230000035578 autophosphorylation Effects 0.000 description 4
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 4
- 238000012937 correction Methods 0.000 description 4
- 206010012601 diabetes mellitus Diseases 0.000 description 4
- 230000009977 dual effect Effects 0.000 description 4
- 238000001317 epifluorescence microscopy Methods 0.000 description 4
- 230000003176 fibrotic effect Effects 0.000 description 4
- 239000012634 fragment Substances 0.000 description 4
- 108010017007 glucose-regulated proteins Proteins 0.000 description 4
- 239000001963 growth medium Substances 0.000 description 4
- 210000002443 helper t lymphocyte Anatomy 0.000 description 4
- 238000003384 imaging method Methods 0.000 description 4
- 238000003364 immunohistochemistry Methods 0.000 description 4
- 230000002401 inhibitory effect Effects 0.000 description 4
- 229940125396 insulin Drugs 0.000 description 4
- 208000012947 ischemia reperfusion injury Diseases 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 238000002595 magnetic resonance imaging Methods 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- 210000000663 muscle cell Anatomy 0.000 description 4
- 229910052760 oxygen Inorganic materials 0.000 description 4
- 239000001301 oxygen Substances 0.000 description 4
- 230000008488 polyadenylation Effects 0.000 description 4
- 235000019419 proteases Nutrition 0.000 description 4
- 238000003753 real-time PCR Methods 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 230000001177 retroviral effect Effects 0.000 description 4
- 230000001052 transient effect Effects 0.000 description 4
- 238000013519 translation Methods 0.000 description 4
- 239000003981 vehicle Substances 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 3
- 102000007469 Actins Human genes 0.000 description 3
- 108010085238 Actins Proteins 0.000 description 3
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 3
- 206010008479 Chest Pain Diseases 0.000 description 3
- 108060005980 Collagenase Proteins 0.000 description 3
- 102000029816 Collagenase Human genes 0.000 description 3
- 102220605874 Cytosolic arginine sensor for mTORC1 subunit 2_D10A_mutation Human genes 0.000 description 3
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 3
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 239000007995 HEPES buffer Substances 0.000 description 3
- 108010033040 Histones Proteins 0.000 description 3
- 102000002265 Human Growth Hormone Human genes 0.000 description 3
- 241001135569 Human adenovirus 5 Species 0.000 description 3
- 206010020772 Hypertension Diseases 0.000 description 3
- 206010061216 Infarction Diseases 0.000 description 3
- 102100034343 Integrase Human genes 0.000 description 3
- 102000003996 Interferon-beta Human genes 0.000 description 3
- 108090000467 Interferon-beta Proteins 0.000 description 3
- 238000012313 Kruskal-Wallis test Methods 0.000 description 3
- 208000035967 Long Term Adverse Effects Diseases 0.000 description 3
- 108700011259 MicroRNAs Proteins 0.000 description 3
- 241000713333 Mouse mammary tumor virus Species 0.000 description 3
- 208000000770 Non-ST Elevated Myocardial Infarction Diseases 0.000 description 3
- 208000008589 Obesity Diseases 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- 102100026918 Phospholipase A2 Human genes 0.000 description 3
- 108010058864 Phospholipases A2 Proteins 0.000 description 3
- 108091000080 Phosphotransferase Proteins 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 241000714474 Rous sarcoma virus Species 0.000 description 3
- 208000006011 Stroke Diseases 0.000 description 3
- 102000004903 Troponin Human genes 0.000 description 3
- 108090001027 Troponin Proteins 0.000 description 3
- 108020005202 Viral DNA Proteins 0.000 description 3
- 108700005077 Viral Genes Proteins 0.000 description 3
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 3
- 230000000692 anti-sense effect Effects 0.000 description 3
- 239000000427 antigen Substances 0.000 description 3
- 108091007433 antigens Proteins 0.000 description 3
- 102000036639 antigens Human genes 0.000 description 3
- 108010084541 asialoorosomucoid Proteins 0.000 description 3
- 230000001908 autoinhibitory effect Effects 0.000 description 3
- 230000009286 beneficial effect Effects 0.000 description 3
- 230000017531 blood circulation Effects 0.000 description 3
- 239000001110 calcium chloride Substances 0.000 description 3
- 229910001628 calcium chloride Inorganic materials 0.000 description 3
- 210000000234 capsid Anatomy 0.000 description 3
- 210000000170 cell membrane Anatomy 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 210000000038 chest Anatomy 0.000 description 3
- 210000000349 chromosome Anatomy 0.000 description 3
- 229960002424 collagenase Drugs 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000003205 diastolic effect Effects 0.000 description 3
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 3
- 208000035475 disorder Diseases 0.000 description 3
- 239000002612 dispersion medium Substances 0.000 description 3
- 210000002919 epithelial cell Anatomy 0.000 description 3
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 108020001507 fusion proteins Proteins 0.000 description 3
- 102000037865 fusion proteins Human genes 0.000 description 3
- 108700004026 gag Genes Proteins 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 101150028578 grp78 gene Proteins 0.000 description 3
- 210000002064 heart cell Anatomy 0.000 description 3
- 238000002744 homologous recombination Methods 0.000 description 3
- 230000006801 homologous recombination Effects 0.000 description 3
- 230000007954 hypoxia Effects 0.000 description 3
- 230000007574 infarction Effects 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 238000007912 intraperitoneal administration Methods 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 150000002632 lipids Chemical group 0.000 description 3
- 239000006166 lysate Substances 0.000 description 3
- 229910001629 magnesium chloride Inorganic materials 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 244000005700 microbiome Species 0.000 description 3
- 239000002105 nanoparticle Substances 0.000 description 3
- 210000004940 nucleus Anatomy 0.000 description 3
- 230000030648 nucleus localization Effects 0.000 description 3
- 235000020824 obesity Nutrition 0.000 description 3
- 238000005457 optimization Methods 0.000 description 3
- 238000013146 percutaneous coronary intervention Methods 0.000 description 3
- PHEDXBVPIONUQT-RGYGYFBISA-N phorbol 13-acetate 12-myristate Chemical group C([C@]1(O)C(=O)C(C)=C[C@H]1[C@@]1(O)[C@H](C)[C@H]2OC(=O)CCCCCCCCCCCCC)C(CO)=C[C@H]1[C@H]1[C@]2(OC(C)=O)C1(C)C PHEDXBVPIONUQT-RGYGYFBISA-N 0.000 description 3
- 239000002953 phosphate buffered saline Substances 0.000 description 3
- 102000020233 phosphotransferase Human genes 0.000 description 3
- 229920000642 polymer Polymers 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 108020001580 protein domains Proteins 0.000 description 3
- 230000019491 signal transduction Effects 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 238000000527 sonication Methods 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 230000004083 survival effect Effects 0.000 description 3
- 238000002560 therapeutic procedure Methods 0.000 description 3
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical class CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 3
- 230000005758 transcription activity Effects 0.000 description 3
- 230000005026 transcription initiation Effects 0.000 description 3
- 238000010967 transthoracic echocardiography Methods 0.000 description 3
- 238000012762 unpaired Student’s t-test Methods 0.000 description 3
- GUAHPAJOXVYFON-ZETCQYMHSA-N (8S)-8-amino-7-oxononanoic acid zwitterion Chemical compound C[C@H](N)C(=O)CCCCCC(O)=O GUAHPAJOXVYFON-ZETCQYMHSA-N 0.000 description 2
- PRDFBSVERLRRMY-UHFFFAOYSA-N 2'-(4-ethoxyphenyl)-5-(4-methylpiperazin-1-yl)-2,5'-bibenzimidazole Chemical compound C1=CC(OCC)=CC=C1C1=NC2=CC=C(C=3NC4=CC(=CC=C4N=3)N3CCN(C)CC3)C=C2N1 PRDFBSVERLRRMY-UHFFFAOYSA-N 0.000 description 2
- KDCGOANMDULRCW-UHFFFAOYSA-N 7H-purine Chemical compound N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 2
- 101100524324 Adeno-associated virus 2 (isolate Srivastava/1982) Rep78 gene Proteins 0.000 description 2
- 206010001258 Adenoviral infections Diseases 0.000 description 2
- 108010088751 Albumins Proteins 0.000 description 2
- 102000009027 Albumins Human genes 0.000 description 2
- 102100023635 Alpha-fetoprotein Human genes 0.000 description 2
- 108020005544 Antisense RNA Proteins 0.000 description 2
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 2
- 101800001415 Bri23 peptide Proteins 0.000 description 2
- 101800000655 C-terminal peptide Proteins 0.000 description 2
- 102400000107 C-terminal peptide Human genes 0.000 description 2
- 238000011740 C57BL/6 mouse Methods 0.000 description 2
- 108091079001 CRISPR RNA Proteins 0.000 description 2
- 108010070997 CaMKII inhibitor AIP Proteins 0.000 description 2
- 108010035563 Chloramphenicol O-acetyltransferase Proteins 0.000 description 2
- 108700010070 Codon Usage Proteins 0.000 description 2
- 102000012422 Collagen Type I Human genes 0.000 description 2
- 108010022452 Collagen Type I Proteins 0.000 description 2
- 108010008286 DNA nucleotidylexotransferase Proteins 0.000 description 2
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 2
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 2
- 206010013801 Duchenne Muscular Dystrophy Diseases 0.000 description 2
- 208000000059 Dyspnea Diseases 0.000 description 2
- 206010013975 Dyspnoeas Diseases 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 108700041152 Endoplasmic Reticulum Chaperone BiP Proteins 0.000 description 2
- 102100021451 Endoplasmic reticulum chaperone BiP Human genes 0.000 description 2
- 102100039328 Endoplasmin Human genes 0.000 description 2
- 241000214054 Equine rhinitis A virus Species 0.000 description 2
- 238000000729 Fisher's exact test Methods 0.000 description 2
- 241000710198 Foot-and-mouth disease virus Species 0.000 description 2
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 2
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 2
- 241000713813 Gibbon ape leukemia virus Species 0.000 description 2
- 108010062347 HLA-DQ Antigens Proteins 0.000 description 2
- 108010067802 HLA-DR alpha-Chains Proteins 0.000 description 2
- 101150112743 HSPA5 gene Proteins 0.000 description 2
- 101710154606 Hemagglutinin Proteins 0.000 description 2
- 102100021519 Hemoglobin subunit beta Human genes 0.000 description 2
- 108091005904 Hemoglobin subunit beta Proteins 0.000 description 2
- 241000700721 Hepatitis B virus Species 0.000 description 2
- 208000009889 Herpes Simplex Diseases 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 102100037907 High mobility group protein B1 Human genes 0.000 description 2
- 101710168537 High mobility group protein B1 Proteins 0.000 description 2
- 101001000998 Homo sapiens Protein phosphatase 1 regulatory subunit 12C Proteins 0.000 description 2
- 241000725303 Human immunodeficiency virus Species 0.000 description 2
- 102000018251 Hypoxanthine Phosphoribosyltransferase Human genes 0.000 description 2
- 108010091358 Hypoxanthine Phosphoribosyltransferase Proteins 0.000 description 2
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 2
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 2
- 102000013463 Immunoglobulin Light Chains Human genes 0.000 description 2
- 108010065825 Immunoglobulin Light Chains Proteins 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 108010061833 Integrases Proteins 0.000 description 2
- 102000014150 Interferons Human genes 0.000 description 2
- 108010050904 Interferons Proteins 0.000 description 2
- 108010002350 Interleukin-2 Proteins 0.000 description 2
- 102000000588 Interleukin-2 Human genes 0.000 description 2
- 102000010789 Interleukin-2 Receptors Human genes 0.000 description 2
- 108010038453 Interleukin-2 Receptors Proteins 0.000 description 2
- 239000012097 Lipofectamine 2000 Substances 0.000 description 2
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 2
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 2
- 102000016387 Pancreatic elastase Human genes 0.000 description 2
- 108010067372 Pancreatic elastase Proteins 0.000 description 2
- 241001631646 Papillomaviridae Species 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 241001672814 Porcine teschovirus 1 Species 0.000 description 2
- 101710176177 Protein A56 Proteins 0.000 description 2
- 102100035620 Protein phosphatase 1 regulatory subunit 12C Human genes 0.000 description 2
- 108010071563 Proto-Oncogene Proteins c-fos Proteins 0.000 description 2
- 102000007568 Proto-Oncogene Proteins c-fos Human genes 0.000 description 2
- 230000006819 RNA synthesis Effects 0.000 description 2
- 108091030071 RNAI Proteins 0.000 description 2
- 238000011530 RNeasy Mini Kit Methods 0.000 description 2
- 238000011529 RT qPCR Methods 0.000 description 2
- 101000868151 Rattus norvegicus Somatotropin Proteins 0.000 description 2
- 108700008625 Reporter Genes Proteins 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 101100111629 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) KAR2 gene Proteins 0.000 description 2
- YIQKLZYTHXTDDT-UHFFFAOYSA-H Sirius red F3B Chemical compound C1=CC(=CC=C1N=NC2=CC(=C(C=C2)N=NC3=C(C=C4C=C(C=CC4=C3[O-])NC(=O)NC5=CC6=CC(=C(C(=C6C=C5)[O-])N=NC7=C(C=C(C=C7)N=NC8=CC=C(C=C8)S(=O)(=O)[O-])S(=O)(=O)[O-])S(=O)(=O)O)S(=O)(=O)O)S(=O)(=O)[O-])S(=O)(=O)[O-].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+] YIQKLZYTHXTDDT-UHFFFAOYSA-H 0.000 description 2
- 101710172711 Structural protein Proteins 0.000 description 2
- 108091008874 T cell receptors Proteins 0.000 description 2
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 2
- 102100036407 Thioredoxin Human genes 0.000 description 2
- 108010022394 Threonine synthase Proteins 0.000 description 2
- 102000006601 Thymidine Kinase Human genes 0.000 description 2
- 108020004440 Thymidine kinase Proteins 0.000 description 2
- 102000009190 Transthyretin Human genes 0.000 description 2
- 102100029290 Transthyretin Human genes 0.000 description 2
- 239000013504 Triton X-100 Substances 0.000 description 2
- 229920004890 Triton X-100 Polymers 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- 206010046865 Vaccinia virus infection Diseases 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 229960001138 acetylsalicylic acid Drugs 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 239000012190 activator Substances 0.000 description 2
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 2
- 210000004504 adult stem cell Anatomy 0.000 description 2
- 108010013829 alpha subunit DNA polymerase III Proteins 0.000 description 2
- 108010026331 alpha-Fetoproteins Proteins 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 230000000844 anti-bacterial effect Effects 0.000 description 2
- 229940121375 antifungal agent Drugs 0.000 description 2
- 239000003429 antifungal agent Substances 0.000 description 2
- 229960005070 ascorbic acid Drugs 0.000 description 2
- 235000010323 ascorbic acid Nutrition 0.000 description 2
- 239000011668 ascorbic acid Substances 0.000 description 2
- 238000003149 assay kit Methods 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 238000009534 blood test Methods 0.000 description 2
- 108091005948 blue fluorescent proteins Proteins 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 230000005961 cardioprotection Effects 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000022131 cell cycle Effects 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- ZPUCINDJVBIVPJ-LJISPDSOSA-N cocaine Chemical compound O([C@H]1C[C@@H]2CC[C@@H](N2C)[C@H]1C(=O)OC)C(=O)C1=CC=CC=C1 ZPUCINDJVBIVPJ-LJISPDSOSA-N 0.000 description 2
- 238000004891 communication Methods 0.000 description 2
- 239000003184 complementary RNA Substances 0.000 description 2
- 238000002586 coronary angiography Methods 0.000 description 2
- 108010082025 cyan fluorescent protein Proteins 0.000 description 2
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 102000004419 dihydrofolate reductase Human genes 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 108700004025 env Genes Proteins 0.000 description 2
- 238000013401 experimental design Methods 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 108091006047 fluorescent proteins Proteins 0.000 description 2
- 102000034287 fluorescent proteins Human genes 0.000 description 2
- 230000009368 gene silencing by RNA Effects 0.000 description 2
- 239000003862 glucocorticoid Substances 0.000 description 2
- 239000000185 hemagglutinin Substances 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 239000000411 inducer Substances 0.000 description 2
- 230000008595 infiltration Effects 0.000 description 2
- 238000001764 infiltration Methods 0.000 description 2
- 210000004969 inflammatory cell Anatomy 0.000 description 2
- 238000009434 installation Methods 0.000 description 2
- 229940079322 interferon Drugs 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 239000007928 intraperitoneal injection Substances 0.000 description 2
- 230000000302 ischemic effect Effects 0.000 description 2
- 239000007951 isotonicity adjuster Substances 0.000 description 2
- 210000003292 kidney cell Anatomy 0.000 description 2
- 230000007774 longterm Effects 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 2
- 239000002679 microRNA Substances 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 230000002107 myocardial effect Effects 0.000 description 2
- 210000002569 neuron Anatomy 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 230000003472 neutralizing effect Effects 0.000 description 2
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 2
- 244000309711 non-enveloped viruses Species 0.000 description 2
- 230000007959 normoxia Effects 0.000 description 2
- 230000008520 organization Effects 0.000 description 2
- 230000007918 pathogenicity Effects 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- 208000030613 peripheral artery disease Diseases 0.000 description 2
- 239000008194 pharmaceutical composition Substances 0.000 description 2
- 239000002644 phorbol ester Substances 0.000 description 2
- 108010079892 phosphoglycerol kinase Proteins 0.000 description 2
- 150000003904 phospholipids Chemical class 0.000 description 2
- 108700004029 pol Genes Proteins 0.000 description 2
- 229920002401 polyacrylamide Polymers 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 235000017924 poor diet Nutrition 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 239000002510 pyrogen Substances 0.000 description 2
- 238000011002 quantification Methods 0.000 description 2
- 230000010837 receptor-mediated endocytosis Effects 0.000 description 2
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 2
- 208000004124 rheumatic heart disease Diseases 0.000 description 2
- 239000011435 rock Substances 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 208000013220 shortness of breath Diseases 0.000 description 2
- 230000000391 smoking effect Effects 0.000 description 2
- 239000000344 soap Substances 0.000 description 2
- 239000001540 sodium lactate Substances 0.000 description 2
- 235000011088 sodium lactate Nutrition 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 238000000528 statistical test Methods 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 230000035882 stress Effects 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 125000001424 substituent group Chemical group 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 238000007910 systemic administration Methods 0.000 description 2
- 108060008226 thioredoxin Proteins 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 238000010361 transduction Methods 0.000 description 2
- 230000026683 transduction Effects 0.000 description 2
- 230000014621 translational initiation Effects 0.000 description 2
- 230000017105 transposition Effects 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- GETQZCLCWQTVFV-UHFFFAOYSA-N trimethylamine Chemical compound CN(C)C GETQZCLCWQTVFV-UHFFFAOYSA-N 0.000 description 2
- 238000009966 trimming Methods 0.000 description 2
- 230000010415 tropism Effects 0.000 description 2
- 210000004881 tumor cell Anatomy 0.000 description 2
- 208000007089 vaccinia Diseases 0.000 description 2
- 150000003680 valines Chemical group 0.000 description 2
- 210000002845 virion Anatomy 0.000 description 2
- 108091005957 yellow fluorescent proteins Proteins 0.000 description 2
- VRYALKFFQXWPIH-PBXRRBTRSA-N (3r,4s,5r)-3,4,5,6-tetrahydroxyhexanal Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)CC=O VRYALKFFQXWPIH-PBXRRBTRSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- UVBYMVOUBXYSFV-XUTVFYLZSA-N 1-methylpseudouridine Chemical compound O=C1NC(=O)N(C)C=C1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 UVBYMVOUBXYSFV-XUTVFYLZSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- ASJSAQIRZKANQN-CRCLSJGQSA-N 2-deoxy-D-ribose Chemical compound OC[C@@H](O)[C@@H](O)CC=O ASJSAQIRZKANQN-CRCLSJGQSA-N 0.000 description 1
- 101800000504 3C-like protease Proteins 0.000 description 1
- CYDQOEWLBCCFJZ-UHFFFAOYSA-N 4-(4-fluorophenyl)oxane-4-carboxylic acid Chemical compound C=1C=C(F)C=CC=1C1(C(=O)O)CCOCC1 CYDQOEWLBCCFJZ-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 150000005007 4-aminopyrimidines Chemical class 0.000 description 1
- ZXIATBNUWJBBGT-JXOAFFINSA-N 5-methoxyuridine Chemical compound O=C1NC(=O)C(OC)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 ZXIATBNUWJBBGT-JXOAFFINSA-N 0.000 description 1
- FFKUHGONCHRHPE-UHFFFAOYSA-N 5-methyl-1h-pyrimidine-2,4-dione;7h-purin-6-amine Chemical compound CC1=CNC(=O)NC1=O.NC1=NC=NC2=C1NC=N2 FFKUHGONCHRHPE-UHFFFAOYSA-N 0.000 description 1
- LRSASMSXMSNRBT-UHFFFAOYSA-N 5-methylcytosine Chemical compound CC1=CNC(=O)N=C1N LRSASMSXMSNRBT-UHFFFAOYSA-N 0.000 description 1
- 108020005075 5S Ribosomal RNA Proteins 0.000 description 1
- BXJHWYVXLGLDMZ-UHFFFAOYSA-N 6-O-methylguanine Chemical compound COC1=NC(N)=NC2=C1NC=N2 BXJHWYVXLGLDMZ-UHFFFAOYSA-N 0.000 description 1
- ZAOGIVYOCDXEAK-UHFFFAOYSA-N 6-n-methyl-7h-purine-2,6-diamine Chemical compound CNC1=NC(N)=NC2=C1NC=N2 ZAOGIVYOCDXEAK-UHFFFAOYSA-N 0.000 description 1
- 108091034151 7SK RNA Proteins 0.000 description 1
- 208000035657 Abasia Diseases 0.000 description 1
- 101100524317 Adeno-associated virus 2 (isolate Srivastava/1982) Rep40 gene Proteins 0.000 description 1
- 101100524319 Adeno-associated virus 2 (isolate Srivastava/1982) Rep52 gene Proteins 0.000 description 1
- 101100524321 Adeno-associated virus 2 (isolate Srivastava/1982) Rep68 gene Proteins 0.000 description 1
- 108700040115 Adenosine deaminases Proteins 0.000 description 1
- 108700028369 Alleles Proteins 0.000 description 1
- 102100033312 Alpha-2-macroglobulin Human genes 0.000 description 1
- 208000024827 Alzheimer disease Diseases 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 208000009575 Angelman syndrome Diseases 0.000 description 1
- 206010002383 Angina Pectoris Diseases 0.000 description 1
- 206010002660 Anoxia Diseases 0.000 description 1
- 241000976983 Anoxia Species 0.000 description 1
- 108020004491 Antisense DNA Proteins 0.000 description 1
- 206010003225 Arteriospasm coronary Diseases 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 208000037260 Atherosclerotic Plaque Diseases 0.000 description 1
- 241000711404 Avian avulavirus 1 Species 0.000 description 1
- 108091032955 Bacterial small RNA Proteins 0.000 description 1
- 206010061692 Benign muscle neoplasm Diseases 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 101150018129 CSF2 gene Proteins 0.000 description 1
- 101150069031 CSN2 gene Proteins 0.000 description 1
- AQGNHMOJWBZFQQ-UHFFFAOYSA-N CT 99021 Chemical compound CC1=CNC(C=2C(=NC(NCCNC=3N=CC(=CC=3)C#N)=NC=2)C=2C(=CC(Cl)=CC=2)Cl)=N1 AQGNHMOJWBZFQQ-UHFFFAOYSA-N 0.000 description 1
- 239000012657 CaMKII inhibitor Substances 0.000 description 1
- 102000019025 Calcium-Calmodulin-Dependent Protein Kinases Human genes 0.000 description 1
- 108010026870 Calcium-Calmodulin-Dependent Protein Kinases Proteins 0.000 description 1
- 101150044789 Cap gene Proteins 0.000 description 1
- 208000006029 Cardiomegaly Diseases 0.000 description 1
- 208000031229 Cardiomyopathies Diseases 0.000 description 1
- 206010062746 Carditis Diseases 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 101710163595 Chaperone protein DnaK Proteins 0.000 description 1
- 206010008469 Chest discomfort Diseases 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- 206010009866 Cold sweat Diseases 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108020004394 Complementary RNA Proteins 0.000 description 1
- 208000002330 Congenital Heart Defects Diseases 0.000 description 1
- 208000003890 Coronary Vasospasm Diseases 0.000 description 1
- 235000005956 Cosmos caudatus Nutrition 0.000 description 1
- 102000004420 Creatine Kinase Human genes 0.000 description 1
- 108010042126 Creatine kinase Proteins 0.000 description 1
- HMFHBZSHGGEWLO-SOOFDHNKSA-N D-ribofuranose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H]1O HMFHBZSHGGEWLO-SOOFDHNKSA-N 0.000 description 1
- 101150090523 DAZL gene Proteins 0.000 description 1
- 102000016559 DNA Primase Human genes 0.000 description 1
- 108010092681 DNA Primase Proteins 0.000 description 1
- 238000007702 DNA assembly Methods 0.000 description 1
- 102100033215 DNA nucleotidylexotransferase Human genes 0.000 description 1
- 101710177611 DNA polymerase II large subunit Proteins 0.000 description 1
- 101710184669 DNA polymerase II small subunit Proteins 0.000 description 1
- 230000033616 DNA repair Effects 0.000 description 1
- 102000016911 Deoxyribonucleases Human genes 0.000 description 1
- 108010053770 Deoxyribonucleases Proteins 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 102100031780 Endonuclease Human genes 0.000 description 1
- 108010042407 Endonucleases Proteins 0.000 description 1
- 108010067770 Endopeptidase K Proteins 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 101150106478 GPS1 gene Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 108010060309 Glucuronidase Proteins 0.000 description 1
- 102000053187 Glucuronidase Human genes 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 229940121710 HMGCoA reductase inhibitor Drugs 0.000 description 1
- 208000010496 Heart Arrest Diseases 0.000 description 1
- 101710178376 Heat shock 70 kDa protein Proteins 0.000 description 1
- 101710152018 Heat shock cognate 70 kDa protein Proteins 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 101001023784 Heteractis crispa GFP-like non-fluorescent chromoprotein Proteins 0.000 description 1
- 101000615488 Homo sapiens Methyl-CpG-binding domain protein 2 Proteins 0.000 description 1
- 108010000521 Human Growth Hormone Proteins 0.000 description 1
- 239000000854 Human Growth Hormone Substances 0.000 description 1
- 241000598171 Human adenovirus sp. Species 0.000 description 1
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 1
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 1
- 208000000563 Hyperlipoproteinemia Type II Diseases 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 108700002232 Immediate-Early Genes Proteins 0.000 description 1
