WO2023194798A1 - Methods for treating leukocytosis, endothelial dysfunction and carditis using lipid binding protein-based complexes - Google Patents

Methods for treating leukocytosis, endothelial dysfunction and carditis using lipid binding protein-based complexes Download PDF

Info

Publication number
WO2023194798A1
WO2023194798A1 PCT/IB2023/000183 IB2023000183W WO2023194798A1 WO 2023194798 A1 WO2023194798 A1 WO 2023194798A1 IB 2023000183 W IB2023000183 W IB 2023000183W WO 2023194798 A1 WO2023194798 A1 WO 2023194798A1
Authority
WO
WIPO (PCT)
Prior art keywords
subject
dose
apoa
binding protein
lipid binding
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2023/000183
Other languages
English (en)
French (fr)
Inventor
Cyrille TUPIN
Constance PEYROTTES
Ronald Barbaras
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Abionyx Pharma SA
Original Assignee
Abionyx Pharma SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US18/854,185 priority Critical patent/US20250255931A1/en
Priority to CA3247588A priority patent/CA3247588A1/en
Priority to AU2023251245A priority patent/AU2023251245A1/en
Priority to IL316100A priority patent/IL316100A/en
Priority to KR1020247036482A priority patent/KR20240171131A/ko
Priority to JP2024559383A priority patent/JP2025512987A/ja
Application filed by Abionyx Pharma SA filed Critical Abionyx Pharma SA
Priority to EP23729835.1A priority patent/EP4504233A1/en
Priority to CN202380044954.XA priority patent/CN119317440A/zh
Publication of WO2023194798A1 publication Critical patent/WO2023194798A1/en
Priority to MX2024012302A priority patent/MX2024012302A/es
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/543Lipids, e.g. triglycerides; Polyamines, e.g. spermine or spermidine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/543Lipids, e.g. triglycerides; Polyamines, e.g. spermine or spermidine
    • A61K47/544Phospholipids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis

