WO2023191487A1 - 아프리카돼지열병 바이러스 유래 p62 및 f20572 단백질 절편 및 이들의 용도 - Google Patents

아프리카돼지열병 바이러스 유래 p62 및 f20572 단백질 절편 및 이들의 용도 Download PDF

Info

Publication number
WO2023191487A1
WO2023191487A1 PCT/KR2023/004167 KR2023004167W WO2023191487A1 WO 2023191487 A1 WO2023191487 A1 WO 2023191487A1 KR 2023004167 W KR2023004167 W KR 2023004167W WO 2023191487 A1 WO2023191487 A1 WO 2023191487A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
asfv
present
swine fever
african swine
Prior art date
Application number
PCT/KR2023/004167
Other languages
English (en)
French (fr)
Inventor
홍민선
전보영
박재완
Original Assignee
연세대학교 원주산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020220039705A external-priority patent/KR20230140889A/ko
Priority claimed from KR1020220050971A external-priority patent/KR20230151361A/ko
Application filed by 연세대학교 원주산학협력단 filed Critical 연세대학교 원주산학협력단
Publication of WO2023191487A1 publication Critical patent/WO2023191487A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/12—Viral antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/20—Antivirals for DNA viruses
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses

Definitions

  • the present invention relates to p62 and F20572 protein fragments derived from African swine fever virus (ASFV) and their uses, and more specifically, to an isolated polypeptide consisting of the amino acid sequence represented by SEQ ID NO: 1 or 11, It relates to a vaccine composition against ASFV containing the polypeptide as an active ingredient, a method for animal skinning using the polypeptide, and a method for detecting/diagnosing ASFV infection using the polypeptide, diagnostic reagents, and kits.
  • ASFV African swine fever virus
  • African swine fever is an infectious disease in pigs caused by infection with the African swine fever virus (ASFV), a member of the Asfarviridae family. It was first reported in Kenya in 1921 and has mainly been reported since then. There have been reports of outbreaks in the sub-Saharan region, and since 2007, the scope of occurrence has begun to increase in regions other than Africa, such as the Black Sea coast of Georgia, Armenia, and Azerbaijan. In particular, the outbreak has recently spread from Russia to the east and west, and the number of cases in China and Southeast Asia, which have a lot of interaction with Korea, is rapidly increasing.
  • the African swine fever virus is very resistant to the general environment and remains infectious for more than 18 months at room temperature and for more than 6 months in meat products such as ham. It is also very resistant to heat, losing its infectivity only when exposed to 56°C for at least 1 hour. It has (Non-patent Document 1).
  • African swine fever is a serious disease with a mortality rate of up to 100% when infected with pigs, there is no commercialized vaccine for this disease.
  • African swine fever is spreading again in Europe and has spread to the Asian continent, attention is being focused on vaccine development research, which had not been carried out properly in the past.
  • vaccine development research due to safety concerns, the development of live attenuated vaccines is limited, and previous experimental studies have not shown significant effectiveness.
  • ASFV is larger than other viruses and has a more complex structure, so we are looking for effective parts for defense.
  • the gene size of the African swine fever virus is 10 times that of common RNA viruses, and it has many genes.
  • the gene is large, there are many types of proteins that can be made from the gene, and the ASFV genome is known to encode at least 151 ORFs.
  • the African swine fever virus has a large number of structural proteins and the size of the virus itself is much larger than other viruses, being more than 10 times the size of the circovirus and 4 to 5 times the size of the PRRS virus. Because the African swine fever virus is large and complex, it is difficult to immunize against it, and an effective vaccine has not yet been developed.
  • Diagnosis is also very important because it is a high-risk infectious disease that requires pigs to be disposed of as soon as they occur.
  • diagnostic testing by an accredited laboratory is essential. Laboratory diagnostic tests detect ASFV in the blood and internal organs or detect antibodies in the serum of infected pigs. Since a vaccine has not yet been developed, a positive antibody test indicates field infection. If the virus needs to be isolated from blood, a blood sample collected at the time the initial fever symptoms are confirmed is suitable, and organs such as lymph nodes and spleen should be refrigerated. The ideal sample for testing antibodies is serum from an infected pig in the recovery period between 8 and 21 days after infection.
  • the first screening test for antibodies using serum from infected pigs is OIE-ELISA (indirect method) and a commercially available ELISA for antibody detection, followed by immunorubbing (IB), immunoperoxidase test (IPT), and indirect fluorescence.
  • Final evaluation can be performed through the antibody method (IFA) (see Non-Patent Document 2).
  • ASF disease progresses rapidly and in various stages, and asymptotically infected pigs may also exist, so the laboratory must perform both antigen and antibody tests to accurately determine infection.
  • Non-patent Document 1 Jiyeon Lee, Diagnosis and prevention of African swine fever, Journal of Korean Veterinary Medical Association, Vol. 50_No.11 Nov 2014, 671-673.
  • Non-patent document 2 Daniel Beltran-Alcrudo et al., African swine fever: detection and diagnosis - A manual for veterinarians. FAO Animal Production and Health Manual 2017. No. 19.Rome. Food and Agriculture Organization of the United Nations (FAO). 88 pages.
  • the present inventors have made diligent efforts to provide a commercially available ASFV infection prevention vaccine and an ASFV infection diagnosis method.
  • the polypeptide consisting of the unique sequence provided by the present invention is superior to the natural protein in ASFV.
  • the present invention was completed by confirming that the ASFV infection serum had a significantly superior detection/diagnosis ability, had the potential to be used as a vaccine, and had high industrial productivity and preservation efficiency.
  • the object of the present invention is to provide an isolated polypeptide consisting of the amino acid sequence represented by SEQ ID NO: 1 or 11.
  • Another object of the present invention is to provide a polynucleotide encoding the polypeptide, an expression vector containing the polynucleotide, and a host cell containing the expression vector.
  • Another object of the present invention is to provide a composition for a vaccine against African swine fever virus containing the polypeptide as an active ingredient.
  • Another object of the present invention is to provide a composition for a vaccine against African swine fever virus consisting of the above polypeptide.
  • Another object of the present invention is to provide a composition for a vaccine against African swine fever virus consisting essentially of the above polypeptide.
  • Another object of the present invention is to provide a method for inducing a protective immune response against African swine fever in animals, comprising administering an immunologically effective amount of the polypeptide to the animal. .
  • Another object of the present invention is to provide a composition for diagnosing African swine fever virus infection comprising the polypeptide as an active ingredient.
  • Another object of the present invention is to provide a composition for diagnosing African swine fever virus infection consisting of the above polypeptide.
  • Another object of the present invention is to provide a composition for diagnosing African swine fever virus infection consisting essentially of the polypeptide.
  • Another object of the present invention is to provide a diagnostic reagent for determining the presence of antibodies against the African swine fever virus containing the polypeptide as an active ingredient and a diagnostic kit containing the diagnostic reagent.
  • Another object of the present invention is to include the steps of: (a) contacting an animal sample with the polypeptide; and (b) detecting the presence of an antibody bound to the polypeptide in the sample.
  • Another object of the present invention is to provide the use of the polypeptide for producing a composition for a vaccine against African swine fever virus.
  • Another object of the present invention is to provide the use of the polypeptide for producing a composition for diagnosing African swine fever virus infection.
  • Another object of the present invention is to include the steps of: (a) treating a biological sample obtained from a subject with the polypeptide; (b) detecting the presence of an antibody bound to the polypeptide in the biological sample; and (c) diagnosing the subject as infected with African swine fever virus when the amount of antibody bound to the polypeptide increases compared to the control group.
  • the present invention provides an isolated polypeptide consisting of the amino acid sequence represented by SEQ ID NO: 1 or 11.
  • the present invention provides a polynucleotide encoding the polypeptide, an expression vector containing the polynucleotide, and a host cell containing the expression vector.
  • the present invention provides a composition for a vaccine against African swine fever virus containing the above polypeptide as an active ingredient.
  • the present invention provides a composition for a vaccine against African swine fever virus consisting of the above polypeptide.
  • the present invention provides a composition for a vaccine against African swine fever virus consisting essentially of the above polypeptide.
  • the present invention provides a method of inducing a protective immune response against African swine fever in animals, comprising administering an immunologically effective amount of the polypeptide to the animal. Provides a derivation method.
  • the present invention provides a composition for diagnosing African swine fever virus infection comprising the polypeptide as an active ingredient.
  • the present invention provides a composition for diagnosing African swine fever virus infection consisting of the above polypeptide.
  • the present invention provides a composition for diagnosing African swine fever virus infection consisting essentially of the above polypeptide.
  • the present invention provides a diagnostic reagent for determining the presence of antibodies to the African swine fever virus containing the polypeptide as an active ingredient and a diagnostic kit containing the diagnostic reagent. .
  • the present invention includes the steps of (a) contacting an animal sample with the polypeptide; and (b) detecting the presence of an antibody bound to the polypeptide in the sample.
  • the present invention provides the use of the polypeptide for preparing a composition for a vaccine against African swine fever virus.
  • the present invention provides the use of the polypeptide for producing a composition for diagnosing African swine fever virus infection.
  • the present invention includes the steps of (a) treating a biological sample obtained from a subject with the polypeptide; (b) detecting the presence of an antibody bound to the polypeptide in the biological sample; and (c) diagnosing the subject as infected with African swine fever virus when the amount of antibody bound to the polypeptide increases compared to the control group.
  • the term 'antigen' refers to an antigen that, upon introduction into contact with an appropriate cell, induces a state of sensitivity and/or immunoreactivity and interacts in a demonstrable manner with immune cells and/or antibodies of the subject so sensitized in vivo or in vitro. Refers to all substances that react.
  • the term 'antigen' may be used collectively with the same meaning as the term 'immunogen', and preferably promotes the host immune system to produce a secretory, humoral and/or cellular immune response specific to the antigen.
  • the term 'antigenicity' or 'immunogenicity' refers to the property of the antigen or immunogen, and refers to the property of causing a secretory, humoral and/or cellular immune response.
  • the term 'immune response' is a self-defense system that exists in the animal's body, and is a biological phenomenon that distinguishes various substances or living things invading from the outside from itself and eliminates these invaders.
  • This surveillance system for self-defense is largely accomplished by two mechanisms: one is humoral immunity, and the other is cellular immunity.
  • Humoral immunity is achieved by antibodies present in serum, and antibodies have an important function of binding to and eliminating invading foreign antigenic substances.
  • cellular immunity is achieved by several types of cells belonging to the lymphatic system, and these cells are responsible for directly destroying invading cells or tissues.
  • humoral immunity is mainly effective against external substances such as bacteria, viruses, proteins, and complex carbohydrates that exist outside the cell, while cellular immunity exerts its function against various parasites, tissues, intracellular infections, cancer cells, etc.
  • This dual defense system is mainly carried out by two types of lymphocytes, such as B cells and T cells.
  • B cells produce antibodies, and T cells participate in cellular immunity.
  • the immune response by B cells or T cells is an immune system that responds to antigens that have once invaded the body, but only acts when the same type of antigen continues to exist or has invaded repeatedly. Therefore, this immune response is a specific response to a specific antigen.
  • antigen-specific immune responses there is also a type of natural immune response in the body that directly reacts and destroys attacking cells even when the body has not been exposed to an antigen.
  • This immune response includes neutrophil, macrophage, NK (natural killer) cells, etc. Its characteristic feature is that it exerts a variety of functions regardless of the type of cell being attacked.
  • the target immune response in the present invention is antibodies, B cells, helper T cells, suppressor T cells, cytotoxic T cells, and gamma-delta T cells specifically directed against the antigen or antigens contained in the vaccine.
  • Production or activation of producing a therapeutic or protective immunological response in the host, including, but not limited to, one or more of the effects of enhancing resistance to new infections or reducing the clinical severity of the disease.
  • it may be a protective immune response.
  • the protection is evidenced by a reduction or absence of clinical signs normally exhibited by the infected host, a more rapid or lower duration of recovery, or lower viral titers in the tissues or body fluids or excretions of the infected host.
  • polypeptide' and 'protein' are used according to their usual meaning, that is, they mean a polymer of amino acid residues.
  • a polypeptide is not limited to a particular length, but in the context of the present invention may generally refer to a fragment of a full length protein.
  • the polypeptide or protein may include post-translational modifications, such as glycosylation, acetylation, phosphorylation, etc., and other modifications known in the art (both naturally occurring modifications and non-naturally occurring modifications).
  • Polypeptides and proteins of the present invention can be produced using any of a variety of known recombinant and/or synthetic techniques.
  • the single letter (triple letter) of amino acids refers to the following amino acids according to standard abbreviation conventions in the field of biochemistry: A (Ala): alanine; C(Cys): Cysteine; D(Asp): Aspartic acid; E(Glu): glutamic acid; F(Phe): Phenylalanine; G(Gly): glycine; H(His): histidine; I(IIe): Isoleucine; K(Lys): Lysine; L(Leu): leucine; M(Met): methionine; N(Asn): Asparagine; O(Ply)pyrrolysine; P(Pro): Proline; Q(Gln): Glutamine; R(Arg): arginine; S(Ser): Serine; T(Thr): Threonine; U(Sec): selenocysteine, V(Val): valine;
  • 'polynucleotide' and 'nucleic acid' refer to deoxyribonucleotides (DNA) or ribonucleotides (RNA) in single-stranded or double-stranded form. Unless otherwise limited, known analogs of natural nucleotides that hybridize to nucleic acids in a manner similar to naturally occurring nucleotides are also included.
  • the term 'expression' refers to the production of a protein or nucleic acid in a cell.
  • the present inventors sequentially fused a polypeptide fragment identified from the pK205R protein of ASFV from Italy, the linking sequence (-GAGGS-), and a polypeptide fragment identified from the p62 and P72 proteins of ASFV from Kenya, thereby producing ASFV-infected serum (i.e. , antibodies against ASFV in serum), it is a fragment of SEQ ID NO: 1 or 11 that has excellent advantages in terms of detection/diagnosis, usability as a vaccine, and the possibility of mass production for commercial distribution due to excellent expression level, purification efficiency, and storage stability.
  • a polypeptide composed of amino acid sequences was newly identified.
  • the polypeptide is characterized by having a significantly superior effect in the above-mentioned aspects even compared to the natural protein from which it is derived and polypeptides (fragments) of different lengths or sequence compositions derived from the protein.
  • the present invention provides an isolated polypeptide consisting of the amino acid sequence represented by SEQ ID NO: 1 or 11.
  • the polypeptide of the present invention is characterized by immunogenicity against African swine fever virus (ASFV), and is preferably characterized by specific immunogenicity against ASFV originating from Kenya.
  • ASFV African swine fever virus
  • the polypeptide of the present invention has a wide range of universal immunogenicity, reacting with ASFV specimens not only from ASFV type 6, which occurs in Africa, but also ASFV type 2, which occurs in Russia, Georgia, etc., and recently, which occurs in Jung-gu and Asia. It is characterized by having
  • polypeptides described herein may be prepared (manufactured) by any suitable procedure known to those skilled in the art, i.e., genetic engineering methods, such as recombinant techniques.
  • a nucleic acid encoding the polypeptide or its functional equivalent is prepared according to a conventional method.
  • the nucleic acid can be produced by PCR amplification using appropriate primers.
  • DNA sequences can be synthesized using standard methods known in the art, such as automated DNA synthesizers (available from Biosearch or Applied Biosystems).
  • the prepared nucleic acid is inserted into a vector containing one or more expression control sequences (e.g., promoter, enhancer, etc.) that are operatively linked to control the expression of the nucleic acid, and the recombinant formed therefrom is inserted.
  • the resulting transformant is cultured under media and conditions appropriate for expression of the nucleic acid, and a substantially pure polypeptide expressed by the nucleic acid is recovered from the culture.
  • the recovery can be performed using methods known in the art (eg, chromatography).
  • 'substantially pure polypeptide' means that the polypeptide according to the present invention substantially does not contain any other proteins derived from host cells.
  • polypeptide of the present invention can be produced by chemical synthesis methods known in the art as well as recombinant production methods. Representative methods include, but are not limited to, liquid or solid phase synthesis, fragment condensation, F-MOC or T-BOC chemistry.
  • polypeptides of the invention can be prepared by direct peptide synthesis using solid phase techniques.
  • the solid-phase peptide synthesis (SPPS) method can initiate synthesis by attaching functional units called linkers to small porous beads to connect the peptide chain.
  • the peptide is covalently bonded to the bead and is prevented from falling off during the filtration process until it is cleaved by a specific reactant such as TFA (trifluoroacetic acid).
  • the protection process where the N-terminal amine of the peptide attached to the solid phase binds to the N-protected amino acid unit, the deprotection process, the re-revealed amine group and the new Synthesis occurs by repeating the cycle of coupling process (deprotection-wash-coupling-wash) in which amino acids combine.
  • the SPPS method can be performed using microwave technology, which can shorten the time required for coupling and deprotection of each cycle by applying heat during the peptide synthesis process. The heat energy can prevent folding or aggregation of the extended peptide chain and promote chemical bonding.
  • the peptide of the present invention can be produced by a liquid phase peptide synthesis method known in the art, and the peptide of the present invention can be synthesized by various methods, such as a method of mixing the solid phase synthesis method and the liquid phase synthesis method, as described herein.
  • the manufacturing method is not limited to the means.
  • Protein synthesis can be performed using manual techniques or by automation. Automated synthesis can be accomplished using, for example, the Applied Biosystems 431A peptide synthesizer (Perkin Elmer). Alternatively, various fragments can be chemically synthesized separately and combined using chemical methods to produce the desired molecule.
  • the scope of the polypeptide of the present invention includes functional equivalents of the above-described polypeptide of the present invention and their salts.
  • the term 'functional equivalent' means having at least 80% or more, preferably 90%, more preferably 95% or more amino acid sequence homology (i.e., identity) with the polypeptide of the present invention described above.
  • 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% It refers to a peptide that has 96%, 97%, 98%, 99%, and 100% sequence homology, and exhibits substantially the same physiological activity as the polypeptide of the present invention.
  • substantially homogeneous physiological activity is not limited thereto, but may, for example, induce a protective immune response against ASFV in the body of an animal, and as another example, may be used to detect/diagnose the serum of an ASFV-infected animal. It may mean ability, etc.
  • the functional equivalent in the present invention is one produced by addition, insertion, substitution (non-conservative or conservative substitution), deletion, or a combination thereof of some of the amino acid sequences of the polypeptide of the present invention described above.
  • amino acid substitution may preferably be a conservative substitution.
  • conservative substitutions of naturally occurring amino acids are as follows; Aliphatic amino acids (Gly, Ala, Pro), hydrophobic amino acids (Ile, Leu, Val), aromatic amino acids (Phe, Tyr, Trp), acidic amino acids (Asp, Glu), basic amino acids (His, Lys, Arg, Gln, Asn) ) and sulfur-containing amino acids (Cys, Met).
  • amino acid exchanges that do not overall alter the activity of the molecule are known in the art.
  • the functional equivalents also include variants in which some amino acids are deleted in the amino acid sequence of the polypeptide of the present invention.
  • the deletion or substitution of the amino acid is preferably located in a region that is not directly related to the physiological activity (chemokine activity) of the polypeptide provided by the present invention.
  • variants in which several amino acids are added to both ends of the amino acid sequence of the polypeptide of the present invention or within the sequence are also included.
  • the amino acid added above may be, for example, the '-GSHHHHHH' sequence (SEQ ID NO: 23) as a histidine tag for protein separation/purification, and a fragment containing this is preferably the amino acid of SEQ ID NO: 3. It may be a polypeptide having a sequence.
  • polypeptide derivatives in which part of the chemical structure of the polypeptide is modified while maintaining the basic skeleton of the polypeptide and its physiological activity.
