WO2023220747A1 - Nucleic acids encoding a constitutively-active cyclic gmp-amp synthase and immunogenic delivery vehicles for same - Google Patents
Nucleic acids encoding a constitutively-active cyclic gmp-amp synthase and immunogenic delivery vehicles for same Download PDFInfo
- Publication number
- WO2023220747A1 WO2023220747A1 PCT/US2023/066975 US2023066975W WO2023220747A1 WO 2023220747 A1 WO2023220747 A1 WO 2023220747A1 US 2023066975 W US2023066975 W US 2023066975W WO 2023220747 A1 WO2023220747 A1 WO 2023220747A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- composition
- lipid
- mrna
- antigen
- glycero
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/10—Dispersions; Emulsions
- A61K9/127—Synthetic bilayered vehicles, e.g. liposomes or liposomes with cholesterol as the only non-phosphatidyl surfactant
- A61K9/1271—Non-conventional liposomes, e.g. PEGylated liposomes or liposomes coated or grafted with polymers
- A61K9/1272—Non-conventional liposomes, e.g. PEGylated liposomes or liposomes coated or grafted with polymers comprising non-phosphatidyl surfactants as bilayer-forming substances, e.g. cationic lipids or non-phosphatidyl liposomes coated or grafted with polymers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/47—Quinolines; Isoquinolines
- A61K31/4738—Quinolines; Isoquinolines ortho- or peri-condensed with heterocyclic ring systems
- A61K31/4745—Quinolines; Isoquinolines ortho- or peri-condensed with heterocyclic ring systems condensed with ring systems having nitrogen as a ring hetero atom, e.g. phenantrolines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/45—Transferases (2)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/215—Coronaviridae, e.g. avian infectious bronchitis virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/385—Haptens or antigens, bound to carriers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/26—Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
- A61K47/543—Lipids, e.g. triglycerides; Polyamines, e.g. spermine or spermidine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0008—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition
- A61K48/0025—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition wherein the non-active part clearly interacts with the delivered nucleic acid
- A61K48/0041—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition wherein the non-active part clearly interacts with the delivered nucleic acid the non-active part being polymeric
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/50—Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
- A61K9/51—Nanocapsules; Nanoparticles
- A61K9/5107—Excipients; Inactive ingredients
- A61K9/5123—Organic compounds, e.g. fats, sugars
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/88—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation using microencapsulation, e.g. using amphiphile liposome vesicle
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/0018—Culture media for cell or tissue culture
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0639—Dendritic cells, e.g. Langherhans cells in the epidermis
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
- C12N9/1288—Transferases for other substituted phosphate groups (2.7.8)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55516—Proteins; Peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55555—Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6018—Lipids, e.g. in lipopeptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0008—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition
- A61K48/0025—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition wherein the non-active part clearly interacts with the delivered nucleic acid
- A61K48/0033—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition wherein the non-active part clearly interacts with the delivered nucleic acid the non-active part being non-polymeric
Definitions
- the present disclosure relates to compositions for expression of a constitutively-active cyclic GMP-AMP synthase in cells of a mammalian subject and uses thereof for enhancing immunogenicity of mRNA vaccines.
- the mRNA may be encapsulated in a lipid nanoparticle (LNP) or may be complexed with a lipid (RNA-Lipoplex).
- LNP lipid nanoparticle
- RNA-Lipoplex lipid nanoparticle
- the present disclosure also relates to compositions further comprising one or both of a lysophosphatidylcholine (LPC) compound and a pathogen recognition receptor agonist.
- LPC lysophosphatidylcholine
- the present disclosure relates to compositions for expression of a constitutively-active cyclic GMP-AMP synthase in cells of a mammalian subject and uses thereof for enhancing immunogenicity of mRNA vaccines.
- the mRNA may be encapsulated in a lipid nanoparticle (LNP) or may be complexed with a lipid (RNA-Lipoplex).
- LNP lipid nanoparticle
- RNA-Lipoplex lipid nanoparticle
- the present disclosure also relates to compositions further comprising one or both of a lysophosphatidylcholine (LPC) compound and a pathogen recognition receptor agonist.
- LPC lysophosphatidylcholine
- FIG. 1 is an alignment of amino acid sequences of primate cGAS ⁇ N proteins including: human (Homo sapiens, SEQ ID NO:1); Rhesus monkey (Macaca mulatto, SEQ ID NO:2); olive baboon (Papio anubis, SEQ ID NO:3); northern white-cheeked gibbon (Nomascus leucogenys, SEQ ID NO:4); common gibbon (Hylobates lar, SEQ ID NO:5); Sumatran orangutan (Pongo abelii, SEQ ID NO:6); chimpanzee (Pan troglodytes, SEQ ID NO:7); western gorilla (Gorilla, SEQ ID NO:8); and a cGAS ⁇ N consensus sequence (SEQ ID NO:9).
- human Homo sapiens, SEQ ID NO:1
- Rhesus monkey Macaca mulatto, SEQ ID NO:2
- olive baboon Papio anubis, S
- FIG. 2 is a cartoon depicting activation of the stimulator of interferon genes (STING) innate immune signaling pathway by a cyclic GAMP-AMP synthase (cGAS) that has been engineered to be constitutively-active by removal of its amino-terminal phosphoinositidebinding domain.
- cGAS ⁇ N localizes to mitochondria where it binds DNA resulting in the production of cGAMP.
- FIG. 3A-3C depict characteristics of lipid nanoparticles (LNPs) loaded with 22:0 LPC and/or cGAS ⁇ N mRNA.
- FIG. 3A shows that LNPs loaded with 22:0 LPC and/or cGAS ⁇ N mRNA are all less than 150 nm in diameter.
- FIG. 3B shows that mRNA loading efficiency (actual loading compared to theoretical loading) is similar between LNPs loaded with cGAS ⁇ N mRNA alone and LNPs loaded with both cGAS ⁇ N mRNA and 22:0 LPC.
- 3C shows that 22:0 LPC loading efficiency (actual loading compared to theoretical loading) is similar between LNPs loaded with 22:0 LPC alone and LNPs loaded with both cGAS ⁇ N mRNA and 22:0 LPC. Data from LNPs loaded with both cGAS ⁇ N mRNA and 22:0 LPC ([cGAS ⁇ N + 22:0 LPC] LNPs) are shown with diagonal stripes.
- FIG. 4A-4B show that treatment of murine dendritic cells (DCs) with R848 in combination with LNPs loaded with 22:0 LPC leads to hyperactivation, which is defined by the ability of DCs to secrete IL-10 while remaining viable.
- Murine bone marrow-derived dendritic cells (BMDCs) were cultured with controls (PBS or R848) or LNPs with or without R848 for 48 hrs.
- FIG. 4A shows that stimulation of BMDCs with R848 in combination with LNPs loaded with 22:0 LPC ([22:0 LPC] LNPs) or LNPs loaded with both cGAS ⁇ N mRNA and 22:0 LPC ([cGAS ⁇ N + 22:0 LPC] LNPs) induces secretion of IL- 10.
- treatment of BMDCs with LNPs loaded with mRNA encoding cGAS ⁇ N alone ([cGAS ⁇ N] LNPs) or with [cGAS ⁇ N + 22:0 LPC] LNPs was not sufficiently stimulatory for induction of IL-10 secretion.
- 4B shows the viability of BMDCs as determined via measurement of LDH release when cell culture supernatants were collected. Relative to the PBS control, most treatment conditions resulted in relatively similar levels of cell viability, with the exception of treatment with [cGAS ⁇ N + 22:0 LPC] LNPs, which caused a reduction in cell viability. Changes in cytokine secretion as a result of various treatment conditions were compared to treatment with R848 alone. p ⁇ 0.0001****. Statistics were completed using one-way ANOVA with a Tukey post test for multiple comparisons. Data from DCs treated with LNPs loaded with both cGAS ⁇ N mRNA and 22:0 LPC ([cGAS ⁇ N + 22:0 LPC] LNPs) are shown with diagonal stripes.
- FIG. 5A-5C shows the effects of various treatments on cytokine secretion by murine DCs.
- Murine BMDCs were cultured with controls (PBS or R848) or LNPs with or without R848 for 48 hrs.
- FIG. 5A and FIG. 5B show that stimulation of BDMCs with R848 in the presence or absence of other stimuli induces secretion of IL-6 and TNF ⁇ .
- FIG. 5C and FIG. 5D show that stimulation of BMDCs with R848 in the presence or absence of other stimuli induces secretion of RANTES and IP- 10.
- FIG. 6A-6C shows that human monocyte-derived dendritic cells (moDCs) can simultaneously mediate cGAS/STING signaling and hyperactivation.
- Human moDCs were cultured with controls (PBS or R848) or LNPs with or without R848 for 48hrs.
- FIG. 6A shows that moDCs maintained high levels of viability across all treatment conditions, as determined by measurement of LDH release.
- FIG. 6B shows that R848 and 22:0 LPC are required for induction of IL-1 P secretion by moDCs, and that the addition of cGAS ⁇ N mRNA to LNPs was not inhibitory.
- 6C shows that treatment of moDCs with LNPs loaded with cGAS ⁇ N mRNA stimulates IP- 10 secretion even when combined with hyperactivating stimuli R848 and 22:0 LPC. Changes in cytokine secretion as a result of various treatment conditions were compared to treatment with R848 alone. P ⁇ 0.05*, p ⁇ 0.0001****. Statistics were completed using one-way ANOVA with a Tukey post test for multiple comparisons. Data from DCs treated with LNPs loaded with both cGAS ⁇ N mRNA and 22:0 LPC ([cGAS ⁇ N + 22:0 LPC] LNPs) are shown with diagonal stripes.
- FIG. 7A-7C show that cell surface marker expression by human moDCs is maintained or elevated when hyperactivation is combined with cGAS/STING signaling.
- Human moDCs were cultured with controls (PBS or R848) or LNPs with or without R848 for 48 hrs before staining for expression of cell surface proteins involved in DC functions.
- FIG. 7A shows expression of CCR7, a chemokine receptor required for cell migration to lymph nodes, by moDCs as a result of various treatment conditions.
- FIG. 7B shows expression of CD40, a receptor that engages T cell-expressed CD40L during T cell activation and leads to signaling that further enhances T cell activation, by moDCs as a result of various treatment conditions.
- FIG. 7C shows expression of CD83, a marker of DC maturation that is involved T cell activation, by moDCs as a result of various treatment conditions. Changes in cell surface marker expression as a result of various treatment conditions were compared to R848 stimulation alone. P ⁇ 0.05*, p ⁇ 0.01**, ⁇ 0.0001****. Statistics were completed using one-way ANOVA with a Tukey post test for multiple comparisons. Data from DCs treated with LNPs loaded with both cGAS ⁇ N mRNA and 22:0 LPC ([cGAS ⁇ N + 22:0 LPC] LNPs) are shown with diagonal stripes. [0014] FIG.
- FIG. 8A-8D show that expression of antigen presenting and co-stimulatory molecules by human moDCs is maintained or elevated when hyperactivation is combined with cGAS/STING signaling.
- Human moDCs were cultured with controls (PBS or R848) or LNPs with or without R848 for 48 hrs before staining for expression of cell surface proteins involved in DC functions.