Definitions

  • the disclosure is based, in part, on the discovery that subjects treated with the lipid binding protein-based complex CER-001 as described in Example 2 showed an unexpectedly rapid improvement in biomarkers of inflammation, leukocytosis, and endothelial dysfunction. [0004] Accordingly, in some aspects, the disclosure provides methods for treating subjects having or at risk of developing leukocytosis with a dose (e.g., a high dose) of a lipid binding protein-based complex.
  • a dose e.g., a high dose
  • the disclosure provides methods for treating subjects having one or more symptoms associated with leukocytosis, comprising administering to the subject a dose of a lipid binding protein-based complex with a dose (e.g., a high dose) of a lipid binding proteinbased complex.
  • a dose e.g., a high dose
  • the disclosure provides methods for treating subjects having endothelial dysfunction (e.g., subjects having acute coronary syndrome or stroke or who has experienced acute coronary syndrome or stroke) with a dose (e.g., a high dose) of a lipid binding protein-based complex.
  • a dose e.g., a high dose
  • the disclosure provides methods of treating a subject experiencing acute coronary syndrome or stroke or who has experienced acute coronary syndrome or stroke with a high dose of a lipid binding protein-based complex.
  • the disclosure provides methods of treating a subject having or at risk of developing carditis with a dose (e.g., a high dose) of a lipid binding protein-based complex.
  • a dose e.g., a high dose
  • the lipid binding-protein based complex is typically administered in a high dose.
  • a high dose is typically higher than a dose that would be used to treat a chronic condition such as familial hypercholesterolemia.
  • the high dose is typically administered over a relatively short period of time, for example, over a period of two days to two weeks, and typically comprises multiple administrations of the lipid binding protein-based complex, for example two to 20 individual doses.
  • the individual doses can be separated by less than one day (e.g., twice daily administration), or one day or more (e.g., once daily administration).
  • the lipid binding protein-based complex comprises a sphingomyelin and/or a negatively charged lipid, for example CER-001 .
  • CER-001 is a negatively charged lipoprotein complex, and comprises recombinant human ApoA-l, sphingomyelin (SM), and 1 , 2-dihexadecanoyl-sn-glycero-3-phospho-(1'-rac-glycerol) (Dipalmitoylphosphatidyl-glycerol; DPPG). It mimics natural, nascent discoidal pre-beta HDL, which is the form that HDL particles take prior to acquiring cholesterol.
  • CER-001 therapy can (1 ) reduce serum levels of inflammatory cytokines such as IL-6, (2) reduce white blood cell count in subject having leukocytosis or at risk of leukocytosis, and (3) reduce serum levels of ICAM-1 and VCAM-1 , thereby providing a clinical benefit to subjects having or at risk of developing leukocytosis, subjects having endothelial dysfunction, and subjects having or at risk of developing carditis.
  • inflammatory cytokines such as IL-6
  • ICAM-1 and VCAM-1 reduce serum levels of ICAM-1 and VCAM-1
  • the present disclosure provides dosing regimens for lipid binding protein-based therapy (e.g., CER-001 therapy) for subjects as described herein.
  • lipid binding protein-based therapy e.g., CER-001 therapy
  • the dosing regimens of the disclosure typically entail multiple administrations of CER- 001 to a subject (e.g., administered daily or administered approximately 12 hours apart).
  • the CER-001 therapy can be continued for a pre-determined period, e.g., for one week or a period longer than one week (e.g., two weeks).
  • administration of CER-001 to a subject can be continued until one or more symptoms of a condition experienced by the subject are reduced or continued until the serum levels of one or more inflammatory markers are reduced, for example reduced to a normal level or reduced relative to a baseline measurement taken prior to the start of CER-001 therapy.
  • the therapy can in some embodiments be continued until the subject has recovered from the infection.
  • the dosing regimens of the disclosure can entail administering a lipid binding proteinbased complex (e.g., CER-001 ) to a subject according to an initial “induction” regimen, optionally followed by administering the lipid binding protein-based complex to the subject according to a “consolidation” regimen.
  • a lipid binding proteinbased complex e.g., CER-001
  • the induction regimen typically comprises administering multiple doses of the lipid binding protein-based complex (e.g., CER-001 ) to the subject, for example six doses over three days.
  • the lipid binding protein-based complex e.g., CER-001
  • the consolidation regimen typically comprises administering one or more doses of a lipid binding protein-based complex (e.g., CER-001 ) to the subject following the final dose of the induction regimen, for example one or more days after the final dose of the induction regimen.
  • the first dose of the consolidation regimen is administered on the third day after the final dose of the induction regimen.
  • a dosing regimen can comprise administration of a lipid binding protein-based complex (e.g., CER-001 ) to a subject according to an induction regimen on days 1, 2, and 3, and administration of the lipid binding protein-based complex to the subject according to a consolidation regimen on day 6.
  • the consolidation regimen comprises two doses of the lipid binding protein-based complex.
  • the disclosure provides methods of treating a subject as described herein with a lipid binding protein-based complex (e.g., CER-001 ) according to a dosage regimen comprising:
  • the regimen comprises:
  • the dosage regimen comprises a single phase, e.g., corresponding to an induction regimen described herein.
  • a lipid binding protein-based complex (e.g., CER-001 ) is administered in combination with a standard of care therapy such as antibiotic therapy for an infection and/or hemodynamic support.
  • a standard of care therapy such as antibiotic therapy for an infection and/or hemodynamic support.
  • an antihistamine e.g., dexchlorpheniramine, hydroxyzine, diphenhydramine, cetirizine, fexofenadine, or loratadine
  • a lipid binding protein-based complex e.g., CER-001
  • the antihistamine can reduce the likelihood of allergic reactions.
  • FIG. 1 shows IL-6 serum levels in a pig model of sepsis-induced AKI (Example 1).
  • FIG. 2 shows soluble VCAM-1 serum levels in a pig model of sepsis-induced AKI (Example 2).
  • FIG. 3 shows soluble ICAM-1 serum levels in a pig model of sepsis-induced AKI (Example 3).
  • FIG. 4 shows LPS serum levels in a pig model of sepsis-induced AKI (Example 1).
  • FIG. 5 shows a schematic of the clinical study of Example 2.
  • FIG. 6 is a flowsheet for the study of Example 3.
  • FIG. 7 is a flowsheet for the study of Example 4.
  • FIGS. 8A-8J show change in MCP1 (FIG. 8A), TNF-a (FIG. 8B), VCAM (FIG. 8C), ICAM (FIG. 8D), Ferritin (FIG. 8E), white blood cell (FIG. 8F), CRP (FIG. 8G), KIM-1 (FIG. 8H), IL-8 (FIG. 81), and triglycerides (FIG. 8J) in the first cohort of subjects treated in the study of Example 2.
  • FIGS. 9A-9F show VCAM changes for the standard of care (SOO) group and the three CER-001 groups in the clinical study of Example 2.
  • FIG. 9A changes from baseline for SOO group versus aggregated CER-001 groups.
  • FIG. 9B changes from baseline for each of group.
  • FIG. 9C changes as a percentage of peak for the SOC group and the aggregated study groups.
  • FIG. 9D changes as a percentage of peak for the SOC group and the study groups, broken out by whether the subject was enrolled from the ICU or the nephrology department of the center.
  • FIG. 9E changes from baseline for each subject in the SOC and the aggregated CER-001 groups.
  • FIG. 9F changes from baseline for each subject in the SOC group and each study group.
  • FIGS. 10A-10F show ICAM changes for the standard of care (SOC) group and the three CER-001 groups in the clinical study of Example 2.
  • FIG. 10A changes from baseline for SOC group versus aggregated CER-001 groups.
  • FIG. 10B changes from baseline for each of group.
  • FIG. 10C changes as a percentage of peak for the SOC group and the aggregated study groups.
  • FIG. 10D changes as a percentage of peak for the SOC group and the study groups, broken out by whether the subject was enrolled from the ICU or the nephrology department of the center.
  • FIG. 10E changes from baseline for each subject in the SOC and the aggregated CER-001 groups.
  • FIG. 10F changes from baseline for each subject in the SOC group and each study group.
  • FIG. 11 shows MTT cell viability assay results for cultured endothelial cells upon challenge with LPS and CER-001 infusions, as described in Example 6.
  • FIG. 12 summarizes endothelial nitric oxide synthase (eNOS)-based (eNOS(phosphoS1177)) FACS results for cultured endothelial cells upon challenge with LPS and CER-001 infusions, as described in Example 6.
  • eNOS endothelial nitric oxide synthase
  • FIG. 13 shows eNOS(phosphoS1177)-based FACS results for cultured endothelial cells upon challenge with LPS and CER-001 infusions in one representative of three independent experiments, compared to basal and VEFG (positive control) cells, as described in Example 6.
  • FIG. 14 shows MTT cell viability assay results for PBMCs from healthy donors upon challenge with LPS and CER-001 infusions, as described in Example 6.
  • FIG. 15 shows TNF-a synthesis for PBMCs from healthy donors upon challenge with LPS and CER-001 infusions, as described in Example 6.
  • FIG. 16 shows CD14-based FACS results for PBMCs from healthy donors upon challenge with LPS and CER-001 infusions in one representative of three independent experiments, as described in Example 6.
  • FIG. 17 summarizes CD14-based FACS results for PBMCs from healthy donors upon challenge with LPS and CER-001 infusions, as described in Example 6.
  • FIG. 18A-FIG. 18F show white blood cell count changes for the standard of care (SOC) group and the CER-001 groups in the clinical study of Example 2.
  • FIG. 18A white blood cell count changes from baseline for SOC group and aggregated CER-001 groups.
  • FIG. 18B white blood cell count changes from baseline for SOC group and each CER-001 group.
  • FIG. 18D white blood cell count changes for SOC group and aggregated CER-001 groups, broken out by whether the subject was enrolled from the ICll or the nephrology department of the center.
  • FIG. 18E individual data points summarized in FIG. 18A.
  • FIG. 18F individual data points summarized in FIG. 18B.
  • the disclosure provides methods for treating subjects having or at risk of developing leukocytosis with a dose (e.g., a high dose) of a lipid binding protein-based complex.
  • a dose e.g., a high dose
  • the disclosure provides methods for treating subjects having one or more symptoms associated with leukocytosis, comprising administering to the subject a dose of a lipid binding protein-based complex with a dose (e.g., a high dose) of a lipid binding proteinbased complex.
  • a dose e.g., a high dose
  • the disclosure provides methods for treating subjects having endothelial dysfunction (e.g., subjects having acute coronary syndrome or stroke or who has experienced acute coronary syndrome or stroke) with a dose (e.g., a high dose) of a lipid binding protein-based complex.
  • a dose e.g., a high dose
  • the disclosure provides methods of treating a subject experiencing acute coronary syndrome or stroke or who has experienced acute coronary syndrome or stroke with a high dose of a lipid binding protein-based complex.
  • the disclosure provides methods of treating a subject having or at risk of developing carditis with a dose (e.g., a high dose) of a lipid binding protein-based complex.
  • a dose e.g., a high dose
  • the lipid binding protein-based complex is an Apomer, a Cargomer, a HDL based complex, or a HDL mimetic based complex.
  • the lipid binding protein-based complex is CER-001.
  • lipid binding protein-based complexes that can be used in the methods and compositions of the disclosure are described in Section 5.1.
  • Exemplary subject populations who can be treated by the methods of the disclosure and with the compositions of the disclosure are described in Section 5.2.
  • methods of the disclosure comprise administering a lipid binding protein-based complex (e.g., CER-001 ) to a subject in two phases.
  • a lipid binding protein-based complex e.g., CER-001
  • the lipid binding protein-based complex is administered in an initial, intense “induction” regimen.
  • the induction regimen is followed by a less intense “consolidation” regimen.
  • a lipid binding protein-based complex e.g., CER-001
  • can be administered to a subject in a single phase for example according to an administration regimen corresponding to the dose and administration frequency of an induction or consolidation regimen described herein.
  • Induction regimens that can be used in the methods of the disclosure are described in Section 5.3 and consolidation regimens that can be used in the methods of the disclosure are described in Section 5.3.2.
  • the dosing regimens of the disclosure comprise administering a lipid binding protein-based complex (e.g., CER-001 ) as monotherapy or as part of a combination therapy with one or more medications, for example in combination with a standard of care therapy for sepsis or other infection such as antibiotic treatment and/or hemodynamic support.
  • Combination therapies are described in Section 5.4.
  • the lipid binding protein-based complexes comprise HDL or HDL mimeticbased complexes.
  • complexes can comprise a lipoprotein complex as described in U.S. Patent No. 8,206,750, PCT publication WO 2012/109162, PCT publication WO
  • lipoproteins and “apolipoproteins” are used interchangeably herein, and unless required otherwise by context, the term “lipoprotein” encompasses lipoprotein mimetics.
  • lipid binding protein and “lipid binding polypeptide” are also used interchangeably herein, and unless required otherwise by context, the terms do not connote an amino acid sequence of particular length.
  • Lipoprotein complexes can comprise a protein fraction (e.g., an apolipoprotein fraction) and a lipid fraction (e.g., a phospholipid fraction).
  • the protein fraction includes one or more lipid-binding protein molecules, such as apolipoproteins, peptides, or apolipoprotein peptide analogs or mimetics, for example one or more lipid binding protein molecules described in Section 5.1 .2.
  • the lipid fraction typically includes one or more phospholipids which can be neutral, negatively charged, positively charged, or a combination thereof.
  • phospholipids which can be neutral, negatively charged, positively charged, or a combination thereof.
  • Exemplary phospholipids and other amphipathic molecules which can be included in the lipid fraction are described in Section 5.1.4.
  • the lipid fraction contains at least one neutral phospholipid (e.g., a sphingomyelin (SM)) and, optionally, one or more negatively charged phospholipids.
  • the neutral and negatively charged phospholipids can have fatty acid chains with the same or different number of carbons and the same or different degree of saturation.
  • the neutral and negatively charged phospholipids will have the same acyl tail, for example a C16:0, or palmitoyl, acyl chain.
  • the weight ratio of the apolipoprotein fraction: lipid fraction ranges from about 1 :2.7 to about 1 :3 (e.g., 1 :2.7).
  • any phospholipid that bears at least a partial negative charge at physiological pH can be used as the negatively charged phospholipid.
  • Non-limiting examples include negatively charged forms, e.g., salts, of phosphatidylinositol, a phosphatidylserine, a phosphatidylglycerol and a phosphatidic acid.
  • the negatively charged phospholipid is 1 ,2- dipalmitoyl-sn-glycero-3-[phospho-rac-(1-glycerol)], or DPPG, a phosphatidylglycerol.
  • Preferred salts include potassium and sodium salts.
  • a lipoprotein complex used in the methods of the disclosure is a lipoprotein complex as described in U.S. Patent No. 8,206,750 or WO 2012/109162 (and its U.S. counterpart, US 2012/0232005), the contents of each of which are incorporated herein in its entirety by reference.
  • the protein component of the lipoprotein complex is as described in Section 6.1 and preferably in Section 6.1.1 of WO 2012/109162 (and US 2012/0232005), the lipid component is as described in Section 6.2 of WO 2012/109162 (and US 2012/0232005), which can optionally be complexed together in the amounts described in Section 6.3 of WO 2012/109162 (and US 2012/0232005).
  • a lipoprotein complex of the disclosure is in a population of complexes that is at least 85%, at least 90%, at least 95%, at least 97%, or at least 99% homogeneous, as described in Section 6.4 of WO 2012/109162 (and US 2012/0232005), the contents of which are incorporated by reference herein.
  • a lipoprotein complex that can be used in the methods of the disclosure comprises 2-4 ApoA-l equivalents, 2 molecules of charged phospholipid, 60 molecules of lecithin and 40 molecules of SM.
  • a lipoprotein complex that can be used in the methods of the disclosure consists essentially of 2-4 ApoA-l equivalents, 2 molecules of charged phospholipid, 50-80 molecules of lecithin and 20-50 molecules of SM.
  • a lipoprotein complex that can be used in the methods of the disclosure consists essentially of 2-4 ApoA-l equivalents, 2 molecules of charged phospholipid, 50 molecules of lecithin and 50 molecules of SM.
  • a lipoprotein complex that can be used in the methods of the disclosure consists essentially of 2-4 ApoA-l equivalents, 2 molecules of charged phospholipid, 80 molecules of lecithin and 20 molecules of SM.
  • a lipoprotein complex that can be used in the methods of the disclosure consists essentially of 2-4 ApoA-l equivalents, 2 molecules of charged phospholipid, 70 molecules of lecithin and 30 molecules of SM.
  • a lipoprotein complex that can be used in the methods of the disclosure consists essentially of 2-4 ApoA-l equivalents, 2 molecules of charged phospholipid, 60 molecules of lecithin and 40 molecules of SM.
  • a lipoprotein complex that can be used in the methods of the disclosure consists essentially of about 90 to 99.8 wt % lecithin and about 0.2 to 10 wt % negatively charged phospholipid, for example, about 0.2-1 wt %, 0.2-2 wt %, 0.2-3 wt %, 0.2-4 wt %, 0.2-5 wt %, 0.2-6 wt %, 0.2-7 wt %, 0.2-8 wt %, 0.2-9 wt % or 0.2-10 wt % total negatively charged phospholipid(s).
  • HDL-based or HDL mimetic-based complexes can include a single type of lipid-binding protein, or mixtures of two or more different lipid-binding proteins, which may be derived from the same or different species.
  • the complexes will preferably comprise lipid-binding proteins that are derived from, or correspond in amino acid sequence to, the animal species being treated, in order to avoid inducing an immune response to the therapy.
  • lipid-binding proteins of human origin are preferably used for treatment of human patients.
  • the use of peptide mimetic apolipoproteins may also reduce or avoid an immune response.
  • the lipid component includes two types of phospholipids: a sphingomyelin (SM) and a negatively charged phospholipid.
  • SM sphingomyelin
  • exemplary SMs and negatively charged lipids are described in Section 5.1.4.1.
  • Lipid components including SM can optionally include small quantities of additional lipids.
  • Virtually any type of lipids may be used, including, but not limited to, lysophospholipids, galactocerebroside, gangliosides, cerebrosides, glycerides, triglycerides, and cholesterol and its derivatives.
  • the optional lipids When included, such optional lipids will typically comprise less than about 15 wt% of the lipid fraction, although in some instances more optional lipids could be included. In some embodiments, the optional lipids comprise less than about 10 wt%, less than about 5 wt%, or less than about 2 wt%. In some embodiments, the lipid fraction does not include optional lipids.
  • the phospholipid fraction contains egg SM or palmitoyl SM or phytosphingomyelin and DPPG in a weight ratio (SM: negatively charged phospholipid) ranging from 90:10 to 99:1 , more preferably ranging from 95:5 to 98:2. In one embodiment, the weight ratio is 97:3.
  • the molar ratio of the lipid component to the protein component of complexes of the disclosure can vary, and will depend upon, among other factors, the identity(ies) of the apolipoprotein comprising the protein component, the identities and quantities of the lipids comprising the lipid component, and the desired size of the complex. Because the biological activity of apolipoproteins such as ApoA-l are thought to be mediated by the amphipathic helices comprising the apolipoprotein, it is convenient to express the apolipoprotein fraction of the lipid :apolipoprotein molar ratio using ApoA-l protein equivalents.
  • ApoA-l contains 6-10 amphipathic helices, depending upon the method used to calculate the helices.
  • Other apolipoproteins can be expressed in terms of ApoA-l equivalents based upon the number of amphipathic helices they contain.
  • ApoA-lM which typically exists as a disulfide-bridged dimer, can be expressed as 2 ApoA-l equivalents, because each molecule of ApoA-lM contains twice as many amphipathic helices as a molecule of ApoA-l.
  • a peptide apolipoprotein that contains a single amphipathic helix can be expressed as a 1/10-1/6 ApoA-l equivalent, because each molecule contains 1/10-1/6 as many amphipathic helices as a molecule of ApoA-l.
  • the lipid:ApoA-l equivalent molar ratio of the lipoprotein complexes (defined herein as “Ri”) will range from about 105:1 to 110:1.
  • the Ri is about 108:1. Ratios in weight can be obtained using a MW of approximately 650-800 for phospholipids.
  • the molar ratio of lipid : ApoA-l equivalents ranges from about 80:1 to about 110:1 , e.g., about 80:1 to about 100:1.
  • the RSM for complexes can be about 82:1 .
  • lipoprotein complexes used in the methods of the disclosure are negatively charged complexes which comprise a protein fraction which is preferably mature, full-length ApoA-l, and a lipid fraction comprising a neutral phospholipid, sphingomyelin (SM), and negatively charged phospholipid.
  • SM sphingomyelin
  • the lipid component contains SM (e.g., egg SM, palmitoyl SM, phytoSM, or a combination thereof) and negatively charged phospholipid (e.g., DPPG) in a weight ratio (SM : negatively charged phospholipid) ranging from 90:10 to 99:1 , more preferably ranging from 95:5 to 98:2, e.g., 97:3.
  • SM negatively charged phospholipid
  • the ratio of the protein component to lipid component can range from about 1 .2.7 to about 1 :3, with 1 .2.7 being preferred. This corresponds to molar ratios of ApoA-l protein to lipid ranging from approximately 1 :90 to 1 :140. In some embodiments, the molar ratio of protein to lipid in the complex is about 1 :90 to about 1 :120, about 1 :100 to about 1 :140, or about 1 :95 to about 1 :125.