- 208000026350 Inborn Genetic disease Diseases 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 102000004310 Ion Channels Human genes 0.000 description 1
- 108090000862 Ion Channels Proteins 0.000 description 1
- PIWKPBJCKXDKJR-UHFFFAOYSA-N Isoflurane Chemical compound FC(F)OC(Cl)C(F)(F)F PIWKPBJCKXDKJR-UHFFFAOYSA-N 0.000 description 1
- YQEZLKZALYSWHR-UHFFFAOYSA-N Ketamine Chemical compound C=1C=CC=C(Cl)C=1C1(NC)CCCCC1=O YQEZLKZALYSWHR-UHFFFAOYSA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- 101710128836 Large T antigen Proteins 0.000 description 1
- 239000000232 Lipid Bilayer Substances 0.000 description 1
- 102100024640 Low-density lipoprotein receptor Human genes 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 102000000422 Matrix Metalloproteinase 3 Human genes 0.000 description 1
- 208000024556 Mendelian disease Diseases 0.000 description 1
- 102100021299 Methyl-CpG-binding domain protein 2 Human genes 0.000 description 1
- 108060004795 Methyltransferase Proteins 0.000 description 1
- 101100219625 Mus musculus Casd1 gene Proteins 0.000 description 1
- 101100078999 Mus musculus Mx1 gene Proteins 0.000 description 1
- 108010021466 Mutant Proteins Proteins 0.000 description 1
- 102000008300 Mutant Proteins Human genes 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 206010028594 Myocardial fibrosis Diseases 0.000 description 1
- 208000009525 Myocarditis Diseases 0.000 description 1
- 201000004458 Myoma Diseases 0.000 description 1
- 125000000729 N-terminal amino-acid group Chemical group 0.000 description 1
- 108091061960 Naked DNA Proteins 0.000 description 1
- 206010028813 Nausea Diseases 0.000 description 1
- 206010028836 Neck pain Diseases 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 101100385413 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) csm-3 gene Proteins 0.000 description 1
- 244000061176 Nicotiana tabacum Species 0.000 description 1
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 1
- SNIOPGDIGTZGOP-UHFFFAOYSA-N Nitroglycerin Chemical compound [O-][N+](=O)OCC(O[N+]([O-])=O)CO[N+]([O-])=O SNIOPGDIGTZGOP-UHFFFAOYSA-N 0.000 description 1
- 239000000006 Nitroglycerin Substances 0.000 description 1
- 102000006570 Non-Histone Chromosomal Proteins Human genes 0.000 description 1
- 108010008964 Non-Histone Chromosomal Proteins Proteins 0.000 description 1
- 108020004485 Nonsense Codon Proteins 0.000 description 1
- 101800001775 Nuclear inclusion protein A Proteins 0.000 description 1
- 102000002488 Nucleoplasmin Human genes 0.000 description 1
- 239000004677 Nylon Substances 0.000 description 1
- CTQNGGLPUBDAKN-UHFFFAOYSA-N O-Xylene Chemical compound CC1=CC=CC=C1C CTQNGGLPUBDAKN-UHFFFAOYSA-N 0.000 description 1
- 108700005081 Overlapping Genes Proteins 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 101150094724 PCSK9 gene Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 239000002033 PVDF binder Substances 0.000 description 1
- 208000002193 Pain Diseases 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 241000701945 Parvoviridae Species 0.000 description 1
- 108091093037 Peptide nucleic acid Proteins 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 101800001016 Picornain 3C-like protease Proteins 0.000 description 1
- 101710159752 Poly(3-hydroxyalkanoate) polymerase subunit PhaE Proteins 0.000 description 1
- 102000012338 Poly(ADP-ribose) Polymerases Human genes 0.000 description 1
- 108010061844 Poly(ADP-ribose) Polymerases Proteins 0.000 description 1
- 229920000776 Poly(Adenosine diphosphate-ribose) polymerase Polymers 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 206010062519 Poor quality sleep Diseases 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 102000004257 Potassium Channel Human genes 0.000 description 1
- 108010015078 Pregnancy-Associated alpha 2-Macroglobulins Proteins 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 101710130262 Probable Vpr-like protein Proteins 0.000 description 1
- 101800000596 Probable picornain 3C-like protease Proteins 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 229930185560 Pseudouridine Natural products 0.000 description 1
- PTJWIQPHWPFNBW-UHFFFAOYSA-N Pseudouridine C Natural products OC1C(O)C(CO)OC1C1=CNC(=O)NC1=O PTJWIQPHWPFNBW-UHFFFAOYSA-N 0.000 description 1
- 101710185720 Putative ethidium bromide resistance protein Proteins 0.000 description 1
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 1
- 108020005115 Pyruvate Kinase Proteins 0.000 description 1
- 102000013009 Pyruvate Kinase Human genes 0.000 description 1
- 239000012083 RIPA buffer Substances 0.000 description 1
- 102000009572 RNA Polymerase II Human genes 0.000 description 1
- 108010009460 RNA Polymerase II Proteins 0.000 description 1
- 230000007022 RNA scission Effects 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 101100047461 Rattus norvegicus Trpm8 gene Proteins 0.000 description 1
- 102000001218 Rec A Recombinases Human genes 0.000 description 1
- 108010055016 Rec A Recombinases Proteins 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 241001068263 Replication competent viruses Species 0.000 description 1
- 102000009661 Repressor Proteins Human genes 0.000 description 1
- 108010034634 Repressor Proteins Proteins 0.000 description 1
- 102000004167 Ribonuclease P Human genes 0.000 description 1
- 108090000621 Ribonuclease P Proteins 0.000 description 1
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 1
- 208000006117 ST-elevation myocardial infarction Diseases 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 238000012311 Shapiro-Wilk normality test Methods 0.000 description 1
- 108091061750 Signal recognition particle RNA Proteins 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 108020003224 Small Nucleolar RNA Proteins 0.000 description 1
- 102000042773 Small Nucleolar RNA Human genes 0.000 description 1
- 101100166144 Staphylococcus aureus cas9 gene Proteins 0.000 description 1
- 241001069987 Staphylococcus lugdunensis M23590 Species 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 241000193998 Streptococcus pneumoniae Species 0.000 description 1
- 241000194020 Streptococcus thermophilus Species 0.000 description 1
- 206010066286 Stress cardiomyopathy Diseases 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 208000009609 Takotsubo Cardiomyopathy Diseases 0.000 description 1
- 241001420369 Thosea Species 0.000 description 1
- 208000001435 Thromboembolism Diseases 0.000 description 1
- AUYYCJSJGJYCDS-LBPRGKRZSA-N Thyrolar Chemical class IC1=CC(C[C@H](N)C(O)=O)=CC(I)=C1OC1=CC=C(O)C(I)=C1 AUYYCJSJGJYCDS-LBPRGKRZSA-N 0.000 description 1
- 102000011923 Thyrotropin Human genes 0.000 description 1
- 108010061174 Thyrotropin Proteins 0.000 description 1
- 101710183280 Topoisomerase Proteins 0.000 description 1
- 241000283907 Tragelaphus oryx Species 0.000 description 1
- 101710195626 Transcriptional activator protein Proteins 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 102000004357 Transferases Human genes 0.000 description 1
- 108090000992 Transferases Proteins 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 206010045261 Type IIa hyperlipidaemia Diseases 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 108091034135 Vault RNA Proteins 0.000 description 1
- 206010047249 Venous thrombosis Diseases 0.000 description 1
- 108010051583 Ventricular Myosins Proteins 0.000 description 1
- 102100035071 Vimentin Human genes 0.000 description 1
- 108010065472 Vimentin Proteins 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 108091029474 Y RNA Proteins 0.000 description 1
- VRGWBRLULZUWAJ-XFFXIZSCSA-N [(2s)-2-[(1r,3z,5s,8z,12z,15s)-5,17-dihydroxy-4,8,12,15-tetramethyl-16-oxo-18-bicyclo[13.3.0]octadeca-3,8,12,17-tetraenyl]propyl] acetate Chemical compound C1\C=C(C)/CC\C=C(C)/CC[C@H](O)\C(C)=C/C[C@@H]2C([C@@H](COC(C)=O)C)=C(O)C(=O)[C@]21C VRGWBRLULZUWAJ-XFFXIZSCSA-N 0.000 description 1
- 238000002679 ablation Methods 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 108010076089 accutase Proteins 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 206010000891 acute myocardial infarction Diseases 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 230000000172 allergic effect Effects 0.000 description 1
- 230000000735 allogeneic effect Effects 0.000 description 1
- 102000009899 alpha Karyopherins Human genes 0.000 description 1
- 108010077099 alpha Karyopherins Proteins 0.000 description 1
- 101150087698 alpha gene Proteins 0.000 description 1
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 1
- PMMURAAUARKVCB-UHFFFAOYSA-N alpha-D-ara-dHexp Natural products OCC1OC(O)CC(O)C1O PMMURAAUARKVCB-UHFFFAOYSA-N 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 238000000540 analysis of variance Methods 0.000 description 1
- 238000002399 angioplasty Methods 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000007953 anoxia Effects 0.000 description 1
- 239000003816 antisense DNA Substances 0.000 description 1
- 208000007474 aortic aneurysm Diseases 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 230000003416 augmentation Effects 0.000 description 1
- 230000003190 augmentative effect Effects 0.000 description 1
- 230000037429 base substitution Effects 0.000 description 1
- 239000002876 beta blocker Substances 0.000 description 1
- 229940097320 beta blocking agent Drugs 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 102000005936 beta-Galactosidase Human genes 0.000 description 1
- WGDUUQDYDIIBKT-UHFFFAOYSA-N beta-Pseudouridine Natural products OC1OC(CN2C=CC(=O)NC2=O)C(O)C1O WGDUUQDYDIIBKT-UHFFFAOYSA-N 0.000 description 1
- 239000003012 bilayer membrane Substances 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 230000036770 blood supply Effects 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 230000036760 body temperature Effects 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 210000005242 cardiac chamber Anatomy 0.000 description 1
- 206010007625 cardiogenic shock Diseases 0.000 description 1
- 230000001101 cardioplegic effect Effects 0.000 description 1
- 101150055766 cat gene Proteins 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 210000003855 cell nucleus Anatomy 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000005229 chemical vapour deposition Methods 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 208000037998 chronic venous disease Diseases 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 229960003920 cocaine Drugs 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 208000028831 congenital heart disease Diseases 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 101150055601 cops2 gene Proteins 0.000 description 1
- 201000011634 coronary artery vasospasm Diseases 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- WZHCOOQXZCIUNC-UHFFFAOYSA-N cyclandelate Chemical compound C1C(C)(C)CC(C)CC1OC(=O)C(O)C1=CC=CC=C1 WZHCOOQXZCIUNC-UHFFFAOYSA-N 0.000 description 1
- 230000000120 cytopathologic effect Effects 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 229940104302 cytosine Drugs 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 230000007402 cytotoxic response Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 238000002716 delivery method Methods 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000000378 dietary effect Effects 0.000 description 1
- 230000009274 differential gene expression Effects 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 230000005782 double-strand break Effects 0.000 description 1
- 230000011559 double-strand break repair via nonhomologous end joining Effects 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 230000004064 dysfunction Effects 0.000 description 1
- 201000006549 dyspepsia Diseases 0.000 description 1
- 230000002526 effect on cardiovascular system Effects 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 230000005684 electric field Effects 0.000 description 1
- 210000001671 embryonic stem cell Anatomy 0.000 description 1
- 230000002996 emotional effect Effects 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 238000005886 esterification reaction Methods 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 238000010195 expression analysis Methods 0.000 description 1
- 201000001386 familial hypercholesterolemia Diseases 0.000 description 1
- 239000012091 fetal bovine serum Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 238000001917 fluorescence detection Methods 0.000 description 1
- 108010021843 fluorescent protein 583 Proteins 0.000 description 1
- 239000012458 free base Substances 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 238000010230 functional analysis Methods 0.000 description 1
- YFHXZQPUBCBNIP-UHFFFAOYSA-N fura-2 Chemical compound CC1=CC=C(N(CC(O)=O)CC(O)=O)C(OCCOC=2C(=CC=3OC(=CC=3C=2)C=2OC(=CN=2)C(O)=O)N(CC(O)=O)CC(O)=O)=C1 YFHXZQPUBCBNIP-UHFFFAOYSA-N 0.000 description 1
- VPSRLGDRGCKUTK-UHFFFAOYSA-N fura-2-acetoxymethyl ester Chemical compound CC(=O)OCOC(=O)CN(CC(=O)OCOC(C)=O)C1=CC=C(C)C=C1OCCOC(C(=C1)N(CC(=O)OCOC(C)=O)CC(=O)OCOC(C)=O)=CC2=C1OC(C=1OC(=CN=1)C(=O)OCOC(C)=O)=C2 VPSRLGDRGCKUTK-UHFFFAOYSA-N 0.000 description 1
- VRGWBRLULZUWAJ-UHFFFAOYSA-N fusaproliferin Natural products C1C=C(C)CCC=C(C)CCC(O)C(C)=CCC2C(C(COC(C)=O)C)=C(O)C(=O)C21C VRGWBRLULZUWAJ-UHFFFAOYSA-N 0.000 description 1
- 101150098622 gag gene Proteins 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 238000003633 gene expression assay Methods 0.000 description 1
- 238000003197 gene knockdown Methods 0.000 description 1
- 238000012239 gene modification Methods 0.000 description 1
- 238000010363 gene targeting Methods 0.000 description 1
- 230000005017 genetic modification Effects 0.000 description 1
- 235000013617 genetically modified food Nutrition 0.000 description 1
- 231100000734 genotoxic potential Toxicity 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 102000018146 globin Human genes 0.000 description 1
- 108060003196 globin Proteins 0.000 description 1
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- AWUCVROLDVIAJX-UHFFFAOYSA-N glycerol 1-phosphate Chemical compound OCC(O)COP(O)(O)=O AWUCVROLDVIAJX-UHFFFAOYSA-N 0.000 description 1
- 229960003711 glyceryl trinitrate Drugs 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 150000004820 halides Chemical group 0.000 description 1
- 210000003128 head Anatomy 0.000 description 1
- 208000018578 heart valve disease Diseases 0.000 description 1
- 208000024798 heartburn Diseases 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 229910001385 heavy metal Inorganic materials 0.000 description 1
- 230000003067 hemagglutinative effect Effects 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 210000003917 human chromosome Anatomy 0.000 description 1
- 230000004727 humoral immunity Effects 0.000 description 1
- 235000011167 hydrochloric acid Nutrition 0.000 description 1
- 150000004679 hydroxides Chemical class 0.000 description 1
- 239000002471 hydroxymethylglutaryl coenzyme A reductase inhibitor Substances 0.000 description 1
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 1
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 1
- 230000037417 hyperactivation Effects 0.000 description 1
- 208000015210 hypertensive heart disease Diseases 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 238000011532 immunohistochemical staining Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 230000036512 infertility Effects 0.000 description 1
- 208000021646 inflammation of heart layer Diseases 0.000 description 1
- 230000006749 inflammatory damage Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 108700032552 influenza virus INS1 Proteins 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- 238000002743 insertional mutagenesis Methods 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- NBQNWMBBSKPBAY-UHFFFAOYSA-N iodixanol Chemical compound IC=1C(C(=O)NCC(O)CO)=C(I)C(C(=O)NCC(O)CO)=C(I)C=1N(C(=O)C)CC(O)CN(C(C)=O)C1=C(I)C(C(=O)NCC(O)CO)=C(I)C(C(=O)NCC(O)CO)=C1I NBQNWMBBSKPBAY-UHFFFAOYSA-N 0.000 description 1
- 229960004359 iodixanol Drugs 0.000 description 1
- 230000001788 irregular Effects 0.000 description 1
- 229960002725 isoflurane Drugs 0.000 description 1
- JJWLVOIRVHMVIS-UHFFFAOYSA-N isopropylamine Chemical compound CC(C)N JJWLVOIRVHMVIS-UHFFFAOYSA-N 0.000 description 1
- 229960003299 ketamine Drugs 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 238000011866 long-term treatment Methods 0.000 description 1
- HWYHZTIRURJOHG-UHFFFAOYSA-N luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 210000001161 mammalian embryo Anatomy 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 108010082117 matrigel Proteins 0.000 description 1
- 238000002483 medication Methods 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 210000002901 mesenchymal stem cell Anatomy 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- DZNKOAWEHDKBEP-UHFFFAOYSA-N methyl 2-[6-[bis(2-methoxy-2-oxoethyl)amino]-5-[2-[2-[bis(2-methoxy-2-oxoethyl)amino]-5-methylphenoxy]ethoxy]-1-benzofuran-2-yl]-1,3-oxazole-5-carboxylate Chemical compound COC(=O)CN(CC(=O)OC)C1=CC=C(C)C=C1OCCOC(C(=C1)N(CC(=O)OC)CC(=O)OC)=CC2=C1OC(C=1OC(=CN=1)C(=O)OC)=C2 DZNKOAWEHDKBEP-UHFFFAOYSA-N 0.000 description 1
- YACKEPLHDIMKIO-UHFFFAOYSA-N methylphosphonic acid Chemical compound CP(O)(O)=O YACKEPLHDIMKIO-UHFFFAOYSA-N 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 230000020654 modulation by virus of host translation Effects 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 101150008049 mx gene Proteins 0.000 description 1
- 108010056072 myristoylated autocamtide-2-related inhibitory peptide Proteins 0.000 description 1
- 230000008693 nausea Effects 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 108091027963 non-coding RNA Proteins 0.000 description 1
- 102000042567 non-coding RNA Human genes 0.000 description 1
- 230000037434 nonsense mutation Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 108060005597 nucleoplasmin Proteins 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 229920001778 nylon Polymers 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 231100000590 oncogenic Toxicity 0.000 description 1
- 230000002246 oncogenic effect Effects 0.000 description 1
- 229940005483 opioid analgesics Drugs 0.000 description 1
- 210000003463 organelle Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 230000004792 oxidative damage Effects 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 229920002866 paraformaldehyde Polymers 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 235000011007 phosphoric acid Nutrition 0.000 description 1
- 150000003016 phosphoric acids Chemical class 0.000 description 1
- 210000004991 placental stem cell Anatomy 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 108020001213 potassium channel Proteins 0.000 description 1
- 230000003334 potential effect Effects 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000001566 pro-viral effect Effects 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000002250 progressing effect Effects 0.000 description 1
- 229930185346 proliferin Natural products 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 230000004224 protection Effects 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 230000012743 protein tagging Effects 0.000 description 1
- PTJWIQPHWPFNBW-GBNDHIKLSA-N pseudouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1C1=CNC(=O)NC1=O PTJWIQPHWPFNBW-GBNDHIKLSA-N 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 238000003908 quality control method Methods 0.000 description 1
- 239000002096 quantum dot Substances 0.000 description 1
- 230000008707 rearrangement Effects 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000037425 regulation of transcription Effects 0.000 description 1
- 101150066583 rep gene Proteins 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 208000023504 respiratory system disease Diseases 0.000 description 1
- 230000003938 response to stress Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 210000001525 retina Anatomy 0.000 description 1
- 230000000250 revascularization Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 230000033764 rhythmic process Effects 0.000 description 1
- 108040009109 ribonuclease MRP activity proteins Proteins 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 239000013609 scAAV vector Substances 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 239000013605 shuttle vector Substances 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 230000003007 single stranded DNA break Effects 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 210000002027 skeletal muscle Anatomy 0.000 description 1
- 210000002363 skeletal muscle cell Anatomy 0.000 description 1
- 210000001057 smooth muscle myoblast Anatomy 0.000 description 1
- 210000000329 smooth muscle myocyte Anatomy 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- NGSFWBMYFKHRBD-UHFFFAOYSA-M sodium lactate Chemical compound [Na+].CC(O)C([O-])=O NGSFWBMYFKHRBD-UHFFFAOYSA-M 0.000 description 1
- 229940005581 sodium lactate Drugs 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 238000012732 spatial analysis Methods 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 206010041823 squamous cell carcinoma Diseases 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 230000010473 stable expression Effects 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 108020003113 steroid hormone receptors Proteins 0.000 description 1
- 102000005969 steroid hormone receptors Human genes 0.000 description 1
- 208000023516 stroke disease Diseases 0.000 description 1
- 210000002536 stromal cell Anatomy 0.000 description 1
- 108091007196 stromelysin Proteins 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000000153 supplemental effect Effects 0.000 description 1
- 238000003239 susceptibility assay Methods 0.000 description 1
- 229940037128 systemic glucocorticoids Drugs 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-K thiophosphate Chemical compound [O-]P([O-])([O-])=S RYYWUUFWQRZTIU-UHFFFAOYSA-K 0.000 description 1
- 229940094937 thioredoxin Drugs 0.000 description 1
- 230000002537 thrombolytic effect Effects 0.000 description 1
- 229940113082 thymine Drugs 0.000 description 1
- 239000005495 thyroid hormone Substances 0.000 description 1
- 229940036555 thyroid hormone Drugs 0.000 description 1
- 230000000451 tissue damage Effects 0.000 description 1
- 231100000827 tissue damage Toxicity 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 230000000472 traumatic effect Effects 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 102000003390 tumor necrosis factor Human genes 0.000 description 1
- WFKWXMTUELFFGS-UHFFFAOYSA-N tungsten Chemical compound [W] WFKWXMTUELFFGS-UHFFFAOYSA-N 0.000 description 1
- 229910052721 tungsten Inorganic materials 0.000 description 1
- 239000010937 tungsten Substances 0.000 description 1
- 238000007492 two-way ANOVA Methods 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 210000003501 vero cell Anatomy 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 210000005048 vimentin Anatomy 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 230000010464 virion assembly Effects 0.000 description 1
- 229960001600 xylazine Drugs 0.000 description 1
- BPICBUSOMSTKRF-UHFFFAOYSA-N xylazine Chemical compound CC1=CC=CC(C)=C1NC1=NCCCS1 BPICBUSOMSTKRF-UHFFFAOYSA-N 0.000 description 1
- 239000008096 xylene Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
- C12N15/1137—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against enzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases RNAses, DNAses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
- C12Y207/11—Protein-serine/threonine kinases (2.7.11)
- C12Y207/11017—Ca2+/Calmodulin-dependent protein kinase (2.7.11.17)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPRs]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2320/00—Applications; Uses
- C12N2320/30—Special therapeutic applications
- C12N2320/32—Special delivery means, e.g. tissue-specific
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
Definitions
- CRISPR-Cas9 gene editing is being developed as a therapeutic approach to correct monogenic mutations causing hereditary diseases (Liu & Olson, 2022; Chemello et al., 2021; Richter et al., 2020; Amoasii et al., 2018; Amoasii et al., 2019; Koblan et al., 2021).
- Ca 2+ /calmodulin-dependent protein kinase II ⁇ (CaMKII ⁇ ) is a central regulator of cardiac signaling and function (Beckendorf et al., 2018).
- CaMKII ⁇ chronic overactivation of CaMKII ⁇ causes several cardiac diseases in humans and mice, including ischemia/reperfusion (IR) injury, heart failure, hypertrophy, and arrhythmias (Neef et al., 2010; Backs et al., 2009; Lebek et al., 2020; Zhang & Brown, 2004; Ling et al., 2013; Luo et al., 2013; Nassal et al., 2020; Pellicena & Schulman, 2014).
- IR ischemia/reperfusion
- CaMKII ⁇ overactivation in the heart has been linked to disturbances in Ca 2+ homeostasis, inflammation, apoptosis, and fibrosis, leading to cardiac dysfunction (Neef et al., 2010; Backs et al., 2009; Lebek et al., 2020; Zhang & Brown, 2004; Ling et al., 2013; Lebek et al., 2018).
- Oxidation of two methionine residues, Met281 and Met282 located in the regulatory domain of CaMKII ⁇ , promotes hyperactivation of the kinase by preventing association of the catalytic domain with the autoinhibitory region (Erickson et al., 2008).
- a single guide RNA comprising a targeting nucleic acid sequence that targets a CaMKII ⁇ regulatory domain.
- the sgRNA may target Met281 and/or Met282 and/or His283 of CaMKII ⁇ .
- the sgRNA may comprise the sequence: [0005]
- a composition comprising a sgRNA that targets a CaMKII ⁇ regulatory domain and a base editor.
- the base editor may be an adenine base editor (ABE).
- ABE adenine base editor
- the sgRNA may be sgRNA as set forth in the preceding table or defined in paragraph [0003].
- the base editor may comprise a CRISPR/Cas nuclease linked to an adenosine deaminase, such as wherein the CRISPR/Cas nuclease is catalytically impaired and/or wherein the CRISPR/Cas nuclease is a Cas9 nuclease, such as wherein the Cas9 nuclease is isolated or derived from Streptococcus pyogenes (spCas9), Streptococcus pyogenes (spRY), Staphylococcus aureus (SaCas9), Staphylococcus auricularis (SauCas9), Streptococcus pyogenes (spRY) or Staphylococcus lugdunensis (SlugCas9).
- spCas9 Streptococcus pyogenes
- spRY Streptococcus p
- a nucleic acid comprising a sequence encoding a first sgRNA of as set out in the table above, a sequence encoding a base editor, a sequence encoding a first promoter, wherein the first promoter drives expression of the sequence encoding the base editor, and a sequence encoding a second promoter, wherein the second promoter drives expression of the sequence encoding the first sgRNA.
- the base editor may be an adenine base editor (ABE).
- the base editor may comprise a CRISPR/Cas nuclease linked to an adenosine deaminase, such as wherein the CRISPR/Cas nuclease is catalytically impaired.
- the CRISPR/Cas nuclease may be a Cas9 nuclease, such as wherein the Cas9 nuclease is isolated or derived from Streptococcus pyogenes (spCas9), Streptococcus pyogenes (spRY), Staphylococcus aureus (SaCas9), Staphylococcus auricularis (SauCas9), Streptococcus pyogenes (spRY) or Staphylococcus lugdunensis (SlugCas9).