- Treatment of moDCs with various combinations of stimuli resulted in an upregulation of CD80 (FIG. 8A) and CD86 (FIG. 8B) co-stimulatory molecules in comparison to the PBS control.
- moDCs maintained high levels of CD80 and CD86 expression when cGAS/STING signaling was combined with hyperactivation.
- HLA-ABC HLA-ABC
- HLA-DR HLA-DR
- cGAS/STING signaling was combined with hyperactivation (R848 + [cGAS ⁇ N + 22:0 LPC] LNPs)
- R848 + [cGAS ⁇ N + 22:0 LPC] LNPs hyperactivation
- Changes in cell surface marker expression as a result of various treatment conditions were compared to R848 stimulation alone. P ⁇ 0.05*, p ⁇ 0.0001****.
- FIG. 9A shows structures of cationic and ionizable lipids suitable for use in the lipid-based mRNA delivery vehicles of the present disclosure.
- FIG. 9B shows structures of other types of lipids suitable for use in the lipid-based mRNA delivery vehicles of the present disclosure. See also, Hou et al., Nature Review Materials, 6: 1078-1094, 2021, which is incorporated herein by reference.
- the present disclosure relates to compositions for expression of a constitutively-active cyclic GMP-AMP synthase in cells of a mammalian subject and uses thereof for enhancing immunogenicity of mRNA vaccines.
- the mRNA may be encapsulated in a lipid nanoparticle (LNP) or may be complexed with a lipid (RNA-Lipoplex).
- LNP lipid nanoparticle
- RNA-Lipoplex lipid nanoparticle
- the present disclosure also relates to compositions further comprising one or both of a lysophosphatidylcholine (LPC) compound and a pathogen recognition receptor agonist.
- LPC lysophosphatidylcholine
- Inducing an inflammatory response can be desirable, such as for an immunotherapy or vaccination.
- COVID-19 mRNA vaccines comprising LNPs loaded with mRNA encoding a SARS-CoV-2 antigen
- COVID-19 mRNA vaccines have proven to be effective at reducing frequency and severity of infections.
- inducing the cGAS-STING innate immune pathway adjuvants compositions comprising LNPs loaded with mRNA encoding a protein antigen, which in exemplary embodiments is ovalbumin (OVA).
- OVA ovalbumin
- STING signaling is of particular interest out of all possible innate immune signaling pathways because, unlike some other signaling pathways, cGAS-STING activation does not induce translation inhibition.
- a cGAS mutant lacking a portion of its N-terminus was designed such that it is constitutively active (cGAS ⁇ N).
- mRNA encoding the cGAS mutant was packaged in an LNP for cellular uptake and protein expression.
- the LNP- packaged mRNA encoding cGAS ⁇ N has the ability to adjuvant an immune response via the cGAS-STING pathway.
- inclusion of mRNA encoding a constitutively active cGAS, such as cGAS ⁇ N increases the potency of LNPs loaded with mRNA encoding an antigen by increasing inflammatory signals.
- an “effective amount” or a “sufficient amount” of a substance is that amount sufficient to effect beneficial or desired results, including clinical results, and, as such, an “effective amount” depends upon the context in which it is being applied. For instance, in the context of administering an immunogenic composition comprising one or more mRNAs encoding an antigen and a constitutively-active cGAS, an effective amount contains sufficient mRNA, to stimulate an immune response against the antigen (e.g., antigen-reactive antibody and/or cellular immune response).
- an immune response against the antigen e.g., antigen-reactive antibody and/or cellular immune response.
- mammals include, but are not limited to, humans, non-human primates (e.g., monkeys), farm animals, sport animals, rodents (e.g., mice and rats), and pets (e.g., dogs and cats).
- the subject is a human patient, such as a human patient suffering from cancer and/or an infectious disease.
- dose refers to a measured portion of the immunogenic composition taken by (administered to or received by) a subject at any one time.
- isolated and purified refers to a material that is removed from at least one component with which it is naturally associated (e.g., removed from its original environment).
- an isolated phospholipid is at least 90%, 95%, 96%, 97%, 98% or 99% pure as determined by thin layer chromatography, or gas chromatography.
- an isolated protein refers to a protein that has been removed from the culture medium of the host cell that produced the protein.
- composition refers to preparations that are in such form as to permit the biological activity of the active ingredient to be effective, and that contain no additional components that are unacceptably toxic to an individual to which the formulation or composition would be administered. Such formulations or compositions are intended to be sterile.
- Excipients include pharmaceutically acceptable excipients, carriers, vehicles or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable excipient is an aqueous pH buffered solution.
- antigen refers to a substance that is recognized and bound specifically by an antibody or by a T cell antigen receptor.
- Antigens can include peptides, polypeptides, proteins, glycoproteins, polysaccharides, complex carbohydrates, sugars, gangliosides, lipids and phospholipids; portions thereof and combinations thereof.
- the term “antigen” typically refers to a polypeptide encoded by a nucleic acid sequence of a mRNA or a DNA.
- Polypeptide antigens are preferably at least eight amino acid residues in length and may comprise one or more post-translational modifications.
- agonist is used in the broadest sense and includes any molecule that activates signaling through a receptor.
- the agonist binds to the receptor.
- a TLR8 agonist binds to a TLR8 and activates a TLR8-signaling pathway.
- Alkyl refers to monovalent saturated aliphatic hydrocarbyl groups.
- Cx alkyl refers to an alkyl group having x number of carbon atoms.
- Cx-Cy alkyl or Cx-y alkyl refers to an alkyl group having between x number and y number of carbon atoms, inclusive.
- Alkylene refers to divalent saturated aliphatic hydrocarbyl groups.
- Cx alkenyl refers to an alkenyl group having x number of carbon atoms.
- Cx-Cy alkenyl or Cx-y alkenyl refers to an alkenyl group having between x number and y number of carbon atoms, inclusive.
- Stimulation of a response or parameter includes eliciting and/or enhancing that response or parameter when compared to otherwise same conditions except for a parameter of interest, or alternatively, as compared to another condition (e.g., increase in TLR-signaling in the presence of a TLR agonist as compared to the absence of the TLR agonist).
- stimulation of an immune response means an increase in the response. Depending upon the parameter measured, the increase may be from 2-fold to 2,000-fold, or from 5-fold to 500-fold or over, or from 2, 5, 10, 50, or 100-fold to 500, 1,000, 2,000, 5,000, or 10,000-fold.
- “inhibition” of a response or parameter includes reducing and/or repressing that response or parameter when compared to otherwise same conditions except for a parameter of interest, or alternatively, as compared to another condition (e.g., decrease in abnormal cell proliferation after administration of a composition of the present disclosure, as compared to the administration of a placebo composition or no treatment).
- “inhibition” of an immune response means a decrease in the response. Depending upon the parameter measured, the decrease may be from 2-fold to 2,000-fold, or from 5-fold to 500-fold or over, or from 2, 5, 10, 50, or 100-fold to 500, 1,000, 2,000, 5,000, or 10,000-fold.
- a “higher level of DC hyperactivation” refers to a level of DC hyperactivation as a consequence of a treatment condition that is at least 2, 3, 4, 5, 6, 7, 8, 9, or 10-fold above a level of DC hyperactivation as a consequence of a control condition.
- a “lower level of DC hyperactivation” refers to a level of DC hyperactivation as a consequence of a treatment condition that is at least 2, 3, 4, 5, 6, 7, 8, 9, or 10-fold below a level of DC hyperactivation as a consequence of a control condition.
- the term “immunization” refers to a process that increases a mammalian subject’s immune response to an antigen and therefore improves its ability to resist or overcome infection and/or resist disease.
- vaccination refers to the introduction of vaccine into a body of a mammalian subject.
- adjuvant refers to a substance which, when added to a composition comprising an antigen or a nucleic acid encoding an antigen, enhances or potentiates an immune response to the antigen in the mammalian recipient upon exposure.
- treating or “treatment” of a disease refer to executing a protocol, which may include administering one or more therapeutic agents to an individual (human or otherwise), in an effort to obtain beneficial or desired results in the individual, including clinical results.
- Beneficial or desired clinical results include, but are not limited to, alleviation or amelioration of one or more signs or symptoms of a disease, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, preventing spread of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total).
- Treatment also can mean prolonging survival as compared to expected survival of an individual not receiving treatment. Further, “treating” and “treatment” may occur by administration of one dose of a therapeutic agent or therapeutic agents, or may occur upon administration of a series of doses of a therapeutic agent or therapeutic agents.
- Treating” or “treatment” does not require complete alleviation of signs or symptoms, and does not require a cure, and specifically includes protocols that have only a palliative effect on the individual. “Palliating” a disease or disorder means that the extent and/or undesirable clinical manifestations of the disease or disorder are lessened and/or time course of progression of the disease or disorder is slowed, as compared to the expected untreated outcome.
- cGAS refers to a cGAS variant that binds to DNA in the cytoplasm and catalyzes cGAMP synthesis even under some conditions in which native cGAS has little to no enzymatic activity.
- the “constitutively-active cGAS” is a “truncated cGAS”, such as cGAS ⁇ N comprising a C-terminal DNA-binding, enzymatic domain in the absence of a N-terminal disordered domain. That is, cGAS ⁇ N is a constitutively-active cGAS devoid of regulation of enzymatic activity imparted by the N-terminal disordered domain of full length cGAS.
- Cyclic GMP-AMP synthase also referred to as cGAMP synthase or cGAS
- cGAMP synthase is an enzymatic sensor of cytosolic DNA.
- cGAS recognizes double-stranded DNA independent of its sequence resulting in dimerization, formation of liquid-like droplets and production of the secondary messenger 2’3’cyclic GMP-AMP (cGAMP), which binds to and activates STING resulting in expression of interferons and other inflammatory mediators.
- Human cGAS is 522 amino acids in length, including a N-terminal phosphoinositide-binding domain (residues 1-59) and a C-terminal DNA-binding and enzymatic domain (residues 160-522) (Barnett et al., Cell, 176: 1432-1446, 2019). Importantly, expression of cGAS ⁇ N in a human leukemia monocytic cell line was found to result in higher levels of expression of interferon and interferon-stimulated genes (Barnett, supra, 2019).
- amino acid sequence of human cGAS (GenBank No. NP 612450.2) is:
- amino acid sequence of the N-terminal domain of cGAS is:
- cGAS ⁇ N The amino acid sequence of the C-terminal domain of cGAS (cGAS ⁇ N) is: PGASKLRAVLEKLKLSRDDISTAAGMVKGVVDHLLLRLKCDSAFRGVGLLNTGSYYEHVKISAPNEFDVM FKLEVPRIQLEEYSNTRAYYFVKFKRNPKENPLSQFLEGEILSASKMLSKFRKIIKEEINDIKDTDVIMK RKRGGSPAVTLLISEKISVDITLALESKSSWPASTQEGLRIQNWLSAKVRKQLRLKPFYLVPKHAKEGNG FQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKFSSYHVK TAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNLFSSNLIDKRSKEFLTKQIE YERNNEFPVFDEF ( SEQ ID NO : 1
- compositions and methods of the present disclosure comprise a nucleic acid encoding a constitutively-active cGAS as a catalytic adjuvant for improving adaptive immune responses elicited by mRNA vaccines.