  • the complex comprises CER-001 , CSL-111 , CSL-112, CER- 522 or ETC-216.
  • the complex is CER-001.
  • CER-001 as used in the literature and in the Examples below refers to a complex described in Example 4 of WO 2012/109162.
  • WO 2012/109162 refers to CER-001 as a complex having a 1 .2.7 lipoprotein weighttotal phospholipid weight ratio with a SM:DPPG weightweight ratio of 97:3.
  • Example 4 of WO 2012/109162 also describes a method of its manufacture.
  • CER-001 refers to a lipoprotein complex whose individual constituents can vary from CER-001 as described in Example 4 of WO 2012/109162 by up to 20%.
  • the constituents of the lipoprotein complex vary from CER-001 as described in Example 4 of WO 2012/109162 by up to 10%.
  • the constituents of the lipoprotein complex are those described in Example 4 of WO 2012/109162 (plus/minus acceptable manufacturing tolerance variations).
  • the SM in CER-001 can be natural or synthetic.
  • the SM is a natural SM, for example a natural SM described in WO 2012/109162, e.g., chicken egg SM.
  • the SM is a synthetic SM, for example a synthetic SM described in WO 2012/109162, e.g., synthetic palmitoylsphingomyelin, for example as described in WO 2012/109162. Methods for synthesizing palmitoylsphingomyelin are known in the art, for example as described in WO 2014/140787.
  • the lipoprotein in CER-001 apolipoprotein A-l (ApoA-l), preferably has an amino acid sequence corresponding to amino acids 25 to 267 of SEQ ID NO:1 of WO 2012/109162 (identical to SEQ ID NO:2 of this application).
  • ApoA-l can be purified by animal sources (and in particular from human sources) or produced recombinantly.
  • the ApoA-l in CER-001 is recombinant ApoA-l.
  • CER-001 used in a dosing regimen of the disclosure is preferably highly homogeneous, for example at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% homogeneous, as reflected by a single peak in gel permeation chromatography. See, e.g., Section 6.4 of WO 2012/109162.
  • CSL-111 is a reconstituted human ApoA-l purified from plasma complexed with soybean phosphatidylcholine (SBPC) (Tardif et al., 2007, JAMA 297:1675-1682).
  • SBPC soybean phosphatidylcholine
  • CSL-112 is a formulation of ApoA-l purified from plasma and reconstituted to form HDL suitable for intravenous infusion (Diditchenko et al., 2013, DOI 10.1161/ ATVBAHA.113.301981 ).
  • ETC-216 also known as MDCO-216 is a lipid-depleted form of HDL containing recombinant ApoA-lMiiano. See Nicholls et al., 2011 , Expert Opin Biol Ther. 11 (3):387-94. doi: 10.1517/14712598.2011 .557061.
  • CER-522 is a lipoprotein complex comprising a combination of three phospholipids and a 22 amino acid peptide, CT80522:
  • the phospholipid component of CER-522 consists of egg sphingomyelin, 1 ,2-dipalmitoyl- sn-glycero-3-phosphocholine (Dipalmitoylphosphatidylcholine, DPPC) and 1 ,2-dipalmitoyl-sn- glycero-3-[phospho-/'ac-(1-glycerol)] (Dipalmitoylphosphatidyl- glycerol, DPPG) in a 48.5:48.5:3 weight ratio.
  • the ratio of peptide to total phospholipids in the CER-522 complex is 1 :2.5 (w/w).
  • the lipoprotein complex is delipidated HDL.
  • Most HDL in plasma is cholesterol-rich.
  • the lipids in HDL can be depleted, for example partially and/or selectively depleted, e.g., to reduce its cholesterol content.
  • the delipidated HDL can resemble small a, pre0-1 , and other prep forms of HDL. A process for selective depletion of HDL is described in Sacks et al., 2009, J Lipid Res. 50(5): 894-907.
  • a lipoprotein complex comprises a bioactive agent delivery particle as described in US 2004/0229794.
  • a bioactive agent delivery particle can comprise a lipid binding polypeptide (e.g., an apolipoprotein as described previously in this Section or in Section 5.1.2), a lipid bilayer (e.g., comprising one or more phospholipids as described previously in this Section or in Section 5.1 .4.1 ), and a bioactive agent (e.g., an anti-cancer agent), wherein the interior of the lipid bilayer comprises a hydrophobic region, and wherein the bioactive agent is associated with the hydrophobic region of the lipid bilayer.
  • a bioactive agent delivery particle as described in US 2004/0229794.
  • a bioactive agent delivery particle does not comprise a hydrophilic core.
  • a bioactive agent delivery particle is disc shaped (e.g., having a diameter from about 7 to about 29 nm).
  • Bioactive agent delivery particles include bilayer-forming lipids, for example phospholipids (e.g., as described previously in this Section or in Section 5.1.4.1 ).
  • a bioactive agent delivery particle includes both bilayer-forming and non-bilayer- forming lipids.
  • the lipid bilayer of a bioactive agent delivery particle includes phospholipids.
  • the phospholipids incorporated into a delivery particle include dimyristoylphosphatidylcholine (DMPC) and dimyristoylphosphatidylglycerol (DMPG).
  • the lipid bilayer includes DMPC and DMPG in a 7:3 molar ratio.
  • the lipid binding polypeptide is an apolipoprotein (e.g., as described previously in this Section or in Section 5.1.2).
  • the predominant interaction between lipid binding polypeptides, e.g., apolipoprotein molecules, and the lipid bilayer is generally a hydrophobic interaction between residues on a hydrophobic face of an amphipathic structure, e.g., an a-helix of the lipid binding polypeptide and fatty acyl chains of lipids on an exterior surface at the perimeter of the particle.
  • Bioactive agent delivery particles may include exchangeable and/or non-exchangeable apolipoproteins.
  • the lipid binding polypeptide is ApoA-L
  • bioactive agent delivery particles include lipid binding polypeptide molecules, e.g., apolipoprotein molecules, that have been modified to increase stability of the particle.
  • the modification includes introduction of cysteine residues to form intramolecular and/or intermolecular disulfide bonds.
  • bioactive agent delivery particles include a chimeric lipid binding polypeptide molecule, e.g., a chimeric apolipoprotein molecule, with one or more bound functional moieties, for example one or more targeting moieties and/or one or more moieties having a desired biological activity, e.g., antimicrobial activity, which may augment or work in synergy with the activity of a bioactive agent incorporated into the delivery particle.
  • a chimeric lipid binding polypeptide molecule e.g., a chimeric apolipoprotein molecule
  • one or more bound functional moieties for example one or more targeting moieties and/or one or more moieties having a desired biological activity, e.g., antimicrobial activity, which may augment or work in synergy with the activity of a bioactive agent incorporated into the delivery particle.
  • the disclosure relates to an ApoA-l formulation comprising ApoA-l and one or more lipids, wherein the ApoA-l and the lipids are in the form of lipoprotein complexes.
  • the ApoA-l can be any such apolipoprotein described in Section 5.1.3.1 , including, among others, ApoA-l having the amino acid sequence of amino acids 25-267 of SEQ ID NO:2 and/or ApoA-l that is recombinantly expressed.
  • the lipids can be any one or more of those described in Section 5.1 .4.1 .
  • the lipids can include neutral lipids and/or negatively charged lipids.
  • the neutral lipids can comprise sphingomyelin or consist of sphingomyelin, such as natural sphingomyelin (e.g., chicken egg sphingomyelin) and/or synthetic sphingomyelin (e.g., palmitoylsphingomyelin).
  • the negatively charged lipids can comprise 1 ,2-dipalmitoyl-sn-glycero-3-[phospho-rac-( 1-glycerol)] ("DPPG”) or a salt thereof, or consist of DPPG or a salt thereof.
  • the lipids can include neutral phospholipid and negatively charged phospholipid at any weight or molar ratio described herein.
  • the lipids can consist of 95 to 99 weight % neutral phospholipid and 1 to 5 weight % negatively charged phospholipid, such as 96 to 98 weight % neutral phospholipid and 2 to 4 weight % negatively charged phospholipid, or 97 weight % neutral phospholipid and 3 weight % negatively charged phospholipid.
  • the formulations can comprise ApoA-l and the lipids at any weight or molar ratio described herein.
  • the molar ratio of the components of the negatively charged lipid to the neutral lipid to the ApoA-l in the formulation is 2-6:90-120:1.
  • Exemplary formulations can include ApoA-l to lipid ratios ranging from 1 :2 to 1 :3 by weight, such as about 1 .2.7 by weight.
  • the formulations can be used in a method of treating a subject having one or more symptoms associated with leukocytosis, having endothelial dysfunction, having or at risk of developing carditis, having or at risk of developing leukocytosis, experiencing acute coronary syndrome or stroke, and/or who has experienced acute coronary syndrome or stroke, such as the methods described at Sections 5.2-5.4.
  • the formulations can also be for use in treating such diseases or disorders.
  • the formulations can also be for use in the manufacture of a medicament for treating such diseases or disorders.
  • ApoA-l formulations and uses thereof include those set forth as numbered embodiments 1-72 of Group 2.
  • Lipid binding protein molecules that can be used in the complexes described herein include apolipoproteins such as those described in Section 5.1.3.1 and apolipoprotein mimetic peptides such as those described in Section 5.1.3.2.
  • the complex comprises a mixture of lipid binding protein molecules.
  • the complex comprises a mixture of one or more lipid binding protein molecules and one or more apolipoprotein mimetic peptides.
  • the complex comprises 1 to 8 ApoA-l equivalents (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, 1 to 2, 2 to 8, 2 to 6, 2 to 4, 4 to 6, or 4 to 8 ApoA-l equivalents).
  • Lipid binding proteins can be expressed in terms of ApoA-l equivalents based upon the number of amphipathic helices they contain.
  • ApoA-lM which typically exists as a disulfide-bridged dimer, can be expressed as 2 ApoA-l equivalents, because each molecule of ApoA-lM contains twice as many amphipathic helices as a molecule of ApoA-l.
  • a peptide mimetic that contains a single amphipathic helix can be expressed as a 1/10-1/6 ApoA-l equivalent, because each molecule contains 1/10-1/6 as many amphipathic helices as a molecule of ApoA-l.
  • Suitable apolipoproteins that can be included in the lipid binding protein-based complexes include apolipoproteins ApoA-l, ApoA-ll, ApoA-IV, ApoA-V, ApoB, ApoC-l, ApoC-ll, ApoC-l 11 , ApoD, ApoE, ApoJ, ApoH, and any combination of two or more of the foregoing.
  • apolipoproteins Polymorphic forms, isoforms, variants and mutants as well as truncated forms of the foregoing apolipoproteins, the most common of which are Apolipoprotein A-l Milano (ApoA-lM), Apolipoprotein A-IParis (ApoA-IP), and Apolipoprotein A-IZaragoza (ApoA-IZ), can also be used.
  • Apolipoproteins mutants containing cysteine residues are also known, and can also be used (see, e.g., U.S. Publication No. 2003/018132).
  • the apolipoproteins may be in the form of monomers or dimers, which may be homodimers or heterodimers.
  • the apolipoproteins can be modified in their primary sequence to render them less susceptible to oxidations, for example, as described in U.S. Publication Nos. 2008/0234192 and 2013/0137628, and U.S. Patent Nos. 8,143,224 and 8,541 ,236.
  • the apolipoproteins can include residues corresponding to elements that facilitate their isolation, such as His tags, or other elements designed for other purposes.
  • the apolipoprotein in the complex is soluble in a biological fluid (e.g., lymph, cerebrospinal fluid, vitreous humor, aqueous humor, blood, or a blood fraction (e.g., serum or plasma).
  • a biological fluid e.g., lymph, cerebrospinal fluid, vitreous humor, aqueous humor, blood, or a blood fraction (e.g., serum or plasma).
  • the complex comprises covalently bound lipid-binding protein monomers, e.g., dimeric apolipoprotein A-l Milano, which is a mutated form of ApoA-l containing a cysteine.
  • the cysteine allows the formation of a disulfide bridge which can lead to the formation of homodimers or heterodimers (e.g., ApoA-l Milano-ApoA-ll).
  • the apolipoprotein molecules comprise ApoA-l, ApoA-ll, ApoA- IV, ApoA-V, ApoB, ApoC-l, ApoC-ll, ApoC-lll, ApoD, ApoE, ApoJ, or ApoH molecules or a combination thereof.
  • the apolipoprotein molecules comprise or consist of ApoA-l molecules.
  • said ApoA-l molecules are human ApoA-l molecules.
  • said ApoA-l molecules are recombinant.
  • the ApoA- I molecules are not ApoA-l Milano.
  • the ApoA-l molecules are Apolipoprotein A-l Milano (ApoA-IM), Apolipoprotein A-IParis (ApoA-IP), or Apolipoprotein A-IZaragoza (ApoA-IZ) molecules.
  • Apolipoproteins can be purified from animal sources (and in particular from human sources) or produced recombinantly as is well-known in the art, see, e.g., Chung et al., 1980, J. Lipid Res. 21 (3):284-91 ; Cheung et al., 1987, J. Lipid Res. 28(8):913-29. See also U.S. Patent Nos. 5,059,528, 5,128,318, 6,617,134; U.S. Publication Nos. 2002/0156007, 2004/0067873, 2004/0077541 , and 2004/0266660; and PCT Publications Nos. WO 2008/104890 and WO 2007/023476. Other methods of purification are also possible, for example as described in PCT Publication No. WO 2012/109162, the disclosure of which is incorporated herein by reference in its entirety.
  • the apolipoprotein can be in prepro- form, pro- form, or mature form.
  • a complex can comprise ApoA-l (e.g., human ApoA-l) in which the ApoA-l is preproApoA-l, proApoA-l, or mature ApoA-l.
  • the complex comprises ApoA-l that has at least 90% sequence identity to SEQ ID NO:1 : PPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQL GPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAE LQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGA RLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ (SEQ ID NO:1)
  • the complex comprises ApoA-l that has at least 95% sequence identity to SEQ ID NO:1. In other embodiments, the complex comprises ApoA-l that has at least 98% sequence identity to SEQ ID NO:1. In other embodiments, the complex comprises ApoA-l that has at least 99% sequence identity to SEQ ID NO:1 . In other embodiments, the complex comprises ApoA-l that has 100% sequence identity to SEQ ID NO:1.
  • the complex comprises 1 to 8 apolipoprotein molecules (e.g., 1 to 6, 1 to 4, 1 to 2, 2 to 8, 2 to 6, 2 to 4, 4 to 8, 4 to 6, or 6 to 8 apolipoprotein molecules).
  • the complex comprises 1 apolipoprotein molecule.
  • the complex comprises 2 apolipoprotein molecules.
  • the complex comprises 3 apolipoprotein molecules.
  • the complex comprises 4 apolipoprotein molecules.
  • the complex comprises 5 apolipoprotein molecules.
  • the complex comprises 6 apolipoprotein molecules.
  • the complex comprises 7 apolipoprotein molecules.
  • the complex comprises 8 apolipoprotein molecules.
  • the apolipoprotein molecule(s) can comprise a chimeric apolipoprotein comprising an apolipoprotein and one or more attached functional moieties, such as for example, one or more CRN-001 complex(es), one or more targeting moieties, a moiety having a desired biological activity, an affinity tag to assist with purification, and/or a reporter molecule for characterization or localization studies.
  • An attached moiety with biological activity may have an activity that is capable of augmenting and/or synergizing with the biological activity of a compound incorporated into a complex of the disclosure.
  • a moiety with biological activity may have antimicrobial (for example, antifungal, antibacterial, anti-protozoal, bacteriostatic, fungistatic, or antiviral) activity.
  • an attached functional moiety of a chimeric apolipoprotein is not in contact with hydrophobic surfaces of the complex.
  • an attached functional moiety is in contact with hydrophobic surfaces of the complex.
  • a functional moiety of a chimeric apolipoprotein may be intrinsic to a natural protein.
  • a chimeric apolipoprotein includes a ligand or sequence recognized by or capable of interaction with a cell surface receptor or other cell surface moiety.
  • a chimeric apolipoprotein includes a targeting moiety that is not intrinsic to the native apolipoprotein, such as for example, S. cerevisiae a-mating factor peptide, folic acid, transferrin, or lactoferrin.
  • a chimeric apolipoprotein includes a moiety with a desired biological activity that augments and/or synergizes with the activity of a compound incorporated into a complex of the disclosure.
  • a chimeric apolipoprotein may include a functional moiety intrinsic to an apolipoprotein.
  • an apolipoprotein intrinsic functional moiety is the intrinsic targeting moiety formed approximately by amino acids 130-150 of human ApoE, which comprises the receptor binding region recognized by members of the low density lipoprotein receptor family.
  • Other examples of apolipoprotein intrinsic functional moieties include the region of ApoB-100 that interacts with the low density lipoprotein receptor and the region of ApoA-l that interacts with scavenger receptor type B 1 .
  • a functional moiety may be added synthetically or recombinantly to produce a chimeric apolipoprotein.
  • apolipoprotein with the prepro or pro sequence from another preproapolipoprotein (e.g., prepro sequence from preproapoA-ll substituted for the prepro sequence of preproapoA-l).
  • apolipoprotein for which some of the amphipathic sequence segments have been substituted by other amphipathic sequence segments from another apolipoprotein.
  • chimeric refers to two or more molecules that are capable of existing separately and are joined together to form a single molecule having the desired functionality of all of its constituent molecules.
  • the constituent molecules of a chimeric molecule may be joined synthetically by chemical conjugation or, where the constituent molecules are all polypeptides or analogs thereof, polynucleotides encoding the polypeptides may be fused together recombinantly such that a single continuous polypeptide is expressed.
  • a chimeric molecule is termed a fusion protein.
  • a "fusion protein” is a chimeric molecule in which the constituent molecules are all polypeptides and are attached (fused) to each other such that the chimeric molecule forms a continuous single chain.
  • the various constituents can be directly attached to each other or can be coupled through one or more linkers.
  • One or more segments of various constituents can be, for example, inserted in the sequence of an apolipoprotein, or, as another example, can be added N-terminal or C-terminal to the sequence of an apolipoprotein.
  • a fusion protein can comprise an antibody light chain, an antibody fragment, a heavy-chain antibody, or a single-domain antibody.
  • a chimeric apolipoprotein is prepared by chemically conjugating the apolipoprotein and the functional moiety to be attached.
  • Means of chemically conjugating molecules are well known to those of skill in the art. Such means will vary according to the structure of the moiety to be attached, but will be readily ascertainable to those of skill in the art.
  • Polypeptides typically contain a variety of functional groups, e.g., carboxylic acid (--COOH), free amino (--NH2), or sulfhydryl (--SH) groups, that are available for reaction with a suitable functional group on the functional moiety or on a linker to bind the moiety thereto.
  • a functional moiety may be attached at the N-terminus, the C-terminus, or to a functional group on an interior residue (/.e., a residue at a position intermediate between the N- and C-termini) of an apolipoprotein molecule.
  • the apolipoprotein and/or the moiety to be tagged can be derivatized to expose or attach additional reactive functional groups.
  • fusion proteins that include a polypeptide functional moiety are synthesized using recombinant expression systems. Typically, this involves creating a nucleic acid (e.g., DNA) sequence that encodes the apolipoprotein and the functional moiety such that the two polypeptides will be in frame when expressed, placing the DNA under the control of a promoter, expressing the protein in a host cell, and isolating the expressed protein.
  • a nucleic acid e.g., DNA
  • a nucleic acid encoding a chimeric apolipoprotein can be incorporated into a recombinant expression vector in a form suitable for expression in a host cell.
  • an "expression vector” is a nucleic acid which, when introduced into an appropriate host cell, can be transcribed and translated into a polypeptide.
  • the vector may also include regulatory sequences such as promoters, enhancers, or other expression control elements (e.g., polyadenylation signals). Such regulatory sequences are known to those skilled in the art (see, e.g., Goeddel, 1990, Gene Expression Technology: Meth. Enzymol.
  • an apolipoprotein has been modified such that when the apolipoprotein is incorporated into a complex of the disclosure, the modification will increase stability of the complex, confer targeting ability or increase capacity.
  • the modification includes introduction of cysteine residues into apolipoprotein molecules to permit formation of intramolecular or intermolecular disulfide bonds, e.g., by site-directed mutagenesis.
  • a chemical crosslinking agent is used to form intermolecular links between apolipoprotein molecules to enhance stability of the complex.
  • Intermolecular crosslinking prevents or reduces dissociation of apolipoprotein molecules from the complex and/or prevents displacement by endogenous apolipoprotein molecules within an individual to whom the complexes are administered.
  • an apolipoprotein is modified either by chemical derivatization of one or more amino acid residues or by site directed mutagenesis, to confer targeting ability to or recognition by a cell surface receptor.
  • Complexes can be targeted to a specific cell surface receptor by engineering receptor recognition properties into an apolipoprotein.
  • complexes may be targeted to a particular cell type known to harbor a particular type of infectious agent, for example by modifying the apolipoprotein to render it capable of interacting with a receptor on the surface of the cell type being targeted.
  • complexes may be targeted to macrophages by altering the apolipoprotein to confer recognition by the macrophage endocytic class A scavenger receptor (SR-A).
  • SR-A binding ability can be conferred to a complex by modifying the apolipoprotein by site directed mutagenesis to replace one or more positively charged amino acids with a neutral or negatively charged amino acid.
  • SR-A recognition can also be conferred by preparing a chimeric apolipoprotein that includes an N- or C-terminal extension having a ligand recognized by SR-A or an amino acid sequence with a high concentration of negatively charged residues.
  • Complexes comprising apoplipoproteins can also interact with apolipoprotein receptors such as, but not limited to, ABCA1 receptors, ABCG1 receptors, Megalin, Cubulin and HDL receptors such as SR-B1.
  • Peptides, peptide analogs, and agonists that mimic the activity of an apolipoprotein can also be used in the complexes described herein, either alone, in combination with one or more other lipid binding proteins.