  • this includes structural changes to change the stability, storage, volatility, or solubility of the polypeptide of the present invention, and fusion proteins made by fusing with other proteins while maintaining physiological activity.
  • the polypeptide of the present invention is optionally modified by phosphorylation, sulfation, acrylation, glycosylation, methylation, farnesylation, etc. ) may be.
  • the present invention provides a polynucleotide encoding the polypeptide of the present invention.
  • the base combination of the polynucleotide is not particularly limited as long as it can encode the polypeptide of the present invention.
  • the polynucleotide may be provided as a nucleic acid molecule in the form of a single strand or a double strand, including all DNA, cDNA, and RNA sequences.
  • the polynucleotide may include a base sequence represented by SEQ ID NO: 2 or 12.
  • polynucleotide may consist of a base sequence represented by SEQ ID NO: 2 or 12.
  • the polypeptide of the present invention can be provided by operably linking the nucleic acid sequence encoding the polypeptide of the present invention to a vector capable of expressing the same. Accordingly, the present invention provides an expression vector or recombinant vector containing the above polynucleotide.
  • the term 'expression vector' or 'recombinant vector' refers to a vector capable of expressing a target protein or target RNA in a suitable host cell, and refers to a gene construct containing essential regulatory elements operably linked to express the gene insert. .
  • 'operably linked' refers to a functional linkage between a nucleic acid expression control sequence and a nucleic acid sequence encoding a desired protein or RNA to perform a general function.
  • a promoter and a nucleic acid sequence encoding a protein or RNA can be operably linked to affect expression of the encoding nucleic acid sequence.
  • Operational linkage with a recombinant vector can be made using genetic recombination techniques well known in the art, and site-specific DNA cutting and ligation can be done using enzymes generally known in the art.
  • the vectors include, but are not limited to, plasmid vectors, cosmid vectors, bacteriophage vectors, viral vectors, etc.
  • a suitable expression vector includes expression control elements such as a promoter, operator, start codon, stop codon, polyadenylation signal, and enhancer, as well as a signal sequence or leader sequence for membrane targeting or secretion, and can be prepared in various ways depending on the purpose.
  • the promoter of the vector may be constitutive or inducible.
  • the expression vector may also include a selection marker for selecting host cells containing the vector, and, if it is a replicable expression vector, may include an origin of replication.
  • the signal sequence includes the PhoA signal sequence and OmpA signal sequence when the host is a genus Escherichia ( Escherichia sp.), and the ⁇ -amylase signal sequence and subtilisin signal sequence when the host is a bacterium of the genus Bacillus.
  • the MF ⁇ signal sequence, SUC2 signal sequence, etc. can be used, and if the host is an animal cell, the insulin signal sequence, ⁇ -interferon signal sequence, antibody molecule signal sequence, etc. can be used, but are not limited thereto.
  • the present invention also provides a host cell containing the expression vector. That is, the present invention provides a transformant (host cell) transformed with the expression vector (recombinant vector).
  • the transformation can be performed by any method known to be capable of introducing nucleic acids into an organism, cell, tissue or organ, and can be performed by selecting an appropriate standard technique depending on the host cell, as known in the art. . These methods include microprojectile bombardment, electroporation, protoplast fusion, calcium phosphate (CaPO4) precipitation, calcium chloride (CaCl2) precipitation, agitation using silicon carbide fibers, agrobacteria-mediated transformation, Includes, but is not limited to, PEG-mediated fusion, microinjection, liposome-mediated method, dextran sulfate, lipofectamine, heat shock method, etc.
  • 'transformant' can be used interchangeably with 'host cell', etc., and can be introduced into a cell by any means (e.g. electric shock method, calcium phosphatase precipitation method, microinjection method, transformation method, virus infection, etc.). refers to a prokaryotic or eukaryotic cell containing heterologous DNA.
  • the transformant includes all types of single-celled organisms commonly used in the cloning field, such as prokaryotic microorganisms such as various bacteria (e.g., Clostridia genus, Escherichia coli, etc.), lower eukaryotic microorganisms such as yeast, and insect cells. , cells derived from higher eukaryotes, including plant cells, mammals, etc., can be used as host cells, but are not limited thereto. Since the expression level and modification of proteins varies depending on the host cell, a person skilled in the art can select and use the host cell most suitable for the purpose.
  • the transformant of the present invention may preferably refer to a transformed microorganism.
  • host cells include, for example, Escherichia coli, Bacillus subtilis , Streptomyces , Pseudomonas , and Proteus mirabili. It may be a prokaryotic host cell such as Proteus mirabilis or Staphylococcus . Additionally, fungi (e.g., Aspergillus ), yeast (e.g., Pichia pastoris , Saccharomyces cerevisiae ), Schizosaccharomyces ), Neurospora crassa ( Neurospora crassa ), etc. Cells derived from higher eukaryotes including lower eukaryotes, insect cells, plant cells, mammals, etc. can be used as host cells, but are not limited thereto.
  • fungi e.g., Aspergillus
  • yeast e.g., Pichia pastoris , Saccharomyces cerevisiae
  • Schizosaccharomyces e.g.,
  • the transformant (or transformed microorganism, host cell) of the present invention may preferably be Escherichia coli ( E. coli ).
  • Escherichia coli strain of the present invention is not limited thereto, but for example, Rosetta2 (DE3), C41 (DE3), SoluBL21, etc. may be used.
  • the present invention provides a vaccine composition against African swine fever virus comprising the above-described polypeptide as an active ingredient.
  • the present invention provides a vaccine composition against African swine fever virus consisting of the above-described polypeptide.
  • the present invention provides a vaccine composition against African swine fever virus consisting essentially of the above-described polypeptide.
  • the term 'vaccine' or 'vaccine composition' refers to a composition that stimulates an immune response, and is used interchangeably herein with the same meaning as an immunogenic composition.
  • the vaccines include both preventive and therapeutic vaccines.
  • Prophylactic vaccines induce an immune response before exposure to a substance containing the antigen, in order to mount a greater immune response when the subject is exposed to the antigen, thus increasing the ability to resist substances or cells carrying the antigen.
  • Therapeutic vaccines are used by administering to an individual who already has a disease related to the antigen of the vaccine.
  • the therapeutic vaccine stimulates the individual's immune response to the antigen by providing an increased ability to fight the disease or cells carrying the antigen. can be increased.
  • the present invention may provide a vaccine composition for preventing African swine fever virus infection comprising the polypeptide as an active ingredient.
  • the vaccine composition of the present invention can be administered to mammals, including humans, by any method to induce an immune response.
  • it can be administered orally or parenterally.
  • the parenteral administration method is not limited to this, but may include administering the vaccine via transdermal, intramuscular, intraperitoneal, intravenous, or subcutaneous routes.
  • the vaccine may be administered intramuscularly during the first and second vaccinations.
  • the vaccine may be in any form known in the art, for example, a solid form suitable for liquid and injection form or suspension, but is not limited thereto.
  • These agents can also be emulsified or encapsulated in liposomes or fusible glasses or prepared in aerosol or spray form. They can also be incorporated into transdermal patches.
  • liquid or injectable formulations if necessary, they may contain propylene glycol and a sufficient amount (e.g., about 1%) of sodium chloride to prevent hemolysis.
  • the vaccine composition of the present invention is characterized by comprising the polypeptide of the present invention described above, and may further include one or more agents selected from the group consisting of pharmaceutically acceptable carriers, diluents, and adjuvants.
  • pharmaceutically acceptable means a non-toxic composition that is physiologically acceptable and does not inhibit the action of the active ingredient and does not usually cause gastrointestinal upset, allergic reactions such as dizziness, or similar reactions when administered to humans. says
  • the carrier refers to a substance that facilitates the delivery of a target into cells or tissues.
  • Pharmaceutically acceptable carriers may further include, for example, carriers for oral administration or carriers for parenteral administration.
  • carriers for parenteral administration may include water, suitable oils, saline solutions, aqueous glucose, glycols, etc.
  • the carrier may include dry formulations such as coated patches made of titanium or polymers.
  • Suitable carriers for vaccines are known to those skilled in the art and include, but are not limited to, proteins, sugars, etc.
  • the carrier may be an aqueous solution, or a non-aqueous solution, suspension or emulsion.
  • structured or amorphous organic or inorganic polymers may be used as adjuvants to increase immunogenicity in the composition of the present invention.
  • Immune adjuvants are generally known to play a role in promoting immune responses through chemical and physical binding to antigens.
  • the adjuvants used in this study included amorphous aluminum gel, oil emulsion, double oil emulsion, and immunosol.
  • various plant-derived saponins, levamisole, CpG dinucleotide, RNA, DNA, LPS, and various types of cytokines were used to promote immune responses.
  • the above immune composition can be used as a composition for inducing an optimal immune response by combining various adjuvants and additives that promote immune response.
  • mineral salt adjuvants e.g., alum-, calcium-, iron-, zirconium-based salt adjuvants
  • tensioactive adjuvants e.g., Quil A, QS-21, other saponins
  • bacterial-derived adjuvants e.g., N-acetylmuramyl-L-alanyl-D-isoglutamine (MDP), lipopolysaccharide (LPS), monophosphoryl lipid A, trehalose dimycholate (TDM), DNA , CpGs, bacterial toxins
  • adjuvant emulsions e.g.
  • FIA Montanide
  • Adjuvant 65 Lipovant
  • liposomal adjuvants polymeric adjuvants and carriers
  • cytokines e.g. granulocyte-macrophage colony-stimulating factor
  • carbohydrate adjuvants e.g., Bacillus, viruses, etc.
  • Live antigen delivery systems e.g., bacteria, viruses, etc.
  • compositions that can be added to the vaccine include stabilizers, inactivators, antibiotics, preservatives, etc.
  • vaccine antigens may be mixed with distilled water, buffer solutions, etc.
  • compositions may refer to those known in the art.
  • formulation and administration techniques of the vaccines described herein can be provided with reference to literature known in the art.
  • the vaccine composition containing the immunogenic complex protein of the present invention can be used for immunization by administering an effective amount to an individual in need thereof. That is, the present invention provides a method of inducing a protective immune response against African swine fever in animals, comprising administering to a pig an immunologically effective amount of the polypeptide of the present invention described above. .
  • the ‘subject’ may refer to an animal, preferably a mammal other than a human. In one embodiment, the subject may preferably be a pig.
  • the present invention provides a method for enhancing immunity against ASFV in an animal (particularly a pig), comprising administering the polypeptide to the animal (particularly a pig) (i.e., a method for promoting immunity of the animal against ASFV).
  • a method for immunizing is provided.
  • the term 'immunization' refers to the induction of a secretory, humoral and/or cellular immune response to the immunogenic complex protein in the subject when the immunogenic complex protein according to the present invention is administered to the subject.
  • immunization produces a preventive or therapeutic effect on the target disease (in particular, ASFV infection in the present invention).
  • the 'effective amount' is an amount that shows the preventive or therapeutic effect of the vaccine composition of the present invention on the target disease (particularly, ASFV infection), and the polypeptide of the present invention is secreted, humoral and/or cellular in the administered subject. This refers to an amount sufficient to induce a sexual immune response.
  • the total effective amount of the polypeptide of the present invention can be administered to an individual in a single dose, or can be administered by a fractionated treatment protocol in which multiple doses are administered over a long period of time. Additionally, the content of the active ingredient may vary depending on the purpose of administration.
  • the effective dose is determined for each individual by considering various factors such as the type and severity of the target disease, administration route and number of administrations, as well as the age, weight, health status, gender, severity of the disease, diet and excretion rate of the individual requiring administration. Since the effective dosage is determined, a person with ordinary knowledge in the relevant field will be able to determine the appropriate effective dosage depending on the purpose of administration.
  • the pharmaceutical composition of the present invention is not particularly limited in its formulation, administration route, and administration method as long as it exhibits the effects of the present invention.
  • detecting (diagnosing) ASFV infection serum means that the polypeptide of the present invention binds to the anti-ASFV antibody (antibody against African swine fever virus) present in the blood, plasma, or serum of an individual (antigen- Antibody complex formation) means confirming the presence or/and amount of the antibody. If the presence of anti-ASFV antibodies is detected or/and confirmed in the blood, plasma, or serum of an individual, the individual may be determined to be infected with ASFV.
  • the present invention provides a composition for diagnosing African swine fever virus infection comprising the above-described polypeptide as an active ingredient.
  • the present invention provides a composition for diagnosing African swine fever virus infection consisting of the above-described polypeptide.
  • the present invention provides a composition for diagnosing African swine fever virus infection consisting essentially of the above-described polypeptide.
  • the present invention provides a diagnostic reagent composition for determining the presence or absence of antibodies against African swine fever virus containing the above-described polypeptide as an active ingredient, and a diagnostic kit containing the diagnostic reagent composition.
  • the polypeptides of the present invention have remarkable specificity for various types of ASFV, and can specifically detect not only ASFV originating from Kenya but also recently emerging ASFV. Therefore, in one embodiment, the present invention preferably provides a diagnostic reagent composition for determining the presence or absence of antibodies against African swine fever virus containing the above-described polypeptide of the present invention as an active ingredient, and a diagnostic kit containing the same. It may also be to provide a method for detecting (diagnosing) ASFV infected serum including the steps (a) and (b).
  • sample' may be a solid sample or a humoral sample, and preferably may be serum, plasma, muscle tissue, whole blood, lymph, spleen, or a homogenate thereof.
  • the method and device may be applied without particular limitation as long as it is known in the art as a means for detecting an antigen-antibody complex.
  • antigen-antibody complexes can be tested using radial immunodiffusion, immunoprecipitation assays including immunoelectrophoresis or reverse current electrophoresis, radioimmunoassay (RIA), and competitive indirect immunofluorescent assay. ), ELISA (Enzyme Linked Immunosorbent Assay), or immunochromatic assay. Detection in this manner is particularly advantageous when the antigen is provided as a soluble protein, and the polypeptide of the present invention satisfies this characteristic.
  • an ELISA method particularly a sandwich-type ELISA, is used, and in this case, a detection antibody described later is also used.
  • the present invention can be understood as providing a diagnostic kit using the above method, and kit components according to each method are well known in the art.
  • the antigen (polypeptide of the present invention) may be labeled with a labeling substance. That is, the polypeptide of the present invention may be provided linked (e.g., covalently linked or cross-linked) to a detectable label.
  • the detectable labels include chromogenic enzymes (e.g. peroxidase, alkaline phosphatase), radioisotopes (e.g. 124I, 125I, 111In, 99mTc, 32P, 35S), and chromophores. , biotin, luminescent or fluorescent substances (e.g.
  • the detectable label may be another antibody epitope, substrate, cofactor, inhibitor or affinity ligand unrelated to ASFV. Such labeling may be performed during the process of synthesizing the polypeptide of the present invention, or may be additionally performed on an already synthesized polypeptide.
  • a detection antibody that detects an antibody (primary antibody, for example, an antibody produced in animal serum) bound to the antigen (polypeptide of the present invention) may be labeled.
  • the detection antibody (secondary antibody) that can be used in the method according to the present application specifically binds to immunoglobulin (e.g., IgM, IgG) produced in the animal to be diagnosed, and the detection antibody detects visually or various images. It can be labeled as a substance that can be detected using equipment. This can be understood with reference to the above description of the polypeptide labeling material of the present invention.
  • the antigen (polypeptide of the present invention) or detection antibody (secondary antibody) according to the present application may be a peroxidase such as horseradish peroxidase or alkaline phosphatase as a labeling substance.
  • phosphatase glucose oxidase, beta-galactosidase, urease, catalase, asparginase, ribonuclease, horse malate dehydrogenase, staphylococcal nuclease, triose phospate isomerase, glucose-6-phosphate dehydrogenase , glucoamylase, and acetylcholine esterase, which can catalyze a chemical reaction in the presence of a specific substrate and emit a detectable color reaction or light. It is not limited.
  • the antigen (polypeptide of the present invention) or detection antibody according to the present application is viroluminescence, chemiluminescence, or electroluminescence that emits light of a different wavelength from the light irradiated by light irradiation.
  • chromophores used in photoluminescence, electrochemiluminescence, and photoluminescence include green fluorescent protein; Organic compounds include fluorescein isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, and fluorecamine. Including but not limited to this.
  • the antigen (polypeptide of the invention) or detection antibody according to the present disclosure may be labeled with various radioisotope substances.
  • Detection of the labeling material herein can be performed, for example, by a scintillation counter if the labeling material is a radioisotope, and for example, if the labeling material is a fluorescent material, it can be performed by spectroscopy, a phosphoimaging device, or a fluorescence meter. It can be done by the same method.
  • labeling with an enzyme this can be performed by measuring the chromogenic product resulting from conversion of the chromogenic substrate by the enzyme in the presence of an appropriate substrate.
  • it can be detected by comparing the color of the colored product produced by the enzyme reaction through comparison with an appropriate standard or control group.
  • the substance that labels the antigen (polypeptide of the present invention) or detection antibody according to the present application may include, for example, a chromophore; Enzymes including alkaline phosphatase, biotin, beta-galactosidase or peroxidase; radioactive substances; or materials containing nanoparticles such as colloidal gold particles or colored latex particles, but are not limited thereto.
  • the kit of the present invention may further include a suitable buffer solution or medium for the binding reaction between the polypeptide and the anti-ASFV antibody.
  • a suitable buffer solution or medium for the binding reaction between the polypeptide and the anti-ASFV antibody may be additionally included in the kit.
  • other detectable labeling means for labeling the polypeptide may be additionally included in the kit.
  • secondary antibodies and chromogenic substrates labeled with the fluorescent substance of the present invention may be additionally included in the kit.
  • the polypeptide of the present invention may be provided in a form coated on the surface of a plate.
  • ASFV infection can be diagnosed by observing the binding of the polypeptide (antigen) of the present invention on the surface of the plate and the antibody in the sample.
  • the polypeptide of the present invention can be used in a microwell plate such as a 96-well microwell plate, beads or particles containing colloidal gold particles or colored latex particles, or cellulose, nitrocellulose, polyethersulfone, polyvinylidine, fluoride, It may be provided attached to a membrane such as nylon, charged nylon, and polytetrafluoroethylene.
  • the method for attaching or coating the antigen (polypeptide of the present invention) can be a known method, for example, refer to the method described in the Examples herein.
  • the diagnostic reagent of the present invention can be used in a sandwich-type immunoassay method such as ELISA (Enzyme Linked Immuno Sorbent Assay), RIA (Radio Immuno Assay), etc.
  • sandwich-type immunoassay method such as ELISA (Enzyme Linked Immuno Sorbent Assay), RIA (Radio Immuno Assay), etc.
  • ELISA Enzyme Linked Immuno Sorbent Assay
  • RIA Radio Immuno Assay
  • This method involves adding a sample to an antigen bound to a solid substrate, such as beads, membranes, slides, or microwell plates made of glass, plastic (e.g., polystyrene), polysaccharide, nylon, or nitrocellulose.
  • labels capable of direct or indirect detection such as radioactive substances such as 3H or 125I as described above, fluorescent substances, chemiluminescent substances, haptens, biotin, digoxigenin, etc., or are colored through interaction with a substrate.
  • radioactive substances such as 3H or 125I as described above
  • fluorescent substances such as 3H or 125I as described above
  • chemiluminescent substances such as chemiluminescent substances
  • haptens biotin, digoxigenin, etc.
  • the present invention also provides the use of the above-described polypeptide for preparing a composition for a vaccine against African swine fever virus.
  • the present invention provides the use of the above-described polypeptide for producing a composition for diagnosing African swine fever virus infection.
  • (c) providing a method for diagnosing African swine fever virus infection, including the step of diagnosing the subject as infected with African swine fever virus when the amount of antibody bound to the polypeptide is increased compared to the control group.
  • the present invention provides a method of diagnosing and treating African swine fever virus infection in an individual comprising the following steps:
  • Step (iv) is a step of treating the disease by administering therapeutic drugs such as interferon, antiviral agents, etc. to the individual diagnosed with the disease in step (iii), or by means such as surgery.
  • therapeutic drugs such as interferon, antiviral agents, etc.
  • the 'treatment' of the present invention comprehensively refers to improving the symptoms of African swine fever virus infection or the disease, which may include curing, substantially preventing, or improving the condition of the disease, This includes, but is not limited to, alleviating, curing or preventing one or most of the symptoms resulting from the disease.
  • the 'sample' of the present invention is obtained separately from an individual suspected of having a disease and includes, but is not limited to, cells, tissues, blood, serum, plasma, saliva, and sputum. It may be selected from the group consisting of mucosal fluid and urine, and the 'individual' or 'subject' may be an animal, preferably a mammal, especially an animal including a human, and may be a cell, tissue, organ, etc. derived from an animal. It may be possible. The subject may be a patient in need of the treatment effect.
  • the term “comprising” is used in the same sense as “including” or “characterized by,” and specifically refers to the composition or method according to the present invention. It does not exclude additional components or method steps that have not been used. Additionally, the term “consisting of” means excluding additional elements, steps, or ingredients that are not separately stated.
  • the term “essentially consisting of” means that, in the scope of a composition or method, it may include substances or steps that do not substantially affect its basic characteristics in addition to the described substances or steps.
  • the polypeptide composed of the unique sequence provided by the present invention has significantly superior expression and purification yield compared to the native protein in the virus, is short in length, and is useful for detecting/diagnosing ASFV infection serum even compared to the native protein in ASFV. Not only is its ability significantly superior, but it also has the potential to be used as a vaccine and is highly productive at the industrial level.
  • Figure 1 shows the results of confirming the expression level of Asfv-p62 protein, a polypeptide of the present invention, in a recombinant E. coli cell line.
  • FIG. 1 shows the results of purification of Asfv-p62 protein.
  • Figure 3 shows the results of evaluating the diagnostic usefulness of Asfv-p62 protein through ELISA technique.
  • Figure 4 shows the results of comparing the expression level of Asfv-F20572 protein, a polypeptide of the present invention, in a recombinant E. coli cell line with a protein (Asfv-F72205) fused to the same linkage sequence (-GAGGS-) in the order of p72-p205. will be.
  • Figure 5 shows the results of purification of Asfv-F20572 protein.
  • Figure 6 shows the results of evaluating the diagnostic usefulness of Asfv-F20572 protein through ELISA technique.
  • Example 1 Discovery of highly efficient immunogenic fragment polypeptide derived from African swine fever virus (ASFV) p62 protein originating in Kenya
  • ASFV-p62 W/T p62 protein sequence consisting of the amino acid sequence shown in SEQ ID NO. 9 obtained from the Pig/Kenya/KEN-50/1950 ASFV strain. It was produced and shown in [Table 1]. We sought to overcome the difficulties in producing recombinant proteins at a level for commercial use.
  • DNA encoding Kenya Asfv-p62 W/T polypeptide (SEQ ID NO: 10) was synthesized by Macrogen.
  • DNA encoding Asfv-p62 polypeptide (SEQ ID NO: 4) was synthesized by Macrogen.
  • DNA encoding Asfv-p62_145 polypeptide (SEQ ID NO: 8) was synthesized by Macrogen.
  • the polynucleotide encoding each fragment polypeptide was cloned between the Nde1 and BamH1 restriction sites of the pET49b vector (Novagen). Each polypeptide was overexpressed in BL21 strain, an Escherichia coli strain. E.
  • coli cells transformed with the above vector were grown at 37°C using Luria-Bertani (LB) medium containing 100 ug/ml kanamycin until OD600 was 0.7, and 1 mM isopropyl ⁇ -D-1. Protein expression was induced by -thiogalactopyranoside (IPTG). After adding IPTG, the cells were cultured for an additional 3 hours and then centrifuged at 5,000 rpm for 20 minutes to recover the cells.
  • LB Luria-Bertani
  • IPTG -thiogalactopyranoside
  • the recovered cells were resuspended in 25 ml of 1X Phosphate-buffered saline (PBS) buffer containing 10 mM Imidazole, the cells were broken by sonication, centrifuged at 15,000 rpm for 20 minutes, and the supernatant was mixed with Ni. It was treated with -NTA and bound for 1 hour and 30 minutes (4°C). After washing using 1X PBS buffer containing 50mM Imidazole, the solution was eluted using 1XPBS buffer containing 250mM Imidazole and 500mM Imidazoe. Polypeptides were confirmed using SDS-polyacrylamide gel electrophoresis, and the polypeptides were finally stored in a buffer containing 20 mM HEPES at pH 7.4 and 150 mM sodium chloride (4°C, overnight).
  • PBS 1X Phosphate-buffered saline
  • the productivity of the various fragment polypeptides was quantitatively compared and evaluated.
  • the native polypeptide (Kenya Asfv-p62 W/T) was not expressed in the E. coli cell line. Compared to Kenya Asfv-p62 W/T, Asfv-p62 and Asfv-p62_145 polypeptides were successfully expressed in E. coli. However, Asfv-p62_145 was not purified due to poor stability. However, Asfv-p62 could be purified stably and with high purity.
  • the final yield of expression and purification of the fragment polypeptide of Asfv-p62 (SEQ ID NO: 1) of the present invention was 5 mg protein/1L (LB culture), and the time required for purification (to obtain the protein) was 1.5.
  • Asfv-p62 was successfully expressed in an E. coli cell line with the advantage of efficient production in a short period of time, and not only did it show a high yield that could be used commercially in terms of storage stability and purification process, but the purification period was less than 2 days. .
  • the native Kenya Asfv-p62 W/T protein was not expressed in E. coli, and the Asfv-p62_145 protein was expressed in E. coli, but was not purified due to lack of preservation.
  • the Asfv-p62 (SEQ ID NO: 1) polypeptide fragment of the present invention ensures storage stability in E. coli cell lines, enables high-yield purification, and has the advantage of a short purification process (see Figures 1 and 2).
  • ID Screen African Swine Fever Indirect Screening test kit from ID.vet, the binding ability of various fragment polypeptides produced in Example 1-1 to antibodies in ASFV infection serum was tested using ID (indirect)-ELISA. Comparison and evaluation were conducted. Briefly, it was carried out in the following manner. First, Coating buffer (0.015 M Sodium carbonate, 0.035 M Sodium bicarbonate, Final pH 9.6) and each antigen (various fragment polypeptides prepared in Example 1-1, 2 ug/ml each, or (added at a concentration of 4 ug/ml) was added and incubated overnight (16h) at 4°C to coat each well with each antigen.
  • Coating buffer 0.015 M Sodium carbonate, 0.035 M Sodium bicarbonate, Final pH 9.6
  • each antigen variant fragment polypeptides prepared in Example 1-1, 2 ug/ml each, or (added at a concentration of 4 ug/ml) was added and incubated overnight (16h) at 4°C to coat
  • Each well was washed 4 times using 200 ul of PBST buffer (1XPBS + Tween20 0.05%). 100 ul of primary antibody was added to each well and incubated for 1 hour at room temperature (22°C). The primary antibody was treated with ASFV-infected pig serum provided as a positive control in ID.vet's African Swine Fever Indirect Screening test kit. After washing each well with 200 ul of PBST buffer, 100 ul of secondary antibody was added to each well and incubated at room temperature for 1 hour. After adding 100 ul of Substrate solution to each well, light was blocked and incubated at room temperature for 15 minutes. 100 ul of Stop solution was added to each well, and the optical density was measured at 450 nm.
  • the fragment polypeptide of Asfv-p62 (SEQ ID NO: 1) produced and purified from E. coli showed similar levels in ASFV infection-positive serum compared to other African swine fever antigen proteins (Asfv-p72). showed high reactivity. It also showed a similar level of reactivity compared to the commercial diagnostic reagent provided by ID.vet.
  • Example 2 Discovery of highly efficient immunogenic fragment polypeptide derived from Italian African swine fever virus (ASFV) pK205R protein
  • pK205R protein sequence (NCBI GenBank: AAA65278.1 / also referred to herein as Italia-asfv-p205) consisting of the amino acid sequence shown in SEQ ID NO: 15 obtained from the AFV Malawi/Lil 20-1/1983 strain.
  • SEQ ID NO: 15 obtained from the AFV Malawi/Lil 20-1/1983 strain.
  • Various polypeptide fragments were produced, and some representative examples are shown in [Table 2].
  • the pK205R protein has a problem in that the protein itself is randomly cut (degraded) after expression and purification due to protein instability, so recombinant proteins are produced at a level for commercial use and purified proteins are utilized. /There are difficulties in application. Accordingly, expression/purification was attempted from various angles in the present invention.
  • the above proteins and polypeptides were produced briefly as follows. First, the DNA of Italia-asfv-p205 (SEQ ID NO: 16) was synthesized by requesting Macrogen. DNA encoding each fragment polypeptide, including Italia-asfv-pep205-1 and Italia-asfv-pep205-2, amplifies some gene fragments from the Italia-asfv-p205 DNA through PCR (gene amplification technology). It was obtained in the following way. The polynucleotide encoding each fragment polypeptide was cloned between the BamH1 and Sal1 restriction sites of the pET49b vector (Novagen).
  • Each polypeptide was overexpressed in BL21 strain, an Escherichia coli strain.
  • E. coli cells transformed with the above vector were grown at 37°C using Luria-Bertani (LB) medium containing 100 ug/ml kanamycin until OD600 was 0.7, and 1 mM isopropyl ⁇ -D-1.
  • Protein expression was induced by -thiogalactopyranoside (IPTG). After adding IPTG, the cells were cultured for an additional 4 hours and then centrifuged at 5,000 rpm for 20 minutes to recover the cells.
  • LB Luria-Bertani
  • IPTG -thiogalactopyranoside
  • the recovered cells were resuspended in 50 ml of IB buffer (pH 8.0 Tris 0.1 M, pH 8.0 Ethylenediaminetetraacetic acid 5 mM, phenylmethylsulfonyl fluoride 0.1 mM), the cells were broken by sonication, and finally the cells were dissolved in denaturation buffer (6 M Guanidine Hydrochloric Acid). After resuspending in a denaturation buffer containing 0.1 M acid, pH 8.0 Tris, and 2.5 mM Ethylenediaminetetraacetic acid, pH 8.0, the cells were disrupted by sonication.
  • IB buffer pH 8.0 Tris 0.1 M, pH 8.0 Ethylenediaminetetraacetic acid 5 mM, phenylmethylsulfonyl fluoride 0.1 mM
  • the productivity of various fragment polypeptides was quantitatively compared and evaluated.
  • the total amount immediately after culturing the raw protein production cell line and purifying the protein is similar to the other test groups, but Italia-asfv-p205(pK205R) is very unstable during the purification and storage process, causing random protein decomposition, resulting in a total amount of purification. It was impossible to maintain the intact state of the protein.
  • fragments of Italia-asfv-p205 that could be obtained and stored in intact form were screened.
  • fragment polypeptides of Italia-asfv-pep205-1 SEQ ID NO. 17
  • Italia-asfv-pep205-2 SEQ ID NO. 18
  • ID Screen African Swine Fever Indirect Screening test kit from ID.vet, the binding ability of various fragment polypeptides produced in Example 2-1 to antibodies in ASFV infection serum was tested using ID (indirect)-ELISA. Comparison and evaluation were conducted. Briefly, it was carried out in the following manner. First, Coating buffer (0.015 M Sodium carbonate, 0.035 M Sodium bicarbonate, Final pH 9.6) and each antigen (various polypeptide fragments prepared in Example 2-1, 2 ug/ml or (added at a concentration of 4 ug/ml) was added and incubated overnight (16h) at 4°C to coat each well with each antigen.
  • Coating buffer 0.015 M Sodium carbonate, 0.035 M Sodium bicarbonate, Final pH 9.6
  • each antigen variant polypeptide fragments prepared in Example 2-1, 2 ug/ml or (added at a concentration of 4 ug/ml
  • Each well was washed 4 times using 200 ul of PBST buffer (1XPBS + Tween20 0.05%). 100 ul of primary antibody was added to each well and incubated for 1 hour at room temperature (22°C). The primary antibody was treated with ASFV-infected pig serum provided as a positive control in ID.vet's African Swine Fever Indirect Screening test kit. After washing each well with 200 ul of PBST buffer, 100 ul of secondary antibody was added to each well and incubated at room temperature for 1 hour. After adding 100 ul of Substrate solution to each well, light was blocked and incubated at room temperature for 15 minutes. 100 ul of Stop solution was added to each well, and the optical density was measured at 450 nm.
  • the fragment polypeptides of Italia-asfv-pep205-1 (SEQ ID NO. 17) and Italia-asfv-pep205-2 (SEQ ID NO. 18) showed high reactivity to ASFV infection serum (Results (not shown).
  • a fragment polypeptide of Italia-asfv-pep205-1 (SEQ ID NO: 17) having a shorter sequence is used for fusion with the Kenya-asfv-pep72-2 protein fragment obtained in Example 3 below. did.
  • Example 3 Discovery of highly efficient immunogenic fragment polypeptide derived from African swine fever virus (ASFV) p72 protein originating in Kenya
  • the proteins and polypeptides were produced briefly as follows. DNA encoding fragment polypeptides of Asfv-p72-1 and Asfv-p72 was synthesized by Macrogen. The polynucleotide encoding each fragment polypeptide was cloned between the BamH1 and Sal1 restriction sites of the pET49b vector (Novagen). Each polypeptide was overexpressed in BL21 strain, an Escherichia coli strain. E. coli cells transformed with the above vector were grown at 37°C using Luria-Bertani (LB) medium containing 100 ug/ml kanamycin until OD600 was 0.7, and 1 mM isopropyl ⁇ -D-1.
  • LB Luria-Bertani
  • IPTG -thiogalactopyranoside
  • the cells were cultured for an additional 4 hours and then centrifuged at 5,000 rpm for 20 minutes to recover the cells.
  • the recovered cells were resuspended in 50 ml of IB buffer (pH 8.0 Tris 0.1 M, pH 8.0 Ethylenediaminetetraacetic acid 5 mM, phenylmethylsulfonyl fluoride 0.1 mM), the cells were broken by sonication, and finally the cells were dissolved in denaturation buffer (6 M Guanidine Hydrochloric Acid).
  • Polypeptides were identified using SDS-polyacrylamide gel electrophoresis (denaturation buffer consisting of 6 M Guanidine Hydrochloric acid, pH 8.0 Tris 0.1 M, and pH 8.0 Ethylenediaminetetraacetic acid 2.5 mM), and the polypeptides were pH 7.4, HEPES 20 mM, and sodium chloride. It was stored in a buffer containing 150 mM (4°C, overnight).
  • the productivity of various fragment polypeptides was quantitatively compared and evaluated. As a result, it was confirmed that among various fragments, only the fragment polypeptide of Asfv-p72 (SEQ ID NO: 22) can be expressed and purified in E. coli, which shows an advantage in terms of productivity. Kenya-asfv-p72 protein and Asfv-p72-1 fragment polypeptide were not expressed or had extremely low yields when using E. coli expression cell lines, but it was confirmed that Asfv-p72 could be expressed and purified in E. coli cell lines. The total yield of Asfv-p72 fragment polypeptide from expression and purification was about 4 mg/1L (LB culture).
  • ID Screen African Swine Fever Indirect Screening test kit from ID.vet, the binding ability of the fragment polypeptide prepared in Example 3-1 to antibodies in ASFV infection serum was compared and evaluated by ID (indirect)-ELISA method. did. Briefly, it was carried out in the following manner. First, Coating buffer (0.015 M Sodium carbonate, 0.035 M Sodium bicarbonate, Final pH 9.6) and each antigen (fragment polypeptide prepared in Example 3-1, 2 ug/ml or 4 ug, respectively) were added to a 96 Well EIA/RIA plate. /ml concentration) was added and incubated overnight (16h) at 4°C, and each well was coated with each antigen.
  • Coating buffer 0.015 M Sodium carbonate, 0.035 M Sodium bicarbonate, Final pH 9.6
  • each antigen fragment polypeptide prepared in Example 3-1, 2 ug/ml or 4 ug, respectively
  • Each well was washed 4 times using 200 ul of PBST buffer (1XPBS + Tween20 0.05%). 100 ul of primary antibody was added to each well and incubated for 1 hour at room temperature (22°C). The primary antibody was treated with ASFV-infected pig serum provided as a positive control in ID.vet's African Swine Fever Indirect Screening test kit. After washing each well with 200 ul of PBST buffer, 100 ul of secondary antibody was added to each well and incubated at room temperature for 1 hour. After adding 100 ul of Substrate solution to each well, light was blocked and incubated at room temperature for 15 minutes. 100 ul of Stop solution was added to each well, and the optical density was measured at 450 nm.
  • the fragment polypeptide of Asfv-p72 (SEQ ID NO: 22) showed high reactivity with ASFV infection serum, while Asfv-p72-1 (SEQ ID NO: 21) did not (results not shown). Accordingly, in the present invention, the fragment polypeptide of Asfv-p72 (SEQ ID NO: 22) was used for fusion with the Italia-asfv-pep205-1 (SEQ ID NO: 17) fragment polypeptide previously obtained in Example 2.
  • a novel F20572 polypeptide fragment was produced by fusing the Italia-asfv-pep205-1 polypeptide fragment obtained in Example 2 with the Asfv-p72 polypeptide fragment obtained in Example 3.
  • Each antigenic region was created by inserting a linking sequence (-GAGGS-, glycine-alanine-glycine-glycine-serine) consisting of 5 amino acid groups at the connection site between the Italia-asfv-pep205-1 polypeptide fragment and the Asfv-p72 polypeptide fragment. It was designed to function independently in a three-dimensional spatial structure.
  • the DNA encoding the fragment polypeptide was synthesized by Macrogen.
  • the polynucleotide encoding the fragment polypeptide was cloned between the Nde1 and BamH1 restriction sites of the pET49b vector (Novagen). The polypeptide was overexpressed in BL21 strain, an Escherichia coli strain. E.
  • coli cells transformed with the above vector were grown at 37°C using Luria-Bertani (LB) medium containing 100 ug/ml kanamycin until OD600 was 0.7, and 1 mM isopropyl ⁇ -D-1. Protein expression was induced by -thiogalactopyranoside (IPTG). After adding IPTG, the cells were cultured for an additional 3 hours and then centrifuged at 5,000 rpm for 20 minutes to recover the cells.
  • LB Luria-Bertani
  • IPTG -thiogalactopyranoside
  • the recovered cells were resuspended in 40 ml of IB buffer (pH 8.0 Tris 0.1 M, pH 8.0 Ethylenediaminetetraacetic acid 5 mM, Phenylmethylsulfonyl fluoride 0.1 mM, Sodium chloride 0.1 M), then sonicated to break up the cells and finally dissolved in denaturation buffer. After resuspending in (using a denaturation buffer containing 6 M of Guanidine hydrochloric acid, 0.1 M of Tris, pH 8.0, 2.5 mM of Ethylenediaminetetraacetic acid, 2.5 mM of Dithiothreitol, pH 8.0), the cells were disrupted by sonication.
  • IB buffer pH 8.0 Tris 0.1 M, pH 8.0 Ethylenediaminetetraacetic acid 5 mM, Phenylmethylsulfonyl fluoride 0.1 mM, Sodium chloride 0.1 M
  • Refolding buffer 50 mM Sodium chloride, pH 8.0 Tris 100 mM, pH 8.0 Ethylenediaminetetraacetic acid 2.5 mM, 0.6 M L-Arginine, 0.2 mM oxidized glutathione, 2 It was diluted to 1 mg/ml in mM reduced glutathione (10°C, 12hrs). After refolding, transfer to a snake skin tube, add Urea buffer (20mM Tris pH 8.0, 100mM Urea) twice for 12 hours at 4°C, and add 1 Put it in buns.
  • the productivity of the fused polypeptide fragments was quantitatively compared and evaluated.
  • Another fragment polypeptide (Asfv-F72205) was not expressed in E. coli cell lines.
  • Asfv-F20572 polypeptide was successfully expressed in E. coli and could be purified to a high degree of purity.
  • the final yield of expression and purification of the fragment polypeptide of Asfv-F20572 (SEQ ID NO: 11) of the present invention was 1 mg protein/1L (LB culture), and the time required for purification (to obtain the protein) was 2.5. It was one to three days. Asfv-F20572 was successfully expressed in an E.
  • Asfv-F72205 protein which had a different fusion protein sequence, was not expressed in E. coli.
  • Asfv-F20572 (SEQ ID NO: 11) polypeptide fragment of the present invention can be purified in high yield from E. coli cell lines and shows the advantage of a short purification process (see Figures 4 and 5).
  • ID Screen African Swine Fever Indirect Screening test kit from ID.vet, the binding ability of the fragment polypeptide prepared in Example 3-1 to antibodies in ASFV infection serum was compared and evaluated by ID (indirect)-ELISA method. did. Briefly, it was carried out in the following manner. First, Coating buffer (0.015 M Sodium carbonate, 0.035 M Sodium bicarbonate, Final pH 9.6) and each antigen (fragment polypeptide prepared in Example 3-1, 2 ug/ml or 4 ug, respectively) were added to a 96 Well EIA/RIA plate. /ml concentration) was added and incubated overnight (16h) at 4°C, and each well was coated with the antigen.
  • Coating buffer 0.015 M Sodium carbonate, 0.035 M Sodium bicarbonate, Final pH 9.6
  • each antigen fragment polypeptide prepared in Example 3-1, 2 ug/ml or 4 ug, respectively
  • Each well was washed 4 times using 200 ul of PBST buffer (1XPBS + Tween20 0.05%). 100 ul of primary antibody was added to each well and incubated for 1 hour at room temperature (22°C). The primary antibody was treated with ASFV-infected pig serum provided as a positive control in ID.vet's African Swine Fever Indirect Screening test kit. After washing each well with 200 ul of PBST buffer, 100 ul of secondary antibody was added to each well and incubated at room temperature for 1 hour. After adding 100 ul of Substrate solution to each well, light was blocked and incubated at room temperature for 15 minutes. 100 ul of Stop solution was added to each well, and the optical density was measured at 450 nm.
  • the fragment polypeptide of Asfv-F20572 (SEQ ID NO: 11) produced and purified from E. coli was at a superior level compared to other African swine fever antigen proteins (Asfv-p72 or Asfv-p205). It showed high selective reactivity against ASFV infection serum. It also showed excellent reactivity compared to commercial diagnostic reagents provided by ID.vet.
  • the present invention relates to the development and use of p62 and F20572 protein fragments derived from African swine fever virus (ASFV) as recombinant antigens, and more specifically, indicated by SEQ ID NO: 1 or 11.
  • ASFV African swine fever virus
  • an isolated polypeptide consisting of an amino acid sequence a vaccine composition against ASFV containing the polypeptide as an active ingredient, an animal immunization method using the polypeptide, and a method for detecting/diagnosing ASFV infection using the polypeptide, a diagnostic reagent, and It's about the kit.
  • the polypeptide consisting of the unique sequence provided by the present invention is shorter in length compared to the native protein in the virus, and compared to the native protein in ASFV, it not only has a significantly better ability to detect/diagnose ASFV infection serum, but also provides a vaccine. It has the potential to be used as a product, and its productivity is high at the industrial level, so it has great potential for industrial use.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Urology & Nephrology (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Hematology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Biomedical Technology (AREA)
  • Cell Biology (AREA)
  • Physics & Mathematics (AREA)
  • Epidemiology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Communicable Diseases (AREA)
  • General Chemical & Material Sciences (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Food Science & Technology (AREA)
  • Mycology (AREA)
  • Analytical Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