- the constitutively-active cGAS is a truncated cGAS devoid of the N-terminal phosphoinositide-binding domain (cGAS ⁇ N). In some preferred embodiments, the constitutively-active cGAS is a truncated cGAS comprising the C-terminal DNA-binding and enzymatic domain (cGAS ⁇ N).
- the constitutively-active cGAS is a truncated human cGAS devoid of the N-terminal domain (SEQ ID NO: 11). In some preferred embodiments, the constitutively-active cGAS is a truncated human comprising the C-terminal domain (SEQ ID NO:1). In some preferred embodiments, cGAS ⁇ N comprises the amino acid sequence of SEQ ID NO: 1 or the amino acid sequence that is at least 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
- cGAS ⁇ N comprises the amino acid sequence of SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7 or SEQ ID NO:8, or the amino acid sequence at least 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7 or SEQ ID NO:8.
- cGAS ⁇ N comprises the consensus amino acid sequence of SEQ ID NO:9.
- the nucleic acid encoding cGAS ⁇ N is in operable combination with a start codon (ATG).
- Percent (%) sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- the % sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows: 100 times the fraction X/Y, where X is the number of amino acid residues scored as identical matches by the sequence in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % sequence identity of A to B will not equal the % sequence identity of B to A.
- compositions and methods of the present disclosure may comprise an mRNA encoding an antigen or are otherwise suitable for use with a formulation comprising an mRNA encoding an antigen.
- the antigen is a proteinaceous antigen.
- polypeptide and protein are used interchangeably herein in reference to antigens that comprise peptide chains that are at least 8 amino acids in length.
- the antigen is from 8 to 1800 amino acids, 9 to 1000 amino acids, or 10 to 100 amino acids in length.
- the polypeptide may be post-translationally modified such as by phosphorylation, hydroxylation, sulfonation, palmitoylation, and/or glycosylation.
- the antigen is a tumor antigen that comprises the amino acid sequence of at least one full length protein or fragment thereof.
- the tumor antigen comprises an amino acid sequence or fragment thereof from an oncoprotein.
- the mammalian antigen is a neoantigen or encoded by a gene comprising a mutation relative to the gene present in normal cells from a mammalian subject. Neoantigens are thought to be particularly useful in enabling T cells to distinguish between cancer cells and noncancer cells (see, e.g., Schumacher and Schreiber, Science, 348:69-74, 2015).
- the tumor antigen comprises a viral antigen, such as an antigen of a cancercausing virus.
- the tumor antigen is a fusion protein comprising two or more polypeptides, wherein each polypeptide comprises an amino acid sequence from a different tumor antigen or non-contiguous amino acid sequences from the same tumor antigen.
- the fusion protein comprises a first polypeptide and a second polypeptide, wherein each polypeptide comprises non-contiguous amino acid sequences from the same tumor antigen.
- the antigen is a microbial antigen.
- the microbial antigen comprises a viral antigen, a bacterial antigen, a protozoan antigen, a fungal antigen, or combinations thereof.
- the microbial antigen comprises a surface protein or other antigenic subunit of a microbe.
- the mRNA comprises a 5’ untranslated region (5’UTR) at the 5’ end of the coding region and a 3’ untranslated region (3’UTR) at the 3’ end of the coding region.
- the mRNA comprises one or both of a 5’ cap structure and a poly A tail.
- the mRNA further encodes a ribosome skipping sequence, such as the 2A-like (2AL) sequence set forth as SEQ ID NO: 12. Additional 2AL sequences are set forth in SEQ ID NO: 13, SEQ ID NO: 14, and SEQ ID NO: 15.
- the coding regions may be separated by a 2AL sequence.
- the 2AL sequence may be located between the coding region of constitutively active cyclic GMP-AMP synthase (cGAS), and the coding region of an antigen (e.g., cGAS ⁇ N s-2AL-antigen or antigen-2AL-cGAS ⁇ N ).
- the coding regions may be separated by a 2AL sequence (e.g., antigen 1 -2 AL-antigen2).
- a 2AL sequence e.g., antigen 1 -2 AL-antigen2
- Additional 2AL sequence for use in mRNAs of the present disclosure are known in the art (see, e.g., Luke et al., J. Gen. Virol, 89: 1036-1042, 2008, 2AL sequences of Figure 2 are incorporated herein by reference).
- compositions and methods of the present disclosure may comprise a lipid- based delivery vehicle for an mRNA vaccine.
- the vehicle is a lipid nanoparticle (LNP).
- the vehicle is a lipid that forms a complex with the mRNA (RNA-Lipoplex).
- the LNP comprises at least one lipid selected from the group consisting of an ionizable lipid, a cationic lipid, a phospholipid, a pegylated lipid, a structural lipid, and mixtures thereof.
- the at least one lipid comprises an ionizable lipid.
- the at least one lipid comprises a cationic lipid.
- the at least one lipid comprises a phospholipid.
- the at least one lipid comprises a pegylated lipid.
- the at least one lipid comprises a structural lipid.
- the at least one lipid comprise an ionizable lipid, a phospholipid, a pegylated lipid, and a structural lipid.
- the lipid component of RNA-Lipoplex comprises one or more lipids.
- the one or more lipids comprise a first lipid and a second lipid, wherein the first lipid is distinct from the second lipid.
- the first lipid is a cationic lipid
- the second lipid is a neutral or anionic lipid.
- FIG. 9A and FIG. 9B Structures of lipids suitable for use in the lipid-based mRNA delivery vehicles of the present disclosure are depicted in FIG. 9A and FIG. 9B, which are adapted from Figure 2 of Hou et al., Nature Review Materials, 6:1078-1094, 2021. IV. Lysophosphatidylcholine Compounds
- compositions and methods of the present disclosure may comprise a phospholipid, preferably a lysophosphatidylcholine.
- a “lysophosphatidylcholine”(LPC) or “lysophosphatidylcholine molecule” refers to a glycerol molecule bearing one phosphocholine group on a hydroxyl group of the glycerol and bearing one acyl group on one of the other two hydroxyl groups of the glycerol. The remaining hydroxyl group is unsubstituted.
- the isolated lysophosphatidylcholine (LPC) with a single acyl chain is of the form:
- the isolated lysophosphatidylcholine (LPC) with a single acyl chain is of the form: or
- the alkyl or alkenyl chain together with the carbonyl carbon, forms an acyl chain which is one carbon atom longer than the alkyl or alkenyl chain.
- the group “(alkyl or alkylene)” is a C12-C23 alkyl group (such as a C12-C19 alkyl group or a C20-C23 alkyl group)
- the group “(alkyl or alkylene)” is a C12-C23 alkenyl group (such as a C12- C19 alkenyl group or a C20-C23 alkenyl group)
- Acyl chains can be referred to as saturated acyl or unsaturated acyl to distinguish between alkyl-containing and alkenyl-containing acyl groups.
- Standard delta notation or omega notation can be used to indicate the position of one or more double bonds in an unsaturated acyl chain.
- Lysophosphatidylcholine (LPC) compounds of the present disclosure have a single acyl chain in which the acyl chain is a C13-C22 acyl chain or a C13-C24 acyl chain.
- the acyl chain is a C18-C22 acyl chain or a C21-C24 acyl chain.
- the acyl chain is a C22 acyl chain.
- compositions and methods of the present disclosure may comprise a further pathogen recognition receptor (PRR) agonist.
- the PRR agonist comprises an agonist of a toll-like receptor (TLR), a NOD-like receptor (NLR), a RIG-I-like receptor (RLR), or a C-type lectin receptor (CLR).
- the PRR agonist comprises a TLR7/8 agonist.
- TLR7/8 agonist refers to an agonist of TLR7 and/or TLR8.
- the TLR7/8 agonist is a TLR7 agonist.
- the TLR7/8 agonist is a TLR8 agonist.
- the TLR7/8 agonist is an agonist of both TLR7 and TLR8.
- TLR7/8 agonists of the present disclosure are suitable for hyperactivating human dendritic cells in the presence of LPC.
- the TLR7/8 agonist is a small molecule.
- the TLR7/8 agonist is a small molecule with a molecule weight of 900 daltons or less, or a salt thereof. That is, the small molecule TLR7/8 agonist is not a large molecule like a recombinant protein or a synthetic oligonucleotide, which is regulatable by the U.S. FDA’s Center for Biologies Evaluation and Research. Rather the small molecule TLR7/8 agonist is regulatable by the FDA’s Center for Drug Evaluation and Research.
- the small molecule has a molecule weight of from about 90 to about 900 daltons.
- the TLR7/8 agonist comprises an imidazoquinoline compound.
- the TLR7/8 agonist comprises resiquimod (R848).
- the pathogen recognition receptor (PRR) agonist comprises a toll-like receptor (TLR) agonist with the proviso that the TLR agonist does not comprise a TLR7/8 agonist.
- the TLR agonist comprises an agonist of one or more of TLR2, TLR3, TLR4, TLR5, TLR9 and TLR13.
- the PRR agonist is a TLR2/6 agonist, such as Pam2CSK4.
- the TLR agonist is a TLR4 agonist such as monophosphoryl lipid A (MPLA).
- MPLA monophosphoryl lipid A
- the TLR agonist is not an agonist of TLR2, TLR4 and/or TLR9.
- the TLR9 agonist is not a TLR4 ligand such as LPS (endotoxin).
- the PRR agonist comprises a NOD-like receptor (NLR) agonist.
- the PRR agonist comprises a RIG-I-like receptor (RLR) agonist.
- the PRR agonist comprises a C-type lectin receptor (CLR) agonist.
- compositions of the present disclosure are pharmaceutical formulations comprising a pharmaceutically acceptable excipient.
- Pharmaceutical formulations of the present disclosure may be in the form of a solution or a suspension.
- the pharmaceutical formulations may be a dehydrated solid (e.g., freeze dried or spray dried solid).
- the pharmaceutical formulations of the present disclosure are preferably sterile, and preferably essentially endotoxin-free.
- pharmaceutical formulations is used interchangeably herein with the terms “medicinal product” and “medicament”.
- the pharmaceutical formation comprises specific ratios of the various components based on the intended purpose of the formulation.
- compositions of the present disclosure include for instance, solvents, buffering agents, tonicity adjusting agents, bulking agents, and preservatives (See, e.g., Pramanick et al., Pharma Times, 45:65-77, 2013).
- the pharmaceutical formulations may comprise an excipient that functions as one or more of a solvent, a buffering agent, a tonicity adjusting agent, and a bulking agent (e.g., sodium chloride in saline may serve as both an aqueous vehicle and a tonicity adjusting agent).
- the pharmaceutical formulations comprise an aqueous vehicle as a solvent.
- Suitable vehicles include for instance sterile water, saline solution, phosphate buffered saline, and Ringer's solution.
- the composition is isotonic.
- the pharmaceutical formulations may comprise a buffering agent.
- Buffering agents control pH to inhibit degradation of the active agent during processing, storage and optionally reconstitution.
- Suitable buffers include for instance salts comprising acetate, citrate, phosphate or sulfate.
- Other suitable buffers include for instance amino acids such as arginine, glycine, histidine, and lysine.
- the buffering agent may further comprise hydrochloric acid or sodium hydroxide.
- the buffering agent maintains the pH of the composition within a range of 6 to 9.
- the pH is greater than (lower limit) 6, 7 or 8.
- the pH is less than (upper limit) 9, 8, or 7.