  • apolipoprotein peptide mimetics can also be used in the complexes described herein, either alone, in combination with one or more other lipid binding proteins.
  • Non-limiting examples of peptides and peptide analogs that correspond to apolipoproteins, as well as agonists that mimic the activity of ApoA-l, ApoA-lM, ApoA-ll, ApoA- IV, and ApoE, that are suitable for inclusion in the complexes and compositions described herein are disclosed in U.S. Pat. Nos.
  • peptides and peptide analogues can be composed of L-amino acid or D-amino acids or mixture of L- and D-amino acids. They may also include one or more non-peptide or amide linkages, such as one or more well-known peptide/amide isosteres.
  • Such apolipoprotein peptide mimetic can be synthesized or manufactured using any technique for peptide synthesis known in the art, including, e.g., the techniques described in U.S. Pat. Nos. 6,004,925, 6,037,323 and 6,046,166.
  • the lipid binding protein molecules comprise apolipoprotein peptide mimetic molecules and optionally one or more apolipoprotein molecules such as those described above.
  • the apolipoprotein peptide mimetic molecules comprise an ApoA-l peptide mimetic, ApoA-ll peptide mimetic, ApoA-IV peptide mimetic, or ApoE peptide mimetic or a combination thereof.
  • amphipathic molecule is a molecule that possesses both hydrophobic (apolar) and hydrophilic (polar) elements.
  • Amphipathic molecules that can be used in complexes described herein include lipids (e.g., as described in Section 5.1.4.1), detergents (e.g., as described in Section 5.1 .4.2), fatty acids (e.g., as described in Section 5.1 .4.3), and apolar molecules and sterols covalently attached to polar molecules such as, but not limited to, sugars or nucleic acids (e.g., as described in Section 5.1.4.4).
  • the complexes can include a single class of amphipathic molecule (e.g., a single species of phospholipids or a mixture of phospholipids) or can contain a combination of classes of amphipathic molecules (e.g., phospholipids and detergents).
  • the complex can contain one species of amphipathic molecules or a combination of amphipathic molecules configured to facilitate solubilization of the lipid binding protein molecule(s).
  • the amphipathic molecules included in comprise a phospholipid, a detergent, a fatty acid, an apolar moiety or sterol covalently attached to a sugar, or a combination thereof (e.g., selected from the types of amphipathic molecules discussed above).
  • the amphipathic molecules comprise or consist of phospholipid molecules.
  • the phospholipid molecules comprise negatively charged phospholipids, neutral phospholipids, positively charged phospholipids or a combination thereof.
  • the phospholipid molecules contribute a net charge of 1-3 per apolipoprotein molecule in the complex. In some embodiments, the net charge is a negative net charge.
  • the net charge is a positive net charge.
  • the phospholipid molecules consist of a combination of negatively charged and neutral phospholipids.
  • the molar ratio of negatively charge phospholipid to neutral phospholipid ranges from 1 :1 to 1 :3. In some embodiments, the molar ratio of negatively charged phospholipid to neutral phospholipid is about 1 :1 or about 1 :2.
  • the amphipathic molecules comprise neutral phospholipids and negatively charged phospholipids in a weight ratio of 95:5 to 99:1.
  • Lipid binding protein-based complexes can include one or more lipids.
  • one or more lipids can be saturated and/or unsaturated, natural and/or synthetic, charged or not charged, zwitterionic or not.
  • the lipid molecules e.g., phospholipid molecules
  • the lipid molecules can together contribute a net charge of 1-3 (e.g., 1-3, 1-2, 2-3, 1 , 2, or 3) per lipid binding protein molecule in the complex. In some embodiments, the net charge is negative. In other embodiments, the net charge is positive.
  • the lipid comprises a phospholipid.
  • Phospholipids can have two acyl chains that are the same or different (for example, chains having a different number of carbon atoms, a different degree of saturation between the acyl chains, different branching of the acyl chains, or a combination thereof).
  • the lipid can also be modified to contain a fluorescent probe (e.g., as described at yorkilipids.com/product-category/products/fluorescent- lipids/).
  • the lipid comprises at least one phospholipid.
  • Phospholipids can have unsaturated or saturated acyl chains ranging from about 6 to about 24 carbon atoms (e.g., 6-20, 6-16, 6-12, 12-24, 12-20, 12-16, 16-24, 16-20, or 20-24).
  • a phospholipid used in a complex of the disclosure has one or two acyl chains of 12, 14, 16, 18, 20, 22, or 24 carbons (e.g., two acyl chains of the same length or two acyl chains of different length).
  • Non-limiting examples of acyl chains present in commonly occurring fatty acids that can be included in phospholipids are provided in Table 1 , below:
  • Lipids that can be present in the complexes of the disclosure include, but are not limited to, small alkyl chain phospholipids, egg phosphatidylcholine, soybean phosphatidylcholine, dipalmitoylphosphatidylcholine, dimyristoylphosphatidylcholine, distearoylphosphatidylcholine 1-myristoyl-2-palmitoylphosphatidylcholine, 1-palmitoyl-2-myristoylphosphatidylcholine, 1- palmitoyl-2-stearoylphosphatidylcholine, 1-stearoyl-2-palmitoylphosphatidylcholine, dioleoylphosphatidylcholine dioleophosphatidylethanolamine, dilauroylphosphatidylglycerol phosphatidylcholine, phosphatidylserine, phosphatidylethanolamine, phosphatidylinositol
  • Synthetic lipids such as synthetic palmitoylsphingomyelin or N-palmitoyl-4- hydroxysphinganine-1 -phosphocholine (a form of phytosphingomyelin) can be used to minimize lipid oxidation.
  • a lipid binding protein-based complex includes two types of phospholipids: a neutral lipid, e.g., lecithin and/or sphingomyelin (abbreviated SM), and a charged phospholipid (e.g., a negatively charged phospholipid).
  • a “neutral” phospholipid has a net charge of about zero at physiological pH.
  • neutral phospholipids are zwitterions, although other types of net neutral phospholipids are known and can be used.
  • the molar ratio of the charged phospholipid (e.g., negatively charged phospholipid) to neutral phospholipid ranges from 1 :1 to 1 :3, for example, about 1 :1 , about 1 :2, or about 1 :3.
  • the neutral phospholipid can comprise, for example, one or both of the lecithin and/or SM, and can optionally include other neutral phospholipids.
  • the neutral phospholipid comprises lecithin, but not SM.
  • the neutral phospholipid comprises SM, but not lecithin.
  • the neutral phospholipid comprises both lecithin and SM. All of these specific exemplary embodiments can include neutral phospholipids in addition to the lecithin and/or SM, but in many embodiments do not include such additional neutral phospholipids.
  • SM includes sphingomyelins derived or obtained from natural sources, as well as analogs and derivatives of naturally occurring SMs that are impervious to hydrolysis by LCAT, as is naturally occurring SM.
  • SM is a phospholipid very similar in structure to lecithin, but, unlike lecithin, it does not have a glycerol backbone, and hence does not have ester linkages attaching the acyl chains. Rather, SM has a ceramide backbone, with amide linkages connecting the acyl chains.
  • SM can be obtained, for example, from milk, egg or brain.
  • SM analogues or derivatives can also be used.
  • Non-limiting examples of useful SM analogues and derivatives include, but are not limited to, palmitoylsphingomyelin, N-palmitoyl-4-hydroxysphinganine-1 -phosphocholine (a form of phytosphingomyelin), palmitoylsphingomyelin, stearoylsphingomyelin, D-erythro-N-16:0-sphingomyelin and its dihydro isomer, D-erythro-N-16:0-dihydro-sphingomyelin.
  • Synthetic SM such as synthetic palmitoylsphingomyelin or N-palmitoyl-4-hydroxysphinganine-1 -phosphocholine (phytosphingomyelin) can be used in order to produce more homogeneous complexes and with fewer contaminants and/or oxidation products than sphingolipids of animal origin. Methods for synthesizing SM are described in U.S. Publication No. 2016/0075634.
  • Sphingomyelins isolated from natural sources can be artificially enriched in one particular saturated or unsaturated acyl chain.
  • milk sphingomyelin (Avanti Phospholipid, Alabaster, Ala.) is characterized by long saturated acyl chains (/.e., acyl chains having 20 or more carbon atoms).
  • egg sphingomyelin is characterized by short saturated acyl chains (/.e., acyl chains having fewer than 20 carbon atoms).
  • milk sphingomyelin comprises C16:0 (16 carbon, saturated) acyl chains
  • egg sphingomyelin comprises C16:0 acyl chains.
  • the composition of milk sphingomyelin can be enriched to have an acyl chain composition comparable to that of egg sphingomyelin, or vice versa.
  • the SM can be semi-synthetic such that it has particular acyl chains.
  • milk sphingomyelin can be first purified from milk, then one particular acyl chain, e.g., the C16:0 acyl chain, can be cleaved and replaced by another acyl chain.
  • the SM can also be entirely synthesized, by e.g., large-scale synthesis. See, e.g., Dong et al., U.S. Pat. No. 5,220,043, entitled Synthesis of D-erythro-sphingomyelins, issued Jun. 15, 1993; Weis, 1999, Chem. Phys. Lipids 102 (1 -2):3-12.
  • the lengths and saturation levels of the acyl chains comprising a semi-synthetic or a synthetic SM can be selectively varied.
  • the acyl chains can be saturated or unsaturated, and can contain from about 6 to about 24 carbon atoms. Each chain can contain the same number of carbon atoms or, alternatively each chain can contain different numbers of carbon atoms.
  • the semi-synthetic or synthetic SM comprises mixed acyl chains such that one chain is saturated and one chain is unsaturated. In such mixed acyl chain SMs, the chain lengths can be the same or different.
  • the acyl chains of the semisynthetic or synthetic SM are either both saturated or both unsaturated. Again, the chains can contain the same or different numbers of carbon atoms.
  • both acyl chains comprising the semi-synthetic or synthetic SM are identical.
  • the chains correspond to the acyl chains of a naturally-occurring fatty acid, such as for example oleic, palmitic or stearic acid.
  • SM with saturated or unsaturated functionalized chains is used.
  • both acyl chains are saturated and contain from 6 to 24 carbon atoms.
  • Non-limiting examples of acyl chains present in commonly occurring fatty acids that can be included in semi-synthetic and synthetic SMs are provided in Table 1 , above.
  • the SM is palmitoyl SM, such as synthetic palmitoyl SM, which has C16:0 acyl chains, or is egg SM, which includes as a principal component palmitoyl SM.
  • functionalized SM such as phytosphingomyelin, is used.
  • Lecithin can be derived or isolated from natural sources, or it can be obtained synthetically. Examples of suitable lecithins isolated from natural sources include, but are not limited to, egg phosphatidylcholine and soybean phosphatidylcholine.
  • lecithins include, dipalmitoylphosphatidylcholine, dimyristoylphosphatidylcholine, distearoylphosphatidylcholine 1 -myristoyl -2- palmitoylphosphatidylcholine, 1 -palmitoyl -2-myristoylphosphatidylcholine, 1 -palmitoyl -2- stearoylphosphatidylcholine, 1 -stearoyl -2-palmitoylphosphatidylcholine, 1 -palmitoyl -2- oleoylphosphatidylcholine, 1 -oleoyl -2-palmitylphosphatidylcholine, dioleoylphosphatidylcholine and the ether derivatives or analogs thereof.
  • Lecithins derived or isolated from natural sources can be enriched to include specified acyl chains.
  • identity(ies) of the acyl chains can be selectively varied, as discussed above in connection with SM.
  • both acyl chains on the lecithin are identical.
  • the acyl chains of the SM and lecithin are all identical.
  • the acyl chains correspond to the acyl chains of myristitic, palmitic, oleic or stearic acid.
  • the complexes of the disclosure can include one or more negatively charged phospholipids (e.g., alone or in combination with one or more neutral phospholipids).
  • negatively charged phospholipids are phospholipids that have a net negative charge at physiological pH.
  • the negatively charged phospholipid can comprise a single type of negatively charged phospholipid, or a mixture of two or more different, negatively charged, phospholipids.
  • the charged phospholipids are negatively charged glycerophospholipids.
  • Suitable negatively charged phospholipids include, but are not limited to, a 1 ,2-dipalmitoyl-sn-glycero-3-[phospho-/'ac-(1 -glycerol)], a phosphatidylglycerol, a phospatidylinositol, a phosphatidylserine, a phosphatidic acid, and salts thereof (e.g., sodium salts or potassium salts).
  • the negatively charged phospholipid comprises one or more of phosphatidylinositol, phosphatidylserine, phosphatidylglycerol and/or phosphatidic acid.
  • the negatively charged phospholipid comprises or consists of a salt of a phosphatidylglycerol or a salt of a phosphatidylinositol.
  • the negatively charged phospholipid comprises or consists of 1 ,2-dipalmitoyl-sn-glycero-3-[phospho-/'ac-(1-glycerol)], or DPPG, or a salt thereof.
  • the negatively charged phospholipids can be obtained from natural sources or prepared by chemical synthesis. In embodiments employing synthetic negatively charged phospholipids, the identities of the acyl chains can be selectively varied, as discussed above in connection with SM. In some embodiments of the complexes of the disclosure, both acyl chains on the negatively charged phospholipids are identical. In some embodiments, the acyl chains all types of phospholipids included in a complex of the disclosure are all identical. In a specific embodiment, the complex comprises negatively charged phospholipid(s), and/or SM all having 016:0 or 016:1 acyl chains. In a specific embodiment the fatty acid moiety of the SM is predominantly 016:1 palmitoyl.
  • the acyl chains of the charged phospholipid(s), lecithin and/or SM correspond to the acyl chain of palmitic acid. In yet another specific embodiment, the acyl chains of the charged phospholipid(s), lecithin and/or SM correspond to the acyl chain of oleic acid.
  • Examples of positively charged phospholipids that can be included in the complexes of the disclosure include N1-[2-((1S)-1-[(3-aminopropyl)amino]-4-[di(3-amino- propyl)amino]butylcarboxamido)ethyl]-3,4-di[oleyloxy]-benzamide, 1 ,2-di-O-octadecenyl-3- trimethylammonium propane, 1 ,2-dimyristoleoyl-sn-glycero-3-ethylphosphocholine, 1-palmitoyl- 2-oleoyl-sn-glycero-3-ethylphosphocholine, 1 ,2-dioleoyl-sn-glycero-3-ethylphosphocholine, 1 ,2- distearoyl-sn-glycero-3-ethylphosphocholine, 1 ,2-dipalmitoy
  • the lipids used are preferably at least 95% pure, and/or have reduced levels of oxidative agents (such as but not limited to peroxides).
  • Lipids obtained from natural sources preferably have fewer polyunsaturated fatty acid moieties and/or fatty acid moieties that are not susceptible to oxidation.
  • the level of oxidation in a sample can be determined using an iodometric method, which provides a peroxide value, expressed in milli-equivalent number of isolated iodines per kg of sample, abbreviated meq O/kg. See, e.g., Gray, 1978, Measurement of Lipid Oxidation: A Review, Journal of the American Oil Chemists Society 55:539-545;
  • the level of oxidation, or peroxide level is low, e.g., less than 5 meq O/kg, less than 4 meq O/kg, less than 3 meq O/kg, or less than 2 meq O/kg.
  • Complexes can in some embodiments include small quantities of additional lipids.
  • Virtually any type of lipids can be used, including, but not limited to, lysophospholipids, galactocerebroside, gangliosides, cerebrosides, glycerides, triglycerides, and sterols and sterol derivatives (e.g., a plant sterol, an animal sterol, such as cholesterol, or a sterol derivative, such as a cholesterol derivative).
  • a complex of the disclosure can contain cholesterol or a cholesterol derivative, e.g., a cholesterol ester.
  • the cholesterol derivative can also be a substituted cholesterol or a substituted cholesterol ester.
  • the complexes of the disclosure can also contain an oxidized sterol such as, but not limited to, oxidized cholesterol or an oxidized sterol derivative (such as, but not limited to, an oxidized cholesterol ester).
  • an oxidized sterol such as, but not limited to, oxidized cholesterol or an oxidized sterol derivative (such as, but not limited to, an oxidized cholesterol ester).
  • the complexes do not include cholesterol and/or its derivatives (such as a cholesterol ester or an oxidized cholesterol ester).
  • the complexes can contain one or more detergents.
  • the detergent can be zwitterionic, nonionic, cationic, anionic, or a combination thereof.
  • Exemplary zwitterionic detergents include 3-[(3-Cholamidopropyl)dimethylammonio]-1 -propanesulfonate (CHAPS), 3-[(3- Cholamidopropyl)dimethylammonio]-2-hydroxy-1 -propanesulfonate (CHAPSO), and N,N- dimethyldodecylamine N-oxide (LDAO).
  • nonionic detergents include D-(+)-trehalose 6-monooleate, N-octanoyl-N-methylglucamine, N-nonanoyl-N-methylglucamine, N-decanoyl-N- methylglucamine, 1-(7Z-hexadecenoyl)-/'ac-glycerol, 1-(8Z-hexadecenoyl)-rac-glycerol, 1-(8Z- heptadecenoyO-rac-glycerol, 1 -(9Z-hexadecenoyl)-/'ac-glycerol, 1 -decanoyl-rac-glycerol.
  • Exemplary cationic detergents include (S)-O-methyl-serine dodecylamide hydrochloride, dodecylammonium chloride, decyltrimethylammonium bromide, and cetyltrimethylammonium sulfate.
  • Exemplary anionic detergents include cholesteryl hemisuccinate, cholate, alkyl sulfates, and alkyl sulfonates.
  • the complexes can contain one or more fatty acids.
  • the one or more fatty acids can include short-chain fatty acids having aliphatic tails of five or fewer carbons (e.g. butyric acid, isobutyric acid, valeric acid, or isovaleric acid), medium-chain fatty acids having aliphatic tails of 6 to 12 carbons (e.g., caproic acid, caprylic acid, capric acid, or lauric acid), long-chain fatty acids having aliphatic tails of 13 to 21 carbons (e.g., myristic acid, palmitic acid, stearic acid, or arachidic acid) , very long chain fatty acids having aliphatic tails of 22 or more carbons (e.g., behenic acid, lignoceric acid, or cerotic acid), or a combination thereof.
  • short-chain fatty acids having aliphatic tails of five or fewer carbons e.g. butyric acid, isobutyric acid
  • the one or more fatty acids can be saturated (e.g., caprylic acid, capric acid, lauric acid, myristic acid, palmitic acid, stearic acid, arachidic acid, behenic acid, lignoceric acid, or cerotic acid), unsaturated (e.g., myristoleic acid, palmitoleic acid, sapienic acid, oleic acid, elaidic acid, vaccenic acid, linoleic acid, linoelaidic acid, a-linolenic acid, arachidonic acid, eicosapentaenoic acid, erucic acid, or docosahexaenoic acid) or a combination thereof.
  • Unsaturated fatty acids can be cis or trans fatty acids.
  • unsaturated fatty acids used in the complexes of the disclosure are cis fatty acids.
  • the complexes can contain one or more amphipathic molecules that comprise an apolar molecule or moiety (e.g., a hydrocarbon chain, an acyl or diacyl chain) or a sterol (e.g., cholesterol) attached to a sugar (e.g., a monosaccharide such as glucose or galactose, or a disaccharide such as maltose or trehalose).
  • a sugar e.g., a monosaccharide such as glucose or galactose, or a disaccharide such as maltose or trehalose.
  • the sugar can be a modified sugar or a substituted sugar.
  • Exemplary amphipathic molecules comprising an apolar molecule attached to a sugar include dodecan-2-yloxy-R>-D-maltoside, tridecan-3-yloxy-R>-D-maltoside, tridecan-2-yloxy-R>-D- maltoside, n-dodecyl-R>-D-maltoside (DDM), n-octyl-R>-D-glucoside, n-nonyl-R>-D-glucoside, n- decyl-R>-D-maltoside, n-dodecyl-p-D-maltopyranoside, 4-n-Dodecyl-a,a-trehalose, 6-n-dodecyl- a,a-trehalose, and 3-n-dodecyl-a,a-trehalose.
  • DDM dodecan-2-yloxy-R>-D-maltoside
  • the apolar moiety is an acyl or a diacyl chain.
  • the sugar is a modified sugar or a substituted sugar.
  • Lipid binding protein-based complexes can be formulated for the intended route of administration, for example according to techniques known in the art (e.g., as described in Allen et al., eds., 2012, Remington: The Science and Practice of Pharmacy, 22nd Edition, Pharmaceutical Press, London, UK).
  • CER-001 intended for administration by infusion can be formulated in a phosphate buffer with sucrose and mannitol excipients, for example as described in WO 2012/109162.
  • Subjects who can be treated according to the methods described herein are preferably mammals, most preferably human.
  • the subject has or at risk of developing leukocytosis.
  • Leukocytosis can be due to various conditions such as infections, inflammatory processes, and primary bone marrow disorders (e.g., acute leukemias, chronic leukemias and myeloproliferative disorders). Physical stress, for example from seizures, anesthesia or overexertion, and emotional stress can also elevate white blood cell counts.
  • Leukocytosis can also be caused by medications, for example corticosteroids, lithium and beta agonists. Increased eosinophil or basophil counts, resulting from a variety of infections, allergic reactions and other causes, can also sometimes lead to leukocytosis.
  • a subject with leukocytosis has a white blood cell count greater than 11 x 10 9 per L and/or below 100 x 10 9 per L. In some embodiments, the subject has a white blood cell count between 11 x 10 9 per L and 50 x 10 9 per L, between 11 x 10 9 per L and 25 x 10 9 per L, between 25 x 10 9 per L and 50 x 10 9 per L, or between 50 x 10 9 per L and 100 x 10 9 per L.
  • the subject has a white blood cell count more than 11 x 10 9 per L, more than 12 x 10 9 per L, more than 15 x 10 9 per L, or more than 20 x 10 9 per L.
  • the subject has a white blood cell count less than 100 x 10 9 per L, less than 50 x 10 9 per L, less than 25 x 10 9 per L, or less than 15 x 10 9 per L.
  • the subject has a white blood cell count between 11 x 10 9 per L and 15 x 10 9 per L, or between 15 x 10 9 per L and 20 x 10 9 per L
  • Subjects can have one or more symptoms associated with leukocytosis.
  • exemplary symptoms associated with leukocytosis include fever, bleeding or bruising, sweating, pain or tingling in the legs, arms, or abdomen, a vision problem (e.g., blurred vision, double vision, blind spots, cloudy vision, dimmed vision, or a combination thereof), unclear thinking, loss of appetite, or trouble breathing (e.g., shortness of breath, below normal blood oxygen levels).
  • a subject has or is at risk of developing leukocytosis due to inflammation, an infection, a white blood cell disorder, physical stress, emotional stress, medication, or an allergic reaction.
  • a subject having or at risk of developing leukocytosis has an infection, for example a bacterial, fungal, parasitic, or viral infection (e.g., a coronavirus infection such as COVID-19 or influenza).
  • an infection for example a bacterial, fungal, parasitic, or viral infection (e.g., a coronavirus infection such as COVID-19 or influenza).