본 발명은 서열번호 1 또는 11로 표시되는 아미노산 서열로 이루어진 단리된 폴리펩타이드, 상기 폴리펩타이드를 유효성분으로 포함하는 ASFV (African swine fever virus)에 대한 백신 조성물과 상기 폴리펩타이드를 이용한 동물 면역화 방법, 및 상기 폴리펩타이드를 이용한 ASFV 감염 검출/진단 방법, 진단시약 및 키트를 제공한다. 본 발명에서 제공하는 특유의 서열로 구성되는 폴리펩타이드는 바이러스 내 천연형 단백질과 비교하여 발현 및 정제 수율이 현저히 우수하고, 길이가 짧고, ASFV 내의 천연형 단백질과 비교하여도 ASFV 감염 혈청 검출/진단 능력이 현저히 우수할 뿐만 아니라, 백신으로서 사용 가능성이 있으며 또한 산업적 수준에서 생산성이 높아 유용하게 이용될 수 있다.

Description

아프리카돼지열병 바이러스 유래 P62 및 F20572 단백질 절편 및 이들의 용도
본 출원은 2022년 3월 30일에 출원된 대한민국 특허출원 제 10-2022- 0039705호 및 2022년 4월 25일에 출원된 대한민국 특허출원 제 10-2022- 0050971호를 우선권으로 주장하고, 상기 명세서 전체는 본 출원의 참고문헌이다.
본 발명은 아프리카돼지열병 바이러스(African swine fever virus, ASFV) 유래 p62 및 F20572 단백질 절편 및 이들의 용도에 관한 것으로, 보다 상세하게는 서열번호 1 또는 11로 표시되는 아미노산 서열로 이루어진 단리된 폴리펩타이드, 상기 폴리펩타이드를 유효성분으로 포함하는 ASFV에 대한 백신 조성물과 상기 폴리펩타이드를 이용한 동물 면혁화 방법, 및 상기 폴리펩타이드를 이용한 ASFV 감염 검출/진단 방법, 진단시약 및 키트에 관한 것이다.
아프리카돼지열병(African swine fever, ASF)은, 아스파비리대 (Asfarviridae)에 속하는 아프리카돼지열병 바이러스 (African swine fever virus, ASFV) 감염에 의한 돼지 전염병으로, 1921년 케냐에서 최초 보고가 있은후, 주로 사하라 이남 지역에서 발생 보고가 있었고, 2007년 이후로 흑해 연안인 죠지아, 아르메니아, 아제르바이잔 등 아프리카 이외 지역에서 그 발생 범위가 늘어나기 시작하였다. 특히 최근에는 러시아에서 동서로 그 발생이 확산되고 있으며, 우리나라와 교류가 많은 중국 및 동남아시아에서의 발병 사례가 급증하고 있다.
아프리카돼지열병 바이러스는 일반 환경에 매우 저항성이 강하여 실온에서 18개월 이상, 햄과 같은 식육 제품에서도 6개월 이상 감염력이 유지되며, 열에도 매우 강하여 56℃에서 최소 1시간 이상 노출하여야만 감염력을 잃는 특성을 가지고 있다(비특허문헌 1).
아프리카돼지열병은 돼지에 감염시 폐사율이 100%에 이르는 심각한 질병임에도 불구하고 이 질병에 대한 상용화된 백신은 없는 상태이다. 유럽지역에서 아프리카돼지열병이 다시 확산되고, 아시아 대륙까지 전파되면서 과거 제대로 진행되지 못했던 백신에 대한 개발 연구에 이목이 집중되고 있다. 하지만 안전성 문제로 약독화 생독백신은 개발이 제한적인 상황이고 이전의 실험적 연구에서도 큰 효과를 거두지 못하였다. 사독백신 또한 방어에 효과적인 제품을 개발하는데 넘어야 산이 많다. 예를 들면, ASFV는 다른 바이러스보다 크고 복잡한 구조를 가지고 있어 방어에 효과적인 부위를 찾고 있는 실정이다. 아프리카돼지열병 바이러스의 유전자 크기는 일반적인 RNA 바이러스들의 10배 수준으로 많은 유전자를 가지고 있다. 유전자가 크다 보니 유전자로부터 만들어질 수 있는 단백질 종류도 많으며, ASFV 게놈은 통상 적어도 151개의 ORF를 암호화하는 것으로 알려져 있다. 아프리카돼지열병 바이러스는 구조 단백질도 개수가 많고 바이러스의 크기 자체도 다른 바이러스보다 훨씬 커서 써코바이러스(circovirus)의 10배 이상, PRRS바이러스의 4~5배 크기를 가지고 있다. 이렇게 아프리카돼지열병 바이러스가 크고 복잡하다 보니 면역도 어려워 아직도 효과적인 백신이 개발되어 있지 못한 실정이다.
또한 발생 즉시 돼지를 처분해야 하는 위험도가 높은 전염병이기 때문에 진단 또한 매우 중요하다. 아프리카돼지열병의 확진을 위해서는 공인된 실험실의 진단 검사가 필수적이다. 실험실 진단 검사는 혈액 및 내부 장기에서 ASFV를 검출하거나 감염 돼지의 혈청에서 항체를 검출하는 방법이 있다. 백신이 아직 개발되지 않았으므로 항체 검사에서 양성반응은 야외 감염을 의미한다. 만약 혈액에서 바이러스를 분리해야 한다면 초기 발열 증상이 확인된 시기에 채혈한 가검물이 적합하며, 림프절이나 비장과 같은 장기는 냉장 상태로 의뢰한다. 항체를 검사하기 위한 가검물은 감염 후 8~21일 사이의 회복기에 있는 감염 돼지의 혈청이 이상적이다. 감염돈의 혈청을 이용한 항체를 검출법은 OIE-ELISA(간접법)와 상용화된 항체 검출용 ELISA를 이용하여 1차 선별검사를 진행하고 면역탁본법(IB), 면역과산화효소시험(IPT), 간접형광항체법(IFA)을 통해 최종 평가할 수 있다(비특허문헌 2 참조). ASF는 질병의 진행 단계가 빠르고 다양하며 불현성 감염된 돼지도 존재할 수 있으므로 실험실에서는 반드시 항원 및 항체 검사를 함께 수행하여 정확하게 감염 여부를 파악해야 한다.
이에 상업적으로 보급될 수 있고 실효성 있는 ASFV 감염 예방 백신 및 ASFV 감염 진단 관련 기술 개발이 시급한 실정이다.
[선행기술문헌]
[비특허문헌]
(비특허문헌 1) 이지연, 아프리카돼지열병(African swine fever) 진단 및 예방, Journal of Korean Veterinary Medical Association, Vol. 50_No.11 Nov 2014, 671-673.
(비특허문헌 2) Daniel Beltran-Alcrudo et al., African swine fever: detection and diagnosis - A manual for veterinarians. FAO Animal Production and Health Manual 2017. No. 19. Rome. Food and Agriculture Organization of the United Nations (FAO). 88 pages.
이에 본 발명자들은 상업적으로 보급될 수 있는 ASFV 감염 예방 백신 및 ASFV 감염 진단 방법을 제공하기 위하여 예의 노력한 결과, 본 발명에서 제공하는 특유의 서열로 구성되는 폴리펩타이드가 ASFV 내의 천연형 단백질과 비교하여도 ASFV 감염 혈청 검출/진단 능력이 현저히 우수할 뿐만 아니라, 백신으로서 사용 가능성이 있고, 또한 산업적으로도 생산성 및 보존 효율성이 높은 것을 확인하여 본 발명을 완성하였다.
따라서 본 발명의 목적은, 서열번호 1 또는 11로 표시되는 아미노산 서열로 이루어진 단리된 폴리펩타이드를 제공하는 것이다.
본 발명의 다른 목적은, 상기 폴리펩타이드를 암호화하는 폴리뉴클레오타이드, 상기 폴리뉴클레오타이드를 포함하는 발현 벡터 및 상기 발현 벡터를 포함하는 숙주 세포를 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 폴리펩타이드를 유효성분으로 포함하는 아프리카돼지열병 바이러스에 대한 백신용 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 폴리펩타이드로 이루어진 아프리카돼지열병 바이러스에 대한 백신용 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 폴리펩타이드로 필수적으로 이루어진 아프리카돼지열병 바이러스에 대한 백신용 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은, 동물에서 아프리카돼지열병에 대한 방어 면역 반응을 유도하는 방법으로서, 상기 폴리펩타이드의 면역 유효량을 동물에게 투여하는 단계를 포함하는 것인 방어 면역 반응의 유도법을 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 폴리펩타이드를 유효성분으로 포함하는 아프리카돼지열병 바이러스 감염 진단용 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 폴리펩타이드로 이루어진 아프리카돼지열병 바이러스 감염 진단용 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 폴리펩타이드로 필수적으로 이루어진 아프리카돼지열병 바이러스 감염 진단용 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 폴리펩타이드를 유효성분으로 포함하는 아프리카돼지열병 바이러스에 대한 항체 존재 여부를 판단하기 위한 진단 시약 및 상기 진단 시약을 포함하는 진단 키트를 제공하는 것이다.
본 발명의 또 다른 목적은, (a) 동물의 시료를 상기 폴리펩타이드와 접촉시키는 단계; 및 (b) 상기 시료 중 상기 폴리펩타이드와 결합된 항체의 존재를 검출하는 단계를 포함하는 아프리카돼지열병 바이러스 감염 혈청 검출 방법을 제공하는 것이다.
본 발명의 또 다른 목적은, 아프리카돼지열병 바이러스에 대한 백신용 조성물을 제조하기 위한 상기 폴리펩타이드의 용도를 제공하는 것이다.
본 발명의 또 다른 목적은, 아프리카돼지열병 바이러스 감염 진단용 조성물을 제조하기 위한 상기 폴리펩타이드의 용도를 제공하는 것이다.
본 발명의 또 다른 목적은, (a) 피검체로부터 수득한 생물학적 시료에 상기 폴리펩타이드를 처리하는 단계; (b) 상기 생물학적 시료에서 상기 폴리펩타이드와 결합된 항체의 존재를 검출하는 단계; 및 (c) 상기 폴리펩타이드와 결합한 항체의 양이 대조군보다 증가한 경우 상기 피검체를 아프리카돼지열병 바이러스에 감염된 것으로 진단하는 단계를 포함하는, 아프리카돼지열병 바이러스 감염 진단 방법을 제공하는 것이다.
상기와 같은 목적을 달성하기 위하여, 본 발명은 서열번호 1 또는 11로 표시되는 아미노산 서열로 이루어진 단리된 폴리펩타이드를 제공한다.
본 발명의 다른 목적을 달성하기 위하여, 본 발명은 상기 폴리펩타이드를 암호화하는 폴리뉴클레오타이드, 상기 폴리뉴클레오타이드를 포함하는 발현 벡터 및 상기 발현 벡터를 포함하는 숙주 세포를 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 상기 폴리펩타이드를 유효성분으로 포함하는 아프리카돼지열병 바이러스에 대한 백신용 조성물을 제공한다.
또한 본 발명의 또 다른 목적을 달성하기 위하여, 본발명은 상기 폴리펩타이드로 이루어진 아프리카돼지열병 바이러스에 대한 백신용 조성물을 제공한다.
또한 본 발명의 또 다른 목적을 달성하기 위하여, 본발명은 상기 폴리펩타이드로 필수적으로 이루어진 아프리카돼지열병 바이러스에 대한 백신용 조성물을 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 동물에서 아프리카돼지열병에 대한 방어 면역 반응을 유도하는 방법으로서, 상기 폴리펩타이드의 면역 유효량을 동물에게 투여하는 단계를 포함하는 것인 방어 면역 반응의 유도법을 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 상기 폴리펩타이드를 유효성분으로 포함하는 아프리카돼지열병 바이러스 감염 진단용 조성물을 제공한다.
또한, 본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 상기 폴리펩타이드로 이루어진 아프리카돼지열병 바이러스 감염 진단용 조성물을 제공한다.
또한, 본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 상기 폴리펩타이드로 필수적으로 이루어진 아프리카돼지열병 바이러스 감염 진단용 조성물을 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 상기 폴리펩타이드를 유효성분으로 포함하는 아프리카돼지열병 바이러스에 대한 항체 존재 여부를 판단하기 위한 진단 시약 및 상기 진단 시약을 포함하는 진단 키트를 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 (a) 동물의 시료를 상기 폴리펩타이드와 접촉시키는 단계; 및 (b) 상기 시료 중 상기 폴리펩타이드와 결합된 항체의 존재를 검출하는 단계를 포함하는 아프리카돼지열병 바이러스 감염 혈청 검출 방법을 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 아프리카돼지열병 바이러스에 대한 백신용 조성물을 제조하기 위한 상기 폴리펩타이드의 용도를 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 아프리카돼지열병 바이러스 감염 진단용 조성물을 제조하기 위한 상기 폴리펩타이드의 용도를 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 (a) 피검체로부터 수득한 생물학적 시료에 상기 폴리펩타이드를 처리하는 단계; (b) 상기 생물학적 시료에서 상기 폴리펩타이드와 결합된 항체의 존재를 검출하는 단계; 및 (c) 상기 폴리펩타이드와 결합한 항체의 양이 대조군보다 증가한 경우 상기 피검체를 아프리카돼지열병 바이러스에 감염된 것으로 진단하는 단계를 포함하는, 아프리카돼지열병 바이러스 감염 진단 방법을 제공한다.
이하 본 발명을 상세히 설명한다.
본 발명에서 용어 '항원'은 적당한 세포와 접촉하여 유입됨에 따라 민감성 및/또는 면역 반응성 상태를 유도시키고, 생체 내 또는 시험관 내에서 이와 같이 감작된 대상체의 면역 세포 및/또는 항체와 입증 가능한 방식으로 반응하는 모든 물질을 지칭한다. 본 발명에서 용어 '항원'은 '면역원'이라는 용어와 동일한 의미로 통칭되어 사용될 수 있으며, 바람직하게 숙주 면역 체계가 그 항원에 특이적인 분비성, 체액성 및/또는 세포성 면역 반응을 일으키도록 촉진할 수 있는 하나 또는 그 이상의 에피토프를 포함하는 분자를 의미한다. 또한 본 발명에서 용어 '항원성' 또는 '면역원성'은 상기 항원 또는 면역원의 성질을 뜻하는 것으로 분비성, 체액성 및/또는 세포성 면역 반응을 일으키는 성질을 의미한다.
상기 용어 '면역 반응'이란 동물 체내에 존재하는 자기방어체계로서, 외부로부터 침입해오는 각종 물질이나 생명체를 자기 자신과 구별하여 이 침입자를 제거하는 생물학적 현상이다. 이러한 자기방어를 위한 감시 체계는 크게 두 가지 기작에 의해 이루어지는데 하나는 체액성 면역, 그리고 다른 하나는 세포성 면역이다. 체액성 면역은 혈청 내에 존재하는 항체에 의해 이루어지는데, 항체는 침입한 외부 항원물질과 결합하여 그것을 제거하는 중요한 기능을 한다. 한편, 세포성 면역은 림프계에 속하는 몇 종류의 세포에 의해 이루어지는데 이러한 세포는 침입해온 세포나 조직을 직접 파괴하는 기능을 담당한다. 그리하여 체액성 면역은 주로 세포 외부에 존재하는 세균이나 바이러스, 단백질, 복합탄수화물과 같은 외부물질에 대해 효과적이며, 세포성 면역은 각종 기생충, 조직, 세포 내 감염, 암세포 등에 그 기능을 발휘한다. 이러한 이중 방어체계는 B 세포나 T 세포 등의 주로 두 종류 림프구에 의해 수행되는데 B 세포는 항체를 생산하고, T 세포는 세포성 면역에 가담하고 있다. 이러한 B 세포나 T 세포에 의한 면역 반응은 일단 체내로 침입한 항원에 대하여 반응을 하되, 반드시 같은 종류의 항원이 계속 존재하거나 반복 침입해 왔을 경우에 작용하는 면역체계이다. 따라서, 이러한 면역 반응은 특정 항원에 대한 특이한 반응이다. 이러한 항원특이적 면역 반응 이외에도 체내에는 어떤 항원에 대해 노출되어진 경험이 없는 경우라도 직접적으로 반응하여 공격 세포를 파괴하는 일종의 자연 면역 반응도 있는데, 이러한 면역반응에는 neutrophil, macrophage, NK(natural killer) 세포 등이 관여하여 공격대상 세포의 종류에 별로 구애됨이 없이 다양한 기능을 발휘하는 것이 특징이다.
바람직하게 본 발명에서 목적하는 면역반응은, 백신 중에 포함된 항원 또는 항원들에 대해 특이적으로 지시된 항체, B 세포, 헬퍼 T 세포, 서프레서 T 세포, 세포독성 T 세포 및 감마-델타 T 세포의 생산 또는 활성화, 숙주에서 치료학적 또는 보호 면역학적 반응을 나타내어 새로운 감염에 대한 내성이 증진되거나 질환의 임상적 중증도가 감소되는 효과 중 하나 이상을 포함하지만 이에 제한되지는 않는다. 바람직하게는 보호 면역 반응일 수 있다.
상기 보호는 감염된 숙주가 통상적으로 나타내는 임상적 징후의 감소 또는 부재, 보다 신속한 회복 시간 또는 보다 낮아진 지속시간 또는 감염된 숙주의 조직 또는 체액 또는 배설물에서 보다 낮은 바이러스 역가에 의해 입증된다.
본 명세서 사용된 용어 '폴리펩타이드' 및 '단백질'은 통상의 의미에 따라 사용되는 것으로, 즉 아미노산 잔기의 중합체를 의미한다. 폴리펩타이드는 특정의 길이로 한정되지 않지만, 본 발명의 문맥에서는 일반적으로 전장(full length) 단백질의 단편을 지칭하는 것일 수 있다. 상기 폴리펩타이드 또는 단백질은 번역 후의 수식, 예를 들면 글리코실화, 아세틸화, 인산화 등 및 해당 분야에 공지된 다른 수식(자연적으로 발생하는 수식 및 비자연적 발생의 수식)을 포함할 수 있다. 본 발명의 폴리펩타이드 및 단백질은 임의의 다양한 공지의 재조합 및/또는 합성의 기술을 이용하여 제조될 수 있다.
본 명세서에 사용된 아미노산의 일문자(삼문자)는 생화학 분야에서의 표준 약어 규정에 따라 다음의 아미노산을 의미한다: A(Ala): 알라닌; C(Cys): 시스테인; D(Asp):아스파르트산; E(Glu): 글루탐산; F(Phe): 페닐알라닌; G(Gly): 글라이신; H(His): 히스티딘; I(IIe): 이소류신; K(Lys): 라이신; L(Leu): 류신; M(Met): 메티오닌; N(Asn): 아스파라긴; O(Ply)피롤라이신; P(Pro): 프롤린; Q(Gln): 글루타민; R(Arg): 아르기닌; S(Ser): 세린; T(Thr): 트레오닌; U(Sec):셀레노시스테인, V(Val): 발린; W(Trp): 트립토판; Y(Tyr): 티로신.
본 명세서에서 사용된 용어 '폴리뉴클레오타이드', '핵산'은 단일-가닥 또는 이중-가닥의 형태로 된 데옥시리보뉴클레오타이드(DNA) 또는 리보뉴클레오타이드(RNA)를 말한다. 다른 제한이 없는 한, 자연적으로 생성되는 뉴클레오타이드와 비슷한 방법으로 핵산에 혼성화되는 자연적 뉴클레오티드의 공지된 아날로그도 포함된다.
본 명세서에서 용어 '발현(expression)'이라 함은 세포에서 단백질 또는 핵산의 생성을 의미한다.
본 발명자들은 이탈리아 유래 ASFV의 pK205R 단백질로부터 규명한 폴리펩타이드 단편과, 연결서열(-GAGGS-), 및 케냐 유래 ASFV p62 및 P72 단백질로부터 규명한 폴리펩타이드 단편을 순서대로 융합함으로써, ASFV 감염 혈청(즉, 혈청 내 ASFV에 대한 항체) 검출/진단 측면, 백신으로서의 이용 가능성 측면 및 발현량과 정제 효율 및 보존 안정성이 뛰어나 상업적 보급을 위한 대량생산 가능성 측면 등에 있어서 우수한 장점을 지니는 단편으로서 서열번호 1 또는 11의 아미노산 서열로 구성되는 폴리펩타이드를 신규하게 규명하였다. 상기 폴리펩타이드는 이것이 유래된 천연형 단백질 및 상기 단백질에서 유래된 다른 길이 혹은 서열 구성의 폴리펩타이드(단편)과 비교하여도 전술한 측면에 있어서 현저히 우수한 효과를 가지는 것이 특징이다.
이에 본 발명은 서열번호 1 또는 11로 표시되는 아미노산 서열로 이루어진 단리된 폴리펩타이드를 제공한다.
상기 본 발명의 폴리펩타이드는 아프리카돼지열병 바이러스(African swine fever virus, ASFV)에 대한 면역원성(immunogenicity)인 것이 특징이며, 바람직하게는 케냐 유래 ASFV에 특이적인 면역원성을 지니는 것이 특징이다. 한편, 본 발명의 폴리펩타이드는 아프리카에서 발생하고 있는 ASFV type 6 뿐만 아니라 러시아, 조지아 등에서 발생하고 있으며 최근에 중구 및 아시아에서 발생하고 있는 ASFV type 2에 의한 ASFV의 검체 들과 반응하는 광범위한 보편적 면역원성도 지니는 것이 특징이다.
본원에서 기재되는 폴리펩타이드는 해당 분야의 숙련자에게 공지된 임의의 적합한 절차, 즉 유전공학적 방법, 예컨대 재조합 기법에 의해 제조(제작)될 수 있다. 예를 들면, 통상적인 방법에 따라 상기 폴리펩타이드 또는 이의 기능적 동등물을 암호화하는 핵산을 제작한다. 상기 핵산은 적절한 프라이머를 사용하여 PCR 증폭함으로써 제작할 수 있다. 다른 방법으로 당업계에 공지된 표준 방법, 예컨대, 자동 DNA 합성기(Biosearch 또는 Applied Biosystems 사에서 판매하는 것)을 사용하여 DNA 서열을 합성할 수도 있다. 제작된 핵산은 이에 작동 가능하게 연결되어 (operatively linked) 핵산의 발현을 조절하는 하나 이상의 발현 조절 서열(expression control sequence)(예: 프로모터, 인핸서 등)을 포함하는 벡터에 삽입시키고, 이로부터 형성된 재조합 발현 벡터로 숙주세포를 형질전환 시킨다. 생성된 형질전환체를 상기 핵산이 발현되기에 적절한 배지 및 조건 하에서 배양하여, 배양물로부터 상기 핵산에 의해 발현된, 실질적으로 순수한 폴리펩타이드를 회수한다. 상기 회수는 당업계에 공지된 방법(예컨대, 크로마토그래피)을 이용하여 수행할 수 있다. 상기에서 '실질적으로 순수한 폴리펩타이드(substantially pure polypeptide)'라 함은 본 발명에 따른 폴리펩타이드가 숙주세포로부터 유래된 어떠한 다른 단백질도 실질적으로 포함하지 않는 것을 의미한다.
본 발명의 폴리펩타이드 합성을 위한 유전공학적 방법은 당업계에 알려져 있으며, 또한 본 발명의 폴리펩타이드는 재조합 제조 방법뿐만 아니라 당업계에 공지된 화학적 합성 방법에 의해 제조될 수 있다. 대표적인 방법으로서 이들로 한정되는 것은 아니지만 액체 또는 고체상 합성, 단편 응축, F-MOC 또는 T-BOC 화학법이 포함된다.
하나의 실시 양태에서, 일례로 본 발명의 폴리펩타이드는 고체상 기법을 이용한 직접적 펩타이드 합성에 의해 제조될 수 있음이 당업계에 공지되어 있다. 고체상 펩타이드 합성(SPPS) 방법은 작은 다공성의 비드(beads)에 링커(linkers)라 불리는 기능성 유닛(functional units)을 부착하여 펩타이드 사슬을 이어 나갈 수 있도록 유도함으로써 합성을 개시할 수 있다. 액체상 방법과 달리 펩타이드는 비드와 공유 결합하여 TFA (trifluoroacetic acid)와 같은 특정 반응물에 의해 절단되기 전까지 여과(filtration) 과정에 의해 떨어져 나가는 것을 방지한다. 고체상에 부착된 펩타이드의 N-말단 아민과 N-보호 아미노산 유닛(N-protected amino acid unit)이 결합하는 보호(protection) 과정, 탈보호(deprotection) 과정, 다시 드러난 아민 그룹(amine group)과 새로운 아미노산이 결합하는 커플링(coupling) 과정의 사이클(cycle, deprotection-wash-coupling-wash)이 반복되면서 합성이 이루어지게 된다. 상기 SPPS 방법은 마이크로파(microwave) 기술을 함께 이용하여 수행할 수 있으며, 마이크로파 기술은 펩타이드 합성 과정에서 열을 가해줌으로써 각 사이클의 커플링과 탈보호에 필요 시간을 단축시킬 수 있다. 상기 열 에너지는 확장되는 펩타이드 사슬이 접히거나(folding) 집합체를 형성하는 것(aggregation)을 방지하고 화학적 결합을 촉진시킬 수 있다.