- spCas9 Streptococcus pyogenes
- spRY Streptococcus pyogenes
- ScCas9 Staphylococcus aureus
- ScCas9 Staphylococcus auricularis
- spRY Streptococcus pyogenes
- the at least one of the sequences encoding the first promoter and the sequence encoding the second promoter may comprise a cell-type specific promoter, such as a cardiomyocyte-specific promoter, in particular a cardiac troponin T (cTnT) promoter.
- the sequence encoding the second promoter may comprise a sequence encoding a U6 promoter, an H1 promoter, or a 7SK promoter.
- the nucleic acid may comprise a DNA sequence, or an RNA sequence, and/or may further comprise a polyadenosine (polyA) sequence, such as a mini polyA sequence.
- a cell comprising the nucleic acids as defined herein, a composition comprising the nucleic acids as defined herein, a cell comprising such a composition, a composition comprising such a cell.
- a vector comprising the nucleic acids as described herein.
- the vector may further comprise a sequence encoding an inverted terminal repeat (ITR) of a transposable element, such as a transposon (e.g., a Tn7 transposon).
- the vector may further comprise a sequence encoding a 5’ ITR of a T7 transposon and a sequence encoding a 3’ ITR of a T7 transposon.
- the vector may be a non-viral vector, such as a plasmid, or a viral vector, such as an adeno-associated viral (AAV) vector or an adenoviral vector.
- AAV vector may be replication-defective or conditionally replication defective and/or may be a recombinant AAV vector.
- the AAV vector may comprise a sequence isolated or derived from an AAV vector of serotype 1 (AAV1), 2 (AAV2), 3 (AAV3), 4 (AAV4), 5 (AAV5), 6 (AAV6),7 (AAV7), 8 (AAV8), 9 (AAV9), 10 (AAV10), 11 (AAV11) or any combination thereof, such as wherein the AAV vector comprises a sequence isolated or derived from an AAV2 and a sequence isolated or derived from an AAV9.
- the vector may be optimized for expression in mammalian cells, such as optimized for expression in human cells.
- a composition comprising the vector as defined herein, optionally further comprising a pharmaceutically acceptable carrier.
- the vectors of the present disclosure, or the compositions comprising such vectors may comprise a trans-splicing intein system.
- cells comprising the vectors as described herein or the compositions comprising the vectors.
- the cells may be human cells, such as where the cells are cardiomyocytes or human cardiomyocytes, or the cells or human cells may be induced pluripotent stem (iPS) cells.
- iPS induced pluripotent stem
- a method for editing a sequence in the regulatory domain of CaMKII ⁇ comprising contacting a cell with a vector/composition as described here under conditions suitable for expression of the first sgRNA and the adenine base editor, wherein the first sgRNA forms a complex with the adenine base editor, wherein the complex modifies edits a sequence in the regulatory domain of CaMKII ⁇ thereby blocking the oxidative stress response of CaMKII ⁇ .
- a cell produced by this method such as a cardiomyocyte, e.g., a stem-cell derived cardiomyocyte.
- a still further embodiment comprises a method of treating or preventing cardiac injury, such as ischemia/reperfusion injury, in a subject, the method comprising administering to the subject a therapeutically effective amount of a composition as described herein.
- the composition may be administered locally, such as directly to cardiac tissue (e.g., by an infusion or injection), or administered systemically (e.g., by an intravenous infusion or injection).
- the subject may exhibit improved Ca 2+ transient amplitude, decreased arrhythmia, decreased ventricular dilation, improved cardiac function (improved ejection fraction, fractional shortening), or a combination thereof. Also, following administration of the composition, the subject may not exhibit cellular Ca 2+ dysregulation.
- the subject may be a neonate, an infant, a child, a young adult, or an adult, a male, or a female.
- a therapeutically effective amount of a composition as described herein for treating or preventing cardiac injury, such as ischemia/reperfusion injury, in a subject in need thereof is provided.
- an induced pluripotent stem cell comprising an edited CaMKII ⁇ gene encoding Valine 281, optionally comprising an edited CaMKII ⁇ gene encoding Valine 281, Valine 282 and Arginine 283.
- kits for screening at least one candidate agent in a mouse comprising administering one or more candidate agent to the mouse.
- the at least one candidate agent may be screened for its ability to improve left ventricular function.
- the at least one candidate agent may be screened for its ability to rescue cardiac chamber size.
- the at least one candidate agent may be screened for its ability to increase life span.
- the candidate agent may comprise a sgRNA of any one of the present embodiments.
- Both critical methionines are located in the regulatory domain. Upon oxidative stress, these methionines are oxidized, resulting in increased CaMKII activity and cardiac disease.
- CRISPR-Cas9 adenine base editing the inventors identified sgRNA1, which edited only c.A841G (p.M281V; sgRNA1), and sgRNA6, which edited c.A841G (p.M281V), c.A844G (p.M282V), and c.A848G (p.H283R; sgRNA6), thereby preventing CaMKII activation upon oxidative stress.
- Fig.1B Sequence of a segment of exon 11 of CaMKII ⁇ genomic DNA encoding part of the regulatory domain of CaMKII ⁇ (SEQ ID NO: 84). Alignment of sgRNA1 and sgRNA6 with CaMKII ⁇ . PAM sequences for sgRNA1 and sgRNA6 are in blue and green, respectively. Both ATGs encoding methionines are highlighted in yellow. Adenines within the sequences of sgRNA1 (blue) and sgRNA6 (green) are numbered (starting from the PAM). (Fig.
- Fig. 1C Percentage of adenine (A) to guanine (G) editing in human iPSCs for each adenine in sgRNA1 after base editing with ABE8e and sgRNA1, as determined by Sanger sequencing.
- Fig. 1D Percentage of adenine (A) to guanine (G) editing in human iPSCs for each adenine in sgRNA6 after base editing with ABE8e and sgRNA6, as determined by deep amplicon sequencing.
- FIG. 1E Western blot analysis of oxidized CaMKII (specific antibody), autophosphorylated CaMKII (specific antibody), total CaMKII, and GAPDH in human wildtype (WT), sgRNA1, and sgRNA6 iPSC-CMs for control group and after simulated ischemia/reperfusion (IR).
- Fig.1L Percentage of iPSC-CMs showing arrhythmias, as measured by epifluorescence microscopy. Statistical comparisons are based on one-way ANOVA post-hoc corrected by Holm-Sidak (Figs. 1F-H and Figs. 1J-K) and on Fisher’s exact test (Fig. 1L). Data are presented either as individual data points with means ⁇ SEM or as percent of cells (Fig.1L). [0021] Figs. 2A-E. CaMKII ⁇ base editing improves cardiac function in vivo post- IR. (Fig.
- FIG. 2A Experimental design for subjecting mice to IR, injecting AAV-ABE-sgRNA6 for CaMKII ⁇ editing in vivo and monitoring heart function by echocardiography and cardiac magnetic resonance imaging (MRI).
- the AAV9 delivery system carrying the CRISPR-Cas9 base editing components with a split-intein trans-splicing system is shown.
- FIG. 2C Representative M-mode recordings of hearts of a sham-treated mouse, a mouse subjected to IR, a mouse subjected to IR with intracardiac injection of a control virus, and a mouse subjected to IR with intracardiac injection of AAV-ABE-sgRNA6 (IR+Edit) at three weeks post-IR.
- Figs. 3A-M Analysis of mouse hearts after CaMKII ⁇ in vivo genomic editing by administration of AAV-ABE-sgRNA6.
- Fig. 3A Percentage of adenine (A) to guanine (G) editing of DNA and cDNA for each adenine along sgRNA6 in the myocardium of mice treated with AAV-ABE-sgRNA6, as determined by deep amplicon sequencing.
- FIG.3B Spatial analysis of adenine (A) to guanine (G) editing efficiency at cDNA level for each adenine along sgRNA6 in the anterior and the inferior cardiac wall of mice injected with AAV- ABE-sgRNA6 in the anterior cardiac wall, as determined by Sanger sequencing.
- FIG. 3C Sequencing of a TOPO-TA clone shows in vivo editing (SEQ ID NO: 85) of CaMKII ⁇ gene (SEQ ID NO: 86) at the cDNA level.
- FIG.3D Percentage of transcriptome-wide adenine (A) to inosine (I) editing in the myocardium of sham-treated, IR, IR treated with a control virus, and IR edited mice.
- FIG.3E Western blot analysis of oxidized CaMKII, autophosphorylated CaMKII, total CaMKII, and GAPDH for all groups.
- Fig.3F Mean densitometric analyses for oxidized CaMKII normalized to total CaMKII for sham-treated, IR, IR treated with a control virus, and IR edited mice.
- FIG. 3G Mean densitometric analyses for autophosphorylated CaMKII normalized to total CaMKII for all groups.
- FIG. 3H Mean CaMKII activity for all groups; and for lysates of IR and IR+Control Virus mice both in presence of the CaMKII inhibitor AIP.
- FIG. 3I Western blot analysis of ryanodine receptor type 2 (RyR2) phosphorylation at the CaMKII site (serine 2814), total RyR2, and GAPDH for all groups.
- Fig. 3J Mean densitometric analysis for phosphorylated RyR2 normalized to total RyR2 for all groups.
- Fig.3L Gene ontology terms associated with the 101 genes upregulated in mouse hearts injected with AAV-ABE-sgRNA6 compared to mice receiving control AAV9.
- Fig.3M Gene ontology terms associated with the 108 genes downregulated in mouse hearts injected with AAV-ABE-sgRNA6 compared to mice injected with control AAV9. All replicates are individual mice. Statistical comparisons are based on one-way ANOVA post-hoc corrected by Holm-Sidak.
- FIG. 4A-D Genomic editing of CaMKII ⁇ prevents cardiac cell death and fibrosis after IR.
- Fig.4A Immunohistochemistry of TUNEL (green, arrows), Hoechst 33342 (blue, for all nuclei), and cardiac troponin (red) in representative heart sections of mice subjected to sham-treatment, IR, IR treated with a control AAV9, and IR treated with AAV- ABE-sgRNA6 (IR+Edit; scale bar 20 ⁇ m).
- Fig.4B Mean percentage of TUNEL positive cells in each group.
- FIG.4C Whole transverse cross-sections of trichrome stained hearts for each group (scale bar 500 ⁇ m).
- Fig. 4D Mean percentage of fibrotic cardiac tissue in each group. Replicates are individual mice. Statistical comparisons are based on one-way ANOVA post- hoc corrected by Holm-Sidak. Data are presented as individual data points with means ⁇ SEM.
- Figs.5A-D Screening of various genomic editing strategies of CaMKII ⁇ in HEK293 cells using transfection.
- Fig.5A Percentage of adenine (A) to guanine (G) editing in human HEK293 cells at c.A841 (p.M281) for sgRNAs 1 to 6 combined with either ABEmax or ABE8e that were fused to either SpCas9 or SpRY.
- Fig.5B Percentage of A to G editing in human HEK293 cells at c.A844 (p.M282) for all tested editing strategies.
- Fig.5C Percentage of A to G editing in HEK293 cells for each adenine in sgRNA1 following base editing with ABE8e fused to SpCas9.
- Figs.6A-G Percentage of A to G editing in HEK293 cells for each adenine in sgRNA6 following base editing with ABE8e fused to SpRY. Percentage of editing is based on Sanger sequencing. Adenines along the sequence of either sgRNA1 (Fig. 5C) or sgRNA6 (Fig.5D) are numbered starting from the PAM. Data are presented as individual data points with means ⁇ SEM. [0025] Figs.6A-G. Analysis of potential genomic off-target editing in human iPSC using deep amplicon sequencing.
- Fig. 6B Sequence of sgRNA6 (SEQ ID NO: 31) and the corresponding DNA sequences and PAMs of other CaMKII isoforms ( ⁇ , ⁇ , and ⁇ ) (SEQ ID NOs: 87-89) and of the top eight potential off-target sites predicted by CRISPOR (SEQ ID NOs: 60-67).
- Fig. 6C Percentage of adenine (A) to guanine (G) editing for each adenine in the CaMKII ⁇ DNA sequence corresponding to sgRNA6.
- Fig.6D Percentage of A to G editing for each adenine in the CaMKII ⁇ DNA sequence corresponding to sgRNA6.
- Fig. 6E Percentage of A to G editing for each adenine in the CaMKII ⁇ DNA sequence corresponding to sgRNA6.
- Fig.6F Quantification of CaMKII ⁇ and CaMKII ⁇ mRNA expression in human iPSC-CMs.
- Fig. 6G Percentage of A to G editing for each adenine (ordered from 5’ to 3’) in the DNA sequences of the top eight potential off-target sites, starting with #1.
- Replicates are either human iPSCs (Fig.6C, Fig.6D, Fig.6E, Fig.6G) from three independent nucleofections with sgRNA6 and ABE8e fused to SpRY, or human cardiomyocytes from three independent differentiations (Fig. 6F).
- One wildtype iPSC sample was included as a negative control.
- the red line at 0.2% represents the threshold that has previously been used to distinguish from unspecific background guanine signal (Clement et al., 2019).
- Figs.7A-E Western blot analyses of human iPSC-cardiomyocytes post-IR.
- Fig.7A Mean densitometric analysis of oxidized CaMKII normalized to GAPDH in human wildtype (WT), sgRNA1, and sgRNA6 iPSC-CMs for control group and following simulated ischemia/reperfusion (IR).
- Fig. 7B Mean densitometric analysis for autophosphorylated CaMKII normalized to GAPDH.
- FIG. 7C Mean densitometric analysis for total CaMKII normalized to GAPDH.
- FIG. 7D Mean densitometric analysis for ryanodine receptor type 2 (RyR2) phosphorylation at the CaMKII site (serine 2814) normalized to GAPDH.
- Fig. 7E Mean densitometric analysis for total RyR2 normalized to GAPDH.
- Figs.8A-D CaMKII ⁇ editing preserves cellular Ca 2+ homeostasis in human iPSC-cardiomyocytes post-IR.
- Fig.8A Representative Ca 2+ transients for human wildtype (WT), sgRNA1, and sgRNA6 iPSC-CMs for control group and following simulated ischemia/reperfusion (IR), as measured by epifluorescence microscopy.
- Fig. 8B Mean diastolic Ca 2+ levels.
- FIG. 9A-C Mean relaxation time to 50% baseline.
- FIG. 8D Mean relaxation time to 80% baseline.
- Statistical comparisons are based on the number of cardiomyocytes and were performed with one-way ANOVA post-hoc corrected by Holm- Sidak. Data are presented as individual data points with means ⁇ SEM.
- Figs. 9A-C Testing of mouse-sgRNA6 in mouse N2a cells.
- Fig. 9A Sequence of mouse CaMKII ⁇ gene (SEQ ID NO: 90) encoding part of the regulatory domain and alignment of mouse-sgRNA6 (PAM sequence in green). Both ATGs encoding methionines are highlighted in yellow. Adenines along the sequence of sgRNA6 are numbered (starting from the PAM).
- Fig. 9B Percentage of adenine (A) to guanine (G) editing in mouse N2a cells for each adenine in sgRNA6 following base editing with ABE8e and mouse-sgRNA6, as determined by Sanger sequencing.
- Fig.9C Representative Sanger sequencing chromatogram for editing the mouse genome with sgRNA6 (SEQ ID NO: 91). Data are presented as individual data points with means.
- Figs. 10A-E Evaluation of cardiac function with echocardiography one week before ischemia/reperfusion injury.
- FIG. 10A Mean fractional shortening for sham- treated mice and mice subjected to ischemia/reperfusion (IR) injury with either no injection, injection of a control virus or intracardiac injection of AAV-ABE-sgRNA6 (IR+Edit).
- FIG. 10B Mean left ventricular end-diastolic posterior wall thickness for all groups.
- FIG. 10C Mean left ventricular end-diastolic diameter for all groups.
- FIG. 10D Mean left ventricular end-diastolic volume for all groups.
- FIG. 10E Mean heart rate for all groups. Statistical comparisons are based on eight mice per group and were performed with one-way ANOVA post-hoc corrected by Holm-Sidak.
- FIG. 11A-E Evaluation of cardiac function with echocardiography 24 hours after ischemia/reperfusion injury.
- Fig. 11A Mean fractional shortening for sham- treated mice and mice subjected to ischemia/reperfusion (IR) injury with either no injection, injection of a control virus or intracardiac injection of AAV-ABE-sgRNA6 (IR+Edit).
- Fig. 11B Mean left ventricular end-diastolic posterior wall thickness for all groups.
- Fig. 11C Mean left ventricular end-diastolic diameter for all groups.
- Fig. 11D Mean left ventricular end-diastolic volume for all groups.
- FIG. 12A-E Mean heart rate for all groups. Statistical comparisons are based on eight mice per group and were performed with one-way ANOVA post-hoc corrected by Holm-Sidak. Data are presented as individual data points with means ⁇ SEM. [0031] Figs. 12A-E. Evaluation of cardiac function with echocardiography one week after ischemia/reperfusion injury.
- Fig. 12A Mean fractional shortening for sham- treated mice and mice subjected to ischemia/reperfusion (IR) injury with either no injection, injection of a control virus or intracardiac injection of AAV-ABE-sgRNA6 (IR+Edit).
- Fig. 12B Mean left ventricular end-diastolic posterior wall thickness for all groups.
- FIG. 12C Mean left ventricular end-diastolic diameter for all groups.
- FIG. 12D Mean left ventricular end-diastolic volume for all groups.
- Fig. 12E Mean heart rate for all groups. Statistical comparisons are based on eight mice per group and were performed with one-way ANOVA post-hoc corrected by Holm-Sidak. Data are presented as individual data points with means ⁇ SEM. [0032] Figs. 13A-E. Evaluation of cardiac function with echocardiography two weeks after ischemia/reperfusion injury. (Fig.
- FIG. 13A Mean fractional shortening for sham- treated mice and mice subjected to ischemia/reperfusion (IR) injury with either no injection, injection of a control virus or intracardiac injection of AAV-ABE-sgRNA6 (IR+Edit).
- FIG. 13B Mean left ventricular end-diastolic posterior wall thickness for all groups.
- Fig. 13C Mean left ventricular end-diastolic diameter for all groups.
- Fig. 13D Mean left ventricular end-diastolic volume for all groups.
- FIG. 13E Mean heart rate for all groups. Statistical comparisons are based on eight mice per group and were performed with one-way ANOVA post-hoc corrected by Holm-Sidak (Figs.
- FIGs. 14A-D Evaluation of cardiac function with echocardiography three weeks after ischemia/reperfusion injury.
- Figs.14A Mean fractional shortening for sham- treated mice and mice subjected to ischemia/reperfusion (IR) injury with either no injection, injection of a control virus or intracardiac injection of AAV-ABE-sgRNA6 (IR+Edit).
- Figs. 14B Mean left ventricular end-diastolic posterior wall thickness for all groups.
- FIG. 14C Mean left ventricular end-diastolic volume for all groups.
- FIGs.14D Mean heart rate for all groups. Statistical comparisons are based on eight mice per group and were performed with one-way ANOVA post-hoc corrected by Holm-Sidak. Data are presented as individual data points with means ⁇ SEM.
- Figs. 15A-B Evaluation of cardiac function with cardiac magnetic resonance imaging four weeks after ischemia/reperfusion injury.
- FIG. 15A Mean left ventricular mass for sham-treated mice and mice subjected to ischemia/reperfusion (IR) injury with either no injection, injection of a control virus or intracardiac injection of AAV-ABE- sgRNA6 (IR+Edit).
- IR ischemia/reperfusion
- Figs. 15B Mean left ventricular end-diastolic volume for all groups. Statistical comparisons are based on five mice per group and were performed with Kruskal- Wallis test post-hoc corrected by Dunn (Fig. 15A) and one-way ANOVA post-hoc corrected by Holm-Sidak (Fig.15B). Data are presented as individual data points with means ⁇ SEM. [0035] Figs.16A-D. Analysis of potential genomic off-targets in mouse tissue using deep amplicon sequencing.
- Fig.16A Mouse sequence of sgRNA6 (SEQ ID NO: 32) and the corresponding DNA sequences and PAMs of other CaMKII isoforms ( ⁇ , ⁇ , and ⁇ ) (SEQ ID NOs: 92-94) in the mouse genome. Bases that are different from sgRNA6 are highlighted in yellow. Adenines along the sequence are numbered starting from the PAM.
- Fig. 16B Percentage of cardiac adenine (A) to guanine (G) editing for each adenine in the DNA sequence corresponding to sgRNA6 in different CaMKII isoforms.
- mice were either injected with AAV- ABE-sgRNA6 (IR+Edit; for analyses of CaMKII ⁇ , ⁇ , and ⁇ ) or with a control virus (for analysis of CaMKII ⁇ ).
- Fig.16C Percentage of A to G editing for each adenine in the DNA sequence corresponding to sgRNA6 in the brain (for all CaMKII isoforms), the tibialis anterior muscle (for CaMKII ⁇ ), and the liver (for CaMKII ⁇ ) of mice injected with AAV-ABE-sgRNA6 (IR+Edit).
- FIG. 16D Percentage of A to G editing for each adenine in the DNA sequence corresponding to sgRNA6 in all CaMKII isoforms, measured in wildtype control mice. The red line at 0.2% represents the threshold that has previously been used to distinguish from unspecific background guanine signal (Clement et al., 2019). Data are presented as individual data points with means ⁇ SEM (Figs. 16B-C) or as individual data points with means (Fig. 16D). [0036] Figs. 17A-E. Western blot analyses in mouse myocardium post-IR. (Fig.
- FIG. 17A Mean densitometric analysis for oxidized CaMKII normalized to GAPDH for sham- treated mice and mice subjected to ischemia/reperfusion (IR) injury with either no injection, injection of a control virus or intracardiac injection of AAV-ABE-sgRNA6 (IR+Edit).
- FIG. 17B Mean densitometric analysis for autophosphorylated CaMKII normalized to GAPDH.
- Fig.17C Mean densitometric analysis for total CaMKII normalized to GAPDH.
- FIG.17D Mean densitometric analysis for ryanodine receptor type 2 (RyR2) phosphorylation at the CaMKII site (serine 2814) normalized to GAPDH.
- Fig.17E Mean densitometric analysis for total RyR2 normalized to GAPDH. These data represent further densitometric analyses related to the Western blots presented in the main manuscript. Representative Western blots can be found in Fig.3E (for Fig.17A, Fig.17B, and Fig.17C) and Fig.3I (for Fig.17D and Fig.17E). Statistical comparisons are based on five mice per group and were performed with one-way ANOVA post-hoc corrected by Holm-Sidak. Data are presented as individual data points with means ⁇ SEM. [0037] Figs. 18A-D. Analysis of the cardiac transcriptome post-IR using RNA sequencing. (Fig.
- FIG. 18B Heat map of the 211 differentially expressed genes between sham-treated mice and mice subjected to IR with injection of a control virus.
- FIG. 18C Gene ontology terms associated with the 163 genes upregulated in mice subjected to IR and a control virus.
- Fig. 18D Gene ontology terms associated with the 48 genes downregulated in mice subjected to IR and a control virus. Data are presented as individual data points.
- Fig. 19 Genomic editing of CaMKII ⁇ gene prevents myocardial fibrosis and infiltration of inflammatory cells post-IR. Transverse cross-sections of trichrome stained hearts for one sham-treated mouse and mice subjected to ischemia/reperfusion (IR) injury with either no injection, injection of a control virus or injection of AAV-ABE-sgRNA6 (IR+Edit; 10x magnification, scale bar 50 ⁇ m).
- Figs.20A-B Decreased fibrosis in CaMKII ⁇ edited mice post-IR.
- FIG.20A Whole transverse cross-sections of picrosirius red stained hearts for one sham-treated mouse and mice subjected to ischemia/reperfusion (IR) injury with either no injection, injection of a control virus or injection of AAV-ABE-sgRNA6 (IR+Edit; scale bar 500 ⁇ m).
- Fig.20B Mean percentage of fibrotic cardiac tissue in each group. Replicates are individual mice. Statistical comparisons are based on one-way ANOVA post-hoc corrected by Holm-Sidak. Data are presented as individual data points with means ⁇ SEM. [0040] Figs. 21A-I. Preserved exercise performance 260 days after systemic administration of AAV-ABE-sgRNA6. (Fig.
- FIG. 21A Experimental design to investigate potential long-term adverse effects of CaMKII ⁇ gene editing. Mice were subjected to a treadmill exhaustion test 260 days after intraperitoneal administration of AAV-ABE-sgRNA6. After exhaustion, cardiac function was immediately assessed using echocardiography.
- FIG. 21B Mean bodyweight of CaMKII ⁇ edited mice (Edit) and their non-injected littermates (WT).
- Fig.21C Mean maximal velocity achieved on the treadmill for both groups.
- Fig.21D Mean distance attained on the treadmill prior to exhaustion for both groups.
- FIG. 21E Mean fractional shortening immediately after exhaustion.
- FIG. 21F Mean left ventricular end- diastolic posterior wall thickness.
- Fig.21G Mean left ventricular end-diastolic diameter.
- Fig. 21H Mean left ventricular end-diastolic volume.
- Fig.21I Mean heart rate. Replicates are five individual mice per group. Statistical comparisons are based on unpaired Student’s t tests. Data are presented as individual data points with means ⁇ SEM.
- Fig.22 Mouse- CamKII ⁇ Gene and Protein Sequences (SEQ ID NOs: 96 & 97).
- Fig. 23 Human- CamKII ⁇ Gene and Protein Sequences (SEQ ID NOs: 98 & 99).
- DETAILED DESCRIPTION [0043] Despite current medical advancements, effective treatment for cardiovascular disease remains challenging.
- Cardiovascular disease is a class of diseases that involve the heart or blood vessels.
- CVD includes coronary artery diseases (CAD) such as angina and myocardial infarction (commonly known as a heart attack).
- CAD coronary artery diseases
- Other CVDs include stroke, heart failure, hypertensive heart disease, rheumatic heart disease, cardiomyopathy, abnormal heart rhythms, congenital heart disease, valvular heart disease, carditis, aortic aneurysms, peripheral artery disease, thromboembolic disease, and venous thrombosis.
- the underlying mechanisms vary depending on the disease. It is estimated that dietary risk factors are associated with 53% of CVD deaths.
- Coronary artery disease, stroke, and peripheral artery disease involve atherosclerosis.