  • a subject having or at risk of developing leukocytosis has diabetes.
  • a subject having or at risk of developing leukocytosis has received or is receiving a medication having leukocytosis as a side effect, for example a steroid, corticosteroid, lithium, or a beta agonist.
  • a subject having or at risk of developing leukocytosis has a white blood cell disorder.
  • the while blood cell disorder is a primary bone marrow disorder (e.g., an acute leukemia, chronic leukemia, or myeloproliferative disorder).
  • a primary bone marrow disorder e.g., an acute leukemia, chronic leukemia, or myeloproliferative disorder.
  • the while blood cell disorder is neutrophilia (for example idiopathic neutrophilia, which in some embodiments is chronic idiopathic neutrophilia).
  • the while blood cell disorder is hemolytic anemia.
  • the while blood cell disorder is thrombocytopenia (for example idiopathic thrombocytopenia or essential thrombocytopenia).
  • the while blood cell disorder is a cancer (for example a bone cancer or blood cancer).
  • the while blood cell disorder is a myeloproliferative disorder.
  • the while blood cell disorder is a blood cancer.
  • the while blood cell disorder is lymphoma.
  • the while blood cell disorder is leukemia (for example lymphocytic leukemia, chronic eosinophilic leukemia, chronic myelogenous leukemia, or chronic neutrophilic leukemia).
  • leukemia for example lymphocytic leukemia, chronic eosinophilic leukemia, chronic myelogenous leukemia, or chronic neutrophilic leukemia.
  • the while blood cell disorder is polycythemia vera.
  • the while blood cell disorder is myelofibrosis, for example primary myelofibrosis.
  • administering is effective to reduce the subject’s white blood cell count and/or ameliorate one or more symptoms associated with leukocytosis.
  • the subject has endothelial dysfunction (for example a subject experiencing acute coronary syndrome or stroke or who has experienced acute coronary syndrome or stroke).
  • acute coronary syndrome include myocardial infarction (for example ST-elevation myocardial infarction, non-ST elevation myocardial infarction) and unstable angina.
  • the subject is experiencing acute coronary syndrome. In other embodiments, the subject has experienced acute coronary syndrome. In other embodiments, the subject is experiencing a stroke. In other embodiments, the subject has experienced a stroke. [0176] In some aspects, the subject having or at risk of developing carditis (for example myocarditis and/or pericarditis). In some embodiments, the subject is male. In some embodiments, the subject is less than 60 years old, less than 50 years old, less than 40 years old, less than 30 years old, less than 20 years old and/or at least 5 years old, at least 8 years old, at least 10 years old, at least 12 years old, at least 15 years old, or at least 18 years old.
  • the subject having or at risk of developing carditis has an infection, for example a viral infection or a bacterial infection.
  • exemplary viral infections include influenza and coronavirus infections.
  • the subject has a COVID-19 infection.
  • COVID-19 vaccines for example, mRNA COVID-19 vaccines, have been associated with carditis, especially in young males.
  • the subject at risk of developing carditis is a young male (for example, at least 5, 8, 10, 12, 15, or 18 years of age and less than 30 or 20 years of age).
  • the subject has received a vaccine (e.g., a COVID-19 vaccine) prior to (e.g., 1 to 10 days) administration of the lipid binding protein-based complex.
  • a vaccine e.g., a COVID- 19 vaccine
  • the subject receives a vaccine (e.g., a COVID-19 vaccine) concurrently with administration of the lipid binding protein-based complex (e.g., on the same day).
  • the subject has a SOFA score of 1 to 4 before treatment with a lipid binding protein-based complex, e.g., a score of 1 , 2, 3, or 4 (see, Vincent et al. 1996, Intensive Care Med, 22:707-710).
  • the subject has an endotoxin activity level as measured by the Endotoxin Activity Assay (EEA TM ) (Spectral Medical) of > 0.6 prior to administration of the lipid binding protein-based complex (see, Marshall et al., 2004, J Infect Dis. 190(3):527-34).
  • EAA TM Endotoxin Activity Assay
  • the subject is a subject in need of a reduction in serum levels of one or more inflammatory markers, for example a subject with elevated levels of the one or more inflammatory markers compared to normal levels.
  • exemplary inflammatory cytokines include interleukin 6 (IL-6), C-reactive protein, D-dimer, ferritin, interleukin 8 (IL-8), granulocytemacrophage colony stimulating factor (GM-CSF), monocyte chemoattractant protein (MCP) 1 , and tumor necrosis factor a (TNFa).
  • the one or more cytokines comprise IL-6.
  • the one or more cytokines comprise a combination of the foregoing, for example, 2, 3, 4, 5, 6, 7, or all 8 of interleukin 6 (IL-6), C-reactive protein, D- dimer, ferritin, interleukin 8 (IL-8), granulocyte-macrophage colony stimulating factor (GM-CSF), monocyte chemoattractant protein (MCP) 1 , and tumor necrosis factor a (TNFa).
  • IL-6 interleukin 6
  • C-reactive protein D- dimer
  • ferritin interleukin 8
  • GM-CSF granulocyte-macrophage colony stimulating factor
  • MCP monocyte chemoattractant protein
  • TNFa tumor necrosis factor a
  • the methods of the disclosure typically entail multiple administrations of a lipid binding protein-based complex (e.g., CER-001 ), e.g., two to 20 individual doses (e.g., 2 to 16, 2 to 12, 2 to 10, 2 to 8, 2 to 6, 2 to 4, 4 to 20, 4 to 16, 4 to 10, 4 to 6, 6 to 20, 6 to 16, 6 to 10, 6 to 8, 8 to 20, 8 to 16, 8 to 10, 10 to 20, 10 to 16, or 16 to 20 individual doses).
  • an administration regimen can include four or more doses of a lipid binding protein-based complex (e.g., CER-001 ), e.g., five, six, seven, eight, nine, ten, eleven, twelve, or more than twelve doses.
  • the lipid binding protein-based complex is administered according to an induction and, optionally, a consolidation regimen as described in Sections 5.3.1 and 5.3.2, respectively.
  • the lipid binding protein-based complex can be administered in a single phase, e.g., according to an administration regimen described in this Section.
  • the subject is not treated with the lipid binding proteinbased complex according to a maintenance regimen, e.g., a regimen comprising long-term (e.g., one month or longer) administration of the lipid binding protein-based complex.
  • the lipid binding protein-based complex (e.g., CER-001 ) administration regimens of the disclosure can last up to one week, one week, or more than one week (e.g., two weeks).
  • a lipid binding protein-based complex e.g., CER-001
  • administration regimen can comprise administering: five doses of CER-001 over one week; six doses of CER-001 over one week; seven doses of CER-001 over one week; ten doses of CER-001 over two weeks; twelve doses of CER-001 over two weeks; fourteen doses of CER-001 over two weeks.
  • the methods of the disclosure comprise administering seven doses of CER-001 over one week, e.g., on days 1 , 2, 3, 4, 5, 6, and 7.
  • a lipid binding protein-based complex (e.g., CER-001 ) is administered daily, e.g., daily for at least 5 days, at least 6 days, at least 7 days, or more than 7 days (e.g., daily for up to one week or daily for up to two weeks).
  • a lipid binding protein-based complex (e.g., CER-001 ) multiple doses approximately 12 hours apart (e.g., four to six doses administered approximately 12 hours apart).
  • a lipid binding proteinbased complex (e.g., CER-001 ) is administered less frequently, e.g., every other day, two times per week, three times per week, or once a week.
  • an administration window can be provided, for example, to accommodate slight variations to a multi-dosing per week dosing schedule. For example, a window of ⁇ 2 days or ⁇ 1 day around the dosage date can be used.
  • a lipid binding protein-based complex e.g., CER-001
  • CER-001 can be administered in the methods of the disclosure for a pre-determined period of time, e.g., for one week.
  • a lipid binding protein-based complex e.g., CER-001
  • administration of a lipid binding protein-based complex can be continued until one or more symptoms of condition are reduced or continued until the serum levels of one or more inflammatory markers are reduced, for example reduced to a normal level or reduced relative to a baseline value for the subject, e.g., a baseline value measured prior to the start of lipid binding protein-based complex (e.g., CER-001 ) therapy.
  • Reference or “normal” levels of various inflammatory markers are known in the art.
  • the Mayo Clinic Laboratories test catalog (www.mayocliniclabs.com/test-catalog) provides the following reference values: IL- 6: ⁇ 1.8 pg/mL; C-reactive protein: ⁇ 8.0 mg/mL; D-dimer: ⁇ 500 ng/mL Fibrinogen Equivalent Units (FEU); ferritin: 24-336 mcg/L (males), 11-307 mcg/L (females); IL-8 ⁇ 57.8 pg/mL; TNF-a ⁇ 5.6 pg/mL.
  • FEU Fibrinogen Equivalent Units
  • the methods of the disclosure typically comprise administering a high dose of a lipid binding protein-based complex (e.g., CER-001 ).
  • the high dose can be the aggregate of multiple individual doses (e.g., two, three, four, five, six, seven, eight, nine, 10, or more than 10 individual doses), for example administered over multiple days (e.g., a period of three days, four days, five days, six days, seven days, eight days, nine days, 10 days, eleven days, 12 days, 13 days, 14 days or 15 days).
  • the individual doses of a high dose are in some embodiments administered daily, twice daily (e.g., approximately 12 hours apart), or two to three days apart.
  • a high dose is effective to ameliorate one or more symptoms associated with leukocytosis.
  • the high dose is an amount effective to increase the subject’s HDL and/or ApoA-l blood levels and/or improve the subject’s vascular endothelial function, e.g., measured by circulating vascular cell adhesion molecule 1 (VCAM-1 ) and/or intercellular adhesion molecule 1 (ICAM-1 ) levels.
  • VCAM-1 circulating vascular cell adhesion molecule 1
  • IAM-1 intercellular adhesion molecule 1
  • the high dose or an individual dose is an amount which increases the subject’s HDL and/or ApoA-l levels by at least 25%, at least 30%, or at least 35% 2 to 4 hours after administration.
  • a high dose is effective to reduce the subject’s circulating VCAM-1 by at least 100 ng/mL, at least 200 ng/mL, at least 300 ng/mL, and/or by up to 400 ng/mL within two days of the first administration of the lipid binding protein-based complex. In embodiments, a high dose is effective to reduce the subject’s circulating VCAM-1 by at least 100 ng/mL, at least 200 ng/mL, at least 300 ng/mL, and/or by up to 400 ng/mL within five days of the first administration of the lipid binding protein-based complex.
  • a high dose is effective to reduce the subject’s circulating ICAM-1 by at least 50 ng/mL, at least 75 ng/mL, at least 100 ng/mL and/or by up to 100 ng/mL or up to 125 ng/mL within two days of the first administration of the lipid binding protein-based complex. In embodiments, a high dose is effective to reduce the subject’s circulating ICAM-1 by at least 50 ng/mL, at least 75 ng/mL, at least 100 ng/mL and/or by up to 125 ng/mL within five days of the first administration of the lipid binding protein-based complex.
  • the high dose is an amount effective to reduce serum levels of one or more inflammatory markers, for example, one or more of IL-6, C-reactive protein, D- dimer, ferritin, IL-8, GM-CSF, MCP1 , and TNF-a.
  • the serum levels of the one or more inflammatory markers are reduced from an elevated range to a normal range, and/or reduced by at least 20%, at least 40%, or at least 60%.
  • a high dose is effective to reduce serum levels of IL-6 by at least 20 pg/mL, at least 30 pg/mL, or at least 40 pg/mL and/or by up to 40 pg/mL within two days of the first administration of the lipid binding protein-based complex. In some embodiments, a high dose is effective to reduce serum levels of IL-6 by at least 20 pg/mL, at least 30 pg/mL, or at least 40 pg/mL and/or by up to 50 pg/mL or up to 60 pg/mL within five days of the first administration of the lipid binding protein-based complex.
  • a high dose is effective to reduce serum levels of C-reactive protein.
  • a high dose is effective to reduce serum levels of D-dimer.
  • a high dose is effective to reduce serum levels of ferritin.
  • the high dose is effective to reduce serum levels of ferritin by at least 200 ng/mL, at least 300 ng/mL, or at least 400 ng/mL and/or by up to 700 ng/mL within two days of the first administration of the lipid binding protein-based complex.
  • the high dose is effective to reduce serum levels of ferritin by at least 200 ng/mL, at least 300 ng/mL, or at least 400 ng/mL and/or by up to 700 ng/mL within five days of the first administration of the lipid binding protein-based complex.
  • a high dose is effective to reduce serum levels of interleukin 8 (IL-8).
  • IL-8 interleukin 8
  • a high dose is effective to reduce serum levels of IL-8 by at least 100 pg/mL, at least 150 pg/mL and/or by up to 300 pg/mL within two days of the first administration of the lipid binding protein-based complex.
  • a high dose is effective to reduce serum levels of IL-8 by at least 100 pg/mL, at least 150 pg/mL and/or by up to 300 pg/mL within five days of the first administration of the lipid binding protein-based complex.
  • the high dose is effective to reduce serum levels of monocytechemoattractant protein (MCP) 1 and/or tumor necrosis factor a (TNF-a) and/or KIM- 1.
  • MCP monocytechemoattractant protein
  • TNF-a tumor necrosis factor a
  • KIM- 1 KIM- 1.
  • a high dose is effective to reduce the subject’s white blood cell count. In some embodiments, a high dose is effective to reduce the subject’s white blood cell count by at least 2000 WBCs/mL, at least 3000 WBCs/mL, at least 4000 WBCs/mL, at least 5000 WBCs/mL and/or by up to 8000 WBCs/mL within two days of the first administration of the lipid binding protein-based complex.
  • a high dose is effective to reduce the subject’s white blood cell count by at least 2000 WBCs/mL, at least 3000 WBCs/mL, at least 4000 WBCs/mL, at least 5000 WBCs/mL and/or by up to 6000 WBCs/mL within five days of the first administration of the lipid binding protein-based complex.
  • the high dose is effective to transiently increase serum triglyceride levels, for example for up to 9 days.
  • a high dose is a dose effective to prevent carditis in a subject at risk for carditis or reduce the severity of the carditis in a subject having carditis or at risk of carditis.
  • the dose of a lipid binding protein-based complex (e.g., CER-001 ) administered to a subject (e.g., an individual dose which when aggregated with one or more other individual doses forms a high dose) can in some embodiments range from 4 to 40 mg/kg (e.g., 10 to 40 mg/kg) on a protein weight basis (e.g., 5, 10, 15, 20, 25, 30, 35, or 40 mg/kg or any range bounded by any two of the foregoing values, e.g., 10 to 20 mg/kg, 15 to 25 mg/kg, 20 to 40 mg/kg, 25 to 35 mg/kg, or 30 to 40 mg/kg).
  • a protein weight basis e.g., 5, 10, 15, 20, 25, 30, 35, or 40 mg/kg or any range bounded by any two of the foregoing values, e.g., 10 to 20 mg/kg, 15 to 25 mg/kg, 20 to 40 mg/kg, 25 to 35 mg/kg, or 30 to 40 mg/kg.
  • protein weight basis means that a dose of a lipid binding protein-based complex (e.g., CER-001 ) to be administered to a subject is calculated based upon the amount of ApoA-l in the lipid binding protein-based complex (e.g., CER-001 ) to be administered and the weight of the subject. For example, a subject who weighs 70 kg and is to receive a 20 mg/kg dose of CER-001 would receive an amount of CER-001 that provides 1400 mg of ApoA-l (70 kg x 20 mg/kg).
  • a lipid binding protein-based complex (e.g., CER-001 ) can be administered on a unit dosage basis.
  • the unit dosage used in the methods of the disclosure can in some embodiments vary from 300 mg to 4000 mg (e.g., 600 mg to 4000 mg) per administration (on a protein weight basis).
  • the dosage of a lipid binding protein-based complex is 600 mg to 3000 mg, 800 mg to 3000 mg, 1000 mg to 2400 mg, or 1000 mg to 2000 mg per administration (on a protein weight basis).
  • a high dose of a lipid binding protein-based complex e.g., CER-001
  • a lipid binding protein-based complex e.g., the aggregate of multiple individual doses
  • 600 mg to 40 g on a protein weight basis
  • a high dose is 3 g to 35 g or 5 g to 30 g (on a protein weight basis).
  • a lipid binding protein-based complex e.g., CER-001
  • a stock solution of CER-001 can be diluted in normal saline such as physiological saline (0.9% NaCI) to a total volume between 125 and 250 ml.
  • subjects weighing less than 80 kg will have a total volume of 125 ml whereas subjects weighing at least 80 kg will have a total volume of 250 ml.
  • doses of CER-001 are administered in a total volume of 250 ml.
  • a lipid binding protein-based complex e.g., CER-001
  • administration can be by slow infusion with a duration of more than one hour (e.g., up to 2 hours or up to 24 hours), by rapid infusion of one hour or less, or by a single bolus injection.
  • a lipid binding protein-based complex (e.g., CER-001 ) is administered over a one-hour period, e.g., using an infusion pump at a fixed rate of 125 ml/hr or 250 ml/hr.
  • a dose of a lipid binding proteinbased complex (e.g., CER-001 ) is administered as an infusion over a 24-hour period.
  • induction regimens suitable for use in the methods of the disclosure entail administering multiple doses of a lipid binding protein-based complex (e.g., CER-001 ) over multiple consecutive days, e.g., three consecutive days.
  • a lipid binding protein-based complex e.g., CER-001
  • induction regimens suitable for use in the methods of the disclosure entail twice daily administration of a lipid binding protein-based complex (e.g., CER- 001 ) such as twice daily administration on multiple consecutive days. Twice daily administration can comprise, for example, two doses approximately 12 hours apart or a morning dose and an evening dose (which may be more or less than 12 hours apart).
  • a lipid binding protein-based complex e.g., CER- 001
  • Twice daily administration can comprise, for example, two doses approximately 12 hours apart or a morning dose and an evening dose (which may be more or less than 12 hours apart).
  • the induction regimen comprises two doses of a lipid binding proteinbased complex (e.g., CER-001 ) per day for 3 consecutive days.
  • a lipid binding proteinbased complex e.g., CER-001
  • a therapeutic dose of a lipid binding protein-based complex (e.g., CER-001 ) administered by infusion in the induction regimen can range from 4 to 40 mg/kg (e.g., 4 to 30 mg/kg) on a protein weight basis (e.g., 4, 5, 6, 7, 8, 9, 10, 12 15, 20, 25, 30 or 40 mg/kg, or any range bounded by any two of the foregoing values, e.g., 5 to 15 mg/kg, 10 to 20 mg/kg, or 15 to 25 mg/kg).
  • the dose of a lipid binding protein-based complex (e.g., CER-001) used in the induction regimen is 5 mg/kg.
  • the dose of a lipid binding protein-based complex (e.g., CER-001 ) used in the induction regimen is 10 mg/kg. In some embodiments, the dose of a lipid binding protein-based complex (e.g., CER-001 ) used in the induction regimen is 15 mg/kg. In some embodiments, the dose of a lipid binding proteinbased complex (e.g., CER-001 ) used in the induction regimen is 20 mg/kg. In some embodiments, the induction regimen comprises six doses of a lipid binding protein-based complex (e.g., CER-001 ) administered over three days at a dose of 5 mg/kg, 10 mg/kg, 15 mg/kg or 20 mg/kg.
  • a lipid binding protein-based complex e.g., CER-001
  • a lipid binding protein-based complex (e.g., CER-001 ) can be administered on a unit dosage basis.
  • the unit dosage used in the induction phase can vary from 300 mg to 4000 mg (e.g., 300 mg to 3000 mg) (on a protein weight basis) per administration by infusion.
  • the dosage of a lipid binding protein-based complex (e.g., CER-001) used during the induction phase is 300 mg to 1500 mg, 400 mg to 1500 mg, 500 mg to 1200 mg, or 500 mg to 1000 mg (on a protein weight basis) per administration by infusion.
  • Consolidation regimens suitable for use in the methods of the disclosure entail administering one dose or multiple doses of a lipid binding protein-based complex (e.g., CER- 001 ) following an induction regimen.
  • a lipid binding protein-based complex e.g., CER- 001
  • the consolidation regimen comprises administering two doses of a lipid binding protein-based complex (e.g., CER-001).
  • the two doses can be administered approximately 12 hours apart, or administered as a morning dose and an evening dose (which may be more or less than 12 hours apart).
  • the dose(s) of a lipid binding protein-based complex (e.g., CER-001 ) in a consolidation regimen can in some embodiments be administered on day 6 of a dosing regimen that begins with an induction regimen on day 1 .
  • the dose(s) of a lipid binding protein-based complex (e.g., CER-001) in a consolidation regimen can in some embodiments be administered on day 4 of a dosing regimen that begins with an induction regimen on day 1.
  • the dose(s) of a lipid binding protein-based complex (e.g., CER-001 ) in a consolidation regimen can in some embodiments be administered on day 5 of a dosing regimen that begins with an induction regimen on day 1.
  • the dose(s) of a lipid binding protein-based complex (e.g., CER-001 ) in a consolidation regimen can in some embodiments be administered on day 7 of a dosing regimen that begins with an induction regimen on day 1.
  • a therapeutic dose of a lipid binding protein-based complex (e.g., CER-001 ) administered by infusion in the consolidation regimen can range from 4 mg/kg to 40 mg/kg (e.g., 4 to 30 mg/kg) on a protein weight basis (e.g., 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, or 40 mg/kg, or any range bounded by any two of the foregoing values, e.g., 5 to 15 mg/kg, 10 to 20 mg/kg, or 15 to 25 mg/kg).
  • the dose of a lipid binding protein-based complex (e.g., CER-001 ) used in the consolidation regimen is 5 mg/kg.
  • the dose of a lipid binding protein-based complex (e.g., CER-001 ) used in the consolidation regimen is 10 mg/kg. In some embodiments, the dose of a lipid binding protein-based complex (e.g., CER-001 ) in the consolidation regimen is 15 mg/kg. In some embodiments, the dose of a lipid binding protein-based complex (e.g., CER-001 ) used in the consolidation regimen is 20 mg/kg. In some embodiments, the consolidation regimen comprises two doses of a lipid binding protein-based complex (e.g., CER-001 ) administered on one day at a dose of 5 mg/kg, 10 mg/kg, 15 mg/kg or 20 mg/kg.
  • a lipid binding protein-based complex (e.g., CER-001 ) can be administered on a unit dosage basis.
  • the unit dosage used in the consolidation phase can vary from 300 mg to 4000 mg (e.g., 300 mg to 3000 mg) (on a protein weight basis) per administration by infusion.