- the pharmaceutical compositions may comprise a tonicity adjusting agent.
- Suitable tonicity adjusting agents include for instance dextrose, glycerol, sodium chloride, glycerin and mannitol.
- the pharmaceutical formulations may comprise a bulking agent.
- Bulking agents are particularly useful when the pharmaceutical composition is to be lyophilized before administration.
- the bulking agent is a protectant that aids in the stabilization and prevention of degradation of the active agents during freeze or spray drying and/or during storage.
- Suitable bulking agents are sugars (mono-, di- and polysaccharides) such as sucrose, lactose, trehalose, mannitol, sorbital, glucose and raffinose.
- the pharmaceutical formulations may comprise a preservative. Suitable preservatives include for instance antioxidants and antimicrobial agents. However, in preferred embodiments, the pharmaceutical formulation is prepared under sterile conditions and is in a single use container, and thus does not necessitate inclusion of a preservative.
- the pharmaceutical formulations of the present disclosure are suitable for parenteral administration. That is the pharmaceutical formulations of the present disclosure are not intended for enteral administration (e.g., not by orally, gastrically, or rectally).
- the present disclosure relates to methods of use of any one of the compositions or formulations described herein.
- the methods of use are suitable for a plurality of uses involving stimulating an immune response.
- the methods of use comprise methods of treating cancer.
- the methods of use comprise methods of inhibiting abnormal cell proliferation.
- the methods of use comprise methods of treating or preventing an infectious disease.
- the methods comprise administering an effective amount of a formulation or a composition described herein to an individual in need thereof to achieve a specific outcome.
- the individual is a mammalian subject, such as a human patient. In other embodiments, the individual a non-human patient. In some embodiments, the individual is a canine patient.
- the methods of use involve clinical uses, while in other embodiments the methods of use involve pre-clinical and/or veterinary uses.
- the mammalian subject may be a non-human primate (e.g., monkey or ape) or a rodent (e.g., mouse or rat).
- the mammalian subject may be a farm animal (e.g., cow), a sport animal (e.g., horse), a or a pet (e.g., companion animal such as a dog or cat).
- the present disclosure provides methods of stimulating an immune response in an individual, comprising administering to the individual a composition or formulation described herein in an amount sufficient to stimulate an immune response in the individual.
- “Stimulating” an immune response means increasing the immune response, which can arise from eliciting a de novo immune response (e.g., as a consequence of an initial vaccination regimen) or enhancing an existing immune response (e.g., as a consequence of a booster vaccination regimen).
- stimulating an immune response comprises one or more of the group consisting of: stimulating cytokine production; stimulating B lymphocyte proliferation; stimulating interferon pathway-associated gene expression; stimulating chemoattractant-associated gene expression; and stimulating dendritic cell DC maturation.
- stimulating cytokine production comprises one or more of the group consisting of: stimulating cytokine production; stimulating B lymphocyte proliferation; stimulating interferon pathway-associated gene expression; stimulating chemoattractant-associated gene expression; and stimulating dendritic cell DC maturation.
- the present disclosure provides methods of inducing an antigenspecific immune response in an individual by administering to the individual a composition or formulation described herein in an amount sufficient to induce an antigen-specific immune response in the individual.
- the composition or formulation comprises the antigen.
- the composition or formulation is administered to a tissue of the individual comprising the antigen.
- the immune response may comprise one or more of an antigen-specific antibody response, an antigen-specific cytotoxic T lymphocyte (CTL) response, and an antigen-specific helper T (Th) cell response.
- CTL cytotoxic T lymphocyte
- Th antigen-specific helper T
- “Inducing” an antigen-specific antibody response means increasing titer of the antigen-specific antibodies above a threshold level such as a pre-administration baseline titer or a seroprotective level. “Inducing” an antigen-specific CTL response means increasing frequency of antigen-specific CTL found in peripheral blood above a pre-administration baseline frequency. “Inducing” an antigen-specific Th cell response means increasing frequency of antigen-specific Th cells found in peripheral blood above a preadministration baseline frequency.
- Analysis (both qualitative and quantitative) of the immune response can be by any method known in the art, including, but not limited to, measuring antigen-specific antibody production (including measuring specific antibody subclasses), activation of specific populations of lymphocytes such as B cells and helper T cells, production of cytokines such as IFN-alpha, IFN-gamma, IL-6, IL-12 and/or release of histamine.
- Methods for measuring antigen-specific antibody responses include enzyme-linked immunosorbent assay (ELISA). Activation of specific populations of lymphocytes can be measured by proliferation assays, and with fluorescence-activated cell sorting (FACS). Production of cytokines can also be measured by ELISA.
- methods of stimulating an immune response comprise stimulation of interleukin- Ibeta (IL-ip) secretion, interferon-gamma (IFN-y) secretion, and/or tumor necrosis factor-alpha (TNF-a) secretion by monocyte-derived dendritic cells or peripheral blood mononuclear cells.
- IL-ip interleukin- Ibeta
- IFN-y interferon-gamma
- TNF-a tumor necrosis factor-alpha
- at least 50%, 55%, 60%, 65%, 70% or 75% of the cells contacted with a composition of the present disclosure remain viable at 40-56 hours (or about 48 hours) post-contact.
- the methods are suitable for stimulating an anti-tumor immune response. In other embodiments, the methods are suitable for stimulating an antimicrobe immune response.
- the anti-microbe response is an anti-bacterial immune response. In some embodiments, the anti-microbe response is an anti-fungal immune response. In some embodiments, the anti-microbe response is, an anti-viral immune response. In some embodiments, the anti-microbe response is an anti -protozoan immune response.
- the present disclosure further provides methods of treating or preventing a disease in an individual, comprising administering to the individual a composition or formulation described herein in an amount sufficient to treat or prevent a disease in the individual.
- the disease is cancer.
- the disease is abnormal cell proliferation.
- the disease is an infectious disease.
- the methods involve treating cancer in an individual or otherwise treating a mammalian subject with cancer.
- the cancer is a hematologic cancer, such as a lymphoma, a leukemia, or a myeloma.
- the cancer is a non-hematologic cancer, such as a sarcoma, a carcinoma, or a melanoma.
- the cancer is malignant.
- the methods involve inhibiting abnormal cell proliferation in an individual.
- “Abnormal cell proliferation” refers to proliferation of a benign tumor or a malignant tumor.
- the malignant tumor may be a metastatic tumor.
- the methods involve treating or preventing an infectious disease in an individual.
- the infectious disease is caused by a viral infection.
- the infectious disease is caused by a bacterial infection.
- the infectious disease is caused by a fungal infection.
- the infectious disease is caused by a protozoal infection.
- infectious diseases caused by zoonotic pathogens that infect humans as well as other animals such as mammals or birds.
- the zoonotic pathogen is transmitted to humans via an intermediate species (vector).
- a composition comprising an mRNA encapsulated in a lipid nanoparticle (LNP), wherein the mRNA comprises a coding region of a constitutively active cyclic GMP-AMP synthase (cGAS), and the LNP comprises a first phospholipid, and at least one lipid selected from the group consisting of an ionizable lipid, a pegylated lipid, a structural lipid, a second phospholipid, and mixtures thereof, wherein the first phospholipid comprises a lysophosphatidylcholine (LPC) with a single C13-C24 acyl chain.
- LPC lysophosphatidylcholine
- a composition comprising a first mRNA and a second mRNA encapsulated in a lipid nanoparticle (LNP), wherein the first mRNA comprises a coding region of a constitutively active cyclic GMP-AMP synthase (cGAS), the second mRNA comprises a coding region of an antigen; and the LNP comprises a first phospholipid, and at least one lipid selected from the group consisting of an ionizable lipid, a pegylated lipid, a structural lipid, a second phospholipid, and mixtures thereof, wherein the first phospholipid comprises a lysophosphatidylcholine (LPC) with a single C13-C24 acyl chain.
- LPC lysophosphatidylcholine
- a composition comprising an mRNA encapsulated in a lipid nanoparticle (LNP), wherein the mRNA comprises a first coding region and a second coding region separated by a 2A-like sequence, wherein the first coding region is a coding region of a constitutively active cyclic GMP-AMP synthase (cGAS) and the second coding region is a coding region of an antigen or the first coding region is a coding region of an antigen and the second coding region is a coding region of a constitutively active cyclic GMP-AMP synthase (cGAS), and the LNP comprises a first phospholipid, and at least one lipid selected from the group consisting of an ionizable lipid, a pegylated lipid, a structural lipid, a second phospholipid, and mixtures thereof, wherein the first phospholipid comprises a lysophosphatidylcholine (LPC) with a single C13- C24
- composition of any one of embodiments 1-3, wherein the at least one lipid comprises an ionizable lipid, a second phospholipid, a pegylated lipid, and a structural lipid.
- composition of any one of embodiments 1-4, wherein the ionizable lipid comprises: i) 8-[(2-hydroxyethyl)[6-oxo-6-(undecyloxy)hexyl]amino]-octanoic acid, 1 -octylnonyl ester (SM-102) or analogs or derivatives thereof; and/or ii) 6-((2-hexyldecanoyl)oxy)-N-(6-((2-hexyldecanoyl)oxy)hexyl)-N-(4-hydroxybutyl)hexan- 1-aminium (ALC-0315) or analogs or derivatives thereof; and/or iii) (6Z,9Z,28Z,3 lZ)-heptatriaconta-6,9,28,31-tetraen- 19-yl 4-(dimethylamino)butanoate (DLin-MC3-DMA) or analogs
- composition of any one of embodiments 1-5, wherein the pegylated lipid is selected from the group consisting of a PEG-modified phosphatidyiethanolamine, a PEG- modified phosphatide acid, a PEG-modified ceramide, a PEG-modified dialkylamine, a PEG- modified diacylglycerol, a PEG-modified dialkylglyerol, and combinations thereof.
- composition of any one of embodiments 1-5, wherein the pegylated lipid comprises polyethylene glycol [PEG] 2000 dimyristoyl glycerol [DMG],
- composition of any one of embodiments 1-7, wherein the structural lipid is selected from the group consisting of cholesterol, fecosterol, sitosterol, ergosterol, campesterol, stigmasterol, brassicasterol, tomatidine, ursolic acid, alpha-tocopherol, and combinations thereof.
- composition of any one of embodiments 1-7, wherein the structural lipid comprises cholesterol comprises cholesterol.