또한 당업계에 공지된 액체상 펩타이드 합성법에 의해 본 발명의 펩타이드를 제작할 수 있으며, 또한 본 발명의 펩타이드는 상기 고체상 합성법과 액체상 합성법을 혼합하는 방법 등의 다양한 방법으로 합성 가능하며, 본 명세서에 기술된 수단에 그 제조 방법이 제한되지 않는다.
단백질 합성은 수동 기법을 이용해서 또는 자동화에 의해 수행될 수 있다. 자동화된 합성은, 예를 들어 Applied Biosystems 431A 펩티드 합성기(Perkin Elmer)를 이용해서 달성될 수 있다. 대안적으로, 다양한 단편이 별도로 화학적으로 합성되고 화학적 방법을 이용하여 조합되어 목적 분자를 제조할 수 있다.
한편, 본 발명 폴리펩타이드의 범위에는 전술한 본 발명 폴리펩타이드의 기능적 동등물 및 그들의 염을 포함한다. 일례로 상기 '기능적 동등물'이란 전술한 본 발명의 폴리펩타이드와 적어도 80％ 이상의, 바람직하게는 90％, 더욱 바람직하게는 95％ 이상의 아미노산기 서열 상동성(즉, 동일성)을 갖는 것으로 예를 들면, 80％, 81％, 82％, 83％, 84％, 85％, 86％, 87％, 88％, 89％, 90％, 91％, 92％, 93％, 94％, 95％, 96％, 97％, 98％, 99％, 100％의 서열 상동성을 갖는 것을 포함하며, 본 발명의 폴리펩타이드와 실질적으로 동질의 생리활성을 나타내는 펩타이드를 말한다. 상기에서 '실질적으로 동질의 생리활성'이란, 이에 제한되지 않으나, 일례로 동물의 체내에서 ASFV에 대한 방어 면역반응을 유도하는 것일 수 있으며, 또 다른 일례로 ASFV 감염 동물의 혈청을 검출/진단하는 능력 등을 의미하는 것일 수 있다.
하나의 실시 양태에서, 본 발명에서 기능적 동등물은 전술한 본 발명 폴리펩타이드의 아미노산 서열 중 일부가 부가, 삽입, 치환(비보존적 또는 보존적 치환), 결실 또는 이들의 조합에 의해 생성된 것일 수 있다. 상기에서 아미노산의 치환은 바람직하게는 보존적 치환일 수 있다. 천연에 존재하는 아미노산의 보존적 치환의 예는 다음과 같다; 지방족 아미노산(Gly, Ala, Pro), 소수성 아미노산(Ile, Leu, Val), 방향족 아미노산(Phe, Tyr, Trp), 산성 아미노산(Asp, Glu), 염기성 아미노산(His, Lys, Arg, Gln, Asn) 및 황함유 아미노산(Cys, Met). 분자의 활성을 전체적으로 변경시키지 않는 아미노산 교환은 당해 분야에 공지되어 있다. 또한 상기 기능적 동등물에는, 본 발명 폴리펩타이드의 아미노산 서열상에서 아미노산의 일부가 결실된 변형체도 포함된다. 상기 아미노산의 결실 또는 치환은 바람직하게는 본 발명에서 제공하는 폴리펩타이드의 생리활성(케모카인 활성)에 직접적으로 관련되지 않은 영역에 위치해 있다. 아울러 상기 본 발명 폴리펩타이드의 아미노산 서열의 양 말단 또는 서열 내에 몇몇의 아미노산이 부가된 변형체도 포함된다. 상기에서 부가된 아미노산이란 예를 들면 단백질 분리/정제를 위한 히스티딘 태그(Histidine-tag)로서 '-GSHHHHHH' 서열(서열번호 23)일 수 있으며, 이를 포함하는 단편으로 바람직하게는 서열번호 3의 아미노산 서열을 가지는 폴리펩타이드일 수 있다.
또한 상기 기능적 동등물의 범위에는 폴리펩타이드의 기본 골격 및 이의 생리 활성을 유지하면서 폴리펩타이드의 일부 화학 구조가 변형된 폴리펩타이드 유도체도 포함된다. 예를 들어, 본 발명의 폴리펩타이드의 안정성, 저장성, 휘발성 또는 용해도 등을 변경시키기 위한 구조변경 및 생리활성을 유지하면서 다른 단백질과 융합으로 만들어진 융합단백질 등이 이에 포함된다.
하나의 실시 양태에서, 본 발명의 폴리펩타이드는 경우에 따라 인산화(phosphorylation), 황화(sulfation), 아크릴화(acrylation), 당화(glycosylation), 메틸화(methylation), 파네실화(farnesylation) 등으로 수식(modification)될 수도 있다.
또한 본 발명은, 상기 본 발명의 폴리펩타이드를 암호화(코딩)하는 폴리뉴클레오타이드를 제공한다.
상기 폴리뉴클레오타이드는 본 발명의 폴리펩타이드를 암호화할 수 있는 한 폴리뉴클레오타이드의 염기 조합이 특별히 제한되지 않는다. 상기 폴리뉴클레오티드는 DNA, cDNA 및 RNA 서열을 모두 포함하여 단쇄 또는 이중쇄의 형태의 핵산 분자로서 제공될 수 있다.
하나의 실시 양태에서, 일례로 상기 폴리뉴클레오타이드는 서열번호 2 또는 12로 표시되는 염기서열을 포함하는 것일 수 있다.
또 다른 실시 양태에서, 상기 폴리뉴클레오타이드는 서열번호 2 또는 12로 표시되는 염기서열로 이루어지는 것일 수 있다.
본 발명의 폴리펩타이드를 코딩하는 핵산 서열을 이를 발현할 수 있는 벡터에 작동적으로 연결시켜 상기 본 발명의 폴리펩타이드를 제공할 수 있다. 따라서, 본 발명은 상기 폴리뉴클레오타이드를 포함하는 발현 벡터 또는 재조합 벡터를 제공한다.
본 발명에서 용어 '발현 벡터' 또는 '재조합 벡터'란 적당한 숙주세포에서 목적 단백질 또는 목적 RNA을 발현할 수 있는 벡터로서, 유전자 삽입물이 발현되도록 작동 가능하게 연결된 필수적인 조절 요소를 포함하는 유전자 제작물을 말한다.
상기 용어 '작동 가능하게 연결된(operably linked)'는 일반적 기능을 수행하도록 핵산 발현 조절 서열과 목적하는 단백질 또는 RNA를 코딩하는 핵산 서열이 기능적으로 연결(functional linkage)되어 있는 것을 말한다. 예를 들어 프로모터와 단백질 또는 RNA를 코딩하는 핵산 서열이 작동 가능하게 연결되어 코딩하는 핵산 서열의 발현에 영향을 미칠 수 있다. 재조합 벡터와의 작동적 연결은 당해 기술 분야에서 잘 알려진 유전자 재조합 기술을 이용하여 제조할 수 있으며, 부위-특이적 DNA 절단 및 연결은 당해 기술 분야에서 일반적으로 알려진 효소 등을 사용한다.
하나의 실시 양태에서, 상기 벡터는 플라스미드 벡터, 코즈미드 벡터, 박테리오파아지 벡터 및 바이러스 벡터 등을 포함하나 이에 제한되지 않는다. 적합한 발현 벡터는 프로모터, 오퍼레이터, 개시코돈, 종결코돈, 폴리아데닐화 시그널 및 인핸서 등과 같은 발현 조절 엘리먼트 외에도 막 표적화 또는 분비를 위한 시그널 서열 또는 리더 서열을 포함하며 목적에 따라 다양하게 제조될 수 있다. 벡터의 프로모터는 구성적 또는 유도성일 수 있다. 또한 발현 벡터는 벡터를 함유하는 숙주 세포를 선택하기 위한 선택 마커를 포함하고, 복제 가능한 발현 벡터인 경우 복제 기원을 포함할 수 있다.
시그널 서열에는 숙주가 에스케리치아 속(Escherichia sp.) 균인 경우에는 PhoA 시그널 서열, OmpA 시그널 서열 등이, 숙주가 바실러스속 균인 경우에는 α-아밀라아제 시그널 서열, 서브틸리신 시그널 서열 등이, 숙주가 효모인 경우에는 MFα 시그널 서열, SUC2 시그널 서열 등이, 숙주가 동물세포인 경우에는 인슐린 시그널서열, α-인터페론 시그널 서열, 항체 분자 시그널 서열 등을 이용할 수 있으나, 이에 제한되지 않는다.
또한 본 발명은 상기 발현 벡터를 포함하는 숙주 세포를 제공한다. 즉, 본 발명은 상기 발현 벡터(재조합 벡터)로 형질전환된 형질전환체(숙주 세포)를 제공한다.
상기 형질전환은 핵산을 유기체, 세포, 조직 또는 기관에 도입할 수 있는 것으로 공지된 것이라면 어떤 방법이라도 사용 가능하며, 당 분야에서 공지된 바와 같이 숙주 세포에 따라 적합한 표준 기술을 선택하여 수행할 수 있다. 이런 방법에는 미세사출법(microprojectile bombardment), 전기충격유전자전달법(electroporation), 원형질 융합, 인산 칼슘(CaPO4) 침전, 염화 칼슘(CaCl2) 침전, 실리콘 카바이드 섬유 이용한 교반, 아그로 박테리아 매개된 형질전환, PEG-매개 융합법(PEG-mediated fusion), 미세주입법(microinjection), 리포좀 매개법(liposome-mediated method), 덱스트란 설페이트, 리포펙타민, 열충격법 등이 포함되나, 이로 제한되지 않는다.
상기 용어 '형질전환체'는 '숙주 세포' 등과 호환성 있게 사용될 수 있으며, 임의의 수단(예: 전기충격법, 칼슘 포스파타제 침전법, 미세주입법, 형질전환법, 바이러스 감염 등)에 의해 세포 내로 도입된 이종성 DNA를 포함하는 원핵 또는 진핵 세포를 의미한다.
본 발명에서 상기 형질전환체는 클로닝 분야에서 통상적으로 사용되는 모든 종류의 단세포 유기체, 예컨대 각종 박테리아 (예컨대, Clostridia 속, 대장균, 등) 등의 원핵세포 미생물, 효모 등의 하등 진핵세포 미생물과 곤충 세포, 식물 세포, 포유동물 등을 포함하는 고등 진핵생물 유래의 세포를 숙주세포로 사용할 수 있으며, 이에 제한되지 않는다. 숙주세포에 따라서 단백질의 발현량과 수식 등이 다르게 나타나므로 당업자가 목적하는 바에 가장 적합한 숙주세포를 선택하여 사용할 수 있다. 본 발명의 상기 형질전환체는 바람직하게 형질전환 미생물을 의미하는 것일 수 있다. 구체적으로, 이에 제한되지 않으나, 예를 들어 숙주세포로는 에스케리치아 콜라이(대장균, Escherichia coli), 바실러스 서브틸리스(Bacillus subtilis), 스트렙토마이세스(Streptomyces), 슈도모나스(Pseudomonas), 프로테우스 미라빌리스(Proteus mirabilis) 또는 스타필로코쿠스(Staphylococcus)와 같은 원핵 숙주 세포일 수 있다. 또한, 진균(예를 들어, 아스페르길러스(Aspergillus)), 효모(예를 들어, 피치아 파스토리스(Pichia pastoris), 사카로마이세스 세르비지애(Saccharomyces cerevisiae), 쉬조사카로미세스(Schizosaccharomyces), 뉴로스포라크라사(Neurospora crassa))등과 같은 하등 진핵 세포, 곤충 세포, 식물 세포, 포유동물 등을 포함하는 고등 진핵생물 유래의 세포를 숙주세포로 사용할 수 있으며, 이에 제한되지 않는다.
본 발명의 형질전환체(또는 형질전환 미생물, 숙주 세포)은 바람직하게 에스케리치아 콜라이(대장균, Escherichia coli)일 수 있다. 상기 본 발명의 에스케리치아 콜라이 균주로는 이에 제한되지 않으나, 예를 들어 Rosetta2(DE3), C41(DE3), SoluBL21 등이 사용될 수 있다.
또한 본 발명은 전술한 폴리펩타이드를 유효성분으로 포함하는 아프리카돼지열병 바이러스에 대한 백신 조성물을 제공한다.
또한 본 발명은 전술한 폴리펩타이드로 이루어진 아프리카돼지열병 바이러스에 대한 백신 조성물을 제공한다.
또한 본 발명은 전술한 폴리펩타이드로 필수적으로 이루어진 아프리카돼지열병 바이러스에 대한 백신 조성물을 제공한다.
본 발명에서 용어 '백신' 또는 '백신 조성물'은 면역응답(immuno response)을 자극하는 조성물을 의미하는 것으로, 면역원성 조성물과 동일한 의미로서 본 명세서에서 혼용되어 사용된다. 상기 백신은 예방 백신과 치료 백신을 모두 포함한다. 예방 백신은 개체가 항원에 노출될 때 더 큰 면역 반응을 내재하게 하기 위해, 항원을 포함하는 물질에 노출되기 전에 면역 반응을 유도하고, 따라서 항원을 운반하는 물질 또는 세포에 저항하는 능력을 증가시키는 것을 의미한다. 치료 백신은 백신의 항원과 관련된 질환을 이미 가지고 있는 개체에 투여하는 방식으로 사용되는 것으로 상기 치료 백신은 항원을 운반하는 질환 또는 세포와 싸우기 위한 증가된 능력을 제공하여 항원에 대한 개체의 면역 반응을 증가시킬 수 있다.
하나의 실시 양태에서, 본 발명은 상기 폴리펩타이드를 유효성분으로 포함하는 아프리카돼지열병 바이러스 감염 예방용 백신 조성물을 제공하는 것일 수 있다.
본 발명의 상기 백신 조성물은 인간을 비롯한 포유동물에 어떠한 방법으로도 투여되어 면역반응을 유도할 수 있다. 예를 들면, 경구 또는 비경구적으로 투여할 수 있다. 비경구적인 투여 방법으로는 이에 한정되지는 않으나, 경피, 근육내, 복막내, 정맥내, 피하내 경로로 백신을 접종하는 것일 수 있다. 바람직하게는, 1차 및 2차 접종시 백신을 근육내 접종하는 것일 수 있다.
상기 백신은 당업계에 알려진 임의의 형태, 예를 들면, 액제 및 주사제의 형태 또는 현탁액에 적합한 고체 형태일 수 있으나, 이에 한정되는 것은 아니다. 이러한 제제는 또한 리포좀이나 가용 유리 내로 유화 또는 캡슐화되거나 에어로졸이나 스프레이 형태로도 제조될 수 있다. 이들은 경피(transdermal) 패치에 함유시킬 수도 있다. 액제 또는 주사제의 경우, 필요시 프로필렌 글리콜 및 용혈 현상을 방지하는데 충분한 양(예: 약 1%)의 염화나트륨을 함유할 수 있다.
본 발명의 백신 조성물은 전술한 본 발명의 폴리펩타이드를 포함하는 것을 특징으로 하며, 약학적으로 허용되는 담체, 희석제 및 보조제로 이루어지는 군에서 선택되는 하나 이상의 것을 추가로 포함할 수 있다. 상기에서 "약학적으로 허용되는" 이란 생리학적으로 허용되고 인간에게 투여될 때, 활성 성분의 작용을 저해하지 않으며 통상적으로 위장 장애, 현기증과 같은 알레르기 반응 또는 이와 유사한 반응을 일으키지 않는 비독성의 조성물을 말한다.
상기 담체(carrier)라 함은 세포 또는 조직 내로 목적물의 전달을 용이하게 하는 물질을 의미한다. 약학적으로 허용되는 담체로는 예컨대, 경구 투여용 담체 또는 비경구 투여용 담체를 추가로 포함할 수 있다. 일례로 비경구 투여용 담체는 물, 적합한 오일, 식염수, 수성 글루코오스 및 글리콜 등을 포함할 수 있다. 또한, 담체는 티탄 또는 중합체로 제조된 코팅 패치와 같은 건식 제제(dry formulation)를 포함할 수 있다. 백신에 적합한 담체는 기술분야의 당업자에게 공지되어 있으며, 단백질, 당 등을 포함하지만, 이에 한정되는 것은 아니다. 상기의 담체는 수용액, 또는 비-수용액, 현탁액 또는 에멀젼일 수 있다.
또한 본 발명의 조성물에는 면역원성을 증가시키기 위한 면역보조제로서 정형 또는 비정형 유기 또는 무기 고분자등이 사용될 수 있다. 면역보조제는 일반적으로 항원에 대한 화학적 물리적 결합을 통해 면역반응을 촉진시키는 역할을 하는 것으로 알려져 있다. 이 연구에서 사용된 면역보조제로서는 비정형 알루미늄 겔, 오일 에멀젼, 또는 이중 오일 에멀젼 그리고 이뮤노졸 등이 사용되었다. 또한 면역반응의 촉진을 위해 다양한 식물 유래 사포닌, 레바미솔, CpG 다이뉴클레오티드, RNA, DNA, LPS, 다양한 종류의 싸이토카인 등이 사용되었다. 위와 같은 면역 조성물은 다양한 보조제와 면역반응 촉진 첨가물의 조합에 의해 최적의 면역반응 유도를 위한 조성으로 사용될 수 있다.
이에 제한되지 않으나, 미네랄 염 보조제(예를 들면, 알럼-, 칼슘-, 철-, 지르코늄-기반 염 보조제), 계면활성(tensioactive) 보조제(예를 들면, Quil A, QS-21, 기타 사포닌), 세균-유래 보조제(예를 들면, N-아세틸 뮤라밀-L-알라닐-D-이소글루타민(MDP), 지질 다당류(LPS), 모노포스포릴 지질 A, 트레할로스 다이마이콜레이트(TDM), DNA, CpGs, 세균 독소), 보조제 에멀젼(예를 들면, FIA, Montanide, Adjuvant 65, Lipovant), 리포솜 보조제, 폴리머 보조제 및 담체, 사이토킨(예를 들면, 과립구-대식세포 콜로니 자극 인자), 탄수화물 보조제, 살아있는 항원 전달 시스템(예를 들면, 박테리아, 바이러스)등을 포함할 수 있다.
또한 백신에 추가될 있는 조성물로는 안정제, 불활화제, 항생제, 보존제, 등이 사용될 수 있다. 백신의 투여 경로에 따라 백신 항원은 증류수, 완충용액 등과도 혼합하여 사용될 수 있다.
그 밖의 약학적으로 허용되는 담체 및 제제는 당업계에 공지된 것을 참고로 할 수 있다. 본원에 기재된 백신의 제형 및 투여 기술은 당업계에 공지된 문헌을 참조로 하여 제공될 수 있다.
또한 본 발명의 면역원성 복합 단백질을 포함하는 백신 조성물은 이를 필요로 하는 개체에 유효량으로 투여하여 면역화하는데 사용할 수 있다. 즉, 본 발명은 동물에서 아프리카돼지열병에 대한 방어 면역 반응을 유도하는 방법으로서, 전술한 본 발명의 폴리펩타이드의 면역 유효량을 돼지에게 투여하는 단계를 포함하는 것인 방어 면역 반응의 유도법을 제공한다.
상기 '개체(subject)'는 동물, 바람직하게는 인간을 제외한 포유동물을 의미할 수 있다. 하나의 실시 양태에서, 상기 개체는 바람직하게 돼지(pig)일 수 있다.
따라서 하나의 실시양태에서, 본 발명은 상기 폴리펩타이드를 동물(특히, 돼지)에 투여하는 것을 특징으로 하는, 동물(특히, 돼지)의 ASFV에 대한 면역력을 증진시키는 방법(즉, ASFV에 대해 동물을 면역화시키는 방법)을 제공한다.
본 명세서에서 용어 '면역화(immunization)'는 본 발명에 따른 면역원성 복합 단백질을 개체에 투여했을 때, 개체 내에서 상기 면역원성 복합 단백질에 대한 분비성, 체액성 및/또는 세포성 면역 반응이 유발되는 것으로, 이 같은 면역화를 통해 대상 질환(본 발명에서는 특히 ASFV 감염)에 대한 예방 또는 치료 효과가 나타나게 된다.
상기 '유효량'은 본 발명의 상기 백신 조성물의 대상 질환(특히, ASFV 감염)에 대한 예방이나 치료 효과를 나타내는 양으로, 투여된 개체에서 본 발명의 폴리펩타이드가 분비성, 체액성 및/또는 세포성 면역 반응을 유도하기에 충분한 양을 의미한다.
본 발명의 폴리펩타이드의 총 유효량은 단일 투여량(single does)으로 개체에게 투여될 수 있으며, 다중 투여량(multiple dose)이 장기간 투여되는 분할 치료 방법(fractionated treatment protocol)에 의해 투여될 수 있다. 또한 투여 목적에 따라 유효성분의 함량을 달리할 수도 있다. 상기 유효 용량은 대상 질환의 유형 및 중증도, 투여 경로 및 투여 횟수뿐만 아니라 투여가 필요한 개체의 연령, 체중, 건강 상태, 성별, 질환의 중증도, 식이 및 배설율 등 다양한 요인들을 고려하여 각 개체에 대한 유효 투여량이 결정되는 것이므로, 해당 분야의 통상적인 지식을 가진 자라면 투여 목적에 따라 적절한 유효 투여량을 결정할 수 있을 것이다. 또한 본 발명에 따른 단백질을 투여한 후 면역 세포의 활성을 결정해주는 검정 방법(assay) 또는 널리 알려진 생체내 검정을 사용하여 요법의 효능을 모니터링 함으로써 결정할 수도 있다. 본 발명의 약학적 조성물은 본 발명의 효과를 보이는 한 그 제형, 투여 경로 및 투여 방법에 특별히 제한되지 아니한다.
전술한 본 발명의 폴리펩타이드는, 천연형 단백질 및 상기 단백질 유래 다른 길이/서열 구성의 폴리펩타이드들과 비교하여도, 특이적으로 ASFV 감염 혈청을 검출(진단)하는 효과가 현저하다. 본 발명에서 ASFV 감염 혈청을 검출(진단)한다는 것은, 개체의 혈액, 혈장 또는 혈청 내에 존재하는 항-ASFV 항체(아프리카돼지열병 바이러스에 대한 항체)와 상기 본 발명의 폴리펩타이드가 결합하여(항원-항체 복합체 형성) 상기 항체의 존재 유무 또는/및 존재량을 확인하는 것을 의미한다. 개체의 혈액, 혈장 또는 혈청 내에 항-ASFV 항체의 존재가 검출 또는/및 확인되는 경우, 해당 개체는 ASFV에 감염된 상태인 것으로 판정할 수 있다.
따라서 본 발명은, 전술한 폴리펩타이드를 유효성분으로 포함하는 아프리카돼지열병 바이러스 감염 진단용 조성물을 제공한다.
또한 본 발명은, 전술한 폴리펩타이드로 이루어진 아프리카돼지열병 바이러스 감염 진단용 조성물을 제공한다.
또한 본 발명은, 전술한 폴리펩타이드로 필수적으로 이루어진 아프리카돼지열병 바이러스 감염 진단용 조성물을 제공한다.
또한, 본 발명은, 전술한 폴리펩타이드를 유효성분으로 포함하는 아프리카돼지열병 바이러스에 대한 항체의 존재 여부를 판단하기 위한 진단 시약 조성물 및 상기 진단 시약 조성물을 포함하는 진단 키트를 제공한다.
또한 본 발명은
(a) 동물의 시료를 전술한 본 발명의 폴리펩타이드와 접촉시키는 단계; 및
(b) 상기 시료 중 상기 본 발명의 폴리펩타이드와 결합된 항체의 존재를 검출하는 단계를 포함하는 아프리카돼지열병 바이러스 감염 혈청 검출(진단) 방법을 제공한다.
특히, 본 발명의 폴리펩타이드들은 여러 종류의 ASFV에 대한 특이성이 현저하여, 케냐 유래 ASFV 뿐만 아니라, 최근 발생하고 있는 ASFV에 대해서 특이적으로 검출할 수 있다. 따라서 하나의 실시 양태에서, 바람직하게 본 발명은 전술한 본 발명의 폴리펩타이드를 유효성분으로 포함하는 아프리카돼지열병 바이러스에 대한 항체의 존재 여부를 판단하기 위한 진단 시약 조성물 및 이를 포함하는 진단 키트를 제공하는 것일 수 있으며, 또한 상기 (a) 및 (b) 단계를 포함하는 ASFV 감염혈청 검출(진단) 방법을 제공하는 것일 수 있다.
본 명세서에서 용어 '시료'는 고형 시료 또는 체액성 시료일 수 있으며, 바람직하게는 혈청, 혈장, 근육 조직, 전혈, 림프액, 비장 또는 이들의 균질화물(homogenate)일 수 있다.
본원에 따른 검출 또는 진단에 있어서, 당업계에 항원-항체 복합체를 검출하는 수단으로서 알려진 것이라면 그 방법 및 기구가 특별히 제한되지 않고 적용될 수 있다. 이에 제한되지 않으나, 예를 들면 항원-항체 복합체는 방사상 면역확산(Radial Immunodiffusion), 면역전기영동 또는 역전류 전기영동을 포함하는 면역침전분석, RIA (Radioimmunoassay), 경쟁적 간접면역형광법(competition indirect immunofluorescent assay), ELISA (Enzyme Linked Immunosorbent Assay) 또는 면역크로마틱 분석(immunochromatic assay) 등의 방법으로 검출될 수 있다. 이런 방식의 검출은 특히 항원이 가용성 단백질로 제공되는 경우에 유리하며, 본원 발명의 폴리펩타이드는 이러한 특성을 만족한다. 본원에 따른 일구현예에서는 ELISA 방법, 특히 샌드위치 방식의 ELISA가 사용되며, 이 경우 후술하는 검출항체가 또한 함께 사용된다. 본 발명은 상기 방법을 이용하는 진단 키트를 제공하는 것으로 이해될 수 있으며, 각 방법에 따른 키트 구성품이 당업계에 잘 알려져 있다.
본원에 따른 일 구현 예에서, 항원(본 발명의 폴리펩타이드)-항체 복합체의 검출을 위해, 항원(본 발명의 폴리펩타이드)이 표지물질로 표지될 수 있다. 즉, 본 발명의 폴리펩타이드는 검출 가능한 표지에 링크(예: 공유 결합 또는 가교)되어 제공될 수 있다. 상기 검출 가능한 표지는 발색 효소(예: 퍼옥시다제(peroxidase), 알칼라인 포스파타제(alkaline phosphatase)), 방사성 동위원소(예: 124I, 125I, 111In, 99mTc, 32P, 35S), 크로모포어(chromophore), 바이오틴(biotin), 발광물질 또는 형광물질(예: FITC, RITC, 로다민(rhodamine), 텍사스레드(Texas Red), 플로레신(fluorescein), 피코에리트린(phycoerythrin), 퀀텀닷(quantum dots)), 자기공명영상조영제(예: 수퍼파라마그네틱 산화철(superparamagnetic iron oxides, SPIO), 울트라수퍼파라마그네틱 산화철(ultrasuperparamagnetic iron oxides, USPIO)), 금 입자(Gold particle) 등일 수 있다. 유사하게, 상기 검출 가능한 표지는 ASFV와 관련 없는 다른 항체 에피토프(epitope), 기질(substrate), 보조인자(cofactor), 저해제 또는 친화 리간드일 수 있다. 이러한 표지는 본 발명의 폴리펩타이드를 합성하는 과정 중에 수행할 수도 있고, 이미 합성된 폴리펩타이드에 추가로 수행될 수도 있다.