  • the dosage of a lipid binding protein-based complex (e.g., CER-001) used during the consolidation phase is 300 mg to 1500 mg, 400 mg to 1500 mg, 500 mg to 1200 mg, or 500 mg to 1000 mg (on a protein weight basis) per administration by infusion.
  • a lipid binding protein-based complex e.g., CER-001
  • the lipid binding protein-based complex (e.g., CER-001 ) can be administered during the consolidation phase in the same manner as described in Section 5.3, e.g., as an IV infusion over a one-hour period.
  • a lipid binding protein-based complex (e.g., CER-001 ) can be administered to a subject as described herein as a monotherapy or a part of a combination therapy regimen.
  • a combination therapy may comprise a lipid binding protein-based complex (e.g., CER-001) in combination with a standard of care treatment for sepsis or other infection. See, e.g., Rhodes et al., 2017, Intensive Care Med 43:304-377; Dugar et al., 2020, Cleveland Clinic Journal of Medicine 87(1):53-64.
  • the subject is treated with a lipid binding protein-based complex (e.g., CER-001 ) in combination with fluid replacement therapy.
  • a lipid binding protein-based complex e.g., CER-001
  • an antimicrobial e.g., antimicrobial-based complex
  • the subject is treated with a lipid binding proteinbased complex (e.g., CER-001 ) in combination with an antibiotic (e.g., ceftriaxone, meropenem, ceftazidime, cefotaxime, cefepime, piperacillin and tazobactam, ampicillin and sulbactam, imipenem and cilastatin, levofloxacin, or clindamycin).
  • an antibiotic e.g., ceftriaxone, meropenem, ceftazidime, cefotaxime, cefepime, piperacillin and tazobactam, ampicillin and sulbactam, imipenem and cilastatin, levofloxacin, or clindamycin.
  • the subject is treated with a lipid binding protein-based complex (e.g., CER-001 ) in combination with an antiviral.
  • the subject is treated with a lipid binding protein-based complex (e.g., CER-001 ) in combination with a medication that raises blood pressure (e.g., norepinephrine or epinephrine).
  • a lipid binding protein-based complex e.g., CER-001
  • a medication that raises blood pressure e.g., norepinephrine or epinephrine.
  • a combination therapy regimen can in some embodiments comprise one or more anti- IL-6 agents and/or one or more other agents for treating CRS such as corticosteroids (e.g., methylprednisolone and/or dexamethasone).
  • exemplary anti-l L6 agents include tocilizumab, siltuximab, olokizumab, elsilimomab, BMS-945429, sirukumab, levilimab, and CPSI-2364.
  • a lipid binding protein-based complex e.g., CER-001
  • CER-001 lipid binding protein-based complex
  • Subjects who have or have had a COVID-19 infection can be treated with a lipid binding protein-based complex (e.g., CER-001 ) in combination with one or more additional therapies such as antibodies from recovered COVID-19 patients, antibodies against the spike protein of COVID-19, one or more antiviral agents (e.g., lopinavir, remdesivir, danoprevir, galidesivir, darunavir, ritonavir), chloroquine, hydroxychloroquine, azithromycin, an interferon (e.g., an interferon alpha or an interferon beta, each of which can be pegylated), or a combination thereof.
  • a lipid binding protein-based complex e.g., CER-001
  • additional therapies such as antibodies from recovered COVID-19 patients, antibodies against the spike protein of COVID-19, one or more antiviral agents (e.g., lopinavir, remdesivir, danoprevir,
  • an antihistamine e.g., diphenhydramine, cetirizine, fexofenadine, or loratadine
  • a lipid binding proteinbased complex e.g., CER-001
  • the antihistamine can reduce the likelihood of allergic reactions.
  • Example 1 CER-001 therapy in a swine model of LPS-induced AKI [0226] The ability of CER-001 to mitigate sepsis-related AKI was evaluated in a lipopolysaccharide (LPS)-induced swine model of AKI.
  • LPS lipopolysaccharide
  • Sepsis was induced in the pigs by intravenous infusion of a saline solution containing 300 pg/kg of LPS at TO.
  • Single dose CER-001 treated pigs and CER-001 multiple dose treated pigs received a 20 mg/kg dose of CER-001 at TO.
  • CER-001 multiple dose treated pigs received a second 20 mg/kg dose of CER-001 three hours later (T3).
  • Serum IL-6, LPS, MCP-1 , sVCAM- 1 and slCAM-1 levels were monitored over time. Renal tissue damage and fibrosis were assessed at the end of the study period.
  • Endothelial dysfunction was evaluated by measuring sVCAM-1 and slCAM-1 serum levels. Time-dependent increases of sVCAM-1 and slCAM-1 were observed in endotoxemic animals, while CER-001 treatment strongly decreased sVCAM-1 and slCAM-1 levels in both treated groups (FIG. 2 and FIG. 3, respectively). In line with IL-6 results, the infusion of two doses of CER-001 (FIG. 2, “40 MG”) was more efficient in decreasing sVCAM-1 to basal levels. LPS levels were strongly reduced in CER-001 treated animals (FIG. 4, “20MG” and “40 MG”) and the effects were more evident after the second infusion of CER-001 (FIG. 4, “40 MG”).
  • Example 2 Randomized pilot study comparing short-term CER-001 infusions at different doses to prevent sepsis-induced acute kidney injury
  • Study population This is a single-center, randomized, dose-ranging (phase II) study including patients with sepsis due to intra-abdominal cavity infection or urosepsis, admitted at the Intensive Care Unit (ICU) of the participating center. The investigators ensure that all patients meeting the following inclusion and exclusion criteria are offered enrollment in the study.
  • ICU Intensive Care Unit
  • Endotoxin level (measured by Endotoxin Activity Assay (EEA TM ); Spectral Medical) >0.6 (see, Marshall et al., 2004, J Infect Dis. 190(3):527-34);
  • ALT/AST Alanine transaminase/aspartate transaminase
  • Stage 4 severe chronic kidney disease or requiring dialysis (/.e. estimated glomerular filtration rate (eGFR) ⁇ 30 ml /min/1 .73 m 2 );
  • Terminally ill including metastases or hematological malignancy, with a life expectancy less than 30 days (as assessed by the attending physician) or have been classified as "Do Not Resuscitate";
  • Group A patients continue to receive conventional therapy
  • Group B patients add CER-001 5 mg/kg BID for 3 days to conventional therapy, followed by 5 mg/kg BID on Day 6
  • Group C patients add CER-001 10 mg/kg BID for 3 days to conventional therapy, followed by lOmg/kg BID on Day 6
  • Group D patients add CER-001 20 mg/kg BID for 3 days to conventional therapy, followed by 20mg/kg BID on Day 6 (FIG. 5).
  • Secondary endpoints Secondary end-points are:
  • Baseline is defined as the last measurements taken prior to dosing on Day 1.
  • Intervention/exposure Twenty patients meeting the eligibility criteria, who sign and date an ethical committee (EC)-approved informed consent form, are randomized and assigned (1 :1 :1 :1 ) ratio to conventional therapy (Group A), low dose CER-001 (Group B) or medium dose CER-001 (Group C) or high dose CER-001 (Group D). Conventional therapy is modulated according to the clinical conditions. All non-experimental treatments are allowed to be administered concomitantly during the patient’s participation in this study: any medication the patient takes, other than study drugs specified per protocol, is considered a concomitant medication and is recorded in the study records.
  • Each patient is identified at the screening by a patient number. Once assigned to a patient, the patient number is not reused.
  • the randomization list and the allocation assignment sequence is produced and the investigators that enroll do not have any participation in this task.
  • the randomization list divided into blocks is adequately concealed to prevent attempts at subversion of randomization.
  • Treatment group All patients receive conventional therapy. Treated groups receive an additional therapy with the study drugs. In particular:
  • Group A Conventional therapy (/.e., antibiotic treatments and hemodynamic support according to patient’s conditions).
  • Group B Conventional therapy + CER-001 5 mg/kg BID for 3 consecutive days, followed by 5 mg/kg BID on Day 6.
  • Group C Conventional therapy + CER-001 10 mg/kg BID for 3 consecutive days, followed by 10 mg/kg BID on Day 6.
  • Group D Conventional therapy + CER-001 20 mg/kg BID for 3 consecutive days, followed by 20 mg/kg BID on Day 6.
  • Patients are pretreated with antihistamine prior to each CER-001 dose (e.g. dexchlorpheniramine 5 mg or hydroxyzine 100 mg) to avoid any potential infusion reactions. Patients may be interrupted or discontinued from study medication if any of the following occur: [0245] Any drug-related adverse event or other reason which, in the Investigator's opinion, jeopardizes the patient's participation in the trial or the interpretation of trial data (e.g., severe inter-current illness requiring additional care measures or preventing further dosing); significant tolerability issues.
  • antihistamine e.g. dexchlorpheniramine 5 mg or hydroxyzine 100 mg
  • Reasons for withdrawal from study drug may include, but are not limited to, the following:
  • Investigator's request for safety reasons, such as severe adverse reactions; Investigator’s request, for other reasons, such as patient non-compliance;
  • Procedures The following procedures are performed during the screening visit. Following randomization, subjects initiate treatment within 2 business days.
  • Medical history - includes: recording past and present illnesses and collection of the subjects demographic data (birth date, sex, and race).
  • Vital signs (pulse, blood pressure, and oral, auricular, axillary, or core temperature). Review of inclusion/exclusion criteria.
  • Adverse events are recorded starting from the time informed consent is obtained.
  • CBC Complete blood count
  • WBC white blood cell count
  • RBC red blood cell count
  • Hb haemoglobin
  • Het hematocrit
  • Fasting chemistry panel/electrolytes includes sodium, potassium, chloride, blood urea nitrogen (BUN; or urea), serum creatinine, calculated clearance creatinine (CKD-EPI), glucose, calcium, phosphorus, total protein, uric acid, AST, ALT, y GT, ALP, total and direct bilirubine, albumin, total cholesterol, HDL, LDL, triglycerides, LDH, CPK,
  • ABG for assessing respiratory and/or metabolic disorders
  • Coagulation tests - includes prothrombin time (PT) (expressed as international normalized ratio [I NR]), and partial thromboplastin time (PTT).
  • PT prothrombin time
  • I NR international normalized ratio
  • PTT partial thromboplastin time
  • Urinalysis - includes specific gravity, pH, assessment of protein/albumin, glucose, ketones, and haemoglobin/blood.
  • Serum or urine pregnancy test for women of childbearing potential within 7 days before randomization.
  • Pharmacokinetic and pharmacodynamic assessment includes apoA-l and total cholesterol levels.
  • Endotoxin levels are measured using the EAA TM kit.
  • AKI Biomarkers (TIMP-2 and IGFBP-7) are measured using the Nephrocheck® kit.
  • Inflammatory markers include: CRP, D- dimer, Ferritin, IL-6, IL-8, GM-CSF, MCP 1 and TNF-a.
  • biological samples collected for the daily routine laboratory assessments performed at the Central laboratory are collected, including:
  • Treatment period is defined as from the start of treatment. The visit is planned at Day 3, Day 6 and Day 9. A final visit is planned on Day 30. The following procedures are performed during the therapy visits:
  • CBC Complete blood count
  • WBC white blood cell count
  • RBC red blood cell count
  • Hb haemoglobin
  • Het hematocrit
  • Fasting chemistry panel/electrolytes includes sodium, potassium, chloride, blood urea nitrogen (BUN; or urea), serum creatinine, calculated clearance creatinine (CKD-EPI), glucose, calcium, phosphorus, total protein, uric acid, AST, ALT, yGT, ALP, total and direct bilirubine, albumin, total cholesterol, HDL, LDL, triglycerides, LDH, CPK
  • ABG for assessing respiratory and/or metabolic disorders
  • Coagulation tests - includes prothrombin time (PT) (expressed as international normalized ratio [I NR]), and partial thromboplastin time (PTT).
  • PT prothrombin time
  • I NR international normalized ratio
  • PTT partial thromboplastin time
  • Urinalysis - includes specific gravity, pH, assessment of protein/albumin, glucose, ketones, and haemoglobin/blood.
  • Serum or urine pregnancy test for women of childbearing potential within 7 days before randomization.
  • Pharmacokinetic and pharmacodynamic assessment will include apoA-l and total cholesterol levels.
  • Endotoxin levels are measured using the EAA TM kit.
  • AKI Biomarkers (TIMP-2 and IGFBP-7) are measured using the Nephrocheck® kit.
  • Inflammatory markers include: CRP, D- dimer, Ferritin, IL-6, IL-8, GM-CSF, MCP 1 and TNF-a.
  • biological samples collected for the daily routine laboratory assessments performed at the Central laboratory are collected, including
  • Clinical scores include the SOFA score (Table 2) and the KDIGO criteria for AKI assessment and staging (Table 3). Individual components of each score are documented.
  • MAP Mean arterial pressure
  • CNS central nervous system
  • SaC>2 peripheral arterial oxygen saturation a Vasoactive medications administered for at least 1 hr (dopamine and norepinephrine pg/kg/min) Table 3.
  • Safety evaluations are attained utilizing information collected from the following assessments: physical examination (including weight), vital signs (blood pressure, pulse, temperature), CBC with differential, platelet count, blood chemistries, and fasting lipid profiles [including HDL-cholesterol, LDL-cholesterol and Lipoprotein (a) ], urea, glucose, 24 hour urine protein determination, serum creatinine and calculated creatinine clearance (CKD- EPI) and adverse events monitoring. All women of childbearing potential have a qualitative serum pregnancy test during pre-study screening/baseline evaluation and subsequently, if clinically indicated. Patients are monitored throughout the study for the occurrence of adverse events, that are recorded.
  • Adverse events volunteered by the subject or discovered, as a result of general questioning by the investigator or by physical examination, are recorded. The duration (start and end dates), severity, cause and relationship to study medication, patient outcome, action taken, and an assessment of whether the event was serious are recorded for each reported adverse event.
  • Adverse events Definitions [0259] The term “adverse event,” is synonymous with the term “adverse experience,” which is used by the FDA.
  • An adverse event (AE) is any untoward, undesired, unplanned clinical event in the form of signs, symptoms, disease, or laboratory or physiological observations occurring in a human being participating in a clinical study regardless of causal relationship. This includes the following:
  • a procedure is not an AE, but the reason for a procedure may be an AE.
  • a “preexisting condition” is a clinical condition (including a condition being treated) that is diagnosed before the subject signs the informed consent form and that is documented as part of the subject’s medical history.
  • the questions concerning whether the condition existed before the start of the active phase of the study and whether it has increased in severity and/or frequency are used to determine whether an event is a treatment-emergent adverse event (TEAE).
  • TEAE treatment-emergent adverse event
  • An AE is considered to be treatment emergent if (1 ) it was not present when the active phase of the study began and is not a chronic condition that is part of the subject’s medical history, or (2) it was present at the start of the active phase of the study or as part of the subject’s medical history, but the severity or frequency increased during the active phase.
  • the active phase of the study begins at the time of the first dose of the drug.
  • a “serious adverse event” is any AE occurring at any dose that meets 1 or more of the following criteria:
  • SAEs important medical events that may not result in death, be life-threatening, or require hospitalization may be considered SAEs when, based on appropriate medical judgment, they may jeopardize the subject and may require medical or surgical intervention to prevent one of the outcomes listed above. Examples of such events include allergic bronchospasm requiring intensive treatment in an emergency room or at home, blood dyscrasias or convulsions that do not require hospitalization, or development of drug dependency or drug abuse.
  • a “life-threatening adverse event” is any AE that places the subject at immediate risk of death from the event as it occurred.
  • a life-threatening event does not include an event that might have caused death had it occurred in a more severe form but that did not create an immediate risk of death as it actually occurred.
  • drug-induced hepatitis that resolved without evidence of hepatic failure would not be considered life-threatening, even though drug-induced hepatitis of a more severe nature can be fatal.
  • Hospitalization or prolongation of a hospitalization is a criterion for considering an AE to be serious. In the absence of an AE, the participating investigator should not report hospitalization or prolongation of hospitalization on a form. This is the case in the following situations: Hospitalization or prolongation of hospitalization is needed for a procedure required by the protocol. Day or night survey visits required by the protocol are not considered serious. [0266] Timina for reporting serious adverse events'. Any SAE, regardless of causal relationship, is reported to medical monitor immediately (no later than 24 hours after the investigator becomes aware of the SAE) by faxing a completed serious adverse event form.
  • An AE or SAE can occur from the time that the subject signs the informed consent form to 15 days from the subject’s last dose, regardless of test article or protocol relationship. This includes events that emerge during the screening and placebo run-in periods. All AEs and SAEs are recorded on source documents and recorded on CRFs. All AEs and SAEs that occur after the screening period are recorded on the CRFs.
  • SEAs The investigator provides all documentation pertaining to the event (e.g., additional laboratory tests, consultation reports, discharge summaries, postmortem reports, etc.) to the Medical monitor in a timely manner. Reports relative to the subject’s subsequent course are submitted to the investigator until the event has subsided or, in case of permanent impairment, until the condition stabilizes.
  • Test article abuse and overdose (/.e. use for nonclinical reasons) with or without AEs.
  • An overdose is a dose higher than that prescribed by a health care professional for clinical reasons. It is up to the participating investigator to decide whether a dose is an overdose.
  • AE information is included (when applicable): the specific condition or event and direction of change; whether the condition was pre-existing (/.e. an acute condition present at the start of the study or history of a chronic condition) and, if so, whether it has worsened (in severity and/or frequency); the dates and times of occurrence; severity; causal relationship to test article; action taken; and outcome. Any laboratory abnormality, which in the opinion of the investigator is clinically significant, is reported as an AE.
  • Event can be fully explained by administration of the test article.
  • Event is most likely to be explained by administration of the test article, rather than the subject’s clinical state or other agents/therapies.
  • Event may be explained by administration of the test article, or by the subject’s clinical state or other agents/therapies.
  • Event is most likely to be explained by the subject’s clinical state or other agents/therapies, rather than the test article. Hence not related. Event can be fully explained by the subject’s clinical state or other agents/therapies.
  • a protocol-related SAE may be an event that occurs during a washout period or that is related to a procedure required by the protocol.
  • NCI National Cancer Institute
  • CCAE Common Toxicity Criteria for Adverse Events
  • Moderate The AE interferes with routine activity but responds to symptomatic therapy or rest. The AE may require reducing the dose but not discontinuing administration of the test article.
  • Severe (Grade 3) The AE significantly limits the subject’s ability to perform routine activities despite symptomatic therapy. In addition, the AE leads to discontinuing administration or reducing the dose of the test article.
  • a first cohort of 10 subjects have been treated.
  • CER-001 Compared to standard of care therapy, CER-001 rapidly improved biomarkers of inflammation, leukocytosis, and endothelial dysfunction, preventing subjects’ decline into acute kidney injury. CER-001 treatment was well tolerated at all dose levels (5, 10 and 20 mg/kg, twice a day). No treatment-related serious side effects were seen in this critically ill patient population.
  • FIGS. 9A-FIG. 9F show VCAM changes for the standard of care group and the CER-001 groups measured by ELISA. Statistically significant differences were assessed by using a mixed model ANOVA (ns: p>0.05).
  • FIGS. 9A VCAM changes from baseline for SOC group and aggregated CER-001 groups.
  • FIG. 9B VCAM changes from baseline for SOC group and each study group.
  • FIG. 9A-FIG. 9F show VCAM changes for the standard of care group and the CER-001 groups measured by ELISA. Statistically significant differences were assessed by using a mixed model ANOVA (ns: p>0.05).
  • FIGS. 9A VCAM changes from baseline for SOC group and aggregated CER-001 groups.
  • FIG. 9B VCAM changes from
  • FIG. 9D VCAM changes for SOC group and aggregated CER- 001 groups, broken out by whether the subject was enrolled from the ICU or the nephrology department of the center.
  • FIG. 9E VCAM changes from baseline for each subject in SOC group and aggregated CER-001 groups.
  • FIG. 9F VCAM changes from baseline for each subject in each group.
  • FIG. 10A-FIG. 10F show ICAM changes for the standard of care group (SOC group) and the experimental groups (CER-001 groups) measured by ELISA. Statistically significant differences were assessed by using a mixed model ANOVA (ns: p>0.05).
  • FIG. 10A ICAM changes from baseline for SOC group and aggregated CER-001 groups.
  • FIG. 10B ICAM changes from baseline for SOC group and each study group.
  • FIG. 10A-FIG. 10F show ICAM changes for the standard of care group (SOC group) and the experimental groups (CER-001 groups) measured by ELISA. Statistically significant differences were assessed by using a mixed model ANOVA (ns: p>0.05).
  • FIG. 10A ICAM changes from baseline for SOC group and aggregated C
  • FIG. 10D ICAM changes for SOC group and aggregated CER-001 groups, broken out by whether the subject was enrolled from the ICU or the nephrology department of the center.
  • FIG. 10E ICAM changes from baseline for each subject in SOC group and aggregated CER-001 groups.
  • FIG. 10F ICAM changes from baseline for each subject in each study group.
  • FIG. 18A-FIG. 18F show white blood cell count changes for the standard of care (SOC) group and the CER-001 groups.