- the second phospholipid comprises: i) a hydrophilic head moiety selected from the group consisting of phosphatidyl choline, phosphatidyl ethanolamine, phosphatidyl glycerol, phosphatidyl serine, phosphatidic acid, 2- lysophosphatidyl choline, and sphingomyelin; and ii) one or more fatty acid tail moi eties selected from the group consisting of lauric acid, myristic acid, myristoleic acid, palmitic acid, palmitoleic acid, stearic acid, oleic acid, linoleic acid, alpha-linolenic acid, erucic acid, arachidic acid, arachidonic acid, phytanoic acid, eicosapentaenoic acid, behenic acid, docosapentaenoic acid, and docosahexaen
- composition of any one of embodiments 1-9, wherein the second phospholipid is selected from the group consisting of:
- DLPC 1.2-dilinoleoyl-sn-glycero-3 -phosphocholine
- DMPC 1.2-dimyristoyl-sn-glycero-phosphocholine
- DOPC 1.2-dioleoyl-sn-glycero-3 -phosphocholine
- DPPC 1.2-dipalmitoyl-sn-glycero-3 -phosphocholine
- DSPC 1.2-distearoyl-sn-glycero-3-phosphocholine
- DUPC 1.2-diundecanoyl-sn-glycero-phosphocholine
- POPC l-palmitoyl-2-oleoyl-sn-glycero-3 -phosphocholine
- DOPE 1.2-dioleoyl-sn-glycero-3-phosphoethanola mine
- DOPG 1.2-dioleoyl-sn-glycero-3-phospho-rac-(l -glycerol) sodium salt
- DOPG 1.2-dioleoyl-sn-glycero-3-phospho-rac-(l -glycerol) sodium salt
- composition of embodiment 11, wherein the second phospholipid comprises
- DSPC 1.2-distearoyl-sn-glycero-3-phosphocholine
- composition of embodiment 13, wherein the excipient comprises sucrose.
- a composition comprising: i) an mRNA complexed with one or more lipids (RNA-Lipoplex); and ii) a lysophosphatidylcholine (LPC) with a single C13-C24 acyl chain, wherein the mRNA comprises a coding region of a constitutively active cyclic GMP-AMP synthase (cGAS), and the one or more lipids comprise a first lipid and a second lipid.
- RNA-Lipoplex an mRNA complexed with one or more lipids
- LPC lysophosphatidylcholine
- cGAS constitutively active cyclic GMP-AMP synthase
- a composition comprising: i) a first mRNA and a second mRNA complexed with one or more lipids (RNA-Lipoplex); and ii) a lysophosphatidylcholine (LPC) with a single C13-C24 acyl chain; wherein the first mRNA comprises a coding region of a constitutively active cyclic GMP-AMP synthase (cGAS), and the second mRNA comprises a coding region of an antigen, and the one or more lipids comprise a first lipid and a second lipid.
- RNA-Lipoplex a lysophosphatidylcholine
- LPC lysophosphatidylcholine
- a composition comprising: i) an mRNA complexed with one or more lipids (RNA-Lipoplex); and ii) a lysophosphatidylcholine (LPC) with a single C13-C24 acyl chain, wherein the mRNA comprises a first coding region and a second coding region separated by a 2A-like sequence, the first coding region is a coding region of a constitutively active cyclic GMP-AMP synthase (cGAS) and the second coding region is a coding region of an antigen or the first coding region is a coding region of an antigen and the second coding region is a coding region of a constitutively active cyclic GMP-AMP synthase (cGAS), and the one or more lipids comprise a first lipid and a second lipid.
- RNA-Lipoplex an mRNA complexed with one or more lipids
- LPC lysophosphatid
- composition of embodiment 18, wherein the cationic lipid comprises one or both of: i) l,2-di-O-octadecenyl-3 -trimethylammonium propane (DOTMA) or analogs or derivatives thereof; and ii) l,2-dioleoyl-3 -trimethylammonium propane (DOTAP) or analogs or derivatives thereof.
- DOTMA l,2-di-O-octadecenyl-3 -trimethylammonium propane
- DOTAP l,2-dioleoyl-3 -trimethylammonium propane
- composition of embodiment 18 or embodiment 19, wherein the neutral or anionic lipid comprises: i) l,2-di-(9Z-octadecenoyl)-sn-glycero-3 -phosphoethanolamine (DOPE) or analogs or derivatives thereof; and/or ii) cholesterol or analogs or derivatives thereof; and/or iii) l,2-dioleoyl-sn-glycero-3 -phosphocholine (DOPC) or analogs or derivatives thereof.
- DOPE di-(9Z-octadecenoyl)-sn-glycero-3 -phosphoethanolamine
- DOPC l,2-dioleoyl-sn-glycero-3 -phosphocholine
- composition of embodiment 23, wherein the LPC comprises l-behenoyl-2- hy droxy-sn-gly cero-3 -phosphocholine [LPC(22 : 0)] .
- composition of embodiment 25, wherein the TLR7/8 agonist is a small molecule with a molecule weight of 900 daltons or less.
- composition of embodiment 26, wherein the TLR7/8 agonist comprises an imidazoquinoline compound.
- composition of embodiment 27, wherein the TLR7/8 agonist comprises resiquimod (R848).
- composition of any one of embodiments 1-29, wherein the mRNA or the first mRNA and the second mRNA comprises a 5’ untranslated region (5’UTR) and a 3’ untranslated region (3’UTR).
- a nucleic acid comprising: i) a coding region an antigen, and ii) a coding region of a constitutively-active cyclic GMP-AMP synthase (cGAS), optionally wherein the nucleic acid is mRNA, optionally wherein the nucleic acid is DNA.
- cGAS constitutively-active cyclic GMP-AMP synthase
- composition of embodiment 37, wherein the cGAS ⁇ N comprises the amino acid sequence of SEQ ID NO: 1 or the amino acid sequence at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1.
- composition of embodiment 38, wherein the cGAS ⁇ N comprises:
- composition of embodiment 38, wherein the cGAS ⁇ N is encoded by the nucleotide sequence of SEQ ID NO: 17 .
- composition of embodiment 42 wherein the tumor antigen is a tumor- associated antigen.
- the tumor antigen is a neoantigen.
- composition of embodiment 44, wherein the microbial antigen comprises a viral antigen, a bacterial antigen, a protozoan antigen, or a fungal antigen.
- composition of embodiment 47, wherein the pathogen is capable of causing disease in human subjects.
- composition of embodiment 47 or embodiment 48, wherein the pathogen is a virus.
- composition of embodiment 49, wherein the virus is a SARS-CoV-2.
- composition of embodiment 50, wherein the antigen is a spike (S) glycoprotein of the SARS-CoV-2, optionally wherein the spike glycoprotein is a pre-fusion stabilized variant.
- S spike glycoprotein of the SARS-CoV-2
- LPS lipopolysaccharide
- MPLA monophosphoryl lipid A
- oxPAPC oxidized l-palmitoyl-2-arachidonoyl-sn-glycero-3 -phosphorylcholine
- composition of embodiment 53 wherein the composition does not comprise 2-[[(2R)-2-[(E)-7-carboxy-5-hydroxyhept-6- enoyl]oxy-3-hexadecanoyloxypropoxy]- hydroxyphosphoryl]oxyethyl-trimethylazanium(HOdiA-PC), [(2R)-2-[(E)-7-carboxy-5-oxohept- 6-enoyl]oxy-3-hexadecanoyloxypropyl] 2- (trimethylazaniumyl)ethyl phosphate (KOdiA-PC), 1- palmitoyl-2-(5-hydroxy-8-oxo- octenoyl)-sn-glycero-3-phosphorylcholine (HOOA-PC), 2- [[(2R)-2-[(E)-5,8-dioxooct-6- enoyl]oxy-3-hexadecanoyloxypropoxy]- hydroxyphosphoryl]oxy
- a pharmaceutical formulation comprising the composition of any one of embodiments 1-54, and a pharmaceutically acceptable excipient.
- a method for production of hyperactivated dendritic cells comprising contacting the dendritic cells with an effective amount of the composition of any one of embodiments 1-54, any one of embodiments 25-54, or the formulation of embodiment 55 to produce hyperactivated dendritic cells, wherein the hyperactivated dendritic cells secrete IL- Ibeta without undergoing cell death within about 48 hours of exposure.
- composition (i) contacted in vivo with the composition
- (ii) express higher levels of at least one cell surface marker selected from the group consisting of CCR7, CD40, CD80, CD83, CD86, MHC class II, MHC class I, and combinations thereof.
- a pharmaceutical formulation comprising at least 10 ⁇ 3, 10 ⁇ 4, 10 ⁇ 5 or 10 ⁇ 6 of the hyperactivated dendritic cells produced by the method of any one of embodiments 56-58, and a pharmaceutically acceptable excipient.
- a method of stimulating an immune response against an antigen comprising administering an effective amount of the pharmaceutical formulation of embodiment 55 or embodiment 59 to an individual in need thereof to stimulate the immune response against the antigen.
- a method of treating cancer comprising administering an effective amount of the pharmaceutical formulation of embodiment 55 or embodiment 59 to an individual in need thereof to treat the cancer.
- a method of inhibiting abnormal cell proliferation comprising administering an effective amount of the pharmaceutical formulation of embodiment 55 or embodiment 59 to an individual in need thereof to inhibit abnormal cell proliferation.
- a method of treating or preventing an infectious disease comprising administering an effective amount of the pharmaceutical formulation of embodiment 55 to an individual in need thereof to treat or prevent the infectious disease.
- DSPC l,2-distearoyl-sn-glycero-3-phosphocholine
- the least one lipid comprises 8-[(2-hydroxyethyl)[6-oxo-6-(undecyloxy)hexyl]amino]- octanoic acid, 1 -octylnonyl ester (SM-102) or analogs or derivatives thereof, and cholesterol.
- composition, formulation, or method of embodiment 71 wherein the at least one lipid further comprises a pegylated lipid, optionally wherein the pegylated lipid comprises polyethylene glycol [PEG] 2000 dimyristoyl glycerol [DMG],
- BMDC bone marrow-derived dendritic cell
- CDS cytosolic DNA sensor
- cGAS cyclic GMP-AMP synthase
- CLR C-type lectin receptor
- DAMP damage-associated molecular pattern
- DC dendritic cell
- dLN draining lymph node
- DLS dynamic light scattering
- DMG-PEG-2000 polyethylene glycol [PEG] 2000 dimyristoyl glycerol [DMG]
- DSPC l,2-distearoyl-sn-glycero-3-phosphocholine
- ELSD evaporative light scattering detector
- FLT3L Fms-related tyrosine kinase 3 ligand
- GFP green fluorescent protein
- GV GeneVoy ILMTM formulation
- HdiA-PC l-palmitoyl-2-(5-hydroxy-8-oxo-6- octenedioyl
- Example 1 Combination of a Lysophosphatidylcholine (LPC) with a Single Acyl Chain and a TLR7/8 agonist Hyperactivates Mammalian Peripheral Blood Mononuclear Cells
- This example describes the hyperactivation of canine and human peripheral blood mononuclear cells (PBMCs) with a lipid DAMP in combination with a small molecule PAMP.
- PBMCs peripheral blood mononuclear cells
- PBMCs were isolated from whole blood using density gradient centrifugation with Ficoll-Paque PLUS (Cytivia). Whole blood was diluted 1 : 1 with PBS, layered on top of Ficoll-Paque PLUS and centrifuged at 1000 xg for 30 minutes at room temperature. PBMCs were collected, washed twice in PBS, and incubated with Ack lysis buffer (Lonza) to remove any remaining red blood cells.
- PBMCs were plated in RPMI medium containing 10% FBS, 50 units/mL penicillin, 50 mg/mL streptomycin, 2 mM L-glutamine, 1 mM sodium pyruvate, and 50 mM beta-mercaptoethanol (R10 media).
- Cells were plated at IxlO 5 (canine cells) or IxlO 6 (human cells) per well in 96-well flat bottom tissue culture plates. Lyophilized Vaccigrade R848 (Invivogen) was reconstituted and diluted according to manufacturer’s recommendations and added to cells at a final concentration of 1 pg/mL.
