WO2023153880A1 - Il-12 및 항-fap 항체를 포함하는 융합단백질 및 항암제를 포함하는 암 치료용 약학 조성물 - Google Patents

Il-12 및 항-fap 항체를 포함하는 융합단백질 및 항암제를 포함하는 암 치료용 약학 조성물 Download PDF

Info

Publication number
WO2023153880A1
WO2023153880A1 PCT/KR2023/002030 KR2023002030W WO2023153880A1 WO 2023153880 A1 WO2023153880 A1 WO 2023153880A1 KR 2023002030 W KR2023002030 W KR 2023002030W WO 2023153880 A1 WO2023153880 A1 WO 2023153880A1
Authority
WO
WIPO (PCT)
Prior art keywords
fap
seq
cancer
sequence
antibody
Prior art date
Application number
PCT/KR2023/002030
Other languages
English (en)
French (fr)
Inventor
김동수
김동건
이현지
윤유진
이영인
이다혜
장지훈
이병철
Original Assignee
주식회사 카나프테라퓨틱스
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 카나프테라퓨틱스 filed Critical 주식회사 카나프테라퓨틱스
Publication of WO2023153880A1 publication Critical patent/WO2023153880A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19—Cytokines; Lymphokines; Interferons
    • A61K38/20—Interleukins [IL]
    • A61K38/208—IL-12
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19—Cytokines; Lymphokines; Interferons
    • A61K38/20—Interleukins [IL]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52—Cytokines; Lymphokines; Interferons
    • C07K14/54—Interleukins [IL]
    • C07K14/5434—IL-12
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide

Definitions

  • the present invention relates to IL-12 or a variant thereof; And an anti-cancer pharmaceutical composition comprising a novel fusion protein including an anti-FAP antibody and an anti-cancer agent.
  • Interleukin-12 As a representative inflammatory cytokine, plays an essential role in effectively inducing a cellular immune response.
  • IL-12 is a heterodimeric protein comprising 40 kDa (p40) and 35 kDa (p35) subunits linked by disulfide bonds and is produced by activated macrophages, monocytes, dendritic cells and activated B lymphocytes.
  • IL-12 can enhance T-helper 1 cell immunity, increase cellular T-lymphocyte cytotoxicity, and inhibit angiogenesis.
  • IL-12 activates IFN- ⁇ production in T cells and NK cells.
  • IL-12 sensitizes tumor cells to T-cell mediated cytotoxicity, resulting in tumor growth inhibition and establishment of humoral immunity.
  • a disadvantage in the clinical application of IL-12 is that upon administration, cytokine-associated toxicity may appear systemically.
  • fibroblast activation protein alpha is a gelatinase expressed on activated fibroblasts. It is known that FAP is expressed in more than 90% of cancer-associated fibroblasts of various human carcinomas including prostate and pancreatic cancer. Accordingly, interest in developing immunotherapies targeting FAP-expressing cells has recently increased (Fang J. et.al. , Mol. Ther. Oncolytics. , 3:16007, 2016).
  • the present inventors studied to develop a pharmaceutical composition having an effective anti-cancer effect, a fusion protein including IL-12 and an anti-FAP antibody; And the present invention was completed by confirming that there is synergy in the anticancer effect when administered in combination with the anticancer agent.
  • a first monomer comprising IL-12 or a variant thereof; and a fusion protein comprising a second monomer including an antigen-binding site that specifically binds to FAP (Fibroblast activation protein alpha); And it provides a pharmaceutical composition for cancer treatment containing an anticancer agent.
  • FAP Fibroblast activation protein alpha
  • Another aspect of the present invention is a first monomer comprising IL-12 or a variant thereof; And a fusion protein comprising a second monomer comprising an antigen-binding site that specifically binds to FAP; And it provides a kit for preventing or treating cancer comprising an anticancer agent as an active ingredient.
  • a fusion protein containing an antigen-binding site that specifically binds to IL-12 and FAP may exhibit an anticancer effect by IL-12.
  • IL-12 is specifically accumulated in tumors with high FAP expression, thereby reducing systemic toxicity and showing tumor-specific anti-cancer effects. did That is, cancer can be efficiently treated by specifically localizing IL-12 to the tumor site by targeting FAP, which is specifically highly expressed in the tumor.
  • FAP which is specifically highly expressed in the tumor.
  • the fusion protein and the anticancer agent are administered in combination, there is a synergistic effect on the anticancer effect.
  • T1.08 is an SDS-PAGE result for T1.08, T1.09, T1.10, T1.11, T1.12, T1.13, T1.14 and T1.15 according to an embodiment.
  • T1.01m is an SDS-PAGE result for T1.01m, T1.02m, T1.03m, T1.04m, T1.05m, T1.06m, and T1.07m according to an embodiment.
  • T1.16m is an SDS-PAGE result for T1.16m, T1.17m, T1.18m, T1.19m, T1.20m, T1.21m and T1.22m according to an embodiment.
  • Figure 7 is a graph showing the binding force of T1.01 and T1.02 to recombinant human FAP (rhFAP) through surface plasmon resonance analysis.
  • FIG. 9 is a diagram showing the degree of binding of T1.04 and T1.05 to recombinant human FAP through surface plasmon resonance analysis.
  • FIG. 10 is a diagram showing the degree of binding of T1.06 and T1.07 to recombinant human FAP through surface plasmon resonance analysis.
  • FIG. 11 is a diagram showing the degree of binding of T1.08 and T1.09 to recombinant human FAP through surface plasmon resonance analysis.
  • T1.10 and T1.11 are diagrams showing the degree of binding of T1.10 and T1.11 to recombinant human FAP through surface plasmon resonance analysis.
  • FIG. 13 is a graph showing the binding force of T1.01m and T1.02m to recombinant mouse FAP through surface plasmon resonance analysis.
  • FIG. 14 is a graph showing the binding force of T1.03m to recombinant mouse FAP through surface plasmon resonance analysis.
  • 15 is a graph showing the binding ability of T1.12, T1.01, T1.02, and T1.03 to HEK293-hFAP cells and HEK293 cells through flow cytometry.
  • 16 is a graph showing the binding force of T1.12m, T1.01m, T1.02m and T1.03m to B16F10-mFAP cells and B16F10 cells through flow cytometry.
  • 17 is a graph showing the binding ability of T1.01, T1.02, T1.03, and T1.12 to the IL-12 receptor beta 1 through enzyme-linked immunoprecipitation assay.
  • T1.01, T1.02, T1.03 and T1.12 and IL-12 activities are a graph showing T1.01, T1.02, T1.03 and T1.12 and IL-12 activities through signaling ability of human T cells.
  • LMWH low molecular weight heparin
  • Figure 21 is a graph measuring the cytokine IFN- ⁇ secretion ability of human T cells by T1.12, T1.01, T1.02 and T1.03.
  • FIG. 22 is a graph measuring the cytokine IFN- ⁇ secretion ability of human NK cells by T1.12, T1.01, T1.02 and T1.03.
  • FIG. 23 is a graph showing the tumor growth inhibition ability by T1.01m and T1.02m by measuring the change in tumor size of a mouse tumor model co-injected with FAP-overexpressing fibroblast NIH-3T3 and colorectal cancer cell line CT26.