- Cardiovascular diseases are the leading cause of death worldwide except Africa. Deaths, at a given age, from CVD are more common and have been increasing in much of the developing world, while rates have declined in most of the developed world since the 1970s. Coronary artery disease and stroke account for 80% of CVD deaths in males and 75% of CVD deaths in females. Most cardiovascular disease affects older adults.
- MI Myocardial infarction
- a heart attack is a major cardiovascular insult that occurs when blood flow decreases or stops to the coronary artery of the heart, causing damage to the heart muscle.
- the most common symptom is chest pain or discomfort which may travel into the shoulder, arm, back, neck or jaw. Often it occurs in the center or left side of the chest and lasts for more than a few minutes. The discomfort may occasionally feel like heartburn.
- Other symptoms may include shortness of breath, nausea, feeling faint, a cold sweat or feeling tired. About 30% of people have atypical symptoms.
- MI Magnetic ink senor
- Most MIs occur due to coronary artery disease. Risk factors include high blood pressure, smoking, diabetes, lack of exercise, obesity, high blood cholesterol, poor diet and excessive alcohol intake.
- the complete blockage of a coronary artery caused by a rupture of an atherosclerotic plaque is usually the underlying mechanism of an MI.
- MIs are less commonly caused by coronary artery spasms, which may be due to cocaine, significant emotional stress (commonly known as Takotsubo syndrome) and extreme cold, among others.
- ECGs electrocardiograms
- STYMI ST elevation MI
- Commonly used blood tests include troponin and less often creatine kinase MB.
- Treatment of an MI is time-critical. Aspirin is an appropriate immediate treatment for a suspected MI. Nitroglycerin or opioids may be used to help with chest pain; however, they do not improve overall outcomes. Supplemental oxygen is recommended in those with low oxygen levels or shortness of breath.
- a STEMI treatments attempt to restore blood flow to the heart and include percutaneous coronary intervention (PCI), where the arteries are pushed open and may be stented, or thrombolysis, where the blockage is removed using medications.
- PCI percutaneous coronary intervention
- NSTEMI non-ST elevation myocardial infarction
- CABG coronary artery bypass surgery
- Reperfusion injury sometimes called ischemia-reperfusion injury (IRI) or reoxygenation injury
- IRI ischemia-reperfusion injury
- reoxygenation injury is the tissue damage caused when blood supply returns to tissue after a period of ischemia or lack of oxygen (anoxia or hypoxia).
- oxygen anoxia or hypoxia
- the absence of oxygen and nutrients from blood during the ischemic period creates a condition in which the restoration of circulation results in inflammation and oxidative damage through the induction of oxidative stress rather than (or along with) restoration of normal function.
- MI treatments that seek to restore blood flow to ischemic heart tissue can result in IRI and further damage.
- CaMKII ⁇ Ca 2+ /calmodulin-dependent protein kinase II (CaM kinase II or CaMKII) is a group of serine/threonine-specific protein kinases that are regulated by the Ca 2+ /calmodulin complex.
- CaMKII is involved in many signaling cascades and is thought to be an important mediator of learning and memory. CaMKII is also necessary for Ca 2+ homeostasis and reuptake in cardiomyocytes, chloride transport in epithelia, positive T-cell selection, and CD8 T-cell activation. Dysregulation of CaMKII is linked to Alzheimer's disease, Angelman syndrome, and heart arrhythmia. The four isoforms derive from the alpha, beta, gamma, and delta genes. [0054] All of the isoforms of CaMKII have: a catalytic domain, an autoinhibitory domain, a variable segment, and a self-association domain. The catalytic domain has several binding sites for ATP and other substrate anchor proteins.
- the autoinhibitory domain features a pseudosubstrate site, which binds to the catalytic domain and blocks its ability to phosphorylate proteins.
- the structural feature that governs autoinhibition is the Threonine 287 residue. Phosphorylation of this site will permanently activate the CaMKII enzyme. Once the Threonine 287 residue has been phosphorylated, the inhibitory domain is blocked from the pseudosubstrate site. This effectively blocks autoinhibition, allowing for permanent activation of the CaMKII enzyme. This enables CaMKII to be active, even in the absence of calcium and calmodulin.
- the other two domains in CaMKII are the variable and self-association domains. Differences in these domains contribute to the various CaMKII splicing isoforms.
- the self-association domain (CaMKII AD) is found at the C terminus, the function of this domain is the assembly of the single proteins into large (8 to 14 subunits) multimers.
- the sensitivity of the CaMKII enzyme to calcium and calmodulin is governed by the variable and self-associative domains. This sensitivity level of CaMKII will also modulate the different states of activation for the enzyme. Initially, the enzyme is activated; however, autophosphorylation does not occur because there is not enough calcium or calmodulin present to bind to neighboring subunits.
- CaMKII ⁇ appears in both neuronal and non-neuronal cell types. It is characterized particularly in many tumor cells, such as a variety of pancreatic, leukemic, breast and other tumor cells.
- CaMKII ⁇ variants are highly abundant in myocardial tissue. Increased CaMKII activity has been observed in patients with heart failure, structural heart disease and arrhythmias and CaMKII inhibition has been shown to be beneficial for cardiac disease in preclinical settings. Even though multiple CaMKII inhibitors have already been developed, they all show several limitations, and no compound has been translated into the clinic. The inventors developed a new strategy to overcome the limitations of current CaMKII inhibitors, by precise modulation of CaMKII ⁇ oxidative activation sites using CRISPR/Cas9 base editing technology.
- CRISPR Systems Gene editing is a technology that allows for the modification of target genes within living cells.
- the Cas9 protein of the CRISPR system which is an RNA guided DNA endonuclease, can be engineered to target new sites with relative ease by altering its guide RNA sequence. This discovery has made sequence specific gene editing functionally effective.
- CRISPR system refers collectively to transcripts and other elements involved in the expression of or directing the activity of CRISPR-associated (“Cas”) genes, including sequences encoding a Cas gene, a tracr (trans-activating CRISPR) sequence (e.g., tracrRNA or an active partial tracrRNA), a tracr-mate sequence (encompassing a “direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a “spacer” in the context of an endogenous CRISPR system), and/or other sequences and transcripts from a CRISPR locus.
- a tracr trans-activating CRISPR
- tracr-mate sequence encompassing a “direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system
- guide sequence also referred to as a “spacer” in the context of an endogenous CRIS
- the CRISPR/Cas nuclease or CRISPR/Cas nuclease system can include a non- coding RNA molecule (guide) RNA, which sequence-specifically binds to DNA, and a Cas protein (e.g., Cas9), with nuclease functionality (e.g., two nuclease domains).
- a CRISPR system can derive from a type I, type II, or type III CRISPR system, e.g., derived from a particular organism comprising an endogenous CRISPR system, such as Streptococcus pyogenes.
- the CRISPR system can induce double stranded breaks (DSBs) at the target site, followed by disruptions as discussed herein.
- Cas9 variants deemed “nickases,” are used to nick a single strand at the target site. Paired nickases can be used, e.g., to improve specificity, each directed by a pair of different sgRNAs targeting sequences such that upon introduction of the nicks simultaneously, a 5' overhang is introduced.
- catalytically inactive Cas9 is fused to a heterologous effector domain such as a base editing enzyme or a reverse transcriptase.
- the engineered CRISPR technologies of base editing and prime editing have expanded the toolbox of gene editing strategies to potentially correct genetic mutations by enabling precise edits at individual nucleotides (Chemello et al., 2020).
- Cas9 nickase (nCas9) or deactivated Cas9 (dCas9) is fused to a deaminase protein, allowing precise single-base pair conversions without DSBs within a defined editing window in relation to the protospacer adjacent motif (PAM) site of a sgRNA (Rees et al., 2018).
- CBEs cytosine base editors
- ABEs adenine base editors
- base editors allow efficient installation of single base substitutions in DNA.
- adenosine deaminases induce adenosine (A) to inosine (I) edits in single-stranded DNA that in turn result in A-to-G transitions after DNA repair or replication.
- Adenine base editors are fusions of programmable DNA-binding domains (e.g., catalytically impaired RNA-guided CRISPR/Cas nucleases) linked to an engineered adenosine deaminase.
- programmable DNA-binding domain e.g., catalytically impaired RNA-guided CRISPR/Cas nucleases
- targeted adenines lie within an “editing window” in the single-stranded (ss) DNA bubble (R- loop) induced by the CRISPR-Cas RNA-protein complex.
- the most commonly used ABEs comprise an adenosine deaminase heterodimer consisting of E.
- coli TadA wild-type fused to an engineered E. coli TadA variant (e.g., ABEmax) or a single engineered E. coli TadA variant (e.g., ABE8e, ABE8eV106W, or ABE8.20-m) as well as a nickase Cas9 and nuclear localization sequences (NLS).
- ABEs have been used successfully for installation of A-to-G substitutions in multiple cell types and organisms and could potentially reverse a large number of mutations known to be associated with human disease. Examples of ABEs include those described in U.S. Pat. Publn. US20200308571, PCT Publn. WO2020214842, and PCT Publn.
- WO2021025750 which are each incorporated herein by reference in their entirety.
- a Cas nuclease and sgRNA are introduced into the cell.
- target sites at the 5' end of the sgRNA target the Cas nuclease to the target site, e.g., the gene, using complementary base pairing.
- Target sites may be 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, or 10 nucleotides in length.
- the target site may be selected based on its location immediately 5' of a protospacer adjacent motif (PAM) sequence, such as typically NGG, NG, NRN, NYN, NAG, NNNRRT, or NNGG.
- PAM protospacer adjacent motif
- a CRISPR system is characterized by elements that promote the formation of a CRISPR complex at the site of a target sequence.
- target sequence generally refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between the target sequence and a guide sequence promotes the formation of a CRISPR complex. Full complementarity is not necessarily required, provided there is sufficient complementarity to cause hybridization and promote formation of a CRISPR complex.
- the target sequence may comprise any polynucleotide, such as DNA or RNA polynucleotides.
- the target sequence may be located in the nucleus or cytoplasm of the cell, such as within an organelle of the cell.
- a sequence or template that may be used for recombination into the targeted locus comprising the target sequences is referred to as an “editing template” or “editing polynucleotide” or “editing sequence.”
- an exogenous template polynucleotide may be referred to as an editing template.
- recombination is homologous recombination.
- CRISPR complex comprising the guide sequence hybridized to the target sequence and complexed with one or more Cas proteins
- formation of the CRISPR complex results in cleavage of one or both strands in or near (e.g., within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or more base pairs from) the target sequence.
- the tracr sequence which may comprise or consist of all or a portion of a wild-type tracr sequence (e.g., about or more than about 20, 26, 32, 45, 48, 54, 63, 67, 85, or more nucleotides of a wild-type tracr sequence), may also form part of the CRISPR complex, such as by hybridization along at least a portion of the tracr sequence to all or a portion of a tracr mate sequence that is operably linked to the guide sequence.
- a wild-type tracr sequence e.g., about or more than about 20, 26, 32, 45, 48, 54, 63, 67, 85, or more nucleotides of a wild-type tracr sequence
- the tracr sequence has sufficient complementarity to a tracr mate sequence to hybridize and participate in formation of the CRISPR complex, such as at least 50%, 60%, 70%, 80%, 90%, 95% or 99% of sequence complementarity along the length of the tracr mate sequence when optimally aligned.
- One or more vectors driving expression of one or more elements of the CRISPR system can be introduced into the cell such that expression of the elements of the CRISPR system direct formation of the CRISPR complex at one or more target sites.
- Components can also be delivered to cells as proteins and/or RNA.
- a Cas enzyme, a guide sequence linked to a tracr-mate sequence, and a tracr sequence could each be operably linked to separate regulatory elements on separate vectors.
- the sgRNA may be under the control of a constitutive promoter.
- two or more of the elements expressed from the same or different regulatory elements may be combined in a single vector, with one or more additional vectors providing any components of the CRISPR system not included in the first vector.
- the vector may comprise one or more insertion sites, such as a restriction endonuclease recognition sequence (also referred to as a “cloning site”). In some embodiments, one or more insertion sites are located upstream and/or downstream of one or more sequence elements of one or more vectors.
- a vector may comprise a regulatory element operably linked to an enzyme- coding sequence encoding the CRISPR enzyme, such as a Cas protein.
- Cas proteins include Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csn1 and Csx12), Cas10, Csy1, Csy2, Csy3, Cse1, Cse2, Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1, Csx15, Csfl, Csf2, Csf3, Csf4, homologs thereof, or modified versions thereof.
- the CRISPR enzyme can be Cas9 (e.g., from S. pyogenes or S. pneumonia or S. aureus or S. auricularis or S. lugdunensis).
- the CRISPR enzyme can direct cleavage of one or both strands at the location of a target sequence, such as within the target sequence and/or within the complement of the target sequence.
- the vector can encode a CRISPR enzyme that is mutated with respect to a corresponding wild-type enzyme such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target polynucleotide containing a target sequence.
- a CRISPR enzyme that is mutated with respect to a corresponding wild-type enzyme such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target polynucleotide containing a target sequence.
- D10A aspartate-to-alanine substitution
- pyogenes converts Cas9 from a nuclease that cleaves both strands to a nickase (cleaves a single strand).
- a Cas9 nickase may be used in combination with guide sequence(s), e.g., two guide sequences, which target respectively sense and antisense strands of the DNA target. This combination allows both strands to be nicked and used to induce NHEJ or HDR.
- a Cas9 polypeptide can be a deactivated (e.g., mutated, dCAs9) Cas9 polypeptide, wherein the deactivated Cas9 does not comprise HNH and/or RuvC nickase activities.
- the HNH and RuvC motifs have been characterized in S. thermophilus (see, e.g., Sapranauskas et al.
- a Cas9 polypeptide in which the HNH motif and/or RuvC motif is/are specifically mutated so that the nickase activity is reduced, deactivated, and/or absent can retain one or more of the other known Cas9 functions including DNA, RNA and PAM recognition and binding activities and thus remain functional with regard to these activities, while non-functional with regard to one or both nickase activities.
- the CRIPSR enzyme is a Cas protein, preferably Cas9 (having a nucleotide sequence of Genbank accession no NC_002737.2 and a protein sequence of Genbank accession no NP_269215.1).
- the Cas9 protein may also be modified to improve activity.
- the Cas9 protein may comprise the D10A amino acid substitution, this nickase cleaves only the DNA strand that is complementary to and recognized by the crRNA.
- the Cas9 protein may alternatively or additionally comprise the H840A amino acid substitution, this nickase cleaves only the DNA strand that does not interact with the sRNA.
- Cas9 may be used with a pair (i.e. two) sgRNA molecules (or a construct expressing such a pair) and as a result can cleave the target region on the opposite DNA strand, with the possibility of improving specificity by 100-1500 fold.
- the Cas9 protein may comprise a D1135E substitution.
- the Cas 9 protein may also be the VQR, VRQR or SpRY variant.
- the Cas9 protein may be xCas9 (a Streptococcus pyogenes variant that can recognize a broad range of PAM sequences including NG, GAA and GAT).
- the Cas9 variant is SpCas9-NG (with a relaxed preference to the third nucleotide of the PAM motif, such that the variant can recognize sequences where the PAM motif is NGN rather than NGG), SaCas9 (from S. aureus that can recognize NNGRR(T) PAM sequences; see Ran, F. A. et al. In vivo genome editing using Staphylococcus aureus Cas9. Nature 520, 186-191, doi:10.1038/nature14299 (2015)), SaCas9-KKH (a variant from S. aureus that can recognize NNNRRT PAM sequences), SauCas9 (from S.
- an enzyme coding sequence encoding the CRISPR enzyme is codon optimized for expression in particular cells, such as eukaryotic cells.
- the eukaryotic cells may be those of or derived from a particular organism, such as a mammal, including but not limited to human, mouse, rat, rabbit, dog, or non-human primate.
- codon optimization refers to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence.
- Codon bias differs in codon usage between organisms
- mRNA messenger RNA
- tRNA transfer RNA
- a guide sequence is any polynucleotide sequence having sufficient complementarity with a target polynucleotide sequence to hybridize with the target sequence and direct sequence-specific binding of the CRISPR complex to the target sequence.
- the degree of complementarity between a guide sequence and its corresponding target sequence, when optimally aligned using a suitable alignment algorithm is about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more.
- each of the guide sequences may further comprise additional nucleotides to form or encode a crRNA, e.g., using any known sequence appropriate for the Cas9 being used.
- the crRNA comprises (5’ to 3’) at least a spacer sequence and a first complementarity domain.
- the first complementary domain is sufficiently complementary to a second complementarity domain, which may be part of the same molecule in the case of an sgRNA or in a tracrRNA in the case of a dual or modular sgRNA, to form a duplex. See, e.g., US 2017/0007679 for detailed discussion of crRNA and sgRNA domains, including first and second complementarity domains.
- a single-molecule guide RNA can comprise, in the 5' to 3' direction, an optional spacer extension sequence, a spacer sequence, a minimum CRISPR repeat sequence, a single-molecule guide linker, a minimum tracrRNA sequence, a 3' tracrRNA sequence and/or an optional tracrRNA extension sequence.
- the optional tracrRNA extension can comprise elements that contribute additional functionality (e.g., stability) to the guide RNA.
- the single-molecule guide linker can link the minimum CRISPR repeat and the minimum tracrRNA sequence to form a hairpin structure.
- the optional tracrRNA extension can comprise one or more hairpins.
- the disclosure provides for an sgRNA comprising a spacer sequence and a tracrRNA sequence.
- the guide RNA can be considered to comprise a scaffold sequence necessary for endonuclease binding and a spacer sequence required to bind to the genomic target sequence.
- An exemplary scaffold sequence suitable for use with SaCas9 to follow the guide sequence at its 3’ end is: GTTTAAGTACTCTGTGCTGGAAACAGCACAGAATCTACTTAAACAAGGCAAAAT GCCGTGTTTATCTCGTCAACTTGTTGGCGAGA (SEQ ID NO: 95) in 5’ to 3’ orientation.
- an exemplary scaffold sequence for use with SaCas9 to follow the 3’ end of the guide sequence is a sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 95, or a sequence that differs from SEQ ID NO: 95 by no more than 1, 2, 3, 4, 5, 10, 15, 20, or 25 nucleotides.
- Optimal alignment may be determined with the use of any suitable algorithm for aligning sequences, non-limiting example of which include the Smith-Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows-Wheeler Transform (e.g., the Burrows Wheeler Aligner), Clustal W, Clustal X, BLAT, Novoalign (Novocraft Technologies, ELAND (Illumina, San Diego, Calif.), SOAP (available at soap.genomics.org.cn), and Maq (available at maq.sourceforge.net).
- the CRISPR enzyme may be part of a fusion protein comprising one or more heterologous protein domains.
- a CRISPR enzyme fusion protein may comprise any additional protein sequence, and optionally a linker sequence between any two domains.
- protein domains that may be fused to a CRISPR enzyme include, without limitation, epitope tags, reporter gene sequences, and protein domains having one or more of the following activities: methylase activity, demethylase activity, transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, RNA cleavage activity, nucleic acid binding activity, base editing activity, or reverse transcription activity.
- Non-limiting examples of epitope tags include histidine (His) tags, V5 tags, FLAG tags, influenza hemagglutinin (HA) tags, Myc tags, VSV-G tags, and thioredoxin (Trx) tags.
- reporter genes include, but are not limited to, glutathione-5- transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT) beta galactosidase, beta-glucuronidase, luciferase, green fluorescent protein (GFP), HcRed, DsRed, cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and autofluorescent proteins including blue fluorescent protein (BFP).
- GST glutathione-5- transferase
- HRP horseradish peroxidase
- CAT chloramphenicol acetyltransferase
- beta galactosidase beta-glucuronidase
- a CRISPR enzyme may be fused to a gene sequence encoding a protein or a fragment of a protein that bind DNA molecules or bind other cellular molecules, including but not limited to maltose binding protein (MBP), S-tag, Lex A DNA binding domain (DBD) fusions, GAL4A DNA binding domain fusions, and herpes simplex virus (HSV) BP16 protein fusions. Additional domains that may form part of a fusion protein comprising a CRISPR enzyme are described in US 20110059502, incorporated herein by reference. [0081] As an RNA guided protein, Cas9 requires a short RNA to direct the recognition of DNA targets.
- Cas9 preferentially interrogates DNA sequences containing a PAM sequence (e.g., NGG or NG or NNNRRT or NNGG) it can bind here without a protospacer target.
- a PAM sequence e.g., NGG or NG or NNNRRT or NNGG
- the Cas9-sgRNA complex requires a close match to the sgRNA to create a double strand break.
- CRISPR sequences in bacteria are expressed in multiple RNAs and then processed to create guide strands for RNA. Because eukaryotic systems lack some of the proteins required to process CRISPR RNAs, the synthetic construct sgRNA was created to combine the essential pieces of RNA for Cas9 targeting into a single RNA expressed with the RNA polymerase type III promoter U6.
- RNA Pol III promoters under the control of RNA Pol III include those for ribosomal 5S rRNA, tRNA and few other small RNAs, RNase P and RNase MRP RNA, 7SL RNA (the RNA component of the signal recognition particles), Vault RNAs, Y RNA, SINEs (short interspersed repetitive elements), 7SK RNA, two microRNAs, several small nucleolar RNAs and several few regulatory antisense RNAs. Synthetic sgRNAs are slightly over 100 bp at the minimum length and contain a portion which targets the 20 or 21 protospacer nucleotides immediately preceding the PAM sequence.
- the length of the sgRNA can also be shortened at the 5’ with respect to its canonical length to meet specific criteria, e.g., the removal of a stretch of thymines that can inhibit the polymerase type III transcription activity.
- sgRNAs do not contain the PAM sequence.
- the sgRNA targets a site within the CaMKII ⁇ gene.
- the sgRNA targets a CaMKII ⁇ regulatory domain.
- the sgRNA targets Met281 and/or Met282 of CaMKII ⁇ .
- a nucleic acid may comprise one or more sequences encoding a sgRNA.
- a nucleic acid may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 21 sequences encoding a sgRNA. In some embodiments, all of the sequences encode the same sgRNA. In some embodiments, all of the sequences encode different sgRNAs. In some embodiments, at least 2 of the sequences encode the same sgRNA, for example at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or 21 of the sequences encode the same sgRNA. [0084] In some embodiments, nucleotide gene editing may be performed in vitro or ex vivo.
- cells are contacted in vitro or ex vivo with a nucleotide editing Cas9 and a sgRNA that targets a CaMKII ⁇ site.
- the cells are contacted with one or more nucleic acids encoding the Cas9 and the guide RNA.
- the one or more nucleic acids are introduced into the cells using, for example, lipofection or electroporation.
- Nucleotide gene editing may also be performed in zygotes.
- zygotes may be injected with one or more nucleic acids encoding Cas9 and a sgRNA that targets a CaMKII ⁇ site. The zygotes may subsequently be injected into a host.
- the Cas9 is provided on a vector.
- the vector contains a Cas9 derived from S. pyogenes (SpCas9).
- the vector contains a Cas9 derived from S. aureus (SaCas9).
- the vector contains a Cas9 derived from S. auricularis (SauCas9).
- the vector contains a Cas9 derived from S. lugdunensis (SlugCas9).
- the Cas9 sequence is codon optimized for expression in human cells or mouse cells.
- the vector further contains a sequence encoding a fluorescent protein, such as GFP, which allows Cas 9-expressing cells to be sorted using fluorescence activated cell sorting (FACS).
- the vector is a viral vector such as an adeno-associated viral vector.
- the sgRNA is provided on a vector.
- the vector is a viral vector such as an adeno-associated viral vector.
- the Cas9 and the guide RNA are provided on the same vector.
- the Cas9 and the guide RNA are provided on different vectors. [0087] Any type of vector, such as any of those described herein, may be used.
- the vector is a lipid nanoparticle.
- the vector is a viral vector.
- the viral vector is a non-integrating viral vector (i.e., that does not insert sequence from the vector into a host chromosome).
- the viral vector is an adeno-associated virus vector (AAV), a lentiviral vector, an integrase-deficient lentiviral vector, an adenoviral vector, a vaccinia viral vector, an alphaviral vector, or a herpes simplex viral vector.
- the vector comprises a cardiomyocyte-specific promoter.
- the cardiomyocyte-specific promoter is a cardiac troponin T (cTnT) promoter.
- the vector may be an adeno-associated virus vector (AAV).
- AAV adeno-associated virus vector
- the viral vector is an adeno-associated virus vector, a lentiviral vector, an integrase-deficient lentiviral vector, an adenoviral vector, a vaccinia viral vector, an alphaviral vector, or a herpes simplex viral vector.
- the viral vector is an adeno-associated virus (AAV) vector.
- the AAV vector is an AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAVrh10 (see, e.g., SEQ ID NO: 81 of U.S. Patent 9,790,472, which is incorporated by reference herein in its entirety), AAVrh74 (see, e.g., SEQ ID NO: 1 of U.S.
- Patent Publication No.2015/0111955 which is incorporated by reference herein in its entirety
- AAV9 vector also known as AAVMYO, see, Weinmann et al., 2020, Nature Communications, 11:5432
- Myo-AAV vectors described in Tabebordbar et al., 2021, Cell, 184:1-20 e.g., MyoAAV 1A, 2A, 3A, 4A, 4C, or 4E
- AAV9-rh74-HB-P1 AAV9-AAA-P1-SG vectors described in WO2022053630. wherein the number following AAV indicates the AAV serotype.
- the AAV vector is a single-stranded AAV (ssAAV). In some embodiments, the AAV vector is a double- stranded AAV (dsAAV). Any variant of an AAV vector or serotype thereof, such as a self- complementary AAV (scAAV) vector, is encompassed within the general terms AAV vector, AAV1 vector, etc. See, e.g., McCarty et al., Gene Ther.2001; 8:1248–54, Naso et al., BioDrugs 2017; 31:317-334, and references cited therein for detailed discussion of various AAV vectors. In some embodiments, the vector is an AAV9 vector.
- in vitro or ex vivo gene editing is performed in a cardiac cell.
- gene editing is performed in iPSC or iCM cells.
- the iPSC cells are differentiated after gene editing.
- the iPSC cells may be differentiated into a cardiac cell after editing.
- the iPSC cells are differentiated into cardiac muscle cells.
- the iPSC cells are differentiated into cardiomyocytes.
- iPSC cells may be induced to differentiate according to methods known to those of skill in the art.
- contacting the cell with the nucleotide editing Cas9 and the sgRNA prevents oxidative stress activation of CaMKII ⁇ .