- LYSO PC was added to cells at a final concentration of 82.5 pM. Additional innate agonists were diluted in R10 media according to manufacturer’s recommendations and added to the cells as follows: human GM-CSF (Peprotech) was added at a final concentration of 10 ng/mL; 2’3’ cGAMP (Invivogen) was added at a final concentration of 15 pg/mL; LPS, serotype 055 :B5 (Enzo Life Sciences) was added at a final concentration of 1 pg/mL; Alum hydroxide (Invivogen) was added at a final concentration of 30 pg/mL. Cells were incubated at 37°C, 5% CO2 for two days. Cell cultures were then used for endpoint analyses.
- Endpoint Analyses After culturing PBMCs with PAMPs and DAMPs for two days, supernatant and cell samples were collected for analysis. Cells in culture were pelleted by centrifugation at 400xg for 5 minutes. Half of the media volume in the wells was collected for cytokine quantification by Enzyme-Linked Immunosorbent Assay (ELISA) or LumitTM Bioluminescent assay, while the remaining media and cells were used to quantify cell viability by assessing metabolic activity.
- ELISA Enzyme-Linked Immunosorbent Assay
- LumitTM Bioluminescent assay LumitTM Bioluminescent assay
- IL- 1 [3 secretion from human PBMCs was assessed using one of the following kits: ELISA MAX Deluxe Set Human IL-1 [3 kit (Biolegend), Invitrogen Human IL- 1 [3 kit, or the LumitTM Human IL- 1 [3 Immunoassay (Promega). IFNy secretion from human PBMCs was assessed using the ELISA MAX Deluxe Set Human IFNy (Biolegend) and TNF ⁇ secretion from human PBMCs was assessed using the Human TNF ⁇ Uncoated ELISA kit (Invitrogen).
- ELIS ELIS As were performed according to manufacturer’s instructions with the following modifications: i) total sample + buffer volume for incubation was reduced from 100 ⁇ L to 50 ⁇ L; ii) the top standard was prepared at 500 pg/mL, with two-fold dilutions to 7.8 pg/mL; and iii) sample incubation was completed overnight at 4C on an orbital shaker. LumitTM assays were performed according to manufacturer’s instructions.
- IL- 1 [3 secretion from canine PBMCs was assessed using the Canine IL- 1 [3/IL- 1F2 DuoSet ELISA (R&D) according to manufacturer’s instructions with the following modifications: i) total sample + buffer volume for incubation was reduced from 100 ⁇ L to 50 ⁇ L; ii) sample incubation was completed overnight at 4°C on an orbital shaker. For all ELISAs, absorbance was measured at 450 nm, with a 570 nm correction, using a Spectramax M5e plate reader (Molecular Devices). For LumitTM assays, luminescence was measured on all wavelengths using a Spectramax M5e plate reader (Molecular Devices) with an integration time of 500 ms.
- sample concentrations were interpolated using a standard curve via 4PL analysis on GraphPad Prism 9 (GraphPad Software). The interpolated results of samples were then adjusted for any dilutions made to the supernatant.
- Cell viability was assessed by quantifying the presence of ATP as an indicator of metabolically active cells using the CellTiter-Glo Luminescent Cell Viability Assay (Promega). Metabolic activity was assessed following manufacturer’s instructions. The CellTiter-Glo reagent was mixed with the cell pellets and fresh media then transferred to a white, opaque 96-well plate. Luminescence was measured on all wavelengths on a Spectramax M5e plate reader (Molecular Devices) using an integration time of 500 ms. Percent viability was calculated relative to the control condition of PBMCs treated with R848. [0096] Statistical Analyses. For each condition, cells from each donor were plated for testing in triplicate.
- cytokine quantification triplicate values were used for interpolation and data was plotted as total concentration (pg/mL) or fold change per donor relative to the control condition of R848 alone.
- each donor triplicate was averaged, and the average was used as one donor measurement. Multiple donors were tested and each data point on the column graphs represents the value for a donor.
- test results were compared to the control condition of R848 alone. P-values were calculated using a mixed-effects one-way ANOVA, with corrections for multiple comparisons using a Dunnett’s test.
- PBMCs isolated from whole blood obtained from human donors.
- PBMCs were isolated from whole blood by density gradient centrifugation from multiple human donors and cultured for two days with the hyperactivating stimuli of interest.
- Human PBMCs like human moDCs and canine PBMCs, secreted IL- 10 at levels higher or comparable to all other stimuli tested. Similar to canine PBMCs, human PBMCs secreted IL- 10 in response to R848 alone due to monocyte activation, and this was elevated by addition of 22:0 LYSO PC. The pyroptotic combination of LPS + Alum elicited high levels of IL- 10 as expected. Consistent with observations in canine PBMCs, PGPC + R848 did not induce substantially higher levels of IL-10 than R848 alone. GM-CSF did not induce levels of IL-10 secretion from human PBMCs significantly above background levels produced by untreated cells.
- Lipids for LNPs were purchased from Cayman Chemicals (SM102) or Avanti (22:0 LPC, DSPC, DMG-PEG2000). Cholesterol was purchased from Sigma.
- cGAS ⁇ N mRNA was custom ordered and synthesized via in vitro transcription from a linearized template DNA (Trilink).
- the human cGAS ⁇ N sequence was codon optimized for expression in murine cells, and the synthetic nucleotide sequence is set forth as SEQ ID NO: 17.
- the mRNA sequence was capped using Trilink’s proprietary Clean Cap mRNA technology, with a Nl- methylpseudouridine base modification, and a 120 residue poly A tail.
- the sequence contains a Bbsl restriction enzyme site.
- the sequence information was used to build plasmids, from which the mRNA was synthetically synthesized.
- the mRNA was phosphatase treated after synthesis.
- LNP Synthesis Lipid nanoparticles (LNPs) were prepared using a custom LNP lipid mix (Table 2-1). cGAS ⁇ N mRNA was prepared at 0.02 mg/mL in sodium citrate buffer, pH 4. The custom LNP lipid mix was prepared at 12.5 mM. Ratio of mRNA/22:0 LPC was chosen based on previous experiments that determined in vitro activity of each component. LNPs were synthesized using the NanoAssemblr Ignite instrument (Precision Nanosystems). Lipids in ethanol were combined with the mRNA solutions individually at a 1 :3 volumetric ratio, using a flow rate of 12 mL/min.
- LNPs were washed in 10 volumes of phosphate buffered saline (PBS), pH 7.4 to remove residual ethanol, and then concentrated using Amicon 10K MWCO centrifugal filters. LNPs were filtered through a 0.2 pm filter before use. Table 2-1. LNP Formulations
- LNP Characterization Loading of mRNA into LNPs was quantified using a RiboGreen assay (ThermoFisher) following the manufacturer’s protocol. Samples were diluted to fall within the range of the standard curve. LNPs were lysed using Triton X-100 to assess encapsulation of mRNA into LNPs. Both total mRNA and encapsulated mRNA were quantified. The size of the LNPs was assessed using dynamic light scattering (DLS) on the NanoBrook Omni (Brookhaven). LNPs were diluted 1 : 10 in PBS before running on the DLS. Three 90 second measurements were recorded for each sample.
- DLS dynamic light scattering
- LNPs can be loaded with cGASNN mRNAs and 22:0 LPC at similar levels to LNPs loaded with either cGAS ⁇ N mRNA or 22:0 LPC. All LNPs - 22:0 LPC LNPs, cGAS ⁇ N LNPs, and cGAS ⁇ N + 22:0 LPC LNPs - show similar sizes, with all LNPs ⁇ 150 nm in size (FIG. 3A) with relatively uniform distribution (PDI ⁇ 0.3).
- BMDCs murine bone marrow -derived dendritic cells
- Leg femur and tibia were removed from mice, cut with scissors, and flushed into sterile tubes. Bone marrow suspension was treated with ACK Lysis Buffer for 1 minute, then passed through a 40 pm cell strainer. Cells were counted and resuspended in media consisting of complete IMDM containing 10% FBS, penicillin and streptomycin, and supplements of L-glutamine and sodium pyruvate (110). Cells were then plated at 8E6 bone marrow cells per well in a P12 plate. Recombinant mouse FLT3L (Miltenyi) was added to cultures at 200 ng/mL.
- Differentiated cells were used for subsequent assays on day 9. The efficiency of differentiation was monitored by flow cytometry using a BD Symphony A3, and CD1 lc + MHC-II + cells were routinely above 80% of living cells. For each experiment, 5 to 15 mice were used to generate DCs from bone marrow.
- BMDCs were harvested on day 9 post differentiation, washed with PBS and re-plated in complete IMDM media (110) at a concentration of 2x10 5 cells/well.
- Cells were cultured in the presence or absence of LNPs loaded with 22:0 LPC LNPs at 100 pM, and with or without cGAS ⁇ N mRNA at ⁇ 1 pg/mL (Table 3-1).
- R848 was added at 1 pg/mL final concentration. Forty-eight hours post stimulation, supernatants were collected for cytokine secretion assessment.
- IL-ip cytokine secretion by BMDCs was measured using sandwich ELISAs (Invitrogen) following manufacturer’s instructions. Additional cytokines were measured using the LEGENDplex Mouse Anti-viral Response Panel (Biolegend) according to manufacturer’s instructions. Cell viability was assessed by measuring LDH release into fresh supernatant using the CyQUANT LDH Cytotoxicity Assay (Invitrogen) according to manufacturer’s instructions.
- mice bone marrow cells were differentiated into DCs using FLT3L.
- BMDCs were then stimulated with R848, 22:0 LPC, and cGAS ⁇ N mRNA in various combinations.
- R848, 22:0 LPC were then stimulated with R848, 22:0 LPC, and cGAS ⁇ N mRNA in various combinations.
- cGAS ⁇ N mRNA and 22:0 LPC were formulated in LNPs either separately or in combination.
- Flt3L BMDCs treated with R848 and [cGASRN + 22:0 LPC] LNPs can be hyper activated.
- DCs were assessed for their potential to be hyperactivated in response to treatment with R848 + [cGAS ⁇ N + 22:0 LPC] LNPs; hyperactivation was typified by the DCs’ ability to secrete IL-ip while remaining viable.
- DCs treated with PBS (unstimulated) or treated with only R848 produced minimal or no IL-ip. As expected, combining R848 and 22:0 LPC treatments resulted in IL-ip production 48 hours later (FIG. 4A).
- cGAS/STING signaling primarily activates IRF3 and not NF-kB.
- secretion of RANTES and IP- 10 which are known to be regulated by cGAS/STING signaling, were measured.
- Cells treated with PBS (unstimulated) did not express RANTES or IP- 10.
- cGAS ⁇ N stimulation induced the expression of RANTES and IP- 10, confirming that our mRNA transcript encoded an active cGAS that was successfully delivered to cells and expressed (FIG. 5C-5D).
- RANTES and IP- 10 expression were inhibited compared to single cGAS ⁇ N treatment.
- cGAS ⁇ N demonstrated several things. Firstly, cGAS ⁇ N mRNA was successfully formulated in LNPs for delivery into DCs and was translated into a protein. cGAS ⁇ N protein was active, as indicated by the treatment’s ability to induce RANTES and IP- 10 production. Secondly, in combination with hyperactivating stimuli, cGAS ⁇ N treatment did not reduce secretion of the key hyperactivation cytokine IL-ip. Finally, when cells were stimulated with all three stimuli, inflammatory genes regulated by one stimulus were not impaired by the effects of the other two stimuli. These data demonstrate that cGAS ⁇ N treatment can be combined with hyperactivating stimuli to instruct DCs to produce the inflammatory milieu of both processes simultaneously.