본원에 따른 일 구현 예에서, 상기 항원(본 발명의 폴리펩타이드)에 결합한 항체(1차 항체, 예를 들어 동물 혈청 내에 생성된 항체)를 검출하는 검출 항체(2차 항체)가 표지될 수도 있다. 본원에 따른 방법에 사용될 수 있는 검출 항체(2차 항체)는, 진단 대상 동물에서 생성된 이뮤노글로불린(일례로, IgM, IgG)에 특이적으로 결합하며, 상기 검출 항체는 시각적 또는 다양한 이미지 검출 장비를 이용하여 검출할 수 있는 물질로 표지될 수 있다. 이는 본 발명의 폴리펩타이드 표지물질에 대해 전술한 바를 참조로 하여 이해될 수 있다.
하나의 구체적 실시 양태에서 본원에 따른 항원(본 발명의 폴리펩타이드) 또는 검출 항체(2차 항체)는 표지물질로서 호스라디쉬 퍼옥시다아제(horseradish peroxidase)와 같은 퍼옥시다제, 알칼라인 포스파타아제(alkaline phosphatase), 글루코오스 옥시다아제(glucose oxidase), 베타-갈락토시다아제(beta-galactosidase), 유레아제(urease), 카탈라아제(catalase), 아스파르기나아제(asparginase), 리보뉴클레아제(ribonuclease), 말레이트 데하이드로지나아제(malate dehydrogenase), 스타필로코칼 뉴클레아제(staphylococcal nuclease), 트리오스 포스페이트 이소머라아제(triose phospate isomerase), 글루코오스-6-포스페이트 데하이드로지나아제(glucose-6-phosphate dehydrogenase), 글루코아밀라아제(glucoamylase), 그리고 아세틸콜린 에스터라아제(acetylcholine esterase)와 같이 특정 기질(substrate)의 존재 하에서 화학반응을 촉매하여 검출 가능한 발색 반응 또는 광을 방출할 수 있는 효소로 표지될 수 있으나 이로 제한되는 것은 아니다.
다른 구체적 실시 양태에서, 본원에 따른 항원(본 발명의 폴리펩타이드) 또는 검출 항체는 광의 조사에 의해 조사된 광과 상이한 파장의 광을 방출하는 바이로루미네슨스, 케미루미네슨스, 일렉트로루미네슨스, 일렉트로케미루미네슨스 및 포토루미네슨스에 사용되는 발색단으로 예를 들면 단백질로서 그린형광단백질; 유기화합물로서 플루오르세인 이소티오시아네이트(fluorescein isothiocyanate), 로다민(rhodamine), 파이코에리쓰린(phycoerythrin), 파이코시아닌(phycocyanin), 알로파이코시아닌(allophycocyanin), 그리고 플루오르카민(fluorecamine)을 포함하나 이로 제한되는 것은 아니다.
또 다른 구체적 실시 양태에서, 본원에 따른 항원(본 발명 폴리펩타이드) 또는 검출 항체는 다양한 방사선 동위원소 물질로 표지될 수 있다. 본원에서 표지물질의 검출은 예를 들어 방사선 동위원소인 경우 신틸레이션 카운터(scintillation counter)에 의해 수행할 수 있으며, 예를 들어 표지물질이 형광물질인 경우, 스펙트로스코피, 포스포이미징 장치 또는 형광계측기 등과 같은 방법에 의해 수행할 수 있다. 효소로 표지된 경우, 적절한 기질의 존재하에서 효소에 의한 발색성 기질의 변환에 의해 나타나는 발색 산물을 계측함으로써 수행할 수 있다. 또한, 적당한 표준 혹은 대조군과의 비교를 통해 효소반응에 의해 나타나는 발색 산물의 색 비교로서 탐지할 수 있다.
구체적 실시 양태에서 본원에 따른 항원(본 발명의 폴리펩타이드) 또는 검출 항체를 표지하는 물질은 예를 들면 발색단; 알칼라인 포스파타제, 바이오틴, 베타-갈락토시다제 또는 퍼옥시다제를 포함하는 효소; 방사선물질; 또는 콜로이드성 금입자 또는 착색 라텍스입자 등과 같은 나노입자를 포함하는 물질을 포함하나, 이로 제한되는 것은 아니다.
본 발명의 키트에는 본 발명의 폴리펩타이드 이외에 상기 폴리펩타이드와 항-ASFV 항체의 결합 반응을 위한 적당한 완충용액 또는 배지 등을 추가로 포함할 수 있다. 또한 본 발명의 폴리펩타이드가 직접 표지되지 않은 채로 제공되는 경우에는, 폴리펩타이드의 표지를 위한 다른 검출 가능한 표지 수단이 추가로 키트에 포함될 수 있다. 일례로 본 발명의 형광물질로 표지된 2차 항체, 발색 기질 등이 상기 키트에 추가로 포함될 수도 있다.
또한 본 발명의 폴리펩타이드는 플레이트의 표면에 코팅된 형태로 제공될 수도 있다. 이 경우에는 상기 플레이트에 시료를 처리하여 적당한 조건에서 반응시킨 후, 플레이트의 표면상에서의 본 발명의 폴리펩타이드(항원)와 시료 내 항체의 결합을 관찰하여 ASFV 감염 여부를 진단할 수 있다. 이러한 본 발명의 폴리펩타이드는 96웰 마이크로웰플레이트와 같은 마이크로웰플레이트, 콜로이드성 금 입자 또는 착색 라텍스 입자를 포함하는 비드 또는 입자 또는 셀룰로스, 나이트로셀룰로스, 폴리에테르설폰, 폴리비닐리딘, 플루오라이드, 나일론, 하전나일론 및 폴리테트라플루오로에틸렌 등과 같은 멤브레인에 부착되어 제공될 수 있다. 상기 항원(본 발명의 폴리펩타이드)을 부착 또는 코팅하는 방법은 공지된 방법을 사용할 수 있으며, 예를 들면 본원 실시예에 기재된 것을 참고할 수 있다.
구체적 실시 양태에서 본 발명의 진단시약, 및 이를 포함하는 키트는 ELISA (Enzyme Linked Immuno Sorbent Assay), RIA (Radio Immuno Assay) 등과 같은 샌드위치 방식의 면역분석방식으로 사용될 수 있다. 이러한 방법은 고상의 기질 예를 들면 글라스, 플라스틱(예를 들면 폴리스티렌), 폴리사카라이드, 나일론 또는 나이트로셀룰로스로 제작된 비드, 멤브레인, 슬라이드 또는 마이크로웰플레이트에 결합된 항원에 검체를 추가한 후, 직접 또는 간접 검출이 가능한 표지물질 예를 들면 상술한 바와 같은 3H 또는 125I와 같은 방사성 물질, 형광물질, 화학발광물질, 햅텐, 바이오틴, 디그옥시제닌 등으로 표지되거나 또는 기질과의 작용을 통해 발색 또는 발광이 가능한 호스래디쉬 퍼옥시다제, 알칼라인 포스파타제, 말레이트 데하이드로게나아제와 같은 효소와 컨쥬게이션된 항체와의 결합을 통해 정성 또는 정량적으로 검출할 수 있다. 또한 면역분석 방법은 당업계에 공지되어 있다. ELISA 키트는 결합된 항체를 검출할 수 있는 시약, 예를 들면, 발색단(chromophores), 효소(예: 항체와 컨주게이트됨) 등과 같은 상술한 물질로 표지된 2차 검출 항체 및 검출에 사용되는 기질 등을 추가로 포함할 수 있다.
또한, 본 발명은, 아프리카돼지열병 바이러스에 대한 백신용 조성물을 제조하기 위한 전술한 폴리펩타이드의 용도를 제공한다.
또한, 본 발명은, 아프리카돼지열병 바이러스 감염 진단용 조성물을 제조하기 위한 전술한 폴리펩타이드의 용도를 제공한다.
또한, 본 발명은
(a) 피검체로부터 수득한 생물학적 시료에 상기 폴리펩타이드를 처리하는 단계;
(b) 상기 생물학적 시료에서 상기 폴리펩타이드와 결합된 항체의 존재를 검출하는 단계; 및
(c) 상기 폴리펩타이드와 결합한 항체의 양이 대조군보다 증가한 경우 상기 피검체를 아프리카돼지열병 바이러스에 감염된 것으로 진단하는 단계를 포함하는, 아프리카돼지열병 바이러스 감염 진단 방법을 제공한다.
하나의 실시 양태에서, 본 발명은 하기 단계를 포함하는 개체의 아프리카돼지열병 바이러스 감염을 진단 및 치료하는 방법을 제공한다:
(i) 피검체로부터 수득한 생물학적 시료에 상기 폴리펩타이드를 처리하는 단계;
(ii) 상기 생물학적 시료에서 상기 폴리펩타이드와 결합된 항체의 존재를 검출하는 단계;
(iii) 상기 폴리펩타이드와 결합한 항체의 양이 대조군보다 증가한 경우 상기 피검체를 아프리카돼지열병 바이러스에 감염된 것으로 진단하는 단계; 및
(iv) 상기 진단된 피검체에 아프리카돼지열병 바이러스 감염을 치료하기 위한 치료 약물을 투여하거나 수술을 통해 상기 질환을 치료하는 단계.
상기 (i) 내지 (iv) 단계를 포함하는 방법들은, 전술한 (a) 내지 (c) 단계를 포함하는 방법에 준하여 이해된다.
상기 (iv) 단계는 상기 (iii) 단계에서 질환이 진단된 개체에 인터페론, 항바이러스제 등과 같은 치료 약물 투여, 수술 등의 수단을 통해 상기 질환의 치료를 수행하는 단계이다.
본 발명의 상기 '치료'는 아프리카돼지열병 바이러스 감염 또는 상기 질환의 증상을 개선시키는 것을 포괄적으로 지칭하고, 이는 상기 질환을 치유하거나, 실질적으로 예방하거나, 또는 상태를 개선시키는 것을 포함할 수 있으며, 상기 질환으로부터 비롯된 한 가지 증상 또는 대부분의 증상을 완화시키거나, 치유하거나 예방하는 것을 포함하나, 이에 제한되는 것은 아니다.
본 발명의 상기 '시료'는 질환이 의심되는 개체로부터 분리 수득되는 것으로서, 이에 제한되지는 않으나, 세포, 조직, 혈액, 혈청, 혈장, 타액, 객담. 점막액 및 뇨로 이루어진 군에서 선택될 수 있으며, 상기 '개체' 또는 '피검체'란 동물, 바람직하게는 포유동물, 특히 인간을 포함하는 동물일 수 있으며, 동물에서 유래한 세포, 조직, 기관 등일 수도 있다. 상기 개체는 상기 치료 효과가 필요한 환자(patient) 일 수 있다.
본 명세서에서 용어 “을 포함하는(comprising)”이란 “함유하는(including)”또는 “특징으로 하는(characterized by)”과 동일한 의미로 사용되며, 본 발명에 따른 조성물 또는 방법에 있어서, 구체적으로 언급되지 않은 추가적인 구성 성분 또는 방법의 단계 등을 배제하지 않는다. 또한 용어 “로 이루어지는(consisting of)”이란 별도로 기재되지 않은 추가적인 요소, 단계 또는 성분 등을 제외하는 것을 의미한다. 용어 “필수적으로 이루어지는(essentially consisting of)”이란 조성물 또는 방법의 범위에 있어서, 기재된 물질 또는 단계와 더불어 이의 기본적인 특성에 실질적으로 영향을 미치지 않는 물질 또는 단계 등을 포함할 수 있는 것을 의미한다.
본 발명에서 제공하는 특유의 서열로 구성되는 폴리펩타이드는 바이러스 내 천연형 단백질과 비교하여 발현 및 정제 수율이 현저히 우수하고, 길이가 짧고, ASFV 내의 천연형 단백질과 비교하여도 ASFV 감염 혈청 검출/진단 능력이 현저히 우수할 뿐만 아니라, 백신으로서 사용 가능성이 있으며 또한 산업적 수준에서 생산성이 높다.
도 1은 재조합 대장균 세포주에서 본 발명의 폴리펩타이드인 Asfv-p62 단백질의 발현량을 확인한 결과를 나타낸 것이다.
도 2는 Asfv-p62 단백질의 정제한 결과를 나타낸 것이다.
도 3은 ELISA 기법을 통해 Asfv-p62 단백질의 진단 유용성을 평가한 결과를 나타낸 것이다.
도 4는 재조합 대장균 세포주에서 본 발명의 폴리펩타이드인 Asfv-F20572 단백질의 발현량을 p72-p205의 순서로 동일한 연결서열(-GAGGS-)과 융합한 단백질(Asfv-F72205)과 비교한 결과를 나타낸 것이다.
도 5는 Asfv-F20572 단백질의 정제한 결과를 나타낸 것이다.
도 6은 ELISA 기법을 통해 Asfv-F20572 단백질의 진단 유용성을 평가한 결과를 나타낸 것이다.
이하 본 발명을 상세히 설명한다.
단, 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명의 내용이 하기 실시예에 한정되는 것은 아니다.
실시예 1 : 케냐 유래 아프리카돼지열병 바이러스(ASFV) p62 단백질 유래 고효율의 면역원성 단편 폴리펩타이드의 발굴
1-1. Kenya-ASFV-p62 단백질 유래 단편 폴리펩타이드 제작
Pig/Kenya/KEN-50/1950 ASFV strain으로부터 수득된 서열번호 9로 표시되는 아미노산 서열로 구성되는 p62 단백질(본 명세서에서 ASFV-p62 W/T으로 표기) 서열을 기초로 하여 다양한 폴리펩타이드 단편을 제작하고 [표 1]에 도시하였다. 상업적으로 사용하기 위한 수준으로 재조합 단백질을 생산하는 데에는 어려움이 있는 실정을 극복하고자 하였다.
pep. fragment 명칭 서열정보 서열번호
Kenya Asfv-p62 W/T MPSNMKQFCKISVWLQQHDPDLLEIINNLCMLGNLSAAKYKHGVTFIYPKQAKIRDEIKKHAYSNDPSQAIKTLESLILPFYIPTPMEFTGEIGSYTGVKLEVEKKEANKVILKNGEAVLIPAADFKPFPDRRLAVWIMESGSMPLEGPPYKRKKEGGGNDPPVSKHISPYTPRTRIAIEVEKAFDECMRQNWCSVNNPYLAKSVSLLSFLSLNHPTEFIKVLPLIDFDPLVTFYLLLEPYKTHGDDFLIPETILFGPTGWNGTDLYQSAMLEFKKFFTQITRQTFMDIADTATKEVDVPICYSDPETVHSYANHVRTEILHHMVNKVTTPNLVVQAYNELEQTNTIRHYGPIFPESTINALRFWKKLWQDEQRFVIHGLHRTLMDQPTYETSEFAEIVRNLRFSRPGNNYINELNITSPAMYGDKHTTGDIAPNDRFAMLVAFINSTDFLYTAIPEEKVGGNDTQTGSQTSSLTDLVPTRLHSFLNHNLSKLKILNRAQQTVKNILSNDCLNQLKHYVKHTGKNEILKLLQE 서열번호9
Asfv-p62 MLGNLSAAKYKHGVTFIYPKQAKIRDEIKKHAYSNDPSQAIKTLESLILPFYIPTPAEFTGEIGSYTGVKLEVEKTEANKVILKNGEAVLVPAADFKPFPDRRLAVWIMESGSMPLEGP 서열번호1
Asfv-p62_145 MPQFCKISVWLQQHDPDLLEIINNLCMLGNLSAAKYKHGVTFIYPKQAKIRDEIKKHAYSNDPSQAIKTLESLILPFYIPTPAEFTGEIGSYTGVKLEVEKTEANKVILKNGEAVLVPAADFKPFPDRRLAVWIMESGSMPLEGP 서열번호5
상기 단백질 및 폴리펩타이드들은, 간략하게 다음과 같은 방법으로 생산되었다. Kenya Asfv-p62 W/T 폴리펩타이드를 코딩하는 DNA (서열번호 10)는 마크로젠에 의뢰하여 합성하였다. Asfv-p62 폴리펩타이드를 코딩하는 DNA (서열번호 4)는 마크로젠에 의뢰하여 합성하였다. Asfv-p62_145 폴리펩타이드를 코딩하는 DNA (서열번호 8)는 마크로젠에 의뢰하여 합성하였다. 각 단편 폴리펩타이드를 코딩하는 폴리뉴클레오타이드는 pET49b벡터(Novagen)의 Nde1, BamH1 restriction site 사이에 클로닝되었다. 각 폴리펩타이드들은 Escherichia coli 균주인 BL21 균주에서 과발현시켰다. 상기 벡터로 형질전환된 E. coli 세포들을 100 ug/ml kanamycin이 포함된 Luria-Bertani (LB) 배지를 이용하여 37℃에서 OD600이 0.7이 될 때까지 성장시켰고, 1 mM isopropyl β-D-1-thiogalactopyranoside (IPTG)에 의해 단백질 발현이 유도되었다. IPTG를 넣은 후, 추가로 3시간 동안 배양한 다음, 5,000 rpm에서 20분 간 원심 분리하여 세포를 회수하였다. 회수된 세포를 25 ml의 10 mM Imidazole을 포함한 1X Phosphate-buffered saline(PBS) 버퍼에 재현탁시킨 후, 초음파 처리로 세포를 깨주고 15,000 rpm 으로 20분 동안 원심분리를 실시한 후, 상층액을 Ni-NTA에 처리하여 1시간 30분 동안 결합시켰다 (4℃). 50 mM Imidazole을 포함한 1X PBS 버퍼를 이용해 washing해준 후, 250 mM Imidazole 및 500 mM Imidazoe을 포함한 1X PBS 버퍼를 이용해 용출시켰다. SDS-polyacrylamide gel electrophoresis를 이용해 폴리펩타이드를 확인하였으며, 폴리펩타이드들은 최종적으로 pH7.4 HEPES 20 mM 및 Sodium chloride 150 mM를 포함하는 버퍼에 수용되었다(4℃, overnight).
1-2. 천연형의 p62 단백질 대비 단편 폴리펩타이드의 생산성 평가
상기 여러 가지 단편 폴리펩타이드들의 생산성을 정량적으로 비교 평가하였다. 천연형 폴리펩타이드 (Kenya Asfv-p62 W/T)의 경우 대장균 세포주에서 발현하지 않았다. Kenya Asfv-p62 W/T와 비교하여 Asfv-p62와 Asfv-p62_145 폴리펩타이드는 대장균에서 성공적으로 발현이 되었다. 그러나 Asfv-p62_145는 안정성이 떨어져 정제가 되지 않았다. 하지만 Asfv-p62는 안정적으로 순도 높게 정제가 가능하였다. 본 발명의 Asfv-p62 (서열번호 1)의 단편 폴리펩타이드의 발현 및 정제의 최종 수율은 5 mg protein/1L (LB culture)로 가능하였으며, 정제까지(단백질을 수득하기까지) 소요되는 시간이 1.5일 ~ 2일이었다. Asfv-p62는 짧은 시간 효율적으로 생산할 수 있는 장점을 지닌 대장균 세포주에서 성공적으로 발현이 되었으며, 보존 안정성 및 정제과정 등에서 상업적으로 활용이 가능한 높은 수율을 나타내었을 뿐만 아니라, 정제기간이 2일 이내로 소요되었다. 천연형 Kenya Asfv-p62 W/T 단백질은 대장균에서 발현이 되지 않았고, Asfv-p62_145 단백질은 대장균에서 발현이 되었지만 보존성 부족으로 정제가 되지 않았다. 이처럼 본 발명의 Asfv-p62 (서열번호 1) 폴리펩타이드 단편은, 대장균 세포주에서 보존 안정성을 확보하여 높은 수율의 정제가 가능하며, 짧은 정제 과정의 장점을 나타낸다 (도 1 및 도 2 참조).
1-3. 천연형의 p62 단백질 대비 단편 폴리펩타이드의 ASFV 감염 혈청 진단 능력 비교 평가
ID.vet 사의 ID Screen African Swine Fever Indirect Screening test kit를 이용하여, 상기 실시예 1-1에서 제작한 여러 가지 단편 폴리펩타이드들의 ASFV 감염 혈청내 항체와의 결합능력을 ID(indirect)-ELISA 방법으로 비교 평가하였다. 간략히 다음과 같은 방법으로 수행되었다. 먼저 96 Well EIA/RIA plate에 Coating buffer (0.015 M Sodium carbonate, 0.035 M Sodium bicarbonate, Final pH 9.6)와 각각의 항원(실시예 1-1에서 제작한 여러 가지 단편 폴리펩타이드 각각, 2 ug/ml 또는 4 ug/ml 농도로 첨가)을 첨가하고 4℃에서 overnight (16h) 으로 인큐베이션하여, 각각의 항원으로 well을 코팅하였다. 200 ul의 PBST buffer (1XPBS + Tween20 0.05%)를 사용하여 각 well을 4번씩 세척하여 주었다. 각 well에 1차 항체를 100 ul씩 첨가 후, 실온(22℃)에서 1시간 인큐베이션하였다. 상기 1차 항체는 ID.vet 사의 African Swine Fever Indirect Screening test kit 내에서 positive control로서 제공되는 ASFV 감염 돼지 혈청 형태로 처리되었다. 그 후 PBST buffer 200 ul로 각 well을 세척한 후, 각 well에 2차 항체를 100 ul씩 첨가고 실온에서 1시간 인큐베이션 해주었다. 각 well에 Substrate solution 100 ul씩 첨가 후, 빛을 차단시키고, 실온에서 15분 동안 인큐베이션 해주었다. 각 well에 Stop solution 100 ul 씩 첨가하고, 450 nm 에서 흡광도(Optical Density) 값을 측정하였다.
실험 결과, 도 3에서 보는 바와 같이 대장균에서 생산 및 정제된 Asfv-p62 (서열번호 1)의 단편 폴리펩타이드는 다른 아프리카 돼지 열병 항원 단백질(Asfv-p72) 과 비교하였을 때 유사한 수준으로 ASFV 감염 양성 혈청에 대해서 높은 반응성을 나타내었다. 또한 ID.vet 사에서 제공하는 상업용 진단시약과 비교하여 유사한 수준의 반응성을 나타내었다.
실시예 2: 이탈리아 유래 아프리카돼지열병 바이러스(ASFV) pK205R 단백질 유래 고효율의 면역원성 단편 폴리펩타이드 발굴
2-1. ASFV pK205R 단백질 유래 단편 폴리펩타이드 제작
AFV Malawi/Lil 20-1/1983 strain으로부터 수득된 서열번호 15로 표시되는 아미노산 서열로 구성되는 pK205R 단백질(NCBI GenBank: AAA65278.1 / 본 명세서에서, Italia-asfv-p205로도 표기)서열을 기초로 하여 다양한 폴리펩타이드 단편을 제작하였으며, 대표적인 몇 가지 예들을 [표 2]에 도시하였다. pK205R 단백질은, 단백질 불안정성으로 인해 상기 단백질을 발현 및 정제한 후에 자체적으로 단백질이 무작위적으로 잘려지는(분해되는) 문제가 있어, 상업적으로 사용하기 위한 수준으로 재조합 단백질을 생산하며 정제된 단백질의 활용/응용하는 데에는 어려움이 있는 실정이다. 이에 본 발명에서 발현/정제를 다각도로 시도하였다.
pep. fragment 명칭 서열정보 서열번호
Italia-asfv-p205
(AFV Malawi/Lil 20-1/1983)		 VEPREQFFQDLLSAVDQQMDTVKNDIKDIMKEKTSFMVSFENFIERYDTMEKNIQDLQNKYEEMAANLMTVMTDTKIQLGAIIAQLEILMINGTPLPAKKTTIKEAMPLPSSNTNNDQTSPPASGKTSETPKKNPTNAMFFTRSEWASSKTFREKFLTPEIQAILDEQFANKTGIERLHAEGLYMWRTQFSDEQKKMVKEMMKK 서열번호15
Italia-asfv-pep205-1 VEPREQFFQDLLSAVDQQMDTVKNDIKDIMKEKTSFMVSFENFIERYDTMEKNIQDLQNKYEEMAANLMTVMTDTKIQLGAIIAQLEILMINGTPLPAKKTTIKEAMPLPSSNTNNDQTS 서열번호17
Italia-asfv-pep205-2 VEPREQFFQDLLSAVDQQMDTVKNDIKDIMKEKTSFMVSFENFIERYDTMEKNIQDLQNKYEEMAANLMTVMTDTKIQLGAIIAQLEILMINGTPLPAKKTTIKEAMPLPSSNTNNDQTSPPASGKTSETPKKNPTNAMFFTRSEWASSKTFREKFLTPEIQAILDEQFANKTGIERLHAEG 서열번호18