- the edited cells, or cells derived therefrom show reduced or no level of CaMKII ⁇ activation as compared to non-edited cells.
- gene editing is performed in wild-type mice/iPSC- CMs in response to cardiac injury (e.g., ischemia/reperfusion injury, transverse aortic constriction, etc.). IV.
- expression cassettes are employed to express a protein product, either for subsequent purification and delivery to a cell/subject, or for use directly in a genetic-based delivery approach.
- expression vectors which contain one or more nucleic acids encoding nucleotide editing Cas9 and at least one guide RNA that targets a CaMKII ⁇ .
- a nucleic acid encoding nucleotide editing Cas9 and a nucleic acid encoding at least one guide RNA are provided on the same vector.
- a nucleic acid encoding nucleotide editing Cas9 and a nucleic acid encoding least one guide RNA are provided on separate vectors.
- Expression requires that appropriate signals be provided in the vectors and include various regulatory elements such as enhancers/promoters from both viral and mammalian sources that drive expression of the genes of interest in cells. Elements designed to optimize messenger RNA stability and translatability in host cells also are defined. The conditions for the use of a number of dominant drug selection markers for establishing permanent, stable cell clones expressing the products are also provided, as is an element that links expression of the drug selection markers to expression of the polypeptide. A.
- expression cassette is meant to include any type of genetic construct containing a nucleic acid coding for a gene product in which part or all of the nucleic acid encoding sequence is capable of being transcribed and translated, i.e., is under the control of a promoter.
- a “promoter” refers to a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a gene.
- under transcriptional control means that the promoter is in the correct location and orientation in relation to the nucleic acid to control RNA polymerase initiation and expression of the gene.
- an “expression vector” is meant to include expression cassettes comprised in a genetic construct that is capable of replication, and thus including one or more of origins of replication, transcription termination signals, poly-A regions, selectable markers, and multipurpose cloning sites.
- the term promoter will be used here to refer to a group of transcriptional control modules that are clustered around the initiation site for RNA polymerase II. Much of the thinking about how promoters are organized derives from analyses of several viral promoters, including those for the HSV thymidine kinase (tk) and SV40 early transcription units.
- promoters are composed of discrete functional modules, each consisting of approximately 7-20 bp of DNA, and containing one or more recognition sites for transcriptional activator or repressor proteins.
- At least one module in each promoter functions to position the start site for RNA synthesis.
- the best-known example of this is the TATA box, but in some promoters lacking a TATA box, such as the promoter for the mammalian terminal deoxynucleotidyl transferase gene and the promoter for the SV40 late genes, a discrete element overlying the start site itself helps to fix the place of initiation.
- the nucleotide editing Cas9 constructs of the disclosure are expressed by a muscle-cell specific promoter.
- This muscle-cell specific promoter may be constitutively active or may be an inducible promoter.
- Additional promoter elements regulate the frequency of transcriptional initiation. Typically, these are located in the region 30-110 bp upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well. The spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another. In the tk promoter, the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline.
- viral promotes such as the human cytomegalovirus (CMV) immediate early gene promoter, the SV40 early promoter, the Rous sarcoma virus long terminal repeat, rat insulin promoter and glyceraldehyde-3-phosphate dehydrogenase can be used to obtain high-level expression of the coding sequence of interest.
- CMV human cytomegalovirus
- SV40 early promoter the Rous sarcoma virus long terminal repeat
- rat insulin promoter and glyceraldehyde-3-phosphate dehydrogenase
- glyceraldehyde-3-phosphate dehydrogenase can be used to obtain high-level expression of the coding sequence of interest.
- the use of other viral or mammalian cellular or bacterial phage promoters which are well-known in the art to achieve expression of a coding sequence of interest is contemplated as well, provided that the levels of expression are sufficient for a given purpose.
- Enhancers are genetic elements that increase transcription from a promoter located at a distant position on the same molecule of DNA. Enhancers are organized much like promoters. That is, they are composed of many individual elements, each of which binds to one or more transcriptional proteins. The basic distinction between enhancers and promoters is operational. An enhancer region as a whole must be able to stimulate transcription at a distance; this need not be true of a promoter region or its component elements.
- a promoter must have one or more elements that direct initiation of RNA synthesis at a particular site and in a particular orientation, whereas enhancers lack these specificities. Promoters and enhancers are often overlapping and contiguous, often seeming to have a very similar modular organization. [00101] Below is a list of promoters/enhancers and inducible promoters/enhancers that could be used in combination with the nucleic acid encoding a gene of interest in an expression construct. Additionally, any promoter/enhancer combination (as per the Eukaryotic Promoter Data Base EPDB) could also be used to drive expression of the gene.
- Eukaryotic cells can support cytoplasmic transcription from certain bacterial promoters if the appropriate bacterial polymerase is provided, either as part of the delivery complex or as an additional genetic expression construct.
- the promoter and/or enhancer may be, for example, immunoglobulin light chain, immunoglobulin heavy chain, T-cell receptor, HLA DQ a and/or DQ ⁇ , ⁇ -interferon, interleukin-2, interleukin-2 receptor, MHC class II 5, MHC class II HLA-Dra, ⁇ - Actin, muscle creatine kinase (MCK), prealbumin (transthyretin), elastase I, metallothionein (MTII), collagenase, albumin, ⁇ -fetoprotein, t-globin, ⁇ -globin, c-fos, c-HA-ras, insulin, neural cell adhesion molecule (NCAM), ⁇ 1 -antitrypain, H2B (TH2B) his
- inducible elements may be used.
- the inducible element is, for example, MTII, MMTV (mouse mammary tumor virus), ⁇ -interferon, adenovirus 5 E2, collagenase, stromelysin, SV40, murine MX gene, GRP78 gene, ⁇ -2-macroglobulin, vimentin, MHC class I gene H-2 ⁇ b, HSP70, proliferin, tumor necrosis factor, and/or thyroid stimulating hormone ⁇ gene.
- the inducer is phorbol ester (TFA), heavy metals, glucocorticoids, poly(rI)x, poly(rc), ElA, phorbol ester (TPA), interferon, Newcastle Disease Virus, A23187, IL-6, serum, interferon, SV40 large T antigen, PMA, and/or thyroid hormone.
- TAA phorbol ester
- Any of the inducible elements described herein may be used with any of the inducers described herein.
- cardiomyocyte-specific promoters is the cardiac troponin T (cTnT) promoter.
- a cDNA insert is employed, one will typically desire to include a polyadenylation signal to effect proper polyadenylation of the gene transcript.
- Any polyadenylation sequence may be employed such as human growth hormone and SV40 polyadenylation signals.
- a terminator is also contemplated as an element of the expression cassette. These elements can serve to enhance message levels and to minimize read through from the cassette into other sequences.
- B. 2A Peptide [00106] In some embodiments, a 2A-like self-cleaving domain from the insect virus Thosea asigna (TaV 2A peptide) (EGRGSLLTCGDVEENPGP (SEQ ID NO: 1)) is used.
- 2A-like peptides include, but are not limited to, equine rhinitis A virus (ERAV) 2A peptide (QCTNYALLKLAGDVESNPGP (SEQ ID NO: 2)), porcine teschovirus-1 (PTV1) 2A peptide (ATNFSLLKQAGDVEENPGP (SEQ ID NO: 3)) and foot and mouth disease virus (FMDV) 2A peptide (PVKQLLNFDLLKLAGDVESNPGP (SEQ ID NO: 4)) or modified versions thereof.
- the 2A peptide is used to express a reporter and a nucleotide editing Cas9 simultaneously.
- the reporter may be, for example, GFP or mCherry.
- trans-splicing inteins are used to permit the covalent splicing of the split nucleotide editing Cas9. Due to delivery size limitation, nucleotide editing Cas9 can be split in N- and C-terminal peptides.
- Each half of the split nucleotide editing Cas9 when linked to trans-splicing inteins reassemble after translation into a functional nucleotide editing Cas9 that retains similar editing efficiencies compared to its non-split, full- length equivalent.
- the N- and C-terminal peptides of nucleotide editing Cas9 are fused to split DnaE intein halves from N. puntiforme (Npu).
- Other trans-splicing inteins that may be used include but are not limited to Sce VMA, Mtu RecA, Ssp DnaE. D.
- the expression construct comprises a virus or engineered construct derived from a viral genome.
- adenovirus expression vector is meant to include those constructs containing adenovirus sequences sufficient to (a) support packaging of the construct and (b) to express an antisense polynucleotide that has been cloned therein. In this context, expression does not require that the gene product be synthesized.
- the expression vector comprises a genetically engineered form of adenovirus. Knowledge of the genetic organization of adenovirus, a 36 kB, linear, double- stranded DNA virus, allows substitution of large pieces of adenoviral DNA with foreign sequences up to 7 kB.
- Adenoviral infection of host cells does not result in chromosomal integration because adenoviral DNA can replicate in an episomal manner without potential genotoxicity.
- adenoviruses are structurally stable, and no genome rearrangement has been detected after extensive amplification. Adenovirus can infect virtually all epithelial cells regardless of their cell cycle stage. So far, adenoviral infection appears to be linked only to mild disease such as acute respiratory disease in humans.
- Adenovirus is particularly suitable for use as a gene transfer vector because of its mid-sized genome, ease of manipulation, high titer, wide target cell range and high infectivity.
- Both ends of the viral genome contain 100-200 base pair inverted repeats (ITRs), which are cis elements necessary for viral DNA replication and packaging.
- ITRs inverted repeats
- the early (E) and late (L) regions of the genome contain different transcription units that are divided by the onset of viral DNA replication.
- the E1 region (E1A and E1B) encodes proteins responsible for the regulation of transcription of the viral genome and a few cellular genes.
- the expression of the E2 region results in the synthesis of the proteins for viral DNA replication. These proteins are involved in DNA replication, late gene expression and host cell shut-off.
- the products of the late genes including the majority of the viral capsid proteins, are expressed only after significant processing of a single primary transcript issued by the major late promoter (MLP).
- MLP major late promoter
- the MLP (located at 16.8 m.u.) is particularly efficient during the late phase of infection, and all the mRNAs issued from this promoter possess a 5’-tripartite leader (TPL) sequence which makes them preferred mRNAs for translation.
- TPL 5’-tripartite leader
- recombinant adenovirus is generated from homologous recombination between shuttle vector and provirus vector. Due to the possible recombination between two proviral vectors, wild- type adenovirus may be generated from this process. Therefore, it is critical to isolate a single clone of virus from an individual plaque and examine its genomic structure.
- adenovirus vectors which are replication deficient, depend on a unique helper cell line, designated 293, which was transformed from human embryonic kidney cells by Ad5 DNA fragments and constitutively expresses E1 proteins. Since the E3 region is dispensable from the adenovirus genome, the current adenovirus vectors, with the help of 293 cells, carry foreign DNA in either the E1, the D3 or both regions. In nature, adenovirus can package approximately 105% of the wild-type genome, providing capacity for about 2 extra kb of DNA.
- Helper cell lines may be derived from human cells such as human embryonic kidney cells, muscle cells, hematopoietic cells or other human embryonic mesenchymal or epithelial cells. Alternatively, the helper cells may be derived from the cells of other mammalian species that are permissive for human adenovirus.
- the adenoviruses of the disclosure are replication defective, or at least conditionally replication defective.
- the adenovirus may be of any of the 42 different known serotypes or subgroups A-F.
- Adenovirus type 5 of subgroup C is the preferred starting material in order to obtain the conditional replication-defective adenovirus vector for use in the present disclosure.
- Retroviruses are a group of single-stranded RNA viruses characterized by an ability to convert their RNA to double-stranded DNA in infected cells by a process of reverse-transcription.
- the resulting DNA then stably integrates into cellular chromosomes as a provirus and directs synthesis of viral proteins.
- the integration results in the retention of the viral gene sequences in the recipient cell and its descendants.
- the retroviral genome contains three genes, gag, pol, and env that code for capsid proteins, polymerase enzyme, and envelope components, respectively.
- a sequence found upstream from the gag gene contains a signal for packaging of the genome into virions.
- Two long terminal repeat (LTR) sequences are present at the 5’ and 3’ ends of the viral genome. These contain strong promoter and enhancer sequences and are also required for integration in the host cell genome.
- a nucleic acid encoding a gene of interest is inserted into the viral genome in the place of certain viral sequences to produce a virus that is replication defective.
- a packaging cell line containing the gag, pol, and env genes but without the LTR and packaging components is constructed.
- the packaging sequence allows the RNA transcript of the recombinant plasmid to be packaged into viral particles, which are then secreted into the culture media.
- Retroviral vectors are able to infect a broad variety of cell types. However, integration and stable expression require the division of host cells. [00121]
- retrovirus vectors usually integrate into random sites in the cell genome. This can lead to insertional mutagenesis through the interruption of host genes or through the insertion of viral regulatory sequences that can interfere with the function of flanking genes.
- Another concern with the use of defective retrovirus vectors is the potential appearance of wild-type replication-competent virus in the packaging cells.
- viral vectors may be employed as expression constructs in the present disclosure.
- Vectors derived from viruses such as vaccinia virus, adeno-associated virus (AAV) and herpesviruses may be employed. They offer several attractive features for various mammalian cells.
- the vector is an AAV vector.
- AAV is a small virus that infects humans and some other primate species. AAV is not currently known to cause disease.
- AAV vectors integrate into the host cell genome, which can be important for certain applications, but can also have unwanted consequences.
- Gene therapy vectors using AAV can infect both dividing and quiescent cells and persist in an extrachromosomal state without integrating into the genome of the host cell, although in the native virus some integration of virally carried genes into the host genome does occur.
- the virus is a small (20 nm) replication-defective, non-enveloped virus.
- Wild-type AAV has attracted considerable interest from gene therapy researchers due to a number of features. Chief amongst these is the virus's apparent lack of pathogenicity. It can also infect non-dividing cells and has the ability to stably integrate into the host cell genome at a specific site (designated AAVS1) in the human chromosome 19. This feature makes it somewhat more predictable than retroviruses, which present the threat of a random insertion and of mutagenesis, which is sometimes followed by development of cancer. The AAV genome integrates most frequently into the site mentioned, while random incorporations into the genome take place with a negligible frequency.
- AAVs as gene therapy vectors, however, has eliminated this integrative capacity by removal of the rep and cap from the DNA of the vector.
- the desired gene together with a promoter to drive transcription of the gene is inserted between the inverted terminal repeats (ITR) that aid in concatemer formation in the nucleus after the single-stranded vector DNA is converted by host cell DNA polymerase complexes into double-stranded DNA.
- ITR inverted terminal repeats
- AAV-based gene therapy vectors form episomal concatemers in the host cell nucleus. In non-dividing cells, these concatemers remain intact for the life of the host cell. In dividing cells, AAV DNA is lost through cell division, since the episomal DNA is not replicated along with the host cell DNA.
- AAV DNA Random integration of AAV DNA into the host genome is detectable but occurs at very low frequency. AAVs also present very low immunogenicity, seemingly restricted to generation of neutralizing antibodies, while they induce no clearly defined cytotoxic response. This feature, along with the ability to infect quiescent cells present their dominance over adenoviruses as vectors for human gene therapy. [00125] Use of the AAV does present some disadvantages. The cloning capacity of the vector is relatively limited and most therapeutic genes require the complete replacement of the virus's 4.8 kilobase genome. Large genes are, therefore, not suitable for use in a standard AAV vector. Options are currently being explored to overcome the limited coding capacity.
- AAV self-complementary adeno-associated virus
- scAAV vectors are more immunogenic than single stranded adenovirus vectors, inducing a stronger activation of cytotoxic T lymphocytes.
- the humoral immunity instigated by infection with the wild type is thought to be a very common event.
- the associated neutralizing activity limits the usefulness of the most commonly used serotype AAV2 in certain applications. Accordingly, the majority of clinical trials currently under way involve delivery of AAV2 into the brain, a relatively immunologically privileged organ. In the brain, AAV2 is strongly neuron specific.
- the AAV genome is built of single-stranded deoxyribonucleic acid (ssDNA), either positive- or negative-sensed, which is about 4.7 kilobase long.
- the genome comprises inverted terminal repeats (ITRs) at both ends of the DNA strand, and two open reading frames (ORFs): rep and cap.
- ITRs inverted terminal repeats
- ORFs open reading frames
- the former is composed of four overlapping genes encoding Rep proteins required for the AAV life cycle, and the latter contains overlapping nucleotide sequences of capsid proteins: VP1, VP2 and VP3, which interact together to form a capsid of an icosahedral symmetry.
- the Inverted Terminal Repeat (ITR) sequences comprise 145 bases each.
- the ITRs were also shown to be required for both integration of the AAV DNA into the host cell genome (19th chromosome in humans) and rescue from it, as well as for efficient encapsidation of the AAV DNA combined with generation of a fully assembled, deoxyribonuclease-resistant AAV particles.
- ITRs seem to be the only sequences required in cis next to the therapeutic gene: structural (cap) and packaging (rep) proteins can be delivered in trans. With this assumption many methods were established for efficient production of recombinant AAV (rAAV) vectors containing a reporter or therapeutic gene. However, it was also published that the ITRs are not the only elements required in cis for the effective replication and encapsidation. A few research groups have identified a sequence designated cis-acting Rep-dependent element (CARE) inside the coding sequence of the rep gene. CARE was shown to augment the replication and encapsidation when present in cis.
- CARE Rep-dependent element
- mRNAs messenger ribonucleic acids
- p5 and p19 from which two overlapping messenger ribonucleic acids (mRNAs) of different length can be produced.
- mRNAs messenger ribonucleic acids
- Each of these contains an intron which can be either spliced out or not.
- four various mRNAs, and consequently four various Rep proteins with overlapping sequence can be synthesized.
- Their names depict their sizes in kilodaltons (kDa): Rep78, Rep68, Rep52 and Rep40.
- Rep78 and 68 can specifically bind the hairpin formed by the ITR in the self-priming act and cleave at a specific region, designated terminal resolution site, within the hairpin.
- Rep proteins were shown to bind ATP and to possess helicase activity. It was also shown that they upregulate the transcription from the p40 promoter (mentioned below) but downregulate both p5 and p19 promoters.
- the right side of a positive-sensed AAV genome encodes overlapping sequences of three capsid proteins, VP1, VP2 and VP3, which start from one promoter, designated p40. The molecular weights of these proteins are 87, 72 and 62 kiloDaltons, respectively.
- the AAV capsid is composed of a mixture of VP1, VP2, and VP3 totaling 60 monomers arranged in icosahedral symmetry in a ratio of 1:1:10, with an estimated size of 3.9 MegaDaltons.
- the cap gene produces an additional, non-structural protein called the Assembly-Activating Protein (AAP). This protein is produced from ORF2 and is essential for the capsid-assembly process. The exact function of this protein in the assembly process and its structure have not been solved to date.
- All three VPs are translated from one mRNA.
- mRNA After this mRNA is synthesized, it can be spliced in two different manners: either a longer or shorter intron can be excised resulting in the formation of two pools of mRNAs: a 2.3 kb- and a 2.6 kb-long mRNA pool. Usually, especially in the presence of adenovirus, the longer intron is preferred, so the 2.3-kb-long mRNA represents the so-called “major splice”. In this form the first AUG codon, from which the synthesis of VP1 protein starts, is cut out, resulting in a reduced overall level of VP1 protein synthesis. The first AUG codon that remains in the major splice is the initiation codon for VP3 protein.
- the unique fragment at the N terminus of VP1 protein was shown to possess the phospholipase A2 (PLA2) activity, which is probably required for the releasing of AAV particles from late endosomes.
- PPA2 phospholipase A2
- Muralidhar et al. reported that VP2 and VP3 are crucial for correct virion assembly. More recently, however, Warrington et al. showed VP2 to be unnecessary for the complete virus particle formation and an efficient infectivity, and also presented that VP2 can tolerate large insertions in its N terminus, while VP1 cannot, probably because of the PLA2 domain presence.
- the AAV vector may be replication-defective or conditionally replication defective. In some embodiments, the AAV vector is a recombinant AAV vector.
- the AAV vector comprises a sequence isolated or derived from an AAV vector of serotype AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11 or any combination thereof.
- a single viral vector is used to deliver a nucleic acid encoding a nucleotide editing Cas9 and at least one sgRNA to a cell.
- nucleotide editing Cas9 is provided to a cell using a first viral vector and at least one sgRNA is provided to the cell using a second viral vector.
- the nucleotide editing Cas9 may use a split-intein dual AAV system which reconstitutes the full- length nucleotide editor by protein trans-splicing.
- the Cas9 protein or the base editor is split into two sections, each fused with one part of an intein system (e.g., intein-N and intein-C encoded by dnaEn and dnaEc, respectively).
- an intein system e.g., intein-N and intein-C encoded by dnaEn and dnaEc, respectively.
- the two sections of the Cas9 protein or nucleobase editor are ligated together via intein-mediated protein splicing. See, U.S. Pat. Pub. US20180127780, which is incorporated by reference herein in its entirety.
- a single viral vector is used to deliver a nucleic acid encoding nucleotide editing Cas9 and at least one sgRNA to a cell.
- nucleotide editing Cas9 is provided to a cell using a first viral vector and at least one sgRNA is provided to the cell using a second viral vector.
- the nucleotide editing Cas9 may use a split-intein dual AAV system which reconstitutes the full-length nucleotide editor by protein trans-splicing. In order to effect expression of sense or antisense gene constructs, the expression construct must be delivered into a cell.
- the cell may be a muscle cell, a satellite cell, a mesangioblast, a bone marrow derived cell, a stromal cell or a mesenchymal stem cell.
- the cell is a cardiac muscle cell, a skeletal muscle cell, or a smooth muscle cell.
- the cell is a cell in the tibialis anterior, quadriceps, soleus, triceps, extensor digitorum longus, diaphragm, or heart.
- the cell is an induced pluripotent stem cell (iPSC) or inner cell mass cell (iCM).
- iPSC induced pluripotent stem cell
- iCM inner cell mass cell
- the cell is a human iPSC or a human iCM.
- human iPSCs or human iCMs of the disclosure may be derived from a cultured stem cell line, an adult stem cell, a placental stem cell, or from another source of adult or embryonic stem cells that does not require the destruction of a human embryo. Delivery to a cell may be accomplished in vitro, as in laboratory procedures for transforming cells lines, or in vivo or ex vivo, as in the treatment of certain disease states. One mechanism for delivery is via viral infection where the expression construct is encapsidated in an infectious viral particle. [00139] Several non-viral methods for the transfer of expression constructs into cultured mammalian cells also are contemplated by the present disclosure.
- nucleic acid encoding the gene of interest may be positioned and expressed at different sites.
- the nucleic acid encoding the gene may be stably integrated into the genome of the cell.
- nucleic acid may be stably maintained in the cell as a separate, episomal segment of DNA.
- nucleic acid segments or “episomes” encode sequences sufficient to permit maintenance and replication independent of or in synchronization with the host cell cycle. How the expression construct is delivered to a cell and where in the cell the nucleic acid remains is dependent on the type of expression construct employed. [00141] In yet another embodiment, the expression construct may simply consist of naked recombinant DNA or plasmids.
- Transfer of the construct may be performed by any of the methods mentioned above which physically or chemically permeabilize the cell membrane. This is particularly applicable for transfer in vitro but it may be applied to in vivo use as well. DNA encoding a gene of interest may also be transferred in a similar manner in vivo and express the gene product.
- In still another embodiment for transferring a naked DNA expression construct into cells may involve particle bombardment. This method depends on the ability to accelerate DNA-coated microprojectiles to a high velocity allowing them to pierce cell membranes and enter cells without killing them.
- Several devices for accelerating small particles have been developed. One such device relies on a high voltage discharge to generate an electrical current, which in turn provides the motive force.
- the expression construct is delivered directly to the liver, skin, and/or muscle tissue of a subject. This may require surgical exposure of the tissue or cells, to eliminate any intervening tissue between the gun and the target organ, i.e., ex vivo treatment. Again, DNA encoding a particular gene may be delivered via this method and still be incorporated by the present disclosure.
- the expression construct may be entrapped in a liposome. Liposomes are vesicular structures characterized by a phospholipid bilayer membrane and an inner aqueous medium.
- Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution. The lipid components undergo self-rearrangement before the formation of closed structures and entrap water and dissolved solutes between the lipid bilayers. Also contemplated are lipofectamine-DNA complexes. [00145] Liposome-mediated nucleic acid delivery and expression of foreign DNA in vitro has been very successful. A reagent known as Lipofectamine 2000 TM is widely used and commercially available.
- the liposome may be complexed with a hemagglutinating virus (HVJ) to facilitate fusion with the cell membrane and promote cell entry of liposome-encapsulated DNA.
- HVJ hemagglutinating virus
- the liposome may be complexed or employed in conjunction with nuclear non-histone chromosomal proteins (HMG-1).
- HMG-1 nuclear non-histone chromosomal proteins
- the liposome may be complexed or employed in conjunction with both HVJ and HMG-1.
- receptor-mediated delivery vehicles which can be employed to deliver a nucleic acid encoding a particular gene into cells. These take advantage of the selective uptake of macromolecules by receptor-mediated endocytosis in almost all eukaryotic cells. Because of the cell type-specific distribution of various receptors, the delivery can be highly specific.
- Receptor-mediated gene targeting vehicles generally consist of two components: a cell receptor-specific ligand and a DNA-binding agent. Several ligands have been used for receptor-mediated gene transfer. The most extensively characterized ligands are asialoorosomucoid (ASOR) and transferrin.
- ASOR asialoorosomucoid
- transferrin transferrin
- a synthetic neoglycoprotein which recognizes the same receptor as ASOR, has been used as a gene delivery vehicle and epidermal growth factor (EGF) has also been used to deliver genes to squamous carcinoma cells.
- E. AAV-Cas9 vectors [00149]
- a Cas9 base editor may be packaged into an AAV vector.
- the AAV vector is a wild-type AAV vector.
- the AAV vector contains one or more mutations.
- the AAV vector is isolated or derived from an AAV vector of serotype AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11 or any combination thereof.
- Exemplary AAV-Cas9 vectors contain two ITR (inverted terminal repeat) sequences which flank a central sequence region comprising the Cas9 sequence.
- the ITRs are isolated or derived from an AAV vector of serotype AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11 or any combination thereof.
- the ITRs comprise or consist of full-length and/or wild-type sequences for an AAV serotype.