  • FIG. 18A white blood cell count changes from baseline for SOC group and aggregated CER-001 groups.
  • FIG. 18E shows the individual data points summarized in FIG. 18A.
  • FIG. 18B white blood cell count changes from baseline for SOC group and each CER-001 group.
  • FIG. 18F shows the individual data points summarized in FIG. 18B.
  • FIG. 18D white blood cell count changes for SOC group and aggregated CER-001 groups, broken out by whether the subject was enrolled from the ICll or the nephrology department of the center. Units for FIG. 18A, FIG. 18B, and FIG 18D: cells per microliter.
  • COVID-19 is infects host cells through binding of the viral spike protein (SARS-2-S) to the cell-surface receptor angiotensin-converting enzyme 2 (ACE2), and the HDL scavenger receptor B type 1 (SR-B1 ) facilitates ACE2-dependent entry of the virus.
  • SARS-2-S viral spike protein
  • ACE2 cell-surface receptor angiotensin-converting enzyme 2
  • SR-B1 HDL scavenger receptor B type 1
  • lipid binding protein-based complexes such as CER-001 may provide a therapeutic benefit (e.g., reducing the severity and/or duration of CRS) in subjects having a COVID-19 infection through competitive binding to SR-B1 , thereby limiting the virus’s ability to infect additional cells.
  • Dosing Visits Seven doses (Doses 1 through 7) are administered as a once daily infusion over a 7-day period. IL-6 is measured daily from a pre-infusion sample.
  • FIG. 6 A flowchart for the study is shown in FIG. 6.
  • Reasons for withdrawal of a patient from study drug may include, but are not limited to, the following:
  • CER-001 is provided frozen in 20 mL vials containing approximately 18 mL of product at a concentration of 8 mg/mL (ApoA-l content). CER-001 is dosed by weight. All doses are thawed and then diluted with normal saline to a volume of 250 mL.
  • Dosing occurs at each of the seven dosing visits. At each of these visits, patients are given a single IV infusion CER 001 (20 mg/kg) over a period of 24 hours using an infusion pump. Patients are pretreated with antihistamine prior to each CER-001 dose (e.g. dexchlorpheniramine 5 mg or hydroxyzine 100 mg) to avoid any potential infusion reactions.
  • CER-001 dose e.g. dexchlorpheniramine 5 mg or hydroxyzine 100 mg
  • CER-001 is administered in the hospital under direct observation.
  • Inflammatory markers include: CRP, D-dimer, Ferritin, IL-6, IL-8, GM-CSF, MCP 1 and TNF-d.
  • the primary efficacy parameter is the change in IL-6 from baseline to Day 8.
  • Baseline is defined as the average of the measurements taken at the baseline visit and prior to dosing on Day 1.
  • Secondary efficacy parameters include changes to the inflammatory markers CRP, D- dimer, Ferritin, IL-8, GM-CSF, MCP 1 and TNF-a from baseline to Day 8.
  • IL-6 levels are reduced from baseline to day 8. Secondary efficacy parameters are also reduced from baseline to day 8, indicating that CER-001 therapy can be used to treat CRS and reduce serum levels of inflammatory markers.
  • This Example is a study of CER-001 therapy in COVID-19 patients with severe cytokine release syndrome and renal injury.
  • Radiographic infiltrates by imaging chest x-ray, CT scan, etc.
  • CER-001 dose e.g. dexchlorpheniramine 5 mg or hydroxyzine 100 mg
  • Patients receive IV infusion of CER-001 at the dosage of 15 mg/kg Bl D for 3 consecutive days. At the discretion of the investigator, patients may receive up to two additional doses.
  • Patients may be interrupted or discontinued from study medication if any of the following occur:
  • Reasons for withdrawal from study drug may include, but are not limited to, the following:
  • the dose of the drug may be reduced or increased
  • Medical history includes recording past and present illnesses and collection of the subject’s demographic data (birth date, sex, and race).
  • Vital signs pulse, blood pressure, and oral, auricular, axillary, or core temperature).
  • CBC Complete blood count
  • WBC white blood cell count
  • RBC red blood cell count
  • Hb haemoglobin
  • Het hematocrit
  • Fasting chemistry panel/electrolytes includes sodium, potassium, chloride, blood urea nitrogen (BUN; or urea), serum creatinine, calculated clearance creatinine (CKD-EPI), glucose, calcium, phosphorus, total protein, uric acid, AST, ALT, DGT, ALP, total and direct bilirubine, albumin, total cholesterol, HDL, LDL, triglycerides, LDH, CPK,
  • ABG for assessing respiratory and/or metabolic disorders
  • Coagulation tests - includes prothrombin time (PT) (expressed as international normalized ratio [INR]), and partial thromboplastin time (PTT).
  • PT prothrombin time
  • INR international normalized ratio
  • PTT partial thromboplastin time
  • Urinalysis - includes specific gravity, pH, assessment of protein/albumin, glucose, ketones, and haemoglobin/blood.
  • Serum or urine pregnancy test for women of childbearing potential within 7 days before randomization.
  • Pharmacokinetic and pharmacodynamic assessment include apoA-l and total cholesterol levels.
  • Inflammatory markers include CRP, PCT, D-dimer, Ferritin, IL-6, IL-8, GM-CSF, MCP 1 and TNF-a.
  • CBC Complete blood count
  • WBC white blood cell count
  • RBC red blood cell count
  • Hb haemoglobin
  • Het hematocrit
  • Fasting chemistry panel/electrolytes includes sodium, potassium, chloride, blood urea nitrogen (BUN; or urea), serum creatinine, calculated clearance creatinine (CKD-EPI), glucose, calcium, phosphorus, total protein, uric acid, AST, ALT, DGT, ALP, total and direct bilirubine, albumin, total cholesterol, HDL, LDL, triglycerides, LDH, CPK
  • ABG for assessing respiratory and/or metabolic disorders
  • Coagulation tests - includes prothrombin time (PT) (expressed as international normalized ratio [INR]), and partial thromboplastin time (PTT).
  • PT prothrombin time
  • ILR international normalized ratio
  • PTT partial thromboplastin time
  • Urinalysis - includes specific gravity, pH, assessment of protein/albumin, glucose, ketones, and haemoglobin/blood.
  • Inflammatory markers include CRP, PCT, D-dimer, Ferritin, IL-6, IL-8, GM-CSF, MCP 1 and TNF-a
  • An AE is any untoward medical occurrence associated with the use of the investigational product (active or placebo drug, biologic, or device) in a clinical investigation patient, which does not necessarily have a causal relationship with the product.
  • An AE can, therefore, be any unfavorable and unintended sign (e.g., an abnormal laboratory finding), symptom, or disease temporally associated with the use of an investigational product, whether or not considered related to the investigational product.
  • Adverse events may include:
  • Test abnormalities that reflect a change from baseline and/or that may result in changes in administration of investigational product or in an alteration in medical care (diagnostic or therapeutic)
  • IL-6 levels and other inflammatory markers are reduced from baseline to day 8.
  • This Example is a study of CER-001 therapy for treating ischemia/reperfusion AKI.
  • Pigs with a body weight of 45-60 kg, are fasted for 24 hours before the study. All animals are premedicated with an intramuscular mixture of azaperone (8 mg kg -1 ) and atropine (0.03 mg kg -1 ) to reduce pharyngeal and tracheal secretions and prevent post-intubation bradycardia. After anesthesia, both kidneys are approached through a midline abdominal incision. Then, the renal arteries and vein are isolated and a vessel loop is positioned around the renal artery with a right angle clamp. Warm ischemia is induced for 60 minutes by pulling on the vessel loop.
  • Ischemia is followed by 3 hours of reperfusion, with one half of the animals receiving CER-001 administered directly through the renal artery 5 minutes before the beginning of reperfusion.
  • the animals are euthanized after 24 hours by an IV administration of 1 mL/kg BW pentobarbital. Kidneys are then harvested for analysis.
  • CER-001 attenuates ischemia/reperfusion AKI.
  • Example 6 Lipid binding protein molecule therapy in a model of LPS- induced vascular endothelial injury
  • HIVEC Human umbilical vein endothelial cells
  • ATCC-LGC Standards S.r.L, Sesto San Giovanni, Milan, Italy were purchased from American Type Culture Collection (ATCC-LGC Standards S.r.L, Sesto San Giovanni, Milan, Italy). EC were maintained in their recommended medium, EndGro (Merck Millipore, Darmstadt, Germany).
  • PBMCs Peripheral blood mononuclear cells
  • PBMCs culture supernatants were collected and analyzed by ELISA for TNF-a (R&D Systems, Minneapolis MN, USA)
  • EC and PBMCs were incubated with LPS at 0.3 pg/ml and/or CER-001 at 50 and 500 pg/ml for 60 min and 24 hours.
  • Proliferation rate was measured by MTT Cell Proliferation Assay Kit, according to the manufacturer instructions (Sigma Aldrich). Briefly, 3x10 4 cells/well were seeded in a 96-well plate, and then cells were treated with LPS and CER-001 as indicated. Absorbance at 570 nm was then measured by a spectrophotometer.
  • EC were permeabilized with IntraPrep kit (Instrumentation Laboratory) and incubated with unconjugated primary antibody p-ENOS (Abeam) for 25 minutes at 4°C. Cells were then washed and labeled with secondary Antibody AlexaFluor 488 (Molecular Probes) for 25 minutes at 4°C. Finally, cells were washed twice and resuspended in FACS buffer for acquisition.
  • PBMCs were stained with the following monoclonal antibody, CD14 Monoclonal Antibody (61 D3)-PE, (eBioscienceTM, Thermo Fisher Scientific, Italy), for 20 minutes in the dark at room temperature, washed twice, and resuspended in FACS buffer. Stained PBMCs were then acquired.
  • CD14 Monoclonal Antibody (61 D3)-PE eBioscienceTM, Thermo Fisher Scientific, Italy
  • Data shown are representative of three independent studies. Data are shown as mean ⁇ standard deviation (SD) and compared with the Student-t test.
  • CER-001 modulated the response of peripheral blood mononuclear cells (PBMC) stimulated with LPS at 0.3 pg/ml and/or CER-001 at 50 and 500 pg/ml for 24 hours, decreasing mCD14 expression and TNF-a secretion.
  • MTT assay showed no significant difference in cell viability with respect to the basal for the above conditions.
  • PBMC culture supernatants were analyzed by ELISA with results shown in FIG. 15. After 24 h from LPS stimulation, PBMCs increased TNF-a synthesis. Stimulation of PBMCs with CER-001 at 50 and 500 pg/m alone did not influence TNF-a production.
  • CER-001 both at 50 and 500 pg/m, in culture media of LPS-activated PBMCs reverted LPS effects. Also, FACS showed a strong upregulation of CD14 surface expression by PCMBs 24 h following LPS stimulation (FIG. 16). PBMCs treated with LPS and CER-001 in combination maintained CD14 expression at basal level (FIG. 17).
  • a method of treating a subject having or at risk of developing leukocytosis comprising administering to the subject a dose of a lipid binding protein-based complex effective to reduce the subject’s white blood cell count.
  • a method of treating a subject having one or more symptoms associated with leukocytosis comprising administering to the subject a dose of a lipid binding protein-based complex effective to reduce the subject’s white blood cell count and/or ameliorate one or more of the one or more symptoms associated with leukocytosis.
  • the white blood cell disorder is a primary bone marrow disorder (e.g., an acute leukemia, chronic leukemia, or myeloproliferative disorder).
  • a primary bone marrow disorder e.g., an acute leukemia, chronic leukemia, or myeloproliferative disorder.
  • the white blood cell disorder is neutrophilia, optionally wherein the neutrophilia is idiopathic neutrophilia, which is optionally chronic idiopathic neutrophilia.
  • the white blood cell disorder is a cancer, which is optionally a bone cancer or blood cancer. 38. The method of embodiment 32, wherein the white blood cell disorder is a myeloproliferative disorder or blood cancer.
  • leukemia is lymphocytic leukemia, chronic eosinophilic leukemia, chronic myelogenous leukemia, or chronic neutrophilic leukemia.
  • a method of treating a subject having endothelial dysfunction comprising administering to the subject a dose of a lipid binding protein-based complex, wherein the dose is a high dose.
  • a method of treating a subject experiencing acute coronary syndrome or stroke or who has experienced acute coronary syndrome or stroke comprising administering to the subject a dose of a lipid binding protein-based complex, wherein the dose is a high dose.
  • a method of treating a subject having or at risk of developing carditis comprising administering to the subject a dose of a lipid binding protein-based complex, optionally wherein the carditis is myocarditis and/or pericarditis.
  • the high dose is the aggregate of two to 20 individual doses, optionally wherein the high dose is an aggregate of two, three, four, five, six, seven, eight, nine or 10 individual doses.
  • the high dose comprises four to six individual doses.
  • the high dose comprises six to 20 individual doses.
  • each individual dose is effective to increase the subject’s HDL levels by at least 25%, at least 30% or at least 35% 2 hours after administration.
  • each individual dose is effective to increase the subject’s HDL levels by at least 25%, at least 30% or at least 35% 3 hours after administration.
  • each individual dose is effective to increase the subject’s HDL levels by at least 25%, at least 30% or at least 35% 4 hours after administration.
  • each individual dose is effective to increase the subject’s ApoA-l levels by at least 25%, at least 30% or at least 35% 2-4 hours after administration.
  • each individual dose is effective to increase the subject’s ApoA-l levels by at least 25%, at least 30% or at least 35% 2 hours after administration.
  • each individual dose is effective to increase the subject’s ApoA-l levels by at least 25%, at least 30% or at least 35% 3 hours after administration.
  • each individual dose is effective to increase the subject’s ApoA-l levels by at least 25%, at least 30% or at least 35% 4 hours after administration.
  • IL-6 interleukin-6
  • TNF-a tumor necrosis factor a
  • lipid binding protein-based complex is an Apomer or a Cargomer.
  • the lipid binding protein-based complex comprises a sphingomyelin.
  • each individual dose of the lipid binding protein-based complex administered is 4-40 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex is 4-30 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex is 15-25 mg/kg (on a protein weight basis). 253. The method of embodiment 250, wherein each individual dose of the lipid binding protein-based complex is 10-30 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex is 10-20 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex is 5 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex is 10 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex is 15 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex is 20 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex is 5 to 15 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex is 10 to 20 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex is 15 to 25 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered in the induction regimen is 4-40 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered in the induction regimen is 4-30 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered in the induction regimen is 15-25 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered in the induction regimen is 10-30 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered in the induction regimen is 10-20 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered in the induction regimen is 5 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered in the induction regimen is 10 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered in the induction regimen is 15 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered in the induction regimen is 20 mg/kg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered is 300 mg to 3000 mg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered is 300 mg to 1500 mg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered is 400 mg to 4000 mg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered is 400 mg to 1500 mg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered is 500 mg to 1200 mg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered is 500 mg to 1000 mg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered is 600 mg to 3000 mg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered is 800 mg to 3000 mg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered is 1000 mg to 2400 mg (on a protein weight basis).
  • each individual dose of the lipid binding protein-based complex administered is 1000 mg to 2000 mg (on a protein weight basis).
  • antihistamine comprises dexchlorpheniramine or hydroxyzine.
  • the one or more anti-IL-6 agents comprise tocilizumab, siltuximab, olokizumab, elsilimomab, BMS-945429, sirukumab, levilimab, CPSI-2364, or a combination thereof.
  • a method of treating a subject having one or more symptoms associated with leukocytosis comprising administering to the subject a dose of an Apolipoprotein A-l (“ApoA-l”) formulation comprising ApoA-l and one or more lipids, wherein the ApoA-l and the lipids are in the form of lipoprotein complexes, effective to reduce the subject’s white blood cell count and/or ameliorate one or more of the one or more symptoms associated with leukocytosis.
  • ApoA-l Apolipoprotein A-l
  • a method of treating a subject having endothelial dysfunction comprising administering to the subject an ApoA-l formulation comprising ApoA-l and one or more lipids, wherein the ApoA-l and the lipids are in the form of lipoprotein complexes.
  • a method of treating a subject having or at risk of developing carditis comprising administering to the subject an ApoA-l formulation comprising ApoA-l and one or more lipids, wherein the ApoA-l and the lipids are in the form of lipoprotein complexes.
  • a method of treating a subject having or at risk of developing leukocytosis comprising administering to the subject a dose of an ApoA-l formulation comprising ApoA-l and one or more lipids, wherein the ApoA-l and the lipids are in the form of lipoprotein complexes, effective to reduce the subject’s white blood cell count.
  • a method of treating a subject experiencing acute coronary syndrome or stroke or who has experienced acute coronary syndrome or stroke comprising administering to the subject an ApoA-l formulation comprising ApoA-l and one or more lipids, wherein the ApoA-l and the lipids are in the form of lipoprotein complexes.
  • An Apolipoprotein A-l (“ApoA-l”) formulation comprising ApoA-l and one or more lipids, wherein the ApoA-l and the lipids are in the form of lipoprotein complexes, for use in treating a subject having one or more symptoms associated with leukocytosis.
  • An Apolipoprotein A-l (“ApoA-l”) formulation comprising ApoA-l and one or more lipids, wherein the ApoA-l and the lipids are in the form of lipoprotein complexes, for use in treating a subject having endothelial dysfunction.
  • An Apolipoprotein A-l (“ApoA-l”) formulation comprising ApoA-l and one or more lipids, wherein the ApoA-l and the lipids are in the form of lipoprotein complexes, for use in treating a subject having or at risk of developing carditis.
  • An Apolipoprotein A-l (“ApoA-l”) formulation comprising ApoA-l and one or more lipids, wherein the ApoA-l and the lipids are in the form of lipoprotein complexes, for use in treating a subject having or at risk of developing leukocytosis.
  • An Apolipoprotein A-l (“ApoA-l”) formulation comprising ApoA-l and one or more lipids, wherein the ApoA-l and the lipids are in the form of lipoprotein complexes, for use in treating a subject experiencing acute coronary syndrome or stroke or who has experienced acute coronary syndrome or stroke.
  • An Apolipoprotein A-l (“ApoA-l”) formulation comprising ApoA-l and one or more lipids, wherein the ApoA-l and the lipids are in the form of lipoprotein complexes, for use in the manufacture of a medicament for one or more symptoms associated with leukocytosis.
  • An Apolipoprotein A-l (“ApoA-l”) formulation comprising ApoA-l and one or more lipids, wherein the ApoA-l and the lipids are in the form of lipoprotein complexes, for use in the manufacture of a medicament for endothelial dysfunction.
  • An Apolipoprotein A-l (“ApoA-l”) formulation comprising ApoA-l and one or more lipids, wherein the ApoA-l and the lipids are in the form of lipoprotein complexes, for use in the manufacture of a medicament for carditis or a risk of developing carditis.
  • An Apolipoprotein A-l (“ApoA-l”) formulation comprising ApoA-l and one or more lipids, wherein the ApoA-l and the lipids are in the form of lipoprotein complexes, for use in the manufacture of a medicament for leukocytosis or a risk of developing leukocytosis.
  • An Apolipoprotein A-l (“ApoA-l”) formulation comprising ApoA-l and one or more lipids, wherein the ApoA-l and the lipids are in the form of lipoprotein complexes, for use in the manufacture of a medicament for acute coronary syndrome or stroke.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Urology & Nephrology (AREA)
  • Cardiology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Oncology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Communicable Diseases (AREA)
  • Zoology (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Immunology (AREA)
  • Biophysics (AREA)
  • Virology (AREA)
  • Vascular Medicine (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Medicinal Preparation (AREA)
  • Peptides Or Proteins (AREA)
PCT/IB2023/000183 2022-04-06 2023-04-06 Methods for treating leukocytosis, endothelial dysfunction and carditis using lipid binding protein-based complexes Ceased WO2023194798A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
CA3247588A CA3247588A1 (en) 2022-04-06 2023-04-06 METHODS FOR TREATING LEUKOCYTOSIS, ENDOTHELIAL DYSFUNCTION AND CARDITIS USING LIPID-BINDING PROTEIN COMPLEXES
AU2023251245A AU2023251245A1 (en) 2022-04-06 2023-04-06 Methods for treating leukocytosis, endothelial dysfunction and carditis using lipid binding protein-based complexes
IL316100A IL316100A (en) 2022-04-06 2023-04-06 Methods for treating leukocytosis, endothelial dysfunction, and carditis using lipid-binding protein-based complexes
KR1020247036482A KR20240171131A (ko) 2022-04-06 2023-04-06 지질 결합 단백질-기반 복합체를 사용하여 백혈구증가증, 내피 기능장애 및 심장염을 치료하는 방법
JP2024559383A JP2025512987A (ja) 2022-04-06 2023-04-06 脂質結合タンパク質に基づく複合体を使用して白血球増加、内皮機能不全、および心臓炎を処置する方法
US18/854,185 US20250255931A1 (en) 2022-04-06 2023-04-06 Methods for treating leukocytosis, endothelial dysfunction and carditis using lipid binding protein-based complexes
EP23729835.1A EP4504233A1 (en) 2022-04-06 2023-04-06 Methods for treating leukocytosis, endothelial dysfunction and carditis using lipid binding protein-based complexes
CN202380044954.XA CN119317440A (zh) 2022-04-06 2023-04-06 使用基于脂质结合蛋白的复合物治疗白细胞增多、内皮功能障碍和心脏炎的方法
MX2024012302A MX2024012302A (es) 2022-04-06 2024-10-03 Métodos para tratar leucocitosis, disfunción endotelial y carditis usando complejos basados en proteína de unión a lípidos