상기 단백질 및 폴리펩타이드들은, 간략하게 다음과 같은 방법으로 생산되었다. 먼저, Italia-asfv-p205의 DNA(서열번호 16)를 마크로젠에 의뢰하여 합성하였다. Italia-asfv-pep205-1과 Italia-asfv-pep205-2를 포함하여 각각의 단편 폴리펩타이드들을 코딩하는 DNA들은, 상기 Italia-asfv-p205 DNA로부터 PCR(유전자 증폭기술)을 통해 일부 유전자 조각을 증폭하는 방식으로 수득되었다. 각 단편 폴리펩타이드를 코딩하는 폴리뉴클레오타이드는 pET49b벡터(Novagen)의 BamH1, Sal1 restriction site 사이에 클로닝되었다. 각 폴리펩타이드들은 Escherichia coli 균주인 BL21 균주에서 과발현시켰다. 상기 벡터로 형질전환된 E. coli 세포들을 100 ug/ml kanamycin이 포함된 Luria-Bertani (LB) 배지를 이용하여 37℃에서 OD600이 0.7 이 될 때까지 성장시켰고, 1 mM isopropyl β-D-1-thiogalactopyranoside (IPTG)에 의해 단백질 발현이 유도되었다. IPTG를 넣은 후, 추가로 4시간 동안 배양한 다음, 5,000 rpm에서 20분 간 원심 분리하여 세포를 회수하였다. 회수된 세포를 50 ml의 IB buffer (pH 8.0 Tris 0.1 M, pH 8.0 Ethylenediaminetetraacetic acid 5 mM, phenylmethylsulfonyl fluoride 0.1 mM)에 재현탁 시킨 후, 초음파 처리로 세포를 깨주고 최종적으로 Denaturation buffer (6 M Guanidine Hydrochloric acid, pH 8.0 Tris 0.1 M 및 pH 8.0 Ethylenediaminetetraacetic acid 2.5 mM 조성의 Denaturation buffer를 사용)에 재현탁 시킨 후, 초음파 처리로 세포를 깨주었다. 5,000 rpm으로 원심분리하여, Snake skin tube에 상층액을 넣어주고 20 mM　HEPES pH 7.4 150 mM　NaCl buffer에 4℃ 14시간 넣어 준다. 이것을 다시 5,000 rpm으로 20분 동안 원심분리시킨 후, 상층액을 Ni-NTA에 처리하여 1시간 30분 동안 결합시켰다(4℃). 50 mM Imidazole을 포함한 1X PBS 버퍼를 이용해 washing 해준 후, 250 mM Imidazole 및 500 mM Imidazoe을 포함한 1X PBS 버퍼를 이용해 용출시켰다. SDS-polyacrylamide gel electrophoresis를 이용해 폴리펩타이드를 확인하였으며, 폴리펩타이드들은 pH 7.4 HEPES 20 mM 및 Sodium chloride 150 mM를 포함하는 버퍼에 수용되었다(4℃, overnight).
2-2. pK205R 전장(full sequence) 단백질 대비 단편 폴리펩타이드 생산성 평가
여러 가지 단편 폴리펩타이드들의 생산성을 정량적으로 비교 평가하였다. 생단백질 생산 세포주 배양 및 단백질 정제 직후의 총량은 다른 시험군과 비슷하나, Italia-asfv-p205(pK205R)는 정제과정 및 저장과정에서 매우 불안정하여 무작위적인 단백질의 분해가 일어나서, 이로 인한 총량의 정제된 단백질의 온전한 상태 유지가 불가능하였다.
이에 재조합 단백질의 안정성을 향상시키고자 온전한 형태로 수득 및 저장될 수 있는 Italia-asfv-p205의 절편(단편)들을 스크리닝하였다. 그 결과 여러 단편들 중에서도 특히 Italia-asfv-pep205-1 (서열번호 17) 과 Italia-asfv-pep205-2 (서열번호 18)의 단편 폴리펩타이드가 Italia-asfv-p205와 유사한 수율로, 그러나 정제 및 저장 시 분해되지 않고 안정한 형태로 획득되었다.
2-3. pK205R 전장 단백질 대비 단편 폴리펩타이드들의 ASFV 감염 혈청 진단 능력 비교 평가
ID.vet 사의 ID Screen　African Swine Fever Indirect Screening test kit를 이용하여, 상기 실시예 2-1에서 제작한 여러 가지 단편 폴리펩타이드들의 ASFV 감염 혈청내 항체와의 결합능력을 ID(indirect)-ELISA 방법으로 비교 평가하였다. 간략히 다음과 같은 방법으로 수행되었다. 먼저 96 Well EIA/RIA plate에 Coating buffer (0.015 M Sodium carbonate, 0.035 M Sodium bicarbonate, Final pH 9.6)와 각각의 항원(실시예 2-1에서 제작한 여러 가지 단편 폴리펩타이드 각각, 2 ug/ml 또는 4 ug/ml 농도로 첨가)을 첨가하고 4℃에서 overnight (16h) 으로 인큐베이션하여, 각각의 항원으로 well을 코팅하였다. 200 ul의 PBST buffer (1XPBS + Tween20 0.05%)를 사용하여 각 well을 4번씩 세척하여 주었다. 각 well에 1차 항체를 100 ul씩 첨가 후, 실온(22℃)에서 1시간 인큐베이션 하였다. 상기 1차 항체는 ID.vet 사의 African Swine Fever Indirect Screening test kit 내에서 positive control로서 제공되는 ASFV 감염 돼지 혈청 형태로 처리되었다. 그 후 PBST buffer 200 ul로 각 well을 세척한 후, 각 well에 2차 항체를 100 ul씩 첨가고 실온에서 1시간 인큐베이션 해주었다. 각 well에 Substrate solution 100 ul씩 첨가 후, 빛을 차단시키고, 실온에서 15분 동안 인큐베이션 해주었다. 각 well에 Stop solution 100 ul 씩 첨가하고, 450 nm 에서 흡광도(Optical Density) 값을 측정하였다.
그 결과, 여러 단편들 중에서도, Italia-asfv-pep205-1 (서열번호 17) 및 Italia-asfv-pep205-2 (서열번호 18)의 단편 폴리펩타이드가 ASFV 감염 혈청에 대해서 높은 반응성을 나타내었다(결과 미도시). 한편, 본 발명에서는 이하의 실시예 3에서 수득한 Kenya-asfv-pep72-2 단백질 단편과의 융합을 위해 보다 짧은 서열을 갖는 Italia-asfv-pep205-1 (서열번호 17)의 단편 폴리펩타이드를 이용하였다.
실시예 3: 케냐 유래 아프리카돼지열병 바이러스(ASFV) p72 단백질 유래 고효율의 면역원성 단편 폴리펩타이드 발굴
3-1. ASFV p72 단백질 유래 단편 폴리펩타이드 제작
ASFV pig/Kenya/KEN-05/1950 strain으로부터 수득된 서열번호 19로 표시되는 아미노산 서열로 구성되는 p72 단백질 (NCBI GenBank: AY578698.1/ 본 명세서에서, Kenya-afv-p72로도 표기) 서열을 기초로하여 다양한 폴리펩타이드 단편을 제작하였으며, 대표적인 몇 가지 예들을 [표 3]에 도시하였다. p72 단백질은 기존에 재조합 형태로 발현이 어려웠으며, 상업적으로 사용하기 위한 수준으로 재조합 단백질을 생산하는 데에는 어려움이 있는 실정이다. 이에 본 발명에서 발현/정제를 다각도로 시도하였다.
pep. fragment 명칭 서열정보 서열번호
Kenya-asfv-p72 MASGGAFCLIANDGKADKIILAQDLLNSRISNIKNVNKSYGKPDPEPTLSQIEETHMVHFNAHFKPYVPIGFEYNKVRPHTGTPTLGNKLTFGIPQYGDFFHDMVGHHILGACHSSWQDAPIQGSSQMGAHGQLQTFPRNGYDWDNQTPLEGAVYTLVDPFGRPIVPGTKNAYRNLVYYCEYPGERLYENVRFDVNGNSLDEYSSDVTTLVRKFCIPGDKMTGYKHLVGQEVSVEGTSGPLLCNVQDMHKPHQSKPILTDENDTQRTCTHTNPKFLSQHFPENSHNIQTAGKQDITPITDATYLDIRRNVHYSCNGPQTPKYYQPPLALWIKLRFWFNENVNLAIPSVSIPFGERFITIKLASQKDLVNEFPGLFIRQSRFIPGRPSRRNIRFKPWFIPGVISEISLTNNELYINNLFVTPEIHNLFVKRVRFSLIRVHKTQVTHTNNNHHDEKLMSALKWPIEYMFIGLKPTWNISDQNPHQHRDWHKFGHVVNAIMQPTHHAEVSFQDRDTALPDACSSISDISPITYPITLPIIKNISVTAHGINLIDKFPSKFCSSYIPFHYGGNSIKTPDDPGAMMITFALKPREEYQPSGHINVSRAREFYISWDTDYVGSITTADLVVSASAINFLLLQNGSAVLRYST 서열번호19
Asfv-p72-1 PIGFEYNKVRPHTGTPTLGNKLTFGIPQYGDFFHDMVGHHILGACHSSWQDAPIQGSSQMGAHGQLQTFPRNGYDWDNQTPLEGAVYTLVDPFGRPIVPGTKNAYRNLVYYCEYPGERLYENVRFDVNGNSLDEYSSDVTTLVRKFCIPGDKMTGYKHLVGGPQTPKYYQPPLALWIKLRFWFNENVNLAIPSVSIPFGERFITIKLASQKDLVNEFPGLFIRQSRFIPGRPSRRNIRFKPWFIPGVISEISLTNNELYINNLFVTPEIHNLFVKRVRFSLIRVHKTQVTHTNNNHHDEKLMSALKWPIEYMFIGLKPTWNISDQNPHQHRDWHKFGHVVNAIMQPTHHAEVSFQDRDTALPDACSSISDISPITYPITLPIIKNISVTAHGINLIDKFPSKFCSSYIPFHYGGNSIKTPDDPGAMMITFALKPREEYQPSGHINVSRAREFYISWDTDYVGSITTADLVV 서열번호21
Asfv-p72 GQEVSVEGTSGPLLCNVQDMHKPHQSKPILTDENDTQRTCTHTNPKFLSQHFPENSHNIQTAGKQDITPITDATYLDIRRNVHYSCNG 서열번호22
상기 단백질 및 폴리펩타이드들은, 간략하게 다음과 같은 방법으로 생산되었다. Asfv-p72-1 및 Asfv-p72의 단편 폴리펩타이드를 코딩하는 DNA는 마크로젠에 의뢰하여 합성하였다. 각 단편 폴리펩타이드를 코딩하는 폴리뉴클레오타이드는 pET49b벡터(Novagen)의 BamH1, Sal1 restriction site 사이에 클로닝되었다. 각 폴리펩타이드들은 Escherichia coli 균주인 BL21 균주에서 과발현시켰다. 상기 벡터로 형질전환된 E. coli 세포들을 100 ug/ml kanamycin이 포함된 Luria-Bertani (LB) 배지를 이용하여 37℃에서 OD600이 0.7이 될 때까지 성장시켰고, 1 mM isopropyl β-D-1-thiogalactopyranoside (IPTG)에 의해 단백질 발현이 유도되었다. IPTG를 넣은 후, 추가로 4시간 동안 배양한 다음, 5,000rpm에서 20 분 간 원심 분리하여 세포를 회수하였다. 회수된 세포를 50 ml의 IB buffer (pH 8.0 Tris 0.1 M, pH 8.0 Ethylenediaminetetraacetic acid 5 mM, phenylmethylsulfonyl fluoride 0.1 mM)에 재현탁 시킨 후, 초음파 처리로 세포를 깨주고 최종적으로 Denaturation buffer (6 M Guanidine Hydrochloric acid, pH 8.0 Tris 0.1 M 및 pH 8.0 Ethylenediaminetetraacetic acid 2.5 mM 조성의 Denaturation buffer를 사용)에 재현탁 시킨 후, 초음파 처리로 세포를 깨주었다. 5,000rpm으로 원심분리하여, Snake skin tube에 상층액을 넣어주고 20 mM　HEPES pH 7.4 150 mM　NaCl buffer 에 4℃ 14시간 넣어 준다. 이것을 다시 5,000rpm으로 20분 동안 원심분리시킨 후, 상층액을 Ni-NTA에 처리하여 1시간 30분 동안 결합시켰다(4℃). 50 mM Imidazole을 포함한 1X PBS 버퍼를 이용해 washing 해준 후, 250 mM Imidazole 및 500 mM Imidazoe을 포함한 1X PBS 버퍼를 이용해 용출시켰다. SDS-polyacrylamide gel electrophoresis를 이용해 폴리펩타이드들을 확인하였으며 (6 M Guanidine Hydrochloric acid, pH 8.0 Tris 0.1 M 및 pH 8.0 Ethylenediaminetetraacetic acid 2.5 mM 조성의 Denaturation buffer를 사용), 폴리펩타이드들은 pH 7.4 HEPES 20 mM 및 Sodium chloride 150 mM를 포함하는 버퍼에 수용되었다(4℃, overnight).
3-2. p72 전장(full sequence) 단백질 대비 단편 폴리펩타이드 생산성 평가
여러 가지 단편 폴리펩타이드들의 생산성을 정량적으로 비교 평가하였다. 그 결과, 여러 단편들 중에서도 특히 Asfv-p72 (서열번호 22)의 단편 폴리펩타이드만이 대장균에서 발현 및 정제가 가능한 것을 확인하였으며, 이는 생산성 면에서 장점을 나타낸다. Kenya-asfv-p72 단백질과 Asfv-p72-1 단편 폴리펩타이드는 대장균 발현 세포주를 사용하였을 때 발현이 되지 않거나 수율이 극히 낮았으나, Asfv-p72는 대장균 세포주에서 발현 및 정제가 가능한 것을 확인할 수 있었다. Asfv-p72 단편 폴리펩타이드는 발현 및 정제의 총 수율이 약 4 mg/1L(LB culture)였다.
3-3. p.72 전장 단백질 대비 단편 폴리펩타이드들의 ASFV 감염 혈청 진단 능력 비교 평가
ID.vet 사의 ID Screen　 African Swine Fever Indirect Screening test kit를 이용하여, 상기 실시예 3-1에서 제작한 단편 폴리펩타이드의 ASFV 감염 혈청내 항체와의 결합능력을 ID(indirect)-ELISA 방법으로 비교 평가하였다. 간략히 다음과 같은 방법으로 수행되었다. 먼저 96 Well EIA/RIA plate에 Coating buffer (0.015 M Sodium carbonate, 0.035 M Sodium bicarbonate, Final pH 9.6)와 각각의 항원(실시예 3-1에서 제작한 단편 폴리펩타이드 각각, 2 ug/ml 또는 4 ug/ml 농도로 첨가)을 첨가하고 4℃에서 overnight (16h) 으로 인큐베이션 하여, 각각의 항원으로 well을 코팅하였다. 200 ul의 PBST buffer (1XPBS + Tween20 0.05%)를 사용하여 각 well을 4번씩 세척하여 주었다. 각 well에 1차 항체를 100 ul씩 첨가 후, 실온(22℃)에서 1시간 인큐베이션 하였다. 상기 1차 항체는 ID.vet 사의 African Swine Fever Indirect Screening test kit 내에서 positive control로서 제공되는 ASFV 감염 돼지 혈청 형태로 처리되었다. 그 후 PBST buffer 200 ul로 각 well을 세척한 후, 각 well에 2차 항체를 100 ul씩 첨가고 실온에서 1시간 인큐베이션 해주었다. 각 well에 Substrate solution 100 ul씩 첨가 후, 빛을 차단시키고, 실온에서 15분 동안 인큐베이션 해주었다. 각 well에 Stop solution 100 ul 씩 첨가하고, 450 nm 에서 흡광도(Optical Density) 값을 측정하였다.
실험결과, Asfv-p72 (서열번호 22)의 단편 폴리펩타이드는 ASFV 감염 혈청에 대해서 높은 반응성을 나타내었으며, Asfv-p72-1 (서열번호 21)에서는 그렇지 않았다(결과 미도시). 이에 본 발명에서는 앞서 실시예 2에서 수득한 Italia-asfv-pep205-1 (서열번호 17) 단편 폴리펩타이드와의 융합을 위해 Asfv-p72 (서열번호 22)의 단편 폴리펩타이드를 이용하였다.
실시예 4 : p205와 p72 폴리펩타이드 단편의 융합 단백질의 발굴
4-1. p205와 p72 폴리펩타이드 단편의 융합 단백질 제작
실시예 2에서 수득한 Italia-asfv-pep205-1 폴리펩타이드 단편과 실시예 3에서 수득한 Asfv-p72 폴리펩타이드 단편을 융합하여 신규한 F20572 폴리펩타이드 단편을 제작하였다. 두 개의 다른 Asfv 항원 단백질을 한 개의 폴리펩타이드 단편인 융합단백질 형태로 생산하기 위해 Italia-asfv-pep205-1 폴리펩타이드 단편과 Asfv-p72 폴리펩타이드 단편 부위의 유전자를 합성하였다. Italia-asfv-pep205-1 폴리펩타이드 단편과 Asfv-p72 폴리펩타이드 단편의 연결부위에 5개의 아미노산기로 구성된 연결서열(-GAGGS-, 글라이신-알라닌-글라이신-글라이신-세린)을 삽입하여 각 항원 부위들이 3차원적 공간 구조에서 독립적으로 기능할 수 있도록 하였다. 단편 폴리펩타이드를 코딩하는 DNA는 마크로젠에 의뢰하여 합성하였다. 단편 폴리펩타이드를 코딩하는 폴리뉴클레오타이드는 pET49b벡터(Novagen)의 Nde1, BamH1 restriction site 사이에 클로닝되었다. 폴리펩타이드는 Escherichia coli 균주인 BL21 균주에서 과발현시켰다. 상기 벡터로 형질전환된 E. coli 세포들을 100 ug/ml kanamycin이 포함된 Luria-Bertani (LB) 배지를 이용하여 37℃에서 OD600이 0.7이 될 때까지 성장시켰고, 1 mM isopropyl β-D-1-thiogalactopyranoside (IPTG)에 의해 단백질 발현이 유도되었다. IPTG를 넣은 후, 추가로 3시간 동안 배양한 다음, 5,000 rpm에서 20 분간 원심 분리하여 세포를 회수하였다. 회수된 세포를 40 ml의 IB buffer (pH 8.0 Tris 0.1 M, pH 8.0 Ethylenediaminetetraacetic acid 5 mM, Phenylmethylsulfonyl fluoride 0.1 mM, Sodium chloride 0.1 M)에 재현탁 시킨 후, 초음파 처리로 세포를 깨주고 최종적으로 Denaturation buffer (Guanidine hydrochloric acid 6 M, pH 8.0 Tris 0.1 M, pH 8.0 Ethylenediaminetetraacetic acid 2.5 mM, Dithiothreitol 5 mM 조성의 Denaturation buffer를 사용)에 재현탁 시킨 후, 초음파 처리로 세포를 깨주었다. 15,000 rpm으로 원심분리하여 A280에서 농도를 측정해준 뒤, 상층액을 Refolding buffer (50 mM Sodium chloride, pH 8.0 Tris 100 mM, pH 8.0 Ethylenediaminetetraacetic acid 2.5 mM, 0.6 M L-Arginine, 0.2 mM oxidized glutathione, 2 mM reduced glutathione) 에 1 mg/ml 로 희석시켜주었다(10 ℃, 12hrs). Refolding 후 snake skin tube로 옮겨서, Urea buffer (20 mM Tris pH 8.0, 100 mM Urea)를 4℃에서 12 시간 두 번 넣어 주고, 1 X Phosphate-buffered saline (PBS) 버퍼를 4℃에서 12 시간 동안 두 번 넣어 준다. 이것을 다시 5,000 rpm으로 20분동안 원심분리시킨 후, 상층액을 Ni-NTA에 처리하여 1시간 30분동안 결합시켰다(4℃). 50 mM Imidazole을 포함한 1X PBS 버퍼를 이용해 washing해준 후, 250 mM Imidazole 및 500 mM Imidazoe을 포함한 1X PBS 버퍼를 이용해 용출시켰다. SDS-polyacrylamide gel electrophoresis를 이용해 폴리펩타이드를 확인하였으며, 폴리펩타이드들은 pH7.4 HEPES 20mM 및 Sodium chloride 150mM를 포함하는 버퍼에 수용되었다(4℃, overnight).
4-2. Asfv-F20572 폴리펩타이드 단편의 생산성 평가
상기 융합된 폴리펩타이드 단편의 생산성을 정량적으로 비교 평가하였다. 다른 단편 폴리펩타이드 (Asfv-F72205)의 경우 대장균 세포주에서 발현하지 않았다. 하지만 Asfv-F20572 폴리펩타이드는 대장균에서 성공적으로 발현이 되었고 순도 높게 정제가 가능하였다. 본 발명의 Asfv-F20572 (서열번호 11)의 단편 폴리펩타이드의 발현 및 정제의 최종 수율은 1 mg protein/1L (LB culture)로 가능하였으며, 정제까지(단백질을 수득하기까지) 소요되는 시간이 2.5일 ~ 3일이었다. Asfv-F20572는 짧은 시간 효율적으로 생산할 수 있는 장점을 지닌 대장균 세포주에서 성공적으로 발현이 되었으며 정제과정 등에서 상업적으로 활용이 가능한 수율을 나타내었을 뿐만 아니라, 정제기간이 3일 이내로 소요되었다. 융합 단백의 형태로 생산하여, 한 번의 공정 과정으로 두 개의 다른 Asfv 항원 단백질을 획득할 수 있으며, 추후 연구 및 상업적 활용단계에서 야기될 수 있는 두 개의 다른 항원에 대한 상이한 정량적 분포 등의 오류 등으로 인한 문제점을 방지할 수 있다. 융합 단백질의 순서가 다른 Asfv-F72205 단백질은 대장균에서 발현이 되지 않았다. 이처럼 본 발명의 Asfv-F20572 (서열번호 11) 폴리펩타이드 단편은, 대장균 세포주에서 높은 수율의 정제가 가능하며, 짧은 정제 과정의 장점을 나타낸다 (도 4 및 도 5 참조).
4-3. Asfv-F20572 폴리펩타이드 단편의 ASFV 감염 혈청 진단 능력 비교 평가
ID.vet 사의 ID Screen African Swine Fever Indirect Screening test kit를 이용하여, 상기 실시예 3-1에서 제작한 단편 폴리펩타이드의 ASFV 감염 혈청내 항체와의 결합능력을 ID(indirect)-ELISA 방법으로 비교 평가하였다. 간략히 다음과 같은 방법으로 수행되었다. 먼저 96 Well EIA/RIA plate에 Coating buffer (0.015 M Sodium carbonate, 0.035 M Sodium bicarbonate, Final pH 9.6)와 각각의 항원(실시예 3-1에서 제작한 단편 폴리펩타이드 각각, 2 ug/ml 또는 4 ug/ml 농도로 첨가)을 첨가하고 4℃에서 overnight (16h) 으로 인큐베이션하여, 각각의 항원으로 well을 코팅하였다. 200 ul의 PBST buffer (1XPBS + Tween20 0.05%)를 사용하여 각 well을 4번씩 세척하여 주었다. 각 well에 1차 항체를 100 ul씩 첨가 후, 실온(22℃)에서 1시간 인큐베이션하였다. 상기 1차 항체는 ID.vet 사의 African Swine Fever Indirect Screening test kit 내에서 positive control로서 제공되는 ASFV 감염 돼지 혈청 형태로 처리되었다. 그 후 PBST buffer 200 ul로 각 well을 세척한 후, 각 well에 2차 항체를 100 ul씩 첨가고 실온에서 1시간 인큐베이션 해주었다. 각 well에 Substrate solution 100 ul씩 첨가 후, 빛을 차단시키고, 실온에서 15분 동안 인큐베이션 해주었다. 각 well에 Stop solution 100 ul 씩 첨가하고, 450 nm 에서 흡광도(Optical Density) 값을 측정하였다.
실험 결과, 도 6에서 보는 바와 같이 대장균에서 생산 및 정제된 Asfv-F20572 (서열번호 11)의 단편 폴리펩타이드는 다른 아프리카 돼지 열병 항원 단백질(Asfv-p72 또는 Asfv-p205)과 비교하였을 때 월등한 수준으로 ASFV 감염 혈청에 대해서 높은 선택적 반응성을 나타내었다. 또한 ID.vet 사에서 제공하는 상업용 진단시약과 비교하여도 뛰어난 반응성을 나타내었다.
이상 살펴본 바와 같이, 본 발명은 아프리카돼지열병 바이러스(African swine fever virus, ASFV) 유래 p62 및 F20572 단백질 절편의 재조합 항원으로서의 개발 및 이들의 용도에 관한 것으로, 보다 상세하게는 서열번호 1 또는 11로 표시되는 아미노산 서열로 이루어진 단리된 폴리펩타이드, 상기 폴리펩타이드를 유효성분으로 포함하는 ASFV에 대한 백신 조성물과 상기 폴리펩타이드를 이용한 동물 면역화 방법, 및 상기 폴리펩타이드를 이용한 ASFV 감염 검출/진단 방법, 진단시약 및 키트에 관한 것이다. 본 발명에서 제공하는 특유의 서열로 구성되는 폴리펩타이드는 바이러스 내 천연형 단백질과 비교하여 길이가 짧고, ASFV 내의 천연형 단백질과 비교하여도 ASFV 감염 혈청 검출/진단 능력이 현저히 우수할 뿐만아니라, 백신으로서 사용 가능성이 있으며 또한 산업적 수준에서 생산성이 높으므로 산업상 이용가능성이 크다.