- the ITRs comprise or consist of truncated sequences for an AAV serotype.
- the ITRs comprise or consist of elongated sequences for an AAV serotype. In some embodiments, the ITRs comprise or consist of sequences comprising a sequence variation compared to a wild-type sequence for the same AAV serotype. In some embodiments, the sequence variation comprises one or more of a substitution, deletion, insertion, inversion, or transposition.
- the ITRs comprise or consist of at least 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149 or 150 base pairs.
- the ITRs comprise or consist of 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149 or 150 base pairs.
- the ITRs have a length of 110 ⁇ 10 base pairs.
- the ITRs have a length of 120 ⁇ 10 base pairs. In some embodiments, the ITRs have a length of 130 ⁇ 10 base pairs. In some embodiments, the ITRs have a length of 140 ⁇ 10 base pairs. In some embodiments, the ITRs have a length of 150 ⁇ 10 base pairs. In some embodiments, the ITRs have a length of 115, 145, or 141 base pairs.
- the AAV-Cas9 vector may contain one or more nuclear localization signals (NLS). In some embodiments, the AAV-Cas9 vector contains 1, 2, 3, 4, or 5 nuclear localization signals.
- Exemplary NLS include the c-myc NLS, the SV40 NLS, the hnRNPAI M9 NLS, the nucleoplasmin NLS, the sequence RMRKFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO: 5) of the IBB domain from importin-alpha, the sequences VSRKRPRP (SEQ ID NO: 6) and PPKKARED (SEQ ID NO: 7) of the myoma T protein, the sequence PQPKKKPL (SEQ ID NO: 8) of human p53, the sequence SALIKKKKKMAP (SEQ ID NO: 9) of mouse c-abl IV, the sequences DRLRR (SEQ ID NO: 10) and PKQKKRK (SEQ ID NO: 11) of the influenza virus NS1, the sequence RKLKKKIKKL (SEQ ID NO: 12) of the Hepatitis virus delta antigen and the sequence REKKKFLKRR (SEQ ID NO: 13) of the
- nuclear localization signals include bipartite nuclear localization sequences such as the sequence KRKGDEVDGVDEVAKKKSKK (SEQ ID NO: 14) of the human poly(ADP- ribose) polymerase or the sequence RKCLQAGMNLEARKTKK (SEQ ID NO: 15) of the steroid hormone receptors (human) glucocorticoid.
- the AAV-Cas9 vector may comprise additional elements to facilitate packaging of the vector and expression of the Cas9.
- the AAV-Cas9 vector may comprise a polyA sequence.
- the polyA sequence may be a mini-polyA sequence.
- the AAV-CAs9 vector may comprise a transposable element.
- the AAV-Cas9 vector may comprise a regulator element.
- the regulator element is an activator or a repressor.
- the AAV-Cas9 may contain one or more promoters.
- the one or more promoters drive expression of the Cas9.
- the one or more promoters are cardiomyocyte-specific promoters. Exemplary cardiac-specific promoters include the cardiac troponin T promoter and ⁇ -myosin heavy chain promoter.
- the AAV-Cas9 vector may be optimized for production in yeast, bacteria, insect cells, or mammalian cells. In some embodiments, the AAV-Cas9 vector may be optimized for expression in human cells. In some embodiments, the AAV-Cas9 vector may be optimized for expression in a bacculovirus expression system. [00155] In some embodiments of the gene editing constructs of the disclosure, the construct comprises or consists of a promoter and a nuclease. In some embodiments, the construct comprises or consists of an cTnT promoter and a Cas9 nuclease.
- the construct comprises or consists of an cTnT promoter and a Cas9 nuclease isolated or derived from Staphylococcus pyogenes (“SpCas9”).
- the SpCas9 nuclease comprises or consists of a nucleotide sequence at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to GACAAGAAGTACAGCATCGGCCTGGACATCGGCACCAACTCTGTGGGCTGGGCCGTGATCAC CGACGAGTACAAGGTGCCCAGCAAGAAATTCAAGGTGCTGGGCAACACCGACCGGCACAGCA TCAAGAAGAACCTGATCGGAGCCCTGCTGTTCGACAGCGGCGAAACAGCCGAGGCCACCCGG
- the construct comprising a promoter and a nuclease further comprises at least two inverted terminal repeat (ITR) sequences.
- the construct comprising a promoter and a nuclease further comprises at least two ITR sequences from isolated or derived from an AAV of serotype 2 (AAV2).
- the construct comprising a promoter and a nuclease further comprises at least two ITR sequences each comprising or consisting of a nucleotide sequence of GGCCACTCCCTCTCTGCGCTCGCTCGCTCACTGAGGCCGGGCGACCAAAGGTCGCCCGAC GCCCGGGCTTTGCCCGGGCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGGGA (SEQ ID NO: 17).
- the construct comprising a promoter and a nuclease further comprises at least two ITR sequences, wherein the first ITR sequence comprises or consists of a nucleotide sequence of CCTGCAGGCAGCTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCCCGGGCGTCGG GCGACCTTTGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGGGAGTGGCCAACTC CATCACTAGGGGTTCCT (SEQ ID NO: 18) and the second ITR sequence comprises or consist of a nucleotide sequence of AGGAACCCCTAGTGATGGAGTTGGCCACTCCCTCTCTGCGCTCGCTCGCTCACTGAGGCC GGGCGACCAAAGGTCGCCCGACGCCCGGGCTTTGCCCGGGCGGCCTCAGTGAGCGAGC GCGCAGCTGCCTGCAGG (SEQ ID NO: 19).
- the construct comprises or consists of, from 5’ to 3’ a first ITR, a sequence encoding a promoter, a sequence encoding a nuclease and a second ITR. In some embodiments, the construct comprises or consists of, from 5’ to 3’ a first AAV2 ITR, a sequence encoding an cTnT promoter, a sequence encoding a SpCas9 nuclease and a second AAV2 ITR. In some embodiments, the construct comprising or consisting of, from 5’ to 3’ a first ITR, a sequence encoding a promoter, a sequence encoding a nuclease and a second ITR, further comprises a poly A sequence.
- the polyA sequence comprises or consists of a minipolyA sequence.
- Exemplary minipolyA sequences of the disclosure comprise or consist of a nucleotide sequence of TAGCAATAAAGGATCGTTTATTTTCATTGGAAGCGTGTGTTGGTTTTTTGATCAGGCGCG (SEQ ID NO: 20).
- the construct comprises or consists of, from 5’ to 3’ a first ITR, a sequence encoding a promoter, a sequence encoding a nuclease, a poly A sequence and a second ITR.
- the construct comprises or consists of, from 5’ to 3’ a first ITR, a sequence encoding a promoter, a sequence encoding a nuclease, a minipoly A sequence and a second ITR.
- the construct comprises or consists of, from 5’ to 3’ a first AAV2 ITR, a sequence encoding an cTnT promoter, a sequence encoding a SpCas9 nuclease, a minipoly A sequence and a second AAV2 ITR.
- the construct comprising, from 5’ to 3’ a first ITR, a sequence encoding a promoter, a sequence encoding a nuclease, a poly A sequence and a second ITR, further comprises at least one nuclear localization signal. In some embodiments, the construct comprising, from 5’ to 3’ a first ITR, a sequence encoding a promoter, a sequence encoding a nuclease, a poly A sequence and a second ITR, further comprises at least two nuclear localization signals.
- Exemplary nuclear localization signals of the disclosure comprise or consist of a nucleotide sequence of AAGCGTCCTGCTGCTACTAAGAAAGCTGGTCAAGCTAAGAAAAAGAAA (SEQ ID NO: 21) or a nucleotide sequence of ATGGCCCCAAAGAAGAAGCGGAAGGTCGGTATCCACGGAGTCCCAGCAGCC (SEQ ID NO: 22).
- the construct comprises or consists of, from 5’ to 3’ a first ITR, a sequence encoding a promoter, a sequence encoding a first nuclear localization signal, a sequence encoding a nuclease, a poly A sequence and a second ITR.
- the construct comprises or consists of, from 5’ to 3’ a first ITR, a sequence encoding a promoter, a sequence encoding a first nuclear localization signal, a sequence encoding a nuclease, a sequence encoding a second nuclear localization signal, a poly A sequence and a second ITR.
- the construct comprising, from 5’ to 3’ a first ITR, a sequence encoding a promoter, a sequence encoding a first nuclear localization signal, a sequence encoding a nuclease, a sequence encoding a second nuclear localization signal, a poly A sequence and a second ITR, further comprises a stop codon.
- the stop codon may have a sequence of TAG, TAA, or TGA.
- the construct comprises or consists of, from 5’ to 3’ a first ITR, a sequence encoding a promoter, a sequence encoding a first nuclear localization signal, a sequence encoding a nuclease, a sequence encoding a second nuclear localization signal, a stop codon, a poly A sequence and a second ITR.
- the construct comprising or consisting of, from 5’ to 3’ a first ITR, a sequence encoding a promoter, a sequence encoding a first nuclear localization signal, a sequence encoding a nuclease, a sequence encoding a second nuclear localization signal, a stop codon, a poly A sequence and a second ITR, further comprises transposable element inverted repeats.
- Exemplary transposable element inverted repeats of the disclosure comprise or consist of a nucleotide sequence of TGTGGGCGGACAAAATAGTTGGGAACTGGGAGGGGTGGAAATGGAGTTTTTAAGGATTATTT AGGGAAGAGTGACAAAATAGATGGGAACTGGGTGTAGCGTCGTAAGCTAATACGAAAATTAA AAATGACAAAATAGTTTGGAACTAGATTTCACTTATCTGGTT (SEQ ID NO: 23) and/or a nucleotide sequence of GAATATAGTCTTTACCATGCCCTTGGCCACGCCCCTCTTTAATACGACGGGCAATTTGCACT TCAGAAAATGAAGAGTTTGCTTTAGCCATAACAAAAGTCCAGTATGCTTTTTCACAGCATAA CTGGACTGATTTCAGTTTACAACTATTCTGTCTAGTTTAAGACTTTATTGTCATAGTTTAGA TCTATTTTGTTCAGTTTAAGACTTTATTGTCCGCCCACA (SEQ ID NO: 24).
- the construct comprises or consists of, from 5’ to 3’ a first transposable element inverted repeat, a first ITR, a sequence encoding a promoter, a sequence encoding a first nuclear localization signal, a sequence encoding a nuclease, a sequence encoding a second nuclear localization signal, a stop codon, a poly A sequence, a second ITR, and a second transposable element inverted repeat.
- the construct comprising or consisting of, from 5’ to 3’, a first transposable element inverted repeat, a first ITR, a sequence encoding a promoter, a sequence encoding a first nuclear localization signal, a sequence encoding a nuclease, a sequence encoding a second nuclear localization signal, a stop codon, a poly A sequence, a second ITR, and a second transposable element inverted repeat, further comprises a regulatory sequence.
- Exemplary regulatory sequences of the disclosure comprise or consist of a nucleotide sequence of CATGCAAGCTGTAGCCAACCACTAGAACTATAGCTAGAGTCCTGGGCGAACAAACGATGCTC GCCTTCCAGAAAACCGAGGATGCGAACCACTTCATCCGGGGTCAGCACCACCGGCAAGCGCC GCGACGGCCGAGGTCTTCCGATCTCCTGAAGCCAGGGCAGATCCGTGCACAGCACCTTGCCG TAGAAGAACAGCAAGGCCGCCAATGCCTGACGATGCGTGGAGACCGAAACCTTGCGCTCGTT CGCCAGCCAGGACAGAAATGCCTCGACTTCGCTGCTGCCCAAGGTTGCCGGGTGACGCACAC CGTGGAAACGGATGAAGGCACGAACCCAGTTGACATAAGCCTGTTCGGTTCGTAAACTGTAA TGCAAGTAGCGTATGCGCTCACGCAACTGGTCCAGAACCTTGACCGAACGCAGCGGTGGTAA CGGTGGTCCAGAACCTTGACCGAACGCAGCGGTGGTA
- the construct comprises or consists of, from 5’ to 3’ a first transposable element inverted repeat, a first ITR, a sequence encoding a promoter, a sequence encoding a first nuclear localization signal, a sequence encoding a nuclease, a sequence encoding a second nuclear localization signal, a stop codon, a poly A sequence, a second ITR, a regulatory sequence and a second transposable element inverted repeat.
- the construct may further comprise one or more spacer sequences. Exemplary spacer sequences of the disclosure have length from 1-1500 nucleotides, inclusive of all ranges therebetween.
- the spacer sequences may be located either 5’ to or 3’ to an ITR, a promoter, a nuclear localization sequence, a nuclease, a stop codon, a polyA sequence, a transposable element inverted repeat, and/or a regulator element.
- AAV-sgRNA vectors [00157] In some embodiments, at least a first sequence encoding a sgRNA and a second sequence encoding a sgRNA may be packaged into an AAV vector. In some embodiments, at least a first sequence encoding a sgRNA, a second sequence encoding a sgRNA, and a third sequence encoding a sgRNA may be packaged into an AAV vector.
- At least a first sequence encoding a sgRNA, a second sequence encoding a sgRNA, a third sequence encoding a sgRNA, and a fourth sequence encoding a sgRNA may be packaged into an AAV vector.
- at least a first sequence encoding a sgRNA, a second sequence encoding a sgRNA, a third sequence encoding a sgRNA, a fourth sequence encoding a sgRNA, and a fifth sequence encoding a sgRNA may be packaged into an AAV vector.
- a plurality of sequences encoding a sgRNA are packaged into an AAV vector.
- 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 sequences encoding a sgRNA may be packaged into an AAV vector.
- each sequence encoding a sgRNA is different.
- at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 of the sequences encoding a sgRNA are the same.
- all of the sequence encoding a sgRNA are the same.
- the AAV vector is a wild-type AAV vector.
- the AAV vector contains one or more mutations.
- the AAV vector is isolated or derived from an AAV vector of serotype AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11 or any combination thereof.
- Exemplary AAV-sgRNA vectors contain two ITR (inverted terminal repeat) sequences which flank a central sequence region comprising the sgRNA sequences.
- the ITRs are isolated or derived from an AAV vector of serotype AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11 or any combination thereof.
- the ITRs are isolated or derived from an AAV vector of a first serotype and a sequence encoding a capsid protein of the AAV-sgRNA vector is isolated or derived from an AAV vector of a second serotype.
- the first serotype and the second serotype are the same.
- the first serotype and the second serotype are not the same.
- the first serotype is AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, or AAV11.
- the second serotype is AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, or AAV11.
- the first serotype is AAV2 and the second serotype is AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, or AAV11.
- the first serotype is AAV2 and the second serotype is AAV9.
- Exemplary AAV-sgRNA vectors contain two ITR (inverted terminal repeat) sequences which flank a central sequence region comprising the sgRNA sequences.
- the ITRs are isolated or derived from an AAV vector of serotype AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11 or any combination thereof.
- a first ITR is isolated or derived from an AAV vector of a first serotype
- a second ITR is isolated or derived from an AAV vector of a second serotype
- a sequence encoding a capsid protein of the AAV-sgRNA vector is isolated or derived from an AAV vector of a third serotype.
- the first serotype and the second serotype are the same.
- the first serotype and the second serotype are not the same. In some embodiments, the first serotype, the second serotype, and the third serotype are the same. In some embodiments, the first serotype, the second serotype, and the third serotype are not the same. In some embodiments, the first serotype is AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, or AAV11. In some embodiments, the second serotype is AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, or AAV11.
- the third serotype is AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, or AAV11.
- the first serotype is AAV2, the second serotype is AAV4 and the third serotype is AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, or AAV11.
- the first serotype is AAV2, the second serotype is AAV4 and the third serotype is AAV9.
- Exemplary AAV-sgRNA vectors contain two ITR (inverted terminal repeat) sequences which flank a central sequence region comprising the sgRNA sequences.
- the ITRs are isolated or derived from an AAV vector of serotype AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11 or any combination thereof.
- the ITRs comprise or consist of full-length and/or wild-type sequences for an AAV serotype.
- the ITRs comprise or consist of truncated sequences for an AAV serotype.
- the ITRs comprise or consist of elongated sequences for an AAV serotype.
- the ITRs comprise or consist of sequences comprising a sequence variation compared to a wild-type sequence for the same AAV serotype.
- the sequence variation comprises one or more of a substitution, deletion, insertion, inversion, or transposition.
- the ITRs comprise or consist of at least 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149 or 150 base pairs.
- the ITRs comprise or consist of 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149 or 150 base pairs.
- the ITRs have a length of 110 ⁇ 10 base pairs.
- the ITRs have a length of 120 ⁇ 10 base pairs. In some embodiments, the ITRs have a length of 130 ⁇ 10 base pairs. In some embodiments, the ITRs have a length of 140 ⁇ 10 base pairs. In some embodiments, the ITRs have a length of 150 ⁇ 10 base pairs. In some embodiments, the ITRs have a length of 115, 145, or 141 base pairs. [00161] In some embodiments, the AAV-sgRNA vector may comprise additional elements to facilitate packaging of the vector and expression of the sgRNA. In some embodiments, the AAV-sgRNA vector may comprise a transposable element. In some embodiments, the AAV-sgRNA vector may comprise a regulatory element.
- the regulatory element comprises an activator or a repressor.
- the AAV-sgRNA sequence may comprise a non-functional or “stuffer” sequence.
- Exemplary stuffer sequences of the disclosure may have some (a non-zero percentage of) identity or homology to a genomic sequence of a mammal (including a human).
- exemplary stuffer sequences of the disclosure may have no identify or homology to a genomic sequence of a mammal (including a human).
- Exemplary stuffer sequences of the disclosure may comprise or consist of naturally occurring non-coding sequences or sequences that are neither transcribed nor translated following administration of the AAV vector to a subject.
- the AAV-sgRNA vector may be optimized for production in yeast, bacteria, insect cells, or mammalian cells. In some embodiments, the AAV-sgRNA vector may be optimized for expression in human cells. In some embodiments, the AAV-Cas9 vector may be optimized for expression in a bacculovirus expression system. [00163] In some embodiments, the AAV-sgRNA vector comprises at least one promoter. In some embodiments, the AAV-sgRNA vector comprises at least two promoters. In some embodiments, the AAV-sgRNA vector comprises at least three promoters. In some embodiments, the AAV-sgRNA vector comprises at least four promoters.
- the AAV-sgRNA vector comprises at least five promoters.
- promoters include, for example, immunoglobulin light chain, immunoglobulin heavy chain, T-cell receptor, HLA DQ a and/or DQ ⁇ , ⁇ -interferon, interleukin-2, interleukin-2 receptor, MHC class II 5, MHC class II HLA-Dra, ⁇ -Actin, muscle creatine kinase (MCK), prealbumin (transthyretin), elastase I, metallothionein (MTII), collagenase, albumin, ⁇ -fetoprotein, t- globin, ⁇ -globin, c-fos, c-HA-ras, insulin, neural cell adhesion molecule (NCAM), ⁇ 1 - antitrypain, H2B (TH2B) histone, mouse and/or type I collagen, glucose-regulated proteins (GRP94 and GRP78), rat growth hormone, human serum amy
- the AAV vector comprises a first sequence encoding a sgRNA and a second sequence encoding a sgRNA, a first promoter drives expression of the first sequence encoding a sgRNA and a second promoter drives expression of the second sequence encoding a sgRNA.
- the first and second promoters are the same. In some embodiments, the first and second promoters are different. In some embodiments, the first and second promoters are selected from the H1 promoter, the U6 promoter, and the 7SK promoter.
- the first sequence encoding a sgRNA and the second sequence encoding a sgRNA are identical. In some embodiments, the first sequence encoding a sgRNA and the second sequence encoding a sgRNA are not identical.
- the AAV vector comprises a first sequence encoding a sgRNA, a second sequence encoding a sgRNA, and a third sequence encoding a sgRNA, a first promoter drives expression of the first sequence encoding a sgRNA, a second promoter drives expression of the second sequence encoding a sgRNA, and a third promoter drives expression of a third sequence encoding a sgRNA.
- the first, second, and third promoters are the same. In some embodiments, each of the first, second, and third promoters are different. In some embodiments, the first, second, and third promoters are selected from the H1 promoter, the U6 promoter, and the 7SK promoter. In some embodiments, the first promoter is the U6 promoter. In some embodiments, the second promoter is the H1 promoter. In some embodiments, the third promoter is the 7SK promoter. In some embodiments, the first promoter is the U6 promoter, the second promoter is the H1 promoter, and the third promoter is the 7SK promoter.
- the first sequence encoding a sgRNA, the second sequence encoding a sgRNA, and the third sequence encoding a sgRNA are identical. In some embodiments, the first sequence encoding a sgRNA, the second sequence encoding a sgRNA, and the third sequence encoding a sgRNA are not identical.
- the AAV vector comprises a first sequence encoding a sgRNA, a second sequence encoding a sgRNA, a third sequence encoding a sgRNA, and a fourth sequence encoding a sgRNA
- a first promoter drives expression of the first sequence encoding a sgRNA
- a second promoter drives expression of the second sequence encoding a sgRNA
- a third promoter drives expression of the third sequence encoding a sgRNA
- a fourth promoter drives expression of the fourth sequence encoding a sgRNA.
- at least two of the first, second, third, and fourth promoters are the same.
- each of the first, second, third, and fourth promoters are different. In some embodiments, each of the first, second, third and fourth promoters are selected from the H1 promoter, the U6 promoter, and the 7SK promoter. In some embodiments, the first sequence encoding a sgRNA, the second sequence encoding a sgRNA, the third sequence encoding a sgRNA, and the fourth sequence encoding a sgRNA are identical. In some embodiments, the first sequence encoding a sgRNA, the second sequence encoding a sgRNA, the third sequence encoding a sgRNA, and the fourth sequence encoding a sgRNA are not identical.
- the AAV vector comprises a first sequence encoding a sgRNA, a second sequence encoding a sgRNA, a third sequence encoding a sgRNA, a fourth sequence encoding a sgRNA, and a fifth sequence encoding a sgRNA
- a first promoter drives expression of the first sequence encoding a sgRNA
- a second promoter drives expression of the second sequence encoding a sgRNA
- a third promoter drives expression of the third sequence encoding a sgRNA
- a fourth promoter drives expression of the fourth sequence encoding a sgRNA
- a fifth promoter drives expression of the fifth sequence encoding a sgRNA.
- first, second, third, fourth, and fifth promoters are the same. In some embodiments, each of the first, second, third, fourth, and fifth promoters are different. In some embodiments, each of the first, second, third, and fourth promoters are different. In some embodiments, each of the first, second, third, fourth and fifth promoters are selected from the H1 promoter, the U6 promoter, and the 7SK promoter. In some embodiments, the first sequence encoding a sgRNA, the second sequence encoding a sgRNA, the third sequence encoding a sgRNA, the fourth sequence encoding a sgRNA, and the fifth sequence encoding a sgRNA are identical.
- the first sequence encoding a sgRNA, the second sequence encoding a sgRNA, the third sequence encoding a sgRNA, the fourth sequence encoding a sgRNA, and the fifth sequence encoding a sgRNA are not identical.
- pharmaceutical compositions are prepared in a form appropriate for the intended application. Generally, this entails preparing compositions that are essentially free of pyrogens, as well as other impurities that could be harmful to humans or animals. [00169] Appropriate salts and buffers are used to render drugs, proteins or delivery vectors stable and allow for uptake by target cells.
- compositions of the present disclosure comprise an effective amount of the drug, vector or proteins, dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium.
- pharmaceutically acceptable carrier includes solvents, buffers, solutions, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like acceptable for use in formulating pharmaceuticals, such as pharmaceuticals suitable for administration to humans. The use of such media and agents for pharmaceutically active substances is well known in the art.
- the active compositions of the present disclosure may include classic pharmaceutical preparations. Administration of these compositions according to the present disclosure may be via any common route so long as the target tissue is available via that route, but generally including systemic administration. This includes oral, nasal, or buccal. Alternatively, administration may be by intradermal, subcutaneous, intramuscular, intracardiac, intraperitoneal or intravenous injection, or by direct injection into muscle tissue. Such compositions would normally be administered as pharmaceutically acceptable compositions, as described supra.
- the active compounds may also be administered parenterally or intraperitoneally.
- solutions of the active compounds as free base or pharmacologically acceptable salts can be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose.
- Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations generally contain a preservative to prevent the growth of microorganisms.
- the pharmaceutical forms suitable for injectable use include, for example, sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
- these preparations are sterile and fluid to the extent that easy injectability exists. Preparations should be stable under the conditions of manufacture and storage and should be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
- Appropriate solvents or dispersion media may contain, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils.
- the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- the prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars or sodium chloride. Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin. [00173] Sterile injectable solutions may be prepared by incorporating the active compounds in an appropriate amount into a solvent along with any other ingredients (for example as enumerated above) as desired, followed by filtered sterilization.
- any other ingredients for example as enumerated above
- dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the desired other ingredients, e.g., as enumerated above.
- a sterile vehicle which contains the basic dispersion medium and the desired other ingredients, e.g., as enumerated above.
- the preferred methods of preparation include vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient(s) plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- the compositions of the present disclosure are formulated in a neutral or salt form.
- Pharmaceutically acceptable salts include, for example, acid addition salts (formed with the free amino groups of the protein) derived from inorganic acids (e.g., hydrochloric or phosphoric acids, or from organic acids (e.g., acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups of the protein can also be derived from inorganic bases (e.g., sodium, potassium, ammonium, calcium, or ferric hydroxides) or from organic bases (e.g., isopropylamine, trimethylamine, histidine, procaine) and the like. [00175] Upon formulation, solutions are preferably administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective.
- inorganic acids e.g., hydrochloric or phosphoric acids, or from organic acids (e.g., acetic, oxalic, tartaric, mandelic, and the like.
- the formulations may easily be administered in a variety of dosage forms such as injectable solutions, drug release capsules and the like.
- parenteral administration in an aqueous solution for example, the solution generally is suitably buffered and the liquid diluent first rendered isotonic for example with sufficient saline or glucose.
- aqueous solutions may be used, for example, for intravenous, intramuscular, subcutaneous and intraperitoneal administration.
- sterile aqueous media are employed as is known to those of skill in the art, particularly in light of the present disclosure.
- a single dose may be dissolved in 1 ml of isotonic NaCl solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion, (see for example, "Remington's Pharmaceutical Sciences” 15th Edition, pages 1035-1038 and 1570-1580).