- Example 4 Treatment of Human Dendritic Cells with cGAS ⁇ N and Hyperactivating Stimuli Results in Activation of NLRP3 Inflammasome and cGAS-STING Pathways
- Human monocyte-derived dendritic cell (moDC) generation Human monocytes were isolated from Leukopaks purchased from Miltenyi Inc. (San Jose, CA) using the StraightFrom Leukopak CD14 microbead kit according to the manufacturer’s instructions. Monocytes were then aliquoted and frozen in fetal bovine serum containing 10% dimethyl sulfoxide.
- monocyte-derived dendritic cell (moDC) cultures monocytes were thawed and cultured in RPMI medium containing 10% FBS, 50 units/mL penicillin, 50 mg/mL streptomycin, 2 mM L-glutamine, 1 mM sodium pyruvate, 50 mM beta-mercaptoethanol, lOmM HEPES, and Gibco MEM non-essential amino acids (R10 media).
- R10 media Gibco MEM non-essential amino acids
- CD40 is a receptor that engages CD40L on CD4 T cells and ultimately enhances T cell responses.
- CD83 is also involved in T cell activation and is commonly used as an indicator of DC activation. Compared to unstimulated cells, CD40 expression was upregulated when DCs were treated with R848 with or without 22:0 LPC, and a further enhancement was observed when cells were treated with cGAS ⁇ N with or without 22:0 LPC (FIG. 7B). Combining cGAS signaling with hyperactivation also led to an increase in CD40 expression compared to unstimulated cells (FIG. 7B). CD83 expression was more variable compared to CD40 staining, but again combining cGAS ⁇ N treatment with hyperactivation treatment did not eliminate the expression of CD83 (FIG. 7C).
- CD80 and CD86 are costimulatory molecules that engage T cells during antigen presentation and serve as a confirmatory signal that a presented non-self antigen is indeed dangerous.
- DCs are activated with R848 or cGAS ⁇ N or when DCs are hyperactivated with R848 and 22:0 LPC, CD80 and CD86 expression increases (FIG. 8A-8B).
- cGAS ⁇ N and hyperactivating treatments are combined, DCs continue to upregulate CD80 and CD86 compared to unstimulated cells (FIG. 8A-8B).
- both cellular processes are engaged, DCs are still able to supply T cells with co-stimulatory signals.
- HLA-ABC and HLA-DR are Class I and Class II MHC molecules that present antigens to CD8 and CD4 T cells, respectively.
- R848 treatment with or without the addition of 22:0 LPC increased the expression of HLA-ABC (FIG. 8C).
- Treatment of DCs with cGAS ⁇ N with or without 22:0 LPC also had a similar effect on HLA-ABC expression (FIG. 8C).
- cGAS ⁇ N treatment and hyperactivation a significant increase in HLA-ABC was observed compared to the other stimuli combinations.
- Example 5 Combining cGAS ⁇ N mRNA and Hyperactivation as a Vaccination Strategy to Improve Immune Responses
- DCs can be activated to produce chemical signals that promote T cell effector responses.
- Hyperactivation of DCs produces a complementary set of chemical signals.
- hyperactivation induces pro-inflammatory cytokines and add to their cytokine repertoire IL-ip, a critical cytokine for memory T cell formation.
- vaccination strategies that utilize various combinations of cGAS ⁇ N, R848, and 22:0 LPC as adjuvants are compared in vivo.
- the goal of vaccination is to direct immune responses against an antigen of interest or a complex source of antigens of interest (e.g., model antigen, tumor-associated antigen, neoantigen, microbial-derived antigens, etc.). Immune responses are easily detected using well-established immunological methods and common reagents (e.g., tetramer staining, ELISpot assay, ELISA, flow cytometry, etc.).
- An immunogenic composition is prepared, for instance, by loading an mRNA transcript encoding an antigen of interest into lipid nanoparticles (LNPs).
- LNPs lipid nanoparticles
- These LNPs are suitable for administration to mammalian subjects to achieve expression of the antigen of interest in vivo for initiation of an adaptive immune response.
- cGAS ⁇ N delivered as mRNA in an LNP
- cGAS ⁇ N, R848, and 22:0 LPC are contemplated to improve DC function by enhancing de novo T cell activation and memory T cell reactivation. These improvements can have a positive downstream effect on effector and memory T cell responses. Improved T cell activation can also have further positive downstream effects on B cells when B cells undergo germinal center reactions that require T cell engagement. Table 5-1. Immunization Strategy
- the OVA mRNA dose is fixed at 5 pg/mouse, while the adjuvant cGAS ⁇ N mRNA is dosed at about 1.5 pg/mouse and 22:0 LPC is dosed at about 60 pg/mouse (Table 5-1).
- Mice are given a primary immunization on Day 0, with a boost immunization of the same doses on Day 7.
- blood and secondary lymphoid organs are collected.
- blood and secondary lymphoid organs are collected.
- Blood is collected for measurement of antibody and T cell responses. Serum is collected from the blood using serum separation tubes, while blood for cellular analysis is collected using K2EDTA tubes.
- mice After blood collection, mice are euthanized, and the draining lymph nodes and spleen are collected and processed into single cell suspensions. Expected responses are shown in Table 5-1.
- OVA-specific T cell tetramer assessment OVA-specific T cells in the blood and draining lymph node of mice receiving OVA LNP immunization are assessed 14 and 40 days post primary immunization.
- red blood cells are lysed using a RBC lysis buffer, with lysis completed twice to remove all RBCs in the blood. Cells are washed, then stained for viability (Live/Dead), the SIINFEKL-tetramer binding (MBL), and CD3, CD4, and CD8 expression. Cells are fixed with 4% paraformaldehyde, and counting beads are added before running to permit total cell counts to be determined. Data are collected using a BD FACS Symphony and analyzed using Flowjo (BD).
- BD Flowjo
- T effector and T memory T cell measurement The frequency of T effector and T memory cells are assessed by flow cytometry, in the blood and draining lymph node of mice receiving OVA LNP immunization. Briefly cell suspensions are stained with CD3, CD4, CD8, CD62L and CD44 antibodies to measure the frequency of T effector cells (CD44 Low CD62L neg ) and T memory cells (CD44 high CD62L + ) using a BD FACS Symphony instrument and data is analyzed using Flowjo (BD).
- CD3, CD4, CD8, CD62L and CD44 antibodies to measure the frequency of T effector cells (CD44 Low CD62L neg ) and T memory cells (CD44 high CD62L + ) using a BD FACS Symphony instrument and data is analyzed using Flowjo (BD).
- OVA-specific antibody assessment OVA-specific antibodies in the serum of mice receiving OVA LNP immunization are assessed 14 and 40 days post primary immunization. OVA-specific total IgG, IgGl, and IgG2b are assessed by ELISA. Briefly, ELISA plates are coated with 10 pg/mL Endofit Ovalbumin (Invivogen) overnight, then washed and blocked with 2% bovine serum albumin. Plates are washed again, and then serum is added to the plates at a 1 :500 dilution, followed by 1 :5 dilutions for a total of 7 serum dilutions.
- Samples are washed, then incubated with detection antibodies specific for IgG, IgGl, or IgG2b, which are conjugated to HRP (Southern Biotech), to detect total, Th2-skewed, and Thl-skewed OVA-specific antibodies respectively. Plates are washed, then incubated with TMB, and stop solution is added once color development is complete.
- OVA-specific T cell responses OVA-specific T cell responses are determined from secondary lymphoid organ activities. Post-immunization, draining lymph nodes and spleens are collected from the mice at the early (Day 14) and late (Day 40) time points. Harvested lymph nodes and spleens are dissociated into single cell suspensions, which are used in ELISPOT assays. ELISPOT is used to detect ZFNy and IL-5 secretion by T cells, which are indicative of Thl and Th2 responses, respectively.
- Cells from draining lymph nodes and spleens are plated in RPMI medium containing 10% FBS, 50 units/mL penicillin, 50 mg/mL streptomycin, 2 mM L- glutamine, 1 mM sodium pyruvate, 50 mM beta-mercaptoethanol, 10 mM HEPES, and Gibco MEM non-essential amino acids (R10 media).
- Cells are plated at 200,000 cells/well in a 96 well ELISPOT plate and restimulated with 10 mcg/mL OVA peptivator or 1 mcg/mL OVA peptide antigens. As controls, additional plated cells are left unstimulated or stimulated with irrelevant antigens (not used in vaccination). Completion of the assay results in spots that can be visually quantified where cytokines were secreted by T cells, as a method to quantify the number of T cells responding to restimulation.
- mice of Group 1 receive a sham injection containing no antigen and no adjuvants to serve as a baseline where little to no antigen-specific immune responses are expected to be elicited.
- Group 2 mice receive mRNA encoding a model antigen (OVA) formulated in LNPs, which represents a standard LNP vaccination protocol. The remaining groups all receive LNP-loaded with mRNA encoding OVA in combination with adjuvants.
- OVA model antigen
- mice receive R848 + 22:0 LPC, which is expected to hyperactivate DCs that activate the NLRP3 pathway in addition to the NFkB pathway leading to conventional pro-inflammatory cytokine secretion (IL-6 and TNF ⁇ ) and IL-ip production.
- Group 5 mice receive LNPs that encode cGAS ⁇ N, which is expected to induce a Type I IFN response via IRF3.
- mice of Group 6 and Group 7 receive two out of the three stimuli, while mice of Group 8 receive all three stimuli (R848, 22:0 LPC, and cGAS ⁇ N).
- cGAS ⁇ N expression in vivo is contemplated to stimulate DC signals that are particularly beneficial to the immediate effector immune responses. Hyperactivating conditions are also contemplated to benefit effector responses, albeit in the absence of Type I IFN signaling. Additionally, hyperactivation-induced IL-ip signaling leads to improved memory formation. Thus, by combining cGAS signaling and hyperactivation, a very strong effector response and a durable memory response are contemplated to be elicited.
- Group 1 By immunizing with a sham treatment (Group 1), little to no effector and memory responses are likely to be observed and immunizing with antigen mRNA alone or in combination with R848 (Groups 2 and 3) is contemplated to lead to a small effector response and minimal memory formation.
- Group 4 treatment hyperactivates DCs and is expected to be an improvement over Group 2 treatment.
- Group 5 and Group 6 treatments engage only cGAS signaling in DCs and are therefore contemplated to lead to strong effector responses, but less durable memory responses than Group 4 treatment.
- Group 7 is a hyperactivating treatment condition.
- Group 7 and Group 8 are contemplated to yield the best effector and memory responses given that they engage both cGAS and hyperactivation pathways. Since hyperactivating lipids engage cellular processes beyond NLRP3 activation, the Group 8 treatment, which includes 22:0 LPC, is contemplated to result in superior effector and memory responses.
- the three adjuvanting stimuli can be formulated in various ways.
- cGAS ⁇ N mRNA can be encapsulated in LNPs alone or in combination with 22:0 LPC.