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202263328210P 2022-04-06 2022-04-06
US63/328,210 2022-04-06

Publications (1)

Publication Number Publication Date
WO2023194798A1 true WO2023194798A1 (en) 2023-10-12

Family

ID=86732365

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2023/000183 Ceased WO2023194798A1 (en) 2022-04-06 2023-04-06 Methods for treating leukocytosis, endothelial dysfunction and carditis using lipid binding protein-based complexes

Country Status (10)

Country Link
US (1) US20250255931A1 (https=)
EP (1) EP4504233A1 (https=)
JP (1) JP2025512987A (https=)
KR (1) KR20240171131A (https=)
CN (1) CN119317440A (https=)
AU (1) AU2023251245A1 (https=)
CA (1) CA3247588A1 (https=)
IL (1) IL316100A (https=)
MX (1) MX2024012302A (https=)
WO (1) WO2023194798A1 (https=)

Citations (35)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5059528A (en) 1987-05-28 1991-10-22 Ucb, S.A. Expression of human proapolipoprotein a-i
US5128318A (en) 1987-05-20 1992-07-07 The Rogosin Institute Reconstituted HDL particles and uses thereof
US5220043A (en) 1991-03-21 1993-06-15 Ohio University Synthesis of D-erythro-sphingomyelins
US5840688A (en) 1994-03-22 1998-11-24 Research Corporation Technologies, Inc. Eating suppressant peptides
US6004925A (en) 1997-09-29 1999-12-21 J. L. Dasseux Apolipoprotein A-I agonists and their use to treat dyslipidemic disorders
US6037323A (en) 1997-09-29 2000-03-14 Jean-Louis Dasseux Apolipoprotein A-I agonists and their use to treat dyslipidemic disorders
US6046166A (en) 1997-09-29 2000-04-04 Jean-Louis Dasseux Apolipoprotein A-I agonists and their use to treat dyslipidemic disorders
US20020156007A1 (en) 2000-11-10 2002-10-24 Proteopharma Aps Apolipoprotein analogues
US20030045460A1 (en) 2000-08-24 2003-03-06 Fogelman Alan M. Orally administered peptides to ameliorate atherosclerosis
US20030087819A1 (en) 2001-05-09 2003-05-08 Bielicki John K. Cysteine-containing peptides having antioxidant properties
US6617134B1 (en) 1991-12-13 2003-09-09 Esperion Therapeutics, Inc. Dimer of molecular variant of apolipoprotein and processes for the production thereof
US20030171277A1 (en) 2000-08-24 2003-09-11 The Regents Of The University Of California Orally administered peptides to ameliorate atherosclerosis
US20030181372A1 (en) 2002-01-14 2003-09-25 The Regents Of The University Of California Apolipoprotein A-I mutant proteins having cysteine substitutions and polynucleotides encoding same
US20040067873A1 (en) 2002-05-17 2004-04-08 Dasseux Jean-Louis H. Method of treating dyslipidemic disorders
US20040077541A1 (en) 2002-07-30 2004-04-22 Lingyu Zhu Methods of using non-human animal Apolipoprotein A-I protein
US6743778B2 (en) 2000-04-21 2004-06-01 Amgen Inc. Apo-AI/AII peptide derivatives
US20040229794A1 (en) 2003-02-14 2004-11-18 Ryan Robert O. Lipophilic drug delivery vehicle and methods of use thereof
US20040254120A1 (en) 2000-08-24 2004-12-16 The Regents Of The University Of California Orally administered small peptides synergize statin activity
US20040266671A1 (en) 2000-08-24 2004-12-30 The Regents Of The University Of California Orally administered peptides synergize statin activity
US20040266660A1 (en) 2001-08-20 2004-12-30 Alphonse Hubsch Hdl for the treatment of stroke and other ischemic conditions
US20060069030A1 (en) 2004-07-16 2006-03-30 Trustees Of Tufts College Apolipoprotein A1 mimetics and uses thereof
WO2007023476A2 (en) 2005-08-26 2007-03-01 Cerenis Therapeutics Holding Sa Compositions and methods for producing apolipoprotein gene products in lactic acid bacteria
WO2008104890A2 (en) 2007-02-28 2008-09-04 Cerenis Therapeutics Holding Sa Compositions and methods for producing apolipoprotein
US20080234192A1 (en) 2006-12-08 2008-09-25 Washington, University Of Compositions and methods of use for treating cardiovascular disease
US20090081293A1 (en) 2007-09-20 2009-03-26 Katsuyuki Murase Sustained release of apo a-i mimetic peptides and methods of treatment
WO2010093918A1 (en) 2009-02-16 2010-08-19 Cerenis Therapeutics Sa Apolipoprotein a-i mimics
US8143224B2 (en) 2007-10-23 2012-03-27 The Cleveland Clinic Foundation Oxidant resistant apolipoprotein A-1 and mimetic peptides
US8206750B2 (en) 2005-03-24 2012-06-26 Cerenis Therapeutics Holding S.A. Charged lipoprotein complexes and their uses
WO2012109162A1 (en) 2011-02-07 2012-08-16 Cerenis Therapeutics Holding S.A. Lipoprotein complexes and manufacturing and uses thereof
US20130137628A1 (en) 2010-05-11 2013-05-30 Esperion Therapeutics, Inc. Dimeric Oxidation-Resistant Apolipoprotein A1 Variants
WO2014140787A2 (en) 2013-03-15 2014-09-18 Cerenis Therapeutics Holding Sa Methods for the synthesis of sphingomyelins and dihydrosphingomyelins
US20140275590A1 (en) 2013-03-15 2014-09-18 Cerenis Therapeutics Holding Sa Methods for the synthesis of sphingomyelins and dihydrosphingomyelins
WO2015173633A2 (en) 2014-05-02 2015-11-19 Cerenis Therapeutics Holding Sa Hdl therapy markers
WO2021209823A1 (en) * 2020-04-16 2021-10-21 Abionyx Pharma Sa Methods for treating acute conditions using lipid binding protein- based complexes
WO2021209822A1 (en) * 2020-04-16 2021-10-21 Abionyx Pharma Sa Cer-001 therapy for treating kidney disease

Patent Citations (38)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5128318A (en) 1987-05-20 1992-07-07 The Rogosin Institute Reconstituted HDL particles and uses thereof
US5059528A (en) 1987-05-28 1991-10-22 Ucb, S.A. Expression of human proapolipoprotein a-i
US5220043A (en) 1991-03-21 1993-06-15 Ohio University Synthesis of D-erythro-sphingomyelins
US6617134B1 (en) 1991-12-13 2003-09-09 Esperion Therapeutics, Inc. Dimer of molecular variant of apolipoprotein and processes for the production thereof
US5840688A (en) 1994-03-22 1998-11-24 Research Corporation Technologies, Inc. Eating suppressant peptides
US6037323A (en) 1997-09-29 2000-03-14 Jean-Louis Dasseux Apolipoprotein A-I agonists and their use to treat dyslipidemic disorders
US6046166A (en) 1997-09-29 2000-04-04 Jean-Louis Dasseux Apolipoprotein A-I agonists and their use to treat dyslipidemic disorders
US6004925A (en) 1997-09-29 1999-12-21 J. L. Dasseux Apolipoprotein A-I agonists and their use to treat dyslipidemic disorders
US6743778B2 (en) 2000-04-21 2004-06-01 Amgen Inc. Apo-AI/AII peptide derivatives
US20030045460A1 (en) 2000-08-24 2003-03-06 Fogelman Alan M. Orally administered peptides to ameliorate atherosclerosis
US20030171277A1 (en) 2000-08-24 2003-09-11 The Regents Of The University Of California Orally administered peptides to ameliorate atherosclerosis
US20040266671A1 (en) 2000-08-24 2004-12-30 The Regents Of The University Of California Orally administered peptides synergize statin activity
US20040254120A1 (en) 2000-08-24 2004-12-16 The Regents Of The University Of California Orally administered small peptides synergize statin activity
US20020156007A1 (en) 2000-11-10 2002-10-24 Proteopharma Aps Apolipoprotein analogues
US20030087819A1 (en) 2001-05-09 2003-05-08 Bielicki John K. Cysteine-containing peptides having antioxidant properties
US20040266660A1 (en) 2001-08-20 2004-12-30 Alphonse Hubsch Hdl for the treatment of stroke and other ischemic conditions
US20030181372A1 (en) 2002-01-14 2003-09-25 The Regents Of The University Of California Apolipoprotein A-I mutant proteins having cysteine substitutions and polynucleotides encoding same
US20040067873A1 (en) 2002-05-17 2004-04-08 Dasseux Jean-Louis H. Method of treating dyslipidemic disorders
US20040077541A1 (en) 2002-07-30 2004-04-22 Lingyu Zhu Methods of using non-human animal Apolipoprotein A-I protein
US20040229794A1 (en) 2003-02-14 2004-11-18 Ryan Robert O. Lipophilic drug delivery vehicle and methods of use thereof
US20060069030A1 (en) 2004-07-16 2006-03-30 Trustees Of Tufts College Apolipoprotein A1 mimetics and uses thereof
US8206750B2 (en) 2005-03-24 2012-06-26 Cerenis Therapeutics Holding S.A. Charged lipoprotein complexes and their uses
WO2007023476A2 (en) 2005-08-26 2007-03-01 Cerenis Therapeutics Holding Sa Compositions and methods for producing apolipoprotein gene products in lactic acid bacteria
US20080234192A1 (en) 2006-12-08 2008-09-25 Washington, University Of Compositions and methods of use for treating cardiovascular disease
US8541236B2 (en) 2006-12-08 2013-09-24 University Of Washington Mutant apolipoprotein A-1 polypeptide with increased resistance to oxidation and reactive carbonyls
WO2008104890A2 (en) 2007-02-28 2008-09-04 Cerenis Therapeutics Holding Sa Compositions and methods for producing apolipoprotein
US20090081293A1 (en) 2007-09-20 2009-03-26 Katsuyuki Murase Sustained release of apo a-i mimetic peptides and methods of treatment
US8143224B2 (en) 2007-10-23 2012-03-27 The Cleveland Clinic Foundation Oxidant resistant apolipoprotein A-1 and mimetic peptides
WO2010093918A1 (en) 2009-02-16 2010-08-19 Cerenis Therapeutics Sa Apolipoprotein a-i mimics
US20130137628A1 (en) 2010-05-11 2013-05-30 Esperion Therapeutics, Inc. Dimeric Oxidation-Resistant Apolipoprotein A1 Variants
US20120232005A1 (en) 2011-02-07 2012-09-13 Cerenis Therapeutics Holding S.A. Lipoprotein complexes and manufacturing and uses thereof
WO2012109162A1 (en) 2011-02-07 2012-08-16 Cerenis Therapeutics Holding S.A. Lipoprotein complexes and manufacturing and uses thereof
WO2014140787A2 (en) 2013-03-15 2014-09-18 Cerenis Therapeutics Holding Sa Methods for the synthesis of sphingomyelins and dihydrosphingomyelins
US20140275590A1 (en) 2013-03-15 2014-09-18 Cerenis Therapeutics Holding Sa Methods for the synthesis of sphingomyelins and dihydrosphingomyelins
US20160075634A1 (en) 2013-03-15 2016-03-17 Cerenis Therapeutics Holding Sa Methods for the synthesis of sphingomyelins and dihydrosphingomyelins
WO2015173633A2 (en) 2014-05-02 2015-11-19 Cerenis Therapeutics Holding Sa Hdl therapy markers
WO2021209823A1 (en) * 2020-04-16 2021-10-21 Abionyx Pharma Sa Methods for treating acute conditions using lipid binding protein- based complexes
WO2021209822A1 (en) * 2020-04-16 2021-10-21 Abionyx Pharma Sa Cer-001 therapy for treating kidney disease

Non-Patent Citations (25)

* Cited by examiner, † Cited by third party
Title
CHEUNG ET AL., J. LIPID RES., vol. 28, no. 8, 1987, pages 913 - 29
CHUNG ET AL., J. LIPID RES., vol. 21, no. 3, 1980, pages 284 - 91
CONSTANCE H. KEYSERLING ET AL: "Development of CER-001: Preclinical Dose Selection Through to Phase I Clinical Findings", CLINICAL DRUG INVESTIGATION, 17 February 2017 (2017-02-17), NZ, XP055361987, ISSN: 1173-2563, DOI: 10.1007/s40261-017-0506-3 *
DAUM ET AL., J. MOL. MED., vol. 77, 1999, pages 614 - 22
DUGAR ET AL., CLEVELAND CLINIC JOURNAL OF MEDICINE, vol. 87, no. 1, 2020, pages 53 - 64
DUVERGER ET AL., ARTERIOSCLER. THROMB. VASC. BIOL., vol. 16, no. 12, 1996, pages 1424 - 29
DUVERGER ET AL., EURO. J. BIOCHEM., vol. 201, no. 2, 1991, pages 373 - 83
FRANCESCHINI ET AL., J. BIOL. CHEM., vol. 260, no. 14, 1985, pages 8637 - 46
GOEDDEL: "Gene Expression Technology: Meth. Enzymol.", vol. 185, 1990, ACADEMIC PRESS
GRAY: "Measurement of Lipid Oxidation: A Review", JOURNAL OF THE AMERICAN OIL CHEMISTS SOCIETY, vol. 55, 1978, pages 539 - 545
HEATON, F.W.UR: "Improved iodometric Methods for the Determination of Lipid Peroxides", JOURNAL OF THE SCIENCE OF FOOD AND AGRICULTURE, vol. 9, 1958, pages 781 - 786
KIDNEY INTERNATIONAL SUPPLEMENTS, vol. 2, 2012, pages 1 - 138
MARSHALL ET AL., J INFECT DIS., vol. 190, no. 3, 2004, pages 527 - 34
MCLEAN ET AL., J. BIOL. CHEM., vol. 258, no. 14, 1983, pages 8993 - 9000
NICHOLLS ET AL., EXPERT OPIN BIOL THER., vol. 11, no. 3, 2011, pages 387 - 94
RHODES ET AL., INTENSIVE CARE MED, vol. 43, 2017, pages 304 - 377
SACKS ET AL., J LIPID RES., vol. 50, no. 5, 2009, pages 894 - 907
SALLUSTIO ET AL., NEPHROL DIAL TRANSPLANT, vol. 36, 2021, pages 452 - 464
SAMBROOK ET AL.: "Guide to Molecular Cloning Techniques, Methods in Enzymology", vol. 1-3, 1989, COLD SPRING HARBOR PRESS
SHELNESS ET AL., J. BIOL. CHEM., vol. 259, no. 15, 1984, pages 9929 - 35
TARDIF ET AL., JAMA, vol. 297, 2007, pages 1675 - 1682
VINCENT ET AL., INTENSIVE CARE MED, vol. 22, 1996, pages 707 - 710
WEI ET AL., NATURE METABOLISM DOI.ORG/10.1038/S42255-020-00324-0
WEIS, CHEM. PHYS. LIPIDS, vol. 102, no. 1-2, 1999, pages 3 - 12
ZHAO ET AL., J PHARMACOL SCI, vol. 129, 2015, pages 83 - 94

Also Published As

Publication number Publication date
KR20240171131A (ko) 2024-12-06
CN119317440A (zh) 2025-01-14
JP2025512987A (ja) 2025-04-22
EP4504233A1 (en) 2025-02-12
CA3247588A1 (en) 2023-10-12
US20250255931A1 (en) 2025-08-14
AU2023251245A1 (en) 2024-11-14
MX2024012302A (es) 2025-02-10
IL316100A (en) 2024-12-01

Similar Documents

Publication Publication Date Title
US20240033322A1 (en) Methods for treating acute conditions using lipid binding protein-based complexes
Alexander et al. Osteal macrophages promote in vivo intramembranous bone healing in a mouse tibial injury model
JP2022003048A (ja) 組織石灰化の治療方法
JP2006508045A (ja) ヒト以外の動物のアポリポプロテインa−iタンパク質の使用方法
US20240123027A1 (en) Apomers
AU2024207875A1 (en) Lipid binding protein molecule therapy
US20250255931A1 (en) Methods for treating leukocytosis, endothelial dysfunction and carditis using lipid binding protein-based complexes
CN113438945A (zh) 膜联蛋白涂覆的颗粒
WO2025093929A1 (en) Lipid binding protein molecule therapy
US20250360184A1 (en) Methods for treating acute conditions using lipid binding protein-based complexes
US20250352613A1 (en) Methods for treating hyperinflammatory conditions using lipid binding protein -based complexes
Hardy et al. Could a Non-Cellular Molecular Interactome in the Blood Circulation Influence Pathogens’ Infectivity? Cells 2023, 12, 1699

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23729835

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 316100

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: MX/A/2024/012302

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 2024559383

Country of ref document: JP

ENP Entry into the national phase

Ref document number: 20247036482

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: AU2023251245

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2023729835

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2023729835

Country of ref document: EP

Effective date: 20241106

ENP Entry into the national phase

Ref document number: 2023251245

Country of ref document: AU

Date of ref document: 20230406

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 11202406989S

Country of ref document: SG

WWE Wipo information: entry into national phase

Ref document number: 202380044954.X

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 202380044954.X

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: MX/A/2024/012302

Country of ref document: MX

WWP Wipo information: published in national office

Ref document number: 18854185

Country of ref document: US