- Some variation in dosage will necessarily occur depending on the condition of the subject being treated.
- the person responsible for administration will, in any event, determine the appropriate dose for the individual subject.
- preparations should meet sterility, pyrogenicity, general safety and purity standards as required by FDA Office of Biologics standards.
- the nucleotide editing Cas9 and sgRNAs described herein may be delivered to the patient using adoptive cell transfer (ACT).
- adoptive cell transfer one or more expression constructs are provided ex vivo to cells which have originated from the patient (autologous) or from one or more individual(s) other than the patient (allogeneic). The cells are subsequently introduced or reintroduced into the patient.
- one or more nucleic acids encoding nucleotide editing Cas9 and a guide RNA that targets a CaMKII ⁇ splice site are provided to a cell ex vivo before the cell is introduced or reintroduced to a patient.
- nucleotide editing Cas9 refers to a Cas9 protein fused to a base editor.
- Non-limiting examples of Cas9 include SpCas9, SpCas9-NG, SpRY, SaCas9, SaCas9-KKH, SauCas9, and SlugCas9.
- Non limiting examples of a base editor include ABEmax, ABE8e, ABE8eV106W, ABE8.20-m.
- polynucleotide refers to all forms of nucleic acid, oligonucleotides, including deoxyribonucleic acid (DNA) and ribonucleic acid (RNA) and polymers thereof.
- Polynucleotides include genomic DNA, cDNA and antisense DNA, and spliced or unspliced mRNA, rRNA, tRNA and inhibitory DNA or RNA (RNAi, e.g., small or short hairpin (sh)RNA, microRNA (miRNA), small or short interfering (si)RNA, trans-splicing RNA, or antisense RNA).
- RNAi e.g., small or short hairpin (sh)RNA, microRNA (miRNA), small or short interfering (si)RNA, trans-splicing RNA, or antisense RNA.
- Polynucleotides can include naturally occurring, synthetic, and intentionally modified or altered polynucleotides (e.g., variant nucleic acid). Polynucleotides can be single stranded, double stranded, or triplex, linear or circular, and can be of any suitable length. In discussing polynucleotides, a sequence or structure of a particular polynucleotide may be described herein according to the convention of providing the sequence in the 5 ⁇ to 3 ⁇ direction.
- a nucleic acid “backbone” can be made up of a variety of linkages, including one or more of sugar-phosphodiester linkages, peptide-nucleic acid bonds (“peptide nucleic acids” or PNA; PCT No.
- Sugar moieties of a nucleic acid can be ribose, deoxyribose, or similar compounds with substitutions, e.g., 2’ methoxy or 2’ halide substitutions.
- Nitrogenous bases can be conventional bases (A, G, C, T, U), analogs thereof (e.g., modified uridines such as 5- methoxyuridine, pseudouridine, or N1-methylpseudouridine, or others); inosine; derivatives of purines or pyrimidines (e.g., N 4 -methyl deoxyguanosine, deaza- or aza-purines, deaza- or aza- pyrimidines, pyrimidine bases with substituent groups at the 5 or 6 position (e.g., 5- methylcytosine), purine bases with a substituent at the 2, 6, or 8 positions, 2-amino-6- methylaminopurine, O 6 -methylguanine, 4-thio-pyrimidines, 4-amino-pyrimidines, 4- dimethylhydrazine-pyrimidines, and O 4 -alkyl-pyrimidines; U.S.
- modified uridines such as 5- methoxyuridine, pseudour
- Nucleic acids can include one or more “abasic” residues where the backbone includes no nitrogenous base for position(s) of the polymer (U.S. Patent 5,585,481).
- a nucleic acid can comprise only conventional RNA or DNA sugars, bases and linkages, or can include both conventional components and substitutions (e.g., conventional bases with 2’ methoxy linkages, or polymers containing both conventional bases and one or more base analogs).
- Nucleic acid includes “locked nucleic acid” (LNA), an analogue containing one or more LNA nucleotide monomers with a bicyclic furanose unit locked in an RNA mimicking sugar conformation, which enhance hybridization affinity toward complementary RNA and DNA sequences (Vester and Wengel, 2004, Biochemistry 43(42):13233-41).
- LNA locked nucleic acid
- RNA and DNA have different sugar moieties and can differ by the presence of uracil or analogs thereof in RNA and thymine or analogs thereof in DNA.
- a nucleic acid encoding a polypeptide often comprises an open reading frame that encodes the polypeptide. Unless otherwise indicated, a particular nucleic acid sequence also includes degenerate codon substitutions.
- Nucleic acids can include one or more expression control or regulatory elements operably linked to the open reading frame, where the one or more regulatory elements are configured to direct the transcription and translation of the polypeptide encoded by the open reading frame in a mammalian cell.
- expression control/regulatory elements include transcription initiation sequences (e.g., promoters, enhancers, a TATA box, and the like), translation initiation sequences, mRNA stability sequences, poly A sequences, secretory sequences, and the like.
- Expression control/regulatory elements can be obtained from the genome of any suitable organism.
- AAV refers to an adeno-associated virus vector.
- AAV refers to any AAV serotype and variant, including but not limited to an AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAVrh10 (see, e.g., SEQ ID NO: 81 of US 9,790,472, which is incorporated by reference herein in its entirety), AAVrh74 (see, e.g., SEQ ID NO: 1 of US 2015/0111955, which is incorporated by reference herein in its entirety), AAV9 vector, AAV9P vector (also known as AAVMYO, see, Weinmann et al., 2020, Nature Communications, 11:5432), and Myo-AAV vectors described in Tabebordbar et al., 2021, Cell, 184:1-20 (e.g., MyoAAV 1A, 2A, 3A, 4A, 4C, or 4E) , wherein the number following AAV indicates the AAV serotype.
- AAV can also refer to any known AAV (vector) system.
- the AAV vector is a single-stranded AAV (ssAAV).
- the AAV vector is a double-stranded AAV (dsAAV).
- AAVs are small (25 nm), single-DNA stranded non-enveloped viruses with an icosahedral capsid.
- Naturally occurring or engineered AAV serotypes and variants that differ in the composition and structure of their capsid protein have varying tropism, i.e., ability to transduce different cell types. When combined with active promoters, this tropism defines the site of gene expression.
- “Guide RNA”, “guide RNA”, and simply “guide” are used herein interchangeably to refer to either a crRNA (also known as CRISPR RNA), or the combination of a crRNA and a trRNA (also known as tracrRNA).
- the crRNA and trRNA may be associated as a single RNA molecule (single guide RNA, sgRNA) or in two separate RNA molecules (dual guide RNA, dgRNA).
- sgRNA single guide RNA
- dgRNA dual guide RNA
- “Guide RNA” or “guide RNA” refers to each type.
- the trRNA may be a naturally occurring sequence, or a trRNA sequence with modifications or variations compared to naturally occurring sequences.
- guide RNA or “guide” as used herein, and unless specifically stated otherwise, may refer to an RNA molecule (comprising A, C, G, and U nucleotides) or to a DNA molecule encoding such an RNA molecule (comprising A, C, G, and T nucleotides) or complementary sequences thereof.
- RNA molecule comprising A, C, G, and U nucleotides
- DNA molecule comprising A, C, G, and T nucleotides
- the U residues in any of the RNA sequences described herein may be replaced with T residues
- the T residues may be replaced with U residues.
- Target sequences for Cas9s include both the positive and negative strands of genomic DNA (i.e., the sequence given and the sequence’s reverse complement), as a nucleic acid substrate for a Cas9 is a double stranded nucleic acid. Accordingly, where a guide sequence is said to be “complementary to a target sequence”, it is to be understood that the guide sequence may direct a guide RNA to bind to the reverse complement of a target sequence. Thus, in some embodiments, where the guide sequence binds the reverse complement of a target sequence, the guide sequence is identical to certain nucleotides of the target sequence (e.g., the target sequence not including the PAM) except for the substitution of U for T in the guide sequence.
- a “promoter” refers to a nucleotide sequence, usually upstream (5') of a coding sequence, which directs and/or controls the expression of the coding sequence by providing the recognition for RNA polymerase and other factors required for proper transcription. "Promoter” includes a minimal promoter that is a short DNA sequence comprised of a TATA-box and optionally other sequences that serve to specify the site of transcription initiation, to which regulatory elements are added for control of expression. [00185] An “enhancer” is a DNA sequence that can stimulate transcription activity and may be an innate element of the promoter or a heterologous element that enhances the level or tissue specificity of expression.
- Promoters and/or enhancers may be derived in their entirety from a native gene or be composed of different elements derived from different elements found in nature, or even be comprised of synthetic DNA segments.
- a promoter or enhancer may comprise DNA sequences that are involved in the binding of protein factors that modulate/control effectiveness of transcription initiation in response to stimuli, physiological or developmental conditions.
- Non-limiting examples include SV40 early promoter, mouse mammary tumor virus LTR promoter; adenovirus major late promoter (Ad MLP); a herpes simplex virus (HSV) promoter, a cytomegalovirus (CMV) promoter such as the CMV immediate early promoter region (CMVIE), a rous sarcoma virus (RSV) promoter, pol II promoters, pol III promoters, synthetic promoters, hybrid promoters, and the like.
- sequences derived from non-viral genes such as the murine metallothionein gene, will also find use herein.
- Exemplary constitutive promoters include the promoters for the following genes which encode certain constitutive or “housekeeping” functions: hypoxanthine phosphoribosyl transferase (HPRT), dihydrofolate reductase (DHFR), adenosine deaminase, phosphoglycerol kinase (PGK), pyruvate kinase, phosphoglycerol mutase, the actin promoter, and other constitutive promoters known to those of skill in the art.
- HPRT hypoxanthine phosphoribosyl transferase
- DHFR dihydrofolate reductase
- PGK phosphoglycerol kinase
- pyruvate kinase phosphoglycerol mutase
- actin promoter and other constitutive promoters known to those of skill in the art.
- many viral promoters function constitutively in eukaryotic cells.
- a “transgene” is used herein to conveniently refer to a nucleic acid sequence/polynucleotide that is intended or has been introduced into a cell or organism.
- Transgenes include any nucleic acid, such as a gene that encodes an inhibitory RNA or polypeptide or protein, and are generally heterologous with respect to naturally occurring AAV genomic sequences.
- the term “transduce” refers to introduction of a nucleic acid sequence into a cell or host organism by way of a vector (e.g., a viral particle). Introduction of a transgene into a cell by a viral particle can therefore be referred to as “transduction” of the cell.
- the transgene may or may not be integrated into genomic nucleic acid of a transduced cell.
- an introduced transgene becomes integrated into the nucleic acid (genomic DNA) of the recipient cell or organism it can be stably maintained in that cell or organism and further passed on to or inherited by progeny cells or organisms of the recipient cell or organism. Finally, the introduced transgene may exist in the recipient cell or host organism extrachromosomally, or only transiently.
- a “transduced cell” is therefore a cell into which the transgene has been introduced by way of transduction.
- a “transduced” cell is a cell into which, or a progeny thereof in which a transgene has been introduced.
- a transduced cell can be propagated, transgene transcribed and the encoded inhibitory RNA or protein expressed.
- a transduced cell can be in a mammal.
- a nucleic acid/transgene is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence.
- a nucleic acid/transgene encoding an RNAi or a polypeptide, or a nucleic acid directing expression of a polypeptide may include an inducible promoter, or a tissue-specific promoter for controlling transcription of the encoded polypeptide.
- a nucleic acid operably linked to an expression control element can also be referred to as an expression cassette.
- modify or “variant” and grammatical variations thereof, mean that a nucleic acid, polypeptide or subsequence thereof deviates from a reference sequence. Modified and variant sequences may therefore have substantially the same, greater or less expression, activity or function than a reference sequence, but at least retain partial activity or function of the reference sequence.
- a particular type of variant is a mutant protein, which refers to a protein encoded by a gene having a mutation, e.g., a missense or nonsense mutation.
- CRISPR system refers collectively to transcripts and other elements involved in the expression of or directing the activity of CRISPR-associated (“Cas”) genes, including sequences encoding a Cas gene, a tracr (trans-activating CRISPR) sequence (e.g., tracrRNA or an active partial tracrRNA), a tracr-mate sequence (encompassing a “direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a “spacer” in the context of an endogenous CRISPR system), and/or other sequences and transcripts from a CRISPR locus.
- a tracr trans-activating CRISPR
- tracr-mate sequence encompassing a “direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system
- guide sequence also referred to as a “spacer” in the context of an endogenous CRIS
- a “spacer sequence,” sometimes also referred to herein and in the literature as a “spacer,” “protospacer,” “guide sequence,” or “targeting sequence” refers to a sequence within a guide RNA that is complementary to a target sequence and functions to direct a guide RNA to a target sequence for cleavage by a Cas9.
- spacer sequence refers to an RNA molecule (comprising A, C, G, and U nucleotides) or to a DNA molecule encoding such an RNA molecule (comprising A, C, G, and T nucleotides) or complementary sequences thereof.
- a “nucleic acid” or “polynucleotide” variant refers to a modified sequence which has been genetically altered compared to wild-type. The sequence may be genetically modified without altering the encoded protein sequence. Alternatively, the sequence may be genetically modified to encode a variant protein.
- a nucleic acid or polynucleotide variant can also refer to a combination sequence which has been codon modified to encode a protein that still retains at least partial sequence identity to a reference sequence, such as wild-type protein sequence, and also has been codon-modified to encode a variant protein. For example, some codons of such a nucleic acid variant will be changed without altering the amino acids of a protein encoded thereby, and some codons of the nucleic acid variant will be changed which in turn changes the amino acids of a protein encoded thereby. [00195]
- the terms “protein” and “polypeptide” are used interchangeably herein.
- polypeptides encoded by a “nucleic acid” or “polynucleotide” or “transgene” disclosed herein include partial or full-length native sequences, as with naturally occurring wild-type and functional polymorphic proteins, functional subsequences (fragments) thereof, and sequence variants thereof, so long as the polypeptide retains some degree of function or activity. Accordingly, in methods and uses of the disclosure, such polypeptides encoded by nucleic acid sequences are not required to be identical to the endogenous protein that is defective, or whose activity, function, or expression is insufficient, deficient or absent in a treated mammal. [00196] An example of an amino acid modification is a conservative amino acid substitution or a deletion.
- a modified or variant sequence retains at least part of a function or activity of the unmodified sequence (e.g., wild-type sequence).
- Another example of an amino acid modification is a targeting peptide introduced into a capsid protein of a viral particle. Peptides have been identified that target recombinant viral vectors or nanoparticles to various organs and tissues.
- a “variant” of a molecule is a sequence that is substantially similar to the sequence of the native molecule. For nucleotide sequences, variants include those sequences that, because of the degeneracy of the genetic code, encode the identical amino acid sequence of the native protein.
- Naturally occurring allelic variants such as these can be identified with the use of molecular biology techniques, as, for example, with polymerase chain reaction (PCR) and hybridization techniques.
- Variant nucleotide sequences also include synthetically derived nucleotide sequences, such as those generated, for example, by using site- directed mutagenesis, which encode the native protein, as well as those that encode a polypeptide having amino acid substitutions.
- nucleotide sequence variants of the disclosure will have at least 40%, 50%, 60%, to 70%, e.g., 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, to 79%, generally at least 80%, e.g., 81%-84%, at least 85%, e.g., 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, to 98%, sequence identity to the native (endogenous) nucleotide sequence.
- the variant is biologically functional (i.e., retains 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% of activity or function of wild-type).
- “Conservative variations” of a particular nucleic acid sequence refers to those nucleic acid sequences that encode identical or essentially identical amino acid sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given polypeptide. For instance, the codons CGT, CGC, CGA, CGG, AGA and AGG all encode the amino acid arginine.
- nucleic acid variations are “silent variations,” which are one species of “conservatively modified variations.” Every nucleic acid sequence described herein that encodes a polypeptide also describes every possible silent variation, except where otherwise noted.
- each codon in a nucleic acid except ATG, which is ordinarily the only codon for methionine
- each “silent variation” of a nucleic acid that encodes a polypeptide is implicit in each described sequence.
- polynucleotide sequences means that a polynucleotide comprises a sequence that has at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, or 79%, or at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, or 89%, or at least 90%, 91%, 92%, 93%, or 94%, or even at least 95%, 96%, 97%, 98%, or 99% sequence identity, compared to a reference sequence using one of the alignment programs described using standard parameters.
- substantially identical in the context of a polypeptide indicates that a polypeptide comprises a sequence with at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, or 79%, or 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, or 89%, or at least 90%, 91%, 92%, 93%, or 94%, or even, 95%, 96%, 97%, 98% or 99%, sequence identity to the reference sequence over a specified comparison window.
- An indication that two polypeptide sequences are identical is that one polypeptide is immunologically reactive with antibodies raised against the second polypeptide.
- a polypeptide is identical to a second polypeptide, for example, where the two peptides differ only by a conservative substitution.
- treatment refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent, inhibit, reduce, or decrease an undesired physiological change or disorder, such as the development, progression or worsening of the disorder.
- beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilizing a (i.e., not worsening or progressing) symptom or adverse effect of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
- Treatment can also mean prolonging survival as compared to expected survival if not receiving treatment.
- Those in need of treatment include those already with the condition or disorder as well as those predisposed (e.g., as determined by a genetic assay).
- “a” or “an” may mean one or more.
- the words “a” or “an” when used in conjunction with the word “comprising,” the words “a” or “an” may mean one or more than one.
- the use of the term “or” in the claims is used to mean “and/or” unless explicitly indicated to refer to alternatives only or the alternatives are mutually exclusive, although the disclosure supports a definition that refers to only alternatives and “and/or.”
- another may mean at least a second or more.
- the term “about” is used to indicate that a value includes the inherent variation of error for the device, the inherent variation in the method being employed to determine the value, the variation that exists among the study subjects, or a value that is within 10% of a stated value.
- essentially free in terms of a specified component, is used herein to mean that none of the specified component has been purposefully formulated into a composition and/or is present only as a contaminant or in trace amounts.
- the total amount of the specified component resulting from any unintended contamination of a composition is therefore well below 0.05%, preferably below 0.01%.
- Most preferred is a composition in which no amount of the specified component can be detected with standard analytical methods. VII. Examples [00207]
- the following examples are included to demonstrate preferred embodiments of the invention. It should be appreciated by those of skill in the art that the techniques disclosed in the examples which follow represent techniques discovered by the inventor to function well in the practice of the invention, and thus can be considered to constitute preferred modes for its practice.
- Example 1 Materials and Methods
- the aim of the present study was to develop a therapeutic approach for cardiac disease by using CRISPR-Cas9 nucleotide base editing.
- the inventors designed a gene editing system to ablate the oxidative activation sites of CaMKII ⁇ , which cause pathological enzyme activation.
- Different editing approaches were first screened in HEK293 cells. The two most efficient sgRNAs were then tested for their biologic effect in human cardiomyocytes derived from induced pluripotent stem cells (iPSCs).
- iPSCs induced pluripotent stem cells
- the inventors then applied the CRISPR-Cas9 base editing system with the best therapeutic in vitro effect to adult mice that were subjected to ischemia/reperfusion (IR) injury.
- IR ischemia/reperfusion
- All experiments were performed in replicates.
- the inventors used eight C57Bl6 mice at 12 weeks of age per group. Mice were randomly assigned to sham surgery or to IR with either no injection, intracardiac injection of a control virus or intracardiac injection of a CaMKII ⁇ editing system. Echocardiography was performed on each mouse before IR as well as 24 hours, one week, two weeks, and three weeks after IR. Cardiac magnetic resonance imaging was performed in five mice per group at four weeks post-IR.
- mice After five weeks, all mice were euthanized, and five out of eight mice per group were dedicated to molecular analyses and three mice to histological analyses. The inventors did not use a statistical test to predetermine the sample size. All samples are included in the study, with no data excluded. Each experimental procedure involving animals has been reviewed and approved by the University of Texas Southwestern Medical Center’s Institutional Animal Care and Use Committee. [00210] Plasmids and cloning. Plas were ordered from Addgene.
- the sgRNAs (listed in Table S1) were cloned into a pmCherry_sgRNA plasmid containing a U6- driven sgRNA scaffold and a cytomegalovirus (CMV)–driven pmCherry fluorescent protein (gift from Ervin Welker, Addgene plasmid #80457, n2t.net/addgene:80457; RRID: Addgene_80457).
- CMV cytomegalovirus
- pCMV_ABEmax_P2A_GFP (Addgene plasmid #112101, n2t.net/addgene:112101, RRID: Addgene_112101) (Koblan et al., 2018), NG-ABEmax (Addgene plasmid #124163, n2t.net/addgene:124163, RRID: Addgene_124163) (Huang et al., 2019), ABE8e (Addgene plasmid #138489, n2t.net/addgene:138489, RRID: Addgene_138489) (Richter et al., 2020), and NG-ABE8e (Addgene #138491, n2t.net/addgene:138491, RRID: Addgene_138491) (Richter et al., 2020) were gifts from David Liu.
- pCMV-T7-ABEmax(7.10)-SpRY-P2A-EGFP was a gift from Benjamin Kleinstiver (Addgene plasmid #140003, n2t.net/addgene:140003, RRID: Addgene_140003) (Walton et al., 2020).
- ABE8e-SpRY was obtained by adapting pCMV-T7-ABEmax(7.10)- SpRY-P2A-EGFP (RTW5025).
- the N- and C-terminal ABE constructs were adapted from Cbh_v5 AAV-ABE N-terminal (gift from David Liu, Addgene plasmid #137177, n2t.net/addgene:137177, RRID: Addgene_137177) (Levy et al., 2020) and Cbh_v5 AAV-ABE C-terminal (gift from David Liu, Addgene plasmid #137178, n2t.net/addgene:137178, RRID: Addgene_137178) (Levy et al., 2020), respectively, to carry ABE8e-SpRY (driven by a cardiac troponin T promoter) and mouse sgRNA6 (driven by a U6 promoter).
- a split-intein trans- splicing system enabled reassembly to a functional ABE system in vivo, as previously described (Chemello et al., 2021).
- Adaptions were performed using oligonucleotides (IDT) or products of PCR amplification of appropriate template sequences with PrimeStar GXL Polymerase (Takara). Oligonucleotides and PCR products were cloned into restriction enzyme-digested vectors using NEBuilder HiFi DNA Assembly (NEB).
- HEK293 (ATCC) and N2a (ATCC) cells were cultured in Dulbecco’s modified Eagle’s medium (Sigma-Aldrich) containing 10% (v/v) fetal bovine serum (GeminiBio). For transfection, cells were plated onto 24-well plates (Corning) with approximately 125,000 cells per well.
- Human iPSC culture and nucleofection Human iPSCs (previously generated and used in the inventors’ laboratory (Chemello et al., 2021)) were maintained on Matrigel (Corning)-coated 6-well polystyrene culture plates in mTeSR TM 1 media (STEMCELL). At 70-80% confluency, they were passaged using Versene (Thermo Fisher Scientific).
- iPSCs Approximately 8x10 5 iPSCs were used for nucleofection experiments and they were subjected to 10 ⁇ M ROCK inhibitor (Y-27632, Selleckchem) one hour earlier. Single cell status was obtained using Accutase (Innovative Cell Technologies).
- the iPSCs were mixed either with 1.5 ⁇ g of pmCherry_sgRNA plasmid carrying sgRNA1 and 4.5 ⁇ g ABE8e plasmid or with 1.5 ⁇ g of pmCherry_sgRNA plasmid carrying sgRNA6 and 4.5 ⁇ g ABE8e- SpRY plasmid.
- P3 Primary Cell 4D-Nucleofector X Kit (Lonza) was used according to the manufacturer’s protocol to nucleofect iPSCs.
- pmCherry and green fluorescent protein (GFP) double-positive cells were collected by fluorescence-activated cell sorting and clonally expanded to establish the M281V (sgRNA1) and MMH281/282/283VVR (sgRNA6) iPSC lines.
- GFP green fluorescent protein
- DirectPCR cell lysis reagent (Viagen) with proteinase K (1 ⁇ g/ ⁇ L) was used according to the manufacturer’s recommendations to isolate genomic DNA of human HEK293 cells, human iPSCs, and mouse N2a cells.
- DNA was amplified using PrimeSTAR GXL DNA polymerase (Takara) with the primers listed in Table S2 and the PCR product was cleaned using ExoSap-IT Express (Thermo Fisher Scientific). The editing efficiency was determined by analyzing the Sanger chromatograms with EditR (Kluesner et al., 2018). [00219] Deep amplicon sequencing analysis.
- Deep amplicon sequencing was used to measure the on-target editing efficiency for CaMKII ⁇ in human iPSCs and in cardiac tissue from mice treated with AAV-ABE-sgRNA6.
- DNeasy Blood & Tissue Kit (Qiagen) was used to isolate genomic DNA.
- TRIzol Thermo Fisher Scientific
- RNeasy Mini Kit Qiagen
- On-target sites for human CaMKII ⁇ DNA, mouse CaMKII ⁇ DNA, and mouse CaMKII ⁇ cDNA were PCR amplified using PrimeStar GXL Polymerase (Takara) with the primers listed in Table S3.
- Illumina flow cell binding sequences and barcodes were added.
- AMPure XP Beads (Beckman Coulter) were used to purify PCR products that were then tested for integrity on a 2200 TapeStation System (Agilent). After quantification of DNA concentration by QuBit dsDNA high-sensitivity assay (Invitrogen), samples were pooled and loaded onto an Illumina MiSeq. After demultiplexing, amplicon reads were analyzed for editing efficiency using CRISPResso2 (Clement et al., 2019). [00220] Off-target analyses.
- Deep amplicon sequencing (described above) was used to measure several important genes for potential off-target editing of ABE8e-SpRY and sgRNA6.
- potential editing of other CaMKII isoforms ( ⁇ , ⁇ , and ⁇ ) was measured in human iPSCs after nucleofection of ABE components using the primers listed in Table S3.
- CRISPOR cutting frequency determination
- the inventors identified the next top eight candidate off-target sites in the human genome (Table S4) and evaluated them in human iPSCs with the primers listed in Table S5 (Concordet & Haeussler, 2018).