Claims (16)

  1. 서열번호 1 또는 11로 표시되는 아미노산 서열로 이루어진 단리된 폴리펩타이드.
  2. 제1항에 있어서, 상기 폴리펩타이드는 아프리카돼지열병 바이러스(African swine fever virus, ASFV)에 대한 면역원성(immunogenicity)인 것을 특징으로 하는 단리된 폴리펩타이드.
  3. 제2항에 있어서, 상기 ASFV는 케냐 유래인 것을 특징으로 하는 단리된 폴리펩타이드.
  4. 제1항의 폴리펩타이드를 암호화하는 폴리뉴클레오타이드.
  5. 제4항의 폴리뉴클레오타이드를 포함하는 발현 벡터.
  6. 제5항의 발현 벡터를 포함하는 숙주세포.
  7. 제1항의 폴리펩타이드를 유효성분으로 포함하는 아프리카돼지열병 바이러스에 대한 백신용 조성물.
  8. 제7항에 있어서, 상기 조성물은 약학적으로 허용되는 담체, 희석제 및 보조제로 이루어진 군에서 선택된 하나 이상의 것을 추가로 포함하는 백신 조성물.
  9. 동물에서 아프리카돼지열병에 대한 방어 면역 반응을 유도하는 방법으로서, 제1항의 폴리펩타이드의 면역 유효량을 동물에게 투여하는 단계를 포함하는 것인 방어 면역 반응의 유도법.
  10. 제1항의 폴리펩타이드를 유효성분으로 포함하는, 아프리카돼지열병 바이러스 감염 진단용 조성물.
  11. 제1항의 폴리펩타이드를 유효성분으로 포함하는, 아프리카돼지열병 바이러스에 대한 항체의 존재 여부를 판단하기 위한 진단 시약.
  12. 제11항의 진단 시약을 포함하는 진단 키트.
  13. (a) 동물의 시료를 제1항의 폴리펩타이드와 접촉시키는 단계; 및
    (b) 상기 시료 중 제1항의 폴리펩타이드와 결합된 항체의 존재를 검출하는 단계를 포함하는 아프리카돼지열병 바이러스 감염 혈청 검출 방법.
  14. 아프리카돼지열병 바이러스에 대한 백신용 조성물을 제조하기 위한 제1항의 폴리펩타이드의 용도.
  15. 아프리카돼지열병 바이러스 감염 진단용 조성물을 제조하기 위한 제1항의 폴리펩타이드의 용도.
  16. (a) 피검체로부터 수득한 생물학적 시료에 제1항의 폴리펩타이드를 처리하는 단계;
    (b) 상기 생물학적 시료에서 상기 폴리펩타이드와 결합된 항체의 존재를 검출하는 단계; 및
    (c) 상기 폴리펩타이드와 결합한 항체의 양이 대조군보다 증가한 경우 상기 피검체를 아프리카돼지열병 바이러스에 감염된 것으로 진단하는 단계를 포함하는, 아프리카돼지열병 바이러스 감염 진단 방법.
PCT/KR2023/004167 2022-03-30 2023-03-29 아프리카돼지열병 바이러스 유래 p62 및 f20572 단백질 절편 및 이들의 용도 WO2023191487A1 (ko)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR1020220039705A KR20230140889A (ko) 2022-03-30 2022-03-30 아프리카돼지열병 바이러스 유래 p62 단백질 절편 및 이의 용도
KR10-2022-0039705 2022-03-30
KR1020220050971A KR20230151361A (ko) 2022-04-25 2022-04-25 아프리카돼지열병 바이러스 유래 f20572 단백질 절편 및 이의 용도
KR10-2022-0050971 2022-04-25

Publications (1)

Publication Number Publication Date
WO2023191487A1 true WO2023191487A1 (ko) 2023-10-05

Family

ID=88202810

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2023/004167 WO2023191487A1 (ko) 2022-03-30 2023-03-29 아프리카돼지열병 바이러스 유래 p62 및 f20572 단백질 절편 및 이들의 용도

Country Status (1)

Country Link
WO (1) WO2023191487A1 (ko)

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20160094674A (ko) * 2015-02-02 2016-08-10 대한민국(농림축산식품부 농림축산검역본부장) 아프리카 돼지열병 바이러스 단백질 k205r에 대한 단클론항체 및 이를 포함하는 아프리카 돼지열병 바이러스 진단용 조성물
KR20200143267A (ko) * 2019-06-14 2020-12-23 연세대학교 원주산학협력단 아프리카 돼지 열병 바이러스 유래 p72 단백질 절편 및 이의 용도

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20160094674A (ko) * 2015-02-02 2016-08-10 대한민국(농림축산식품부 농림축산검역본부장) 아프리카 돼지열병 바이러스 단백질 k205r에 대한 단클론항체 및 이를 포함하는 아프리카 돼지열병 바이러스 진단용 조성물
KR20200143267A (ko) * 2019-06-14 2020-12-23 연세대학교 원주산학협력단 아프리카 돼지 열병 바이러스 유래 p72 단백질 절편 및 이의 용도

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
DATABASE Protein 21 July 2021 (2021-07-21), ANONYMOUS : "K205R [African swine fever virus] ", XP093096562, retrieved from NCBI Database accession no. QED21606.1 *
DATABASE Protein 22 May 2021 (2021-05-22), ANONYMOUS : "Chain A, CP530R ", XP093096553, retrieved from NCBI Database accession no. 7CP2_A *
HEIMERMAN MALLORY E., MURGIA MARIA V., WU PING, LOWE ANDRE D., JIA WEI, ROWLAND RAYMOND R.: "Linear epitopes in African swine fever virus p72 recognized by monoclonal antibodies prepared against baculovirus-expressed antigen", JOURNAL OF VETERINARY DIAGNOSTIC INVESTIGATION., AAVLD, COLUMBIA, MO., US, vol. 30, no. 3, 1 May 2018 (2018-05-01), US , pages 406 - 412, XP093096546, ISSN: 1040-6387, DOI: 10.1177/1040638717753966 *

Similar Documents

Publication Publication Date Title
KR102449695B1 (ko) 아프리카 돼지 열병 바이러스 유래 p72 단백질 절편 및 이의 용도
JPS62277400A (ja) Ｈｔｌｖ−３エンベロ−プ蛋白質
WO2020251284A1 (ko) 아프리카 돼지 열병 바이러스 유래 p72, p104, p205 단백질 절편 및 이의 용도
CA2331845A1 (en) Compounds and methods for the diagnosis and treatment of ehrlichia infection
WO2019182417A1 (ko) 황열 바이러스 유래 ns1 단백질, 이에 특이적으로 결합하는 단일클론항체 및 이의 용도
KR102433180B1 (ko) 아프리카 돼지 열병 바이러스 유래 p205 단백질 절편 및 이의 용도
WO2023191487A1 (ko) 아프리카돼지열병 바이러스 유래 p62 및 f20572 단백질 절편 및 이들의 용도
WO2021034143A1 (ko) 중증 열성 혈소판 감소증후군 바이러스 유래 면역원성 폴리펩타이드 단편 및 이의 용도
EP1113777B1 (en) Novel hepatitis c virus peptides and uses thereof
AU2638295A (en) Compositions of transactivating proteins of human immunodeficiency virus
KR20230151361A (ko) 아프리카돼지열병 바이러스 유래 f20572 단백질 절편 및 이의 용도
US20070280956A1 (en) Novel hepatitis C virus peptides and uses thereof
AU582358B2 (en) A peptide vaccine or diagnostic, and a polypeptide useful therefor
US5003043A (en) Peptides representing epitopic sites for the major HTLV-I envelope protein, antibodies thereto, and uses thereof
WO2019231110A1 (ko) 대장균 유래 지카바이러스 외피 단백질 도메인 iii 재조합 단백질의 가용화를 위한 조성물 및 이를 이용한 지카 재조합 단백질 생산방법
KR102433177B1 (ko) 아프리카 돼지 열병 바이러스 유래 p104 단백질 절편 및 이의 용도
Dadley-Moore et al. Synthetic peptide antigens induce antibodies to Taenia ovis oncospheres
KR20230140889A (ko) 아프리카돼지열병 바이러스 유래 p62 단백질 절편 및 이의 용도
KR20230137070A (ko) 아프리카돼지열병 바이러스 유래 p30 단백질 절편 및 이의 용도
KR101057587B1 (ko) 치료학적 펩티드
CA2030254A1 (en) Methods of treating retroviral infection
KR102647737B1 (ko) 코로나바이러스감염증-19 바이러스 유래 면역원성 폴리펩타이드 단편 및 이의 용도
WO2022245142A1 (ko) 장티푸스 및 파라티푸스 동시 감별진단 키트
CN114057852B (zh) 一种预防新型冠状病毒肺炎covid-19的多肽及其用途
KR101223998B1 (ko) 간흡충증 진단용 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23781342

Country of ref document: EP

Kind code of ref document: A1