- R848 can be administered as an individual component, within an LNP, or within an LNP containing one or both of the other stimuli.
- the chronology of administration of stimuli can be varied.
- the antigen mRNA-loaded LNPs in combination with cGAS ⁇ N mRNA-loaded LNPs and R848 may be beneficial to administer the antigen mRNA-loaded LNPs in combination with cGAS ⁇ N mRNA-loaded LNPs and R848 in a prime injection to provide a strong effector signal via type I IFN, followed by a boost injection of the antigen mRNA-loaded LNPs in combination with 22:0 LPC-loaded LNPs and R848 to provide the memory signal necessary to generate durable immunity.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Epidemiology (AREA)
- Microbiology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Biophysics (AREA)
- Mycology (AREA)
- Physics & Mathematics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Plant Pathology (AREA)
- Cell Biology (AREA)
- Virology (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Optics & Photonics (AREA)
- Pulmonology (AREA)
- Hematology (AREA)
- Nanotechnology (AREA)
- Dispersion Chemistry (AREA)
- Communicable Diseases (AREA)
- Gastroenterology & Hepatology (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP23732314.2A EP4522212A1 (en) | 2022-05-13 | 2023-05-12 | Nucleic acids encoding a constitutively-active cyclic gmp-amp synthase and immunogenic delivery vehicles for same |
| JP2024566527A JP2025516636A (ja) | 2022-05-13 | 2023-05-12 | 構成的に活性な環状gmp-ampシンターゼをコードする核酸およびそれのための免疫原性送達ビヒクル |
| US18/864,457 US20250255815A1 (en) | 2022-05-13 | 2023-05-12 | Nucleic acids encoding a constitutively-active cyclic gmp-amp synthase and immunogenic delivery vehicles for same |
| IL316959A IL316959A (en) | 2022-05-13 | 2023-05-12 | Nucleic acids encoding essential GMP-cyclic AMP synthase and means of delivering immunogens therefor |
| CN202380050168.0A CN119497629A (zh) | 2022-05-13 | 2023-05-12 | 编码组成型活性环状gmp-amp合酶的核酸及其免疫原性递送媒介物 |
| KR1020247041463A KR20250022050A (ko) | 2022-05-13 | 2023-05-12 | 구성적으로 활성인 시클릭 gmp-amp 신타제를 코딩하는 핵산 및 이를 위한 면역원성 전달 비히클 |
| CA3258341A CA3258341A1 (en) | 2022-05-13 | 2023-05-12 | Nucleic acids encoding a constituently active cyclic GMP-AMP synthase and associated immunogenic delivery vehicles |
| AU2023269866A AU2023269866A1 (en) | 2022-05-13 | 2023-05-12 | Nucleic acids encoding a constitutively-active cyclic gmp-amp synthase and immunogenic delivery vehicles for same |
| TW112117984A TW202400253A (zh) | 2022-05-13 | 2023-05-15 | 編碼具持續性活性之環gmp-amp合成酶之核酸及用於彼等之免疫原性遞送載體 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202263341984P | 2022-05-13 | 2022-05-13 | |
| US63/341,984 | 2022-05-13 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023220747A1 true WO2023220747A1 (en) | 2023-11-16 |
Family
ID=86861986
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2023/066975 Ceased WO2023220747A1 (en) | 2022-05-13 | 2023-05-12 | Nucleic acids encoding a constitutively-active cyclic gmp-amp synthase and immunogenic delivery vehicles for same |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US20250255815A1 (enExample) |
| EP (1) | EP4522212A1 (enExample) |
| JP (1) | JP2025516636A (enExample) |
| KR (1) | KR20250022050A (enExample) |
| CN (1) | CN119497629A (enExample) |
| AU (1) | AU2023269866A1 (enExample) |
| CA (1) | CA3258341A1 (enExample) |
| IL (1) | IL316959A (enExample) |
| TW (1) | TW202400253A (enExample) |
| WO (1) | WO2023220747A1 (enExample) |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016170176A1 (en) * | 2015-04-22 | 2016-10-27 | Curevac Ag | Rna containing composition for treatment of tumor diseases |
| WO2020006038A1 (en) * | 2018-06-29 | 2020-01-02 | Dana-Farber Cancer Institute, Inc. | Structure of the human cgas-dna complex and uses thereof |
-
2023
- 2023-05-12 CA CA3258341A patent/CA3258341A1/en active Pending
- 2023-05-12 WO PCT/US2023/066975 patent/WO2023220747A1/en not_active Ceased
- 2023-05-12 EP EP23732314.2A patent/EP4522212A1/en active Pending
- 2023-05-12 JP JP2024566527A patent/JP2025516636A/ja active Pending
- 2023-05-12 AU AU2023269866A patent/AU2023269866A1/en active Pending
- 2023-05-12 IL IL316959A patent/IL316959A/en unknown
- 2023-05-12 CN CN202380050168.0A patent/CN119497629A/zh active Pending
- 2023-05-12 KR KR1020247041463A patent/KR20250022050A/ko active Pending
- 2023-05-12 US US18/864,457 patent/US20250255815A1/en active Pending
- 2023-05-15 TW TW112117984A patent/TW202400253A/zh unknown
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016170176A1 (en) * | 2015-04-22 | 2016-10-27 | Curevac Ag | Rna containing composition for treatment of tumor diseases |
| WO2020006038A1 (en) * | 2018-06-29 | 2020-01-02 | Dana-Farber Cancer Institute, Inc. | Structure of the human cgas-dna complex and uses thereof |
Non-Patent Citations (11)
| Title |
|---|
| "GenBank", Database accession no. NP 612450.2 |
| BARNETT ET AL., CELL, vol. 176, 2019, pages 1432 - 1446 |
| BERDYSHEV EVGENY ET AL: "Lipid abnormalities in atopic skin are driven by type 2 cytokines", JCI INSIGHT, vol. 3, no. 4, 22 February 2018 (2018-02-22), XP093087116, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5916244/pdf/jciinsight-3-98006.pdf> DOI: 10.1172/jci.insight.98006 * |
| DONOSO-QUEZADA JAVIER ET AL: "The role of lipids in exosome biology and intercellular communication: Function, analytics and applications", TRAFFIC, vol. 22, no. 7, 11 June 2021 (2021-06-11), DK, pages 204 - 220, XP093087304, ISSN: 1398-9219, Retrieved from the Internet <URL:https://onlinelibrary.wiley.com/doi/full-xml/10.1111/tra.12803> DOI: 10.1111/tra.12803 * |
| HOU ET AL., NATURE REVIEW MATERIALS, vol. 6, 2021, pages 1078 - 1094 |
| LUKE ET AL., J. GEN. VIROL, vol. 89, 2008, pages 1036 - 1042 |
| NARANBHAI ET AL., CELL, vol. 185, 2022, pages 1 - 11 |
| PRAMANICK ET AL., PHARMA TIMES, vol. 45, 2013, pages 65 - 77 |
| RYDYZNSKI MODERBACHER ET AL., CELL, vol. 183, no. 4, 2020, pages 996 - 1012 |
| SCHUMACHERSCHREIBER, SCIENCE, vol. 348, 2015, pages 69 - 74 |
| TAO LIANYUAN ET AL: "Metabolomics identifies serum and exosomes metabolite markers of pancreatic cancer", METABOLOMICS, SPRINGER US, NEW YORK, vol. 15, no. 6, 30 May 2019 (2019-05-30), pages 1 - 11, XP036816460, ISSN: 1573-3882, [retrieved on 20190530], DOI: 10.1007/S11306-019-1550-1 * |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2023269866A1 (en) | 2025-01-02 |
| TW202400253A (zh) | 2024-01-01 |
| IL316959A (en) | 2025-01-01 |
| EP4522212A1 (en) | 2025-03-19 |
| US20250255815A1 (en) | 2025-08-14 |
| KR20250022050A (ko) | 2025-02-14 |
| CN119497629A (zh) | 2025-02-21 |
| JP2025516636A (ja) | 2025-05-30 |
| CA3258341A1 (en) | 2023-11-16 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240197869A1 (en) | Hyperactivators of mammalian dendritic cells | |
| US20250041394A1 (en) | Immunostimulatory mrna compositions and uses thereof | |
| US20250255988A1 (en) | Mrna encoding a constitutively-active cyclic gmp-amp synthase and lipid delivery vehicles for same | |
| TW202245808A (zh) | 用於治療癌症之治療性rna | |
| US20250134994A1 (en) | Immunogenic mrna delivery vehicles | |
| US20240041999A1 (en) | Therapeutic RNA for Treating Cancer | |
| US20250255815A1 (en) | Nucleic acids encoding a constitutively-active cyclic gmp-amp synthase and immunogenic delivery vehicles for same | |
| US20250127868A1 (en) | Hyperactivating lipid nanoparticles | |
| WO2024192034A2 (en) | Bystander antigen enhancement of tumor cell lysate immunogenicity | |
| US20240390462A1 (en) | Treatment Schedule for Cytokine Proteins | |
| WO2024159157A2 (en) | Phospholipid analogs for hyperactivation of mammalian dendritic cells | |
| CN118922179A (zh) | 超激活脂质纳米颗粒 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23732314 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024566527 Country of ref document: JP Ref document number: 316959 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202417089283 Country of ref document: IN |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112024023285 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: AU2023269866 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020247041463 Country of ref document: KR Ref document number: 2023732314 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202380050168.0 Country of ref document: CN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202407872W Country of ref document: SG |
|
| ENP | Entry into the national phase |
Ref document number: 2023269866 Country of ref document: AU Date of ref document: 20230512 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2023732314 Country of ref document: EP Effective date: 20241213 |
|
| WWP | Wipo information: published in national office |
Ref document number: 1020247041463 Country of ref document: KR |
|
| WWP | Wipo information: published in national office |
Ref document number: 202380050168.0 Country of ref document: CN |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112024023285 Country of ref document: BR Free format text: 1) APRESENTE NOVO RELATORIO DESCRITIVO ADAPTADO AO ART. 26 INCISO I DA PORTARIA/INPI NO 14/2024, UMA VEZ QUE O CONTEUDO ENVIADO NA PETICAO NO 870240095700 DE 07/11/2024 ENCONTRA-SE FORA DA NORMA EM RELACAO AO TITULO, CONTENDO TEXTO DIFERENTE DO TITULO INCIANDO A PAGINA E NAO CENTRALIZADO. 2) APRESENTE NOVO RESUMO ADAPTADO AO ART. 40 INCISO I DA PORTARIA/INPI NO 14/2024, UMA VEZ QUE O CONTEUDO ENVIADO NA PETICAO NO 870240095700 DE 07/11/2024 ENCONTRA-SE FORA DA NORMA EM RELACAO AO TITULO, CONTENDO TEXTO DIFERENTE DO TITULO INCIANDO A PAGINA E NAO CENTRALIZADO. 3) APRESENTE NOVAS FOLHAS DO RELATORIO DESCRITIVO ADAPTADAS AO ART. 20 DA PORTARIA/INPI NO 14/2024, UMA VEZ QUE O CONTEUDO ENVIADO NA |
|
| ENP | Entry into the national phase |
Ref document number: 112024023285 Country of ref document: BR Kind code of ref document: A2 Effective date: 20241107 |
|
| WWP | Wipo information: published in national office |
Ref document number: 18864457 Country of ref document: US |