- CaMKII ⁇ Besides CaMKII ⁇ , the inventors also measured potential editing of other CaMKII isoforms ( ⁇ , ⁇ , and ⁇ ) in mouse hearts injected with AAV-ABE-sgRNA6. Since targeting CaMKII in organs other than heart may have potentially severe adverse side effects, the inventors tested for off-organ editing in the brain, which expresses all CaMKII isoforms, the tibialis anterior muscle (for CaMKII ⁇ ), and the liver (for CaMKII ⁇ ).
- Editing of CaMKII ⁇ was also analyzed in mice that were injected with a control virus encoding either half of the split adenine base editor (double N- or C-term AAV9) to test whether this was a true control and did not edit CaMKII ⁇ .
- the inventors reported the formal adenine to guanine editing for each adenine along the DNA sequences corresponding to sgRNA6. An allele frequency of 0.2% has previously been used as a cut-off to distinguish from unspecific background guanine signal (Clement et al., 2019). This cut-off is displayed in the graphs and adenines with a guanine level below this threshold are considered as not edited.
- iPSCs were differentiated into cardiomyocytes by subjecting them to CHIR99021 (Selleckchem) in RPMI supplemented with ascorbic acid (50 ⁇ g/mL) and B27 without insulin (RPMI/B27-) for 24 hours (day 0). After that, medium was replaced with RPMI/B27- for 2 days, before replacing it again with RPMI/B27- supplemented with WNT-C59 (Selleckchem). After another 2 days, medium was refreshed with RPMI/B27-. From day 7 onwards, iPSC- cardiomyocytes were cultured in RPMI with ascorbic acid (50 ⁇ g/mL) and B27 (RPMI/B27).
- iPSC-derived cardiomyocytes were maintained in RPMI without glucose and supplemented with 5 mM sodium DL-lactate and CDM3 supplement to metabolically select for cardiomyocytes. After 5 days, medium was replaced with RPMI/B27 and refreshed every 3 days. CMs were analyzed after day 30. For all experiments involving iPSC-derived cardiomyocytes, data were collected from at least three independent differentiations. [00225] Simulated ischemia/reperfusion in vitro. Simulated ischemia/reperfusion (IR) with a hypoxia chamber was used to challenge human iPSC-derived cardiomyocytes in vitro, as previously described (Zhang et al., 2021).
- IR Simulated ischemia/reperfusion
- RPMI/B27 Regular cardiomyocyte culture medium
- ischemia Esumi buffer 117 mM NaCl, 12 mM KCl, 0.9 mM CaCl 2 , 0.49 mM MgCl 2 , 4 mM HEPES, 20 mM sodium lactate, and 5.6 mM 2-deoxyglucose at pH 6.2
- cardiomyocytes were placed in a MIC-101 Modular Incubator Chamber at 37° C (Billups-Rothenberg). Cardiomyocytes were subjected to simulated ischemia (95% N 2 and 5% CO 2 ) for five hours.
- control cardiomyocytes were exposed to normoxia control medium (137 mM NaCl, 3.8 mM KCl, 0.9 mM CaCl 2 , 0.49 mM MgCl 2 , 4 mM HEPES, and 5.6 mM D-glucose at pH 7.4). After five hours, ischemia and normoxia buffers were replaced with fresh culture medium (RPMI/B27). Cells were placed in a regular cell culture incubator for 14 hours reperfusion and were then analyzed. [00226] Western blot analysis. Western blot analysis was performed using either iPSC-derived cardiomyocytes or snap-frozen hearts that were pulverized with a tissue crusher.
- Proteins were isolated using RIPA buffer (Sigma-Aldrich) supplemented with protease- and phosphatase-inhibitors (Roche). Sonication with a Bioruptor Pico (Diagenode, 10 cycles of 30 s sonication on and 30 s off) was used to break genomic DNA. Samples were then centrifuged for 15 min at 10,000 x g at 4o C and supernatant was stored at -80o C. Protein concentration was measured with a BCA assay (Thermo Fisher Scientific) and equal amounts of protein were loaded on a Mini-PROTEAN® TGXTM gel (Bio-Rad).
- Proteins were transferred on a polyvinylidene fluoride membrane (Millipore), blocked in 5% milk in TBS- Tween 0.1% and incubated at 4o C overnight with the primary antibody: rabbit polyclonal anti- oxCaMKII (1:1,000, Sigma-Aldrich, catalog number 07-1387), rabbit polyclonal anti- pCaMKII (1:1,000, Invitrogen, catalog number PA5-37833), mouse monoclonal anti-CaMKII (1:1,000, BD Biosciences, catalog number 611293), rabbit polyclonal anti-pRyR2 (at serine 2814, 1:1,000, Badrilla, catalog number A010-31AP), rabbit polyclonal anti-RyR2 (1:1,000, Sigma-Aldrich, catalog number HPA020028), and mouse monoclonal anti-GAPDH (1:1,000, Sigma-Aldrich, catalog number MAB374).
- rabbit polyclonal anti- oxCaMKII (1
- Proteins were isolated in 1% (v/v) Triton X-100, 20 mM Tris, 100 mM NaCl supplemented with protease- and phosphatase-inhibitors (Roche) at a pH of 7.4. After centrifugation for 15 min at 10,000 x g at 4o C, the supernatant was collected. Equal volumes were loaded to the CycLex® CaM-kinase II assay kit (MBL International Corporation) that was performed according to the manufacturer’s recommendations and absorbance at 450 nm was measured with a CLARIOstar microplate reader (BMG LABTECH).
- iPSC-derived cardiomyocytes were replated on a glass bottom microwell dish (MatTek Corporation) to a single cell density and were cultured for one week in RPMI/B27 to acclimate and reach a steady-state status.
- cardiomyocytes were loaded with 5 ⁇ M Fura- 2 AM (20 min at 37o C, Invitrogen) and were mounted on an inverted microscope (Motic AE31E).
- Ca 2+ dynamics was measured using a fluorescence detection system (IonOptix) and Fura-2 fluorescence emission ratio was obtained by alternating excitation at 340 nm and 380 nm (switching rate 1,000 Hz).
- mice Male C57Bl6 wildtype mice (Charles River) were housed in a standard mouse facility with a regular 12-hour light/dark cycle and received standard chow (2916 Teklad Global). At 12 weeks of age, ischemia/reperfusion (IR) surgery was performed in mice anesthetized with Ketamine/Xylazine complex, intubated, and ventilated with a MiniVent mouse ventilator (Hugo Sachs Elektronik, 105 breaths per minute, 250 ⁇ L stroke volume). Using a rectal probe, mouse body temperature was monitored and kept close to 37.0° C. All surgeries were performed by the same experienced surgeon in a standardized manner.
- IR ischemia/reperfusion
- mice were injected with 7.5x10 11 vg/kg bodyweight of each N- and C-term AAV9, resulting in a total virus amount of 1.5x10 12 vg/kg bodyweight.
- the intracardiac injections (single bolus of 30 ⁇ L volume) were performed by the mouse surgeon, who was blinded to the content of liquid. Eight more mice were subjected to IR injury without any injection and another eight mice were subjected to 45 min open chest without IR and without injection (sham). After that, the chest was carefully closed in layers and the mice were allowed to recover.
- Adeno-associated virus serotype-9 was produced by the Boston Children’s Hospital Viral Core.
- AAV9 vectors were purified and then concentrated with a Millipore Amicon filter unit (UFC910008, 100 kDa). Quantitative real-time PCR assays were used to measure AAV9 titers.
- Transthoracic echocardiography Cardiac function was assessed in conscious mice using two-dimensional transthoracic echocardiography (VisualSonics Vevo2100 imaging system). M-mode traces were acquired, and analysis is based on the average of three consecutive heart beats.
- LVIDd Left ventricular end-diastolic
- LVIDs end-systolic
- Heart rate was calculated based on the interval of three consecutive heart beats. Echocardiography was performed one week before the IR injury as well as 24 hours, one week, two weeks, and three weeks after the IR. Each echocardiography was performed and analyzed by the same experienced operator blinded to the study. [00233] Magnetic resonance imaging.
- MRI Cardiac magnetic resonance imaging
- the FastQC tool (version 0.11.8) was used for quality control to determine low quality and adaptor portion of the reads for trimming.
- Trimmomatic (version 0.39) was used for read-trimming and trimmed reads were aligned to the mouse reference genome (mm10) using HiSAT2 (version 2.1.0, default settings).
- Count matrix for each sample was produced by counting aligned reads using featureCounts (version 1.6.2) and raw count matrix was used for differential gene expression analysis using DESeq package (version 1.38.0) in R (version 3.5.1).
- PCA principal component analysis
- the raw counts of all samples were normalized using the rlog function in R. The normalized values were then used as input for the prcomp function.
- the calculated PC1 and PC2 scores were visualized in a scatter plot using the ggplot2 package.
- Analysis of enriched gene sets was performed using Metascape (/metascape.org/) with the upregulated or downregulated genes as input (Zhou et al., 2019).
- the average percentage of adenine (A) to inosine (I) editing among adenosines in the transcriptome-wide sequencing analysis was obtained by using a previously described strategy (Koblan et al., 2021). The percentage of editing in each sample was quantified using REDItools2.
- the inventors removed all nucleotides except adenosines and filtered the remaining adenosines with a read coverage of less than 10 or a read quality score below 25 to avoid errors due to a low sampling or sequencing quality.
- the percentage of the transcriptome-wide A-to-I editing was calculated by dividing the number of A-to-I conversions in each sample by the total number of adenosines in the inventors’ dataset after filtering. [00237] Histology and Immunohistochemistry.
- mice were dissected out and cleaned in phosphate-buffered saline (PBS) containing cardioplegic 0.2 M KCl for 5 minutes before fixating in 10% neutral-buffered formalin (Sigma-Aldrich) overnight at room temperature. Then, samples were dehydrated in 70% ethanol and embedded in paraffin. Transverse cross- sections 1,500 ⁇ m below the expected normoxic myocardium were used for analyses. Sections were mounted on slides and subjected to trichrome and picrosirius red staining and images were captured at 10x magnification on a BZ-X700 microscope (Keyence).
- the fibrotic tissue was quantified in ImageJ by dividing the collagen positive area by the total area of the cross- section.
- Terminal deoxynucleotidyltransferase-mediated UTP end label (TUNEL) staining for apoptotic cells and immunohistochemical staining for troponin I were done on the same section. Sections were deparaffinized in xylene, run to water through graded ethanol, and antigen retrieval was conducted for 20 min heating in 1 mM EDTA (pH 8.0). Sections were further treated with 0.3% Triton X-100 and interceding PBS washes were performed throughout the protocol, before blocking with 3% normal goat serum.
- mice were acclimated to the treadmill by three 10 min sessions with a velocity set to 0, 5, and 10 m/min for the first, second, and third day, respectively.
- the treadmill was inclined to 10° and the electric shock grid at the rear end was turned on (frequency of 3 Hz, stimulation intensity of 10).
- mice were first subjected to a warm-up of 10 m/min for 2 min. The inventors then set the velocity to 15 m/min that was accelerated at a rate of 0.6 m/min per minute until the mouse was exhausted. Exhaustion was defined by continuous standing for 5 s on the shock grid, which was evaluated by the same observer for all experiments.
- ABE CRISPR-Cas9 adenine base editing
- the inventors used the technology to disrupt a pathological signaling pathway, offering a potential therapeutic approach for cardiac disease.
- the inventors used HEK293 cells to screen six different single guide RNAs (sgRNAs; Table S1) that covered the genomic region encoding methionines 281 (adenine at nucleotide position c.841) and 282 (adenine at nucleotide position c.844).
- sgRNAs single guide RNAs
- the sgRNAs were tested with two adenine base editors, ABEmax and ABE8e, in which the engineered deaminases were fused to either SpCas9 nickase or its variant SpRY nickase (Richter et al., 2020; Koblan et al., 2018; Walton et al., 2020). Sanger sequencing revealed that sgRNA1 combined with ABE8e-SpCas9 had the highest efficiency for editing c.A841G (p.M281V), without editing c.A844 (p.M282).
- sgRNA6 combined with ABE8e-SpRY showed a broader editing window, editing c.A841G (p.M281V), c.A844G (p.M282V), and c.A848G (p.H283R; Figs. 5A-D and Table 6).
- the inventors validated the sgRNA1 + ABE8e-SpCas9 and sgRNA6 + ABE8e-SpRY editing strategies in human induced pluripotent stem cells (iPSCs) using nucleofection and observed the same editing pattern seen in HEK293 cells (Figs.1B-D).
- the two oxidation-sensitive methionines of human CaMKII ⁇ are encoded by exon 11 of the CaMKII ⁇ gene, which shares 79% nucleotide homology with CaMKII ⁇ and 76% nucleotide homology with CaMKII ⁇ .
- the sgRNA6 sequence shared 85% homology with CaMKII ⁇ and CaMKII ⁇ (Fig. 6B).
- the inventors used deep amplicon sequencing to validate the specificity of ABE genomic editing of CaMKII ⁇ with sgRNA6 + ABE8e-SpRY.
- human iPSCs the inventors observed no genomic changes of the CaMKII ⁇ or CaMKII ⁇ genes (Fig. 6C and D and Table 7).
- sgRNA6 has sequence identity with the human CaMKII ⁇ gene, and sequencing analysis showed the human CaMKII ⁇ gene was edited by sgRNA6.
- CaMKII ⁇ is not expressed in human cardiomyocytes, so genomic editing of the CaMKII ⁇ gene in the heart would be inconsequential (Figs.6E-F) (Zhang & Brown, 2004).
- CRISPOR CRISPOR to identify the top eight potential off-target sites (Table S4) (Concordet & Haeussler, 2018). Sequence analysis showed adenine to guanine editing only in the DAZL gene at the adenine base 13 nucleotides upstream from the protospacer adjacent motif (PAM; Fig. 6G and Tables 8 and 9).
- iPSC-CMs cardiomyocytes
- WT iPSC-CMs showed an increase in CaMKII oxidation, as measured by Western blot with an antibody that specifically recognizes oxidized CaMKII, whereas CaMKII oxidation was strongly reduced in sgRNA1 iPSC-CMs and sgRNA6 iPSC-CMs (Figs.1E-F; Fig.7A). WT iPSC-CMs showed a dramatic increase in CaMKII autophosphorylation and activity post-IR, which was both reduced in sgRNA1 and sgRNA6 edited iPSC-CMs (Figs. 1E, 1G, and 1H).
- iPSC-CMs ryanodine receptor type 2 (RyR2) at serine 2814 in WT but not in sgRNA1 or sgRNA6 iPSC-CMs post-IR (Figs.1I-J; Figs. 7A-E).
- Function of iPSC-CMs was assessed by measuring cellular Ca 2+ transients using epifluorescence microscopy. After IR, WT iPSC- CMs showed an increase in diastolic Ca 2+ levels, a decrease in Ca 2+ transient amplitude, and arrhythmias (Figs. 1K-L; Figs. 8A-D).
- iPSC-CMs edited with sgRNA1 and sgRNA6 were protected from deleterious Ca 2+ alterations post-IR.
- CaMKII ⁇ editing in mice subjected to IR injury Since editing with sgRNA6 conferred greater protection to iPSC-CMs than with sgRNA1, the inventors used mouse-sgRNA6 (with 95% homology to human-sgRNA6) and ABE8e-SpRY for base editing to ablate the CaMKII ⁇ oxidative activation sites in vivo in 12-week-old male C57Bl6 mice (Fig.2A and Figs. 9A-C).
- the inventors packaged the ABE components in adeno-associated virus serotype-9 (AAV9) using a split-intein trans-splicing system to accommodate the large size of ABE8e and sgRNA6.
- AAV9 was chosen as the delivery system because it effectively infects the hearts of mice and large mammals (Chemello et al., 2021; Amoasii et al., 2018).
- the inventors used the cardiac troponin T (cTnT) promoter to drive ABE8e expression.
- AAV9 expressing sgRNA6 and ABE8e-SpRY was injected (7.5x10 11 viral genomes (vg)/kg of each component) directly into the area of cardiac injury (Fig.2A).
- Control mice were subjected to IR with either an injection of control AAV9 or no injection. Sham-treated mice were also subjected to 45 min open-chest surgery. Before IR, all mice exhibited normal cardiac function and similar fractional shortening between the groups, as measured by echocardiography (Fig.2B and Figs.10A-E). As expected, cardiac function decreased 24 hours after IR surgery to a similar extent in all groups (Figs. 11A-E).
- mice administered AAV-ABE-sgRNA6 began to functionally recover, as assessed by echocardiography (Fig.2B and Figs.13A-E). This recovery time is consistent with a previous study showing that genomic editing begins within one week after AAV9 delivery of CRISPR- Cas9 components in vivo (Amoasii et al., 2019).
- AAV-ABE-sgRNA6 edited mice showed further cardiac improvement and attained a level of fractional shortening comparable to that of the sham-treated mice (Figs. 2B-C; Figs. 14A-D).
- left ventricular end-diastolic dilation a hallmark feature of heart failure, was observed after IR in control mice but was not seen post-IR in mice injected with AAV-ABE-sgRNA6 (Fig. 2D).
- cardiac magnetic resonance imaging performed in a subgroup of mice at four weeks post-IR, showed impaired cardiac function in control mice and rescue of cardiac function in mice receiving AAV-ABE-sgRNA6 editing components, similar to the echocardiography findings (Fig.2E, Figs.15A-B).
- Deep amplicon sequencing of DNA revealed an adenine to guanine editing efficiency of 7.6 ⁇ 0.2% (c.A841G, p.M281V), 7.5 ⁇ 0.2% (c.A844G, p.M282V), and 8.4 ⁇ 0.2% (c.A848G, p.H283R) of the genomic DNA, and 46.1 ⁇ 1.1% (c.A841G, p.M281V), 46.1 ⁇ 1.1% (c.A844G, p.M282V), and 46.6 ⁇ 1.0% (c.A848G, p.H283R) at the cDNA level (Fig.3A and Table 7).
- the residual signal of oxidized CaMKII in post-IR mice injected with AAV-ABE-sgRNA6 may either be unedited and oxidized CaMKII ⁇ , oxidized CaMKII ⁇ , or unspecific background. Consistent with the amount of oxidized CaMKII, CaMKII autophosphorylation and activity were increased in control mice post-IR but not in post-IR mice injected with AAV-ABE-sgRNA6 (Fig. 3E and Figs.3G-H; Figs.17A-E).
- RNA sequencing of control and AAV-ABE-sgRNA6 edited hearts revealed three different types of transcriptomes by principal component analysis (Figs. 18A- B). Although the transcriptome changed after IR, no differences were detected between the two different control groups post-IR. However, hearts subjected to IR and CaMKII ⁇ editing had a transcriptome different from control WT mouse hearts and formed a third cluster.
- the inventors identified 211 genes that were differentially expressed in mice subjected to IR with injection of control AAV9 compared to sham-treated mice (Fig.18B).
- Gene ontology analysis of the 163 genes upregulated in IR revealed pathways related to cardiac disease, while pathways associated with the 48 downregulated genes were mainly related to cardiac function (Figs.18C-D).
- the inventors found 101 upregulated and 108 downregulated genes in hearts of mice with edited CaMKII ⁇ (Fig. 3K). Analysis of gene ontology terms revealed that pathways related to cardiac performance and disease, which were dysregulated in control AAV9 mice post-IR, were rescued in CaMKII ⁇ edited mice post-IR (Figs.3L-M).
- the inventors found a dramatic increase in the percentage of apoptotic cells in TUNEL-stained heart sections of mice post-IR compared to heart sections of sham- treated mice (Figs. 4A-B). In contrast to the hearts of control mice post-IR, the number of apoptotic cells in CaMKII ⁇ edited mice was comparable to the hearts of sham-treated mice. The inventors also found a 2.7-fold increase in the area of fibrotic tissue in mice post-IR, while the CaMKII ⁇ edited mice were protected against fibrosis post-IR (Figs.4C-D; figs.19 and 16).
- Table S4 Analysis of potential off target editing sites in the human genome predicted by CRISPOR. [00255] Table S5. Primers for deep amplicon sequencing of potential off target editing sites in the human genome. F d TCGTCGGCAGCGTCAGATGTGTATAAGAGACAGACCATTGCCATTCACCTCAT 74
- CaMKII ⁇ inhibition has previously been proposed as a therapy for cardiac disease, and several CaMKII inhibitors have been tested in preclinical studies (Nassal et al., 2020; Pellicena & Schulman, 2014; Lebek et al., 2018).
- these CaMKII inhibitors face several challenges (Nassal et al., 2020), as some were reported to inhibit other ion channels (for example potassium channels) (Hegyi et al., 2015) and others showed small therapeutic benefit (Nassal et al., 2020; Pellicena & Schulman, 2014; Lebek et al., 2018).
- CaMKII ⁇ inhibitors that are ATP-competitive inhibitors also inhibit other kinases with potential deleterious effects, and other inhibitors are not bioavailable or cell permeable (Nassal et al., 2020; Pellicena & Schulman, 2014).
- Another challenge in using CaMKII ⁇ inhibitors is that CaMKII ⁇ is ubiquitously expressed, and its global inhibition can have adverse effects in tissues other than the heart (Uhlen et al., 2015).
- Another clinical limitation of using CaMKII ⁇ inhibitors is the requirement for daily administration. Using the CRISPR-Cas9 ABE system to edit the genome provides a permanent change to the CaMKII ⁇ gene and overrides many of the above limitations.
- the first therapeutic step after a myocardial infarction is coronary angiography and revascularization of the infarct artery, which requires a catheter that could also be used to deliver CaMKII ⁇ editing components to the infarct artery or to the infarct area (Lawton et al., 2022).
- future studies are needed, including more analyses of the pharmacological profile, optimization of the viral dosage, more studies regarding the toxicity and safety of the treatment (such as potential immunogenicity of the base editor), and assessment of animal long-term survival.
- the inventors analyzed the top eight predicted sites in the human genome for potential off target editing, but a deeper analysis (Musunuru et al., 2021), especially after extended exposure to the base editor, will be required for formal regulatory review. It will also be necessary to analyze the interaction with other drugs and treatments as well as the effectiveness of CaMKII ⁇ editing compared to currently available heart failure medication. Further studies showing a benefit in larger animals such as pigs and non-human primates would also be an important step toward clinical advancement of this approach.
- CRISPR-Cas9 gene editing technology is typically used to correct specific genetic mutations before disease onset (Liu & Olson, 2022; Chemello et al., 2021; Richter et al., 2020; Amoasii et al., 2018; Amoasii et al., 2019; Koblan et al., 2021). Since the total number of patients carrying one specific mutation is usually low, the offered treatment affects only a limited group of patients. CRISPR-Cas9 gene has already been used to knock down wildtype PCSK9 gene in the liver as a strategy for hereditary familial hypercholesterolemia (Musunuru et al., 2021).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- General Health & Medical Sciences (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Medicinal Chemistry (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Virology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Enzymes And Modification Thereof (AREA)
Abstract
L'invention concerne une composition et des procédés d'édition de stress de CaMKIlδ pour réduire ou prévenir l'induction de stress oxydatif dans des cellules humaines et des souris.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202263352804P | 2022-06-16 | 2022-06-16 | |
US63/352,804 | 2022-06-16 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2023245092A2 true WO2023245092A2 (fr) | 2023-12-21 |
WO2023245092A3 WO2023245092A3 (fr) | 2024-02-22 |
Family
ID=89192017
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2023/068480 WO2023245092A2 (fr) | 2022-06-16 | 2023-06-15 | ÉDITION DE STRESS DE CAMKIIδ |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2023245092A2 (fr) |
Family Cites Families (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP3986436A4 (fr) * | 2019-06-18 | 2023-07-19 | Peking University | Antagonistes de camkii-delta 9 et utilisations associées |
EP4097233A4 (fr) * | 2020-01-31 | 2024-02-28 | Univ Massachusetts | Plateforme d'éditeur de base cas9-pdbd ayant une plage de ciblage et une spécificité améliorées |
-
2023
- 2023-06-15 WO PCT/US2023/068480 patent/WO2023245092A2/fr unknown
Also Published As
Publication number | Publication date |
---|---|
WO2023245092A3 (fr) | 2024-02-22 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US9080170B2 (en) | Modified U7 snRNAs for treatment of neuromuscular diseases | |
JP7381494B2 (ja) | 転写調節要素及びその使用 | |
JP2008539698A (ja) | 転写後レベルでの核酸発現調節のための方法および組成物 | |
US20210269828A1 (en) | Vectors for gene delivery that persist within cells | |
Chen et al. | Targeting transgene to the heart and liver with AAV 9 by different promoters | |
US20220193264A1 (en) | Compositions and methods for treating laminopathies | |
KR20220155981A (ko) | 미성숙 종결 코돈-매개 장애를 치료하기 위한 방법 및 조성물 | |
KR20240025507A (ko) | 미성숙 종결 코돈-매개 장애를 치료하기 위한 방법 및 조성물 | |
US20240084334A1 (en) | Serpina-modulating compositions and methods | |
CN114555084A (zh) | 用于治疗SCA1的转基因和内含子衍生miRNA联合疗法 | |
US20240165271A1 (en) | Nucleotide editing to reframe dmd transcripts by base editing and prime editing | |
CN113874513A (zh) | 非病毒dna载体及其用于表达fviii治疗剂的用途 | |
TW202323524A (zh) | Hbb—調節組合物及方法 | |
WO2023245092A2 (fr) | ÉDITION DE STRESS DE CAMKIIδ | |
US20220177878A1 (en) | Crispr/cas9 gene editing of atxn2 for the treatment of spinocerebellar ataxia type 2 | |
US20240076638A1 (en) | Methods and compositions for modulating a genome | |
US20230279398A1 (en) | Treating human t-cell leukemia virus by gene editing | |
US20240093186A1 (en) | Cftr-modulating compositions and methods | |
US20230220361A1 (en) | Crispr-cas9 mediated disruption of alcam gene inhibits adhesion and trans-endothelial migration of myeloid cells | |
US20230390367A1 (en) | Genetic approach to suppress coronaviruses | |
CA3223324A1 (fr) | Edition genomique de mutations de rbm20 | |
CN117980482A (zh) | Rbm20突变的基因组编辑 | |
WO2024097602A2 (fr) | Thérapie génique pour la cardiomyopathie lemd2 | |
WO2021138286A1 (fr) | Système d'administration d'aav auto-complémentaire pour crispr/cas9 | |
JP2023542132A (ja) | Fviii治療薬を発現させるための非ウイルス性dnaベクター及びその使用 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23824809 Country of ref document: EP Kind code of ref document: A2 |