  • FIG. 24 is a graph showing individual tumor sizes measured to confirm tumor growth inhibition ability by T1.01m and T1.02m in a mouse tumor model co-injected with FAP-overexpressing fibroblast NIH-3T3 and colorectal cancer cell line CT26. am.
  • 25 is a graph showing the tumor growth inhibition ability by administration of T1.01m and T1.02m at different concentrations by measuring the change in tumor size for each individual in a mouse tumor model in which FAP-overexpressing colorectal cancer cell line CT26 was allografted.
  • Figure 26 shows a tumor recurrence model by allografting CT26 cells and 4T1 cells into mice in which complete remission occurred according to a mouse tumor model co-injected with FAP-overexpressing fibroblast NIH-3T3 and colorectal cancer cell line CT26. Afterwards, it is a graph showing the change in CT26 tumor size.
  • FIG. 27 shows that a tumor recurrence model was constructed by allografting CT26 cells and 4T1 cells into mice in which complete remission occurred in a mouse tumor model co-injected with FAP-overexpressing fibroblast NIH-3T3 and colorectal cancer cell line CT26. Afterwards, it is a graph showing changes in the size of 4T1 tumors.
  • 29 is a graph showing the tumor growth inhibition ability of each individual by administration of T1.03m by concentration by measuring the change in tumor size of each individual in a mouse model in which FAP-overexpressing CT26 cells were allografted.
  • FIG. 30 is a graph showing the tumor growth inhibition ability by administration of T1.03m at different concentrations by measuring the change in tumor size for each individual in a mouse model in which FAP-overexpressing B16F10 cells were allografted.
  • FIG. 31 is a graph showing the tumor growth inhibition ability by administration of T1.03m at different concentrations by measuring the change in tumor size for each individual in a mouse model co-injected with FAP-overexpressing fibroblast NIH-3T3 and lung cancer cell line LLC1.
  • Figure 32 is a mouse model co-injected with FAP-overexpressing fibroblast NIH-3T3 and lung cancer cell line LLC1, 10 days after T1.16m, T1.17m, T1.03m or T1.16m and T1.17m co-administration treatment. It is a graph showing the measurement of tumor size at this elapsed time point.
  • Figure 33a shows the tumor size at the time point after 9 days after treatment with T1.03m and aPD-L1, respectively or simultaneously administered to a mouse model co-injected with FAP-overexpressing fibroblast NIH-3T3 and lung cancer cell line LLC1. This is a graph showing measurements.
  • Figure 33b is a mouse model co-injected with FAP-overexpressing fibroblast NIH-3T3 and lung cancer cell line LLC1, respectively or co-administered with T1.03m and aCTLA-4, and then measuring tumor size at 9 days This is the graph shown by
  • Figure 33c is a mouse model in which FAP-overexpressing fibroblast NIH-3T3 and lung cancer cell line LLC1 were co-injected with T1.03m and aPD-1, respectively or co-administered, and then 9 days later, tumor size was measured. This is the graph shown by
  • Figure 34a shows the tumor size at 16 days after treatment with T1.03m and aPD-L1, respectively or simultaneously, in a mouse model co-injected with FAP-overexpressing fibroblast NIH-3T3 and colon cancer cell line MC38. This is a graph showing measurements.
  • Figure 34b is a fibroblast overexpressing FAP NIH-3T3 and colorectal cancer cell line MC38 in a mouse model co-injected with T1.03m and aPD-L1, respectively or co-administered, and then the tumor size was measured up to 16 days in chronological order. It is a graph represented by
  • Figure 35a shows the tumor size at 11 days after treatment with T1.03m and aPD-L1, respectively or simultaneously, in a mouse model co-injected with FAP-overexpressing fibroblast NIH-3T3 and colon cancer cell line MC38. is the graph shown.
  • Figure 35b is a fibroblast overexpressing FAP NIH-3T3 and colorectal cancer cell line MC38 in a mouse model co-injected with T1.03m and aPD-L1, respectively or co-administered, followed by measuring tumor size until 11 days in chronological order. It is a graph represented by
  • 36a is a graph showing tumor size at 10 days after treatment with T1.03m and aTIGIT, respectively or simultaneously, in a mouse model co-injected with FAP-overexpressing fibroblast NIH-3T3 and colon cancer cell line MC38; am.
  • Figure 36b is a fibroblast NIH-3T3 overexpressing FAP and colorectal cancer cell line MC38 co-injected mouse model, T1.03m and aTIGIT, respectively or co-administered, and then the tumor size was measured up to 10 days and shown in chronological order. it's a graph
  • Figure 37a shows the tumor size at 10 days after treatment with T1.03m and aLAG-3, respectively or simultaneously, in a mouse model co-injected with FAP-overexpressing fibroblast NIH-3T3 and colon cancer cell line MC38. is the graph shown.
  • Figure 37b is a fibroblast overexpressing FAP NIH-3T3 and colorectal cancer cell line MC38 in a mouse model co-injected with T1.03m and aLAG-3, respectively or co-administered, followed by measuring tumor size up to 10 days in chronological order. It is a graph represented by
  • Figure 38a shows the tumor size at 10 days after treatment with T1.03m and aTIM-3, respectively or co-administration, in a mouse model co-injected with FAP-overexpressing fibroblast NIH-3T3 and colon cancer cell line MC38. is the graph shown.
  • Figure 38b is a fibroblast overexpressing FAP NIH-3T3 and colorectal cancer cell line MC38 in a mouse model co-injected with T1.03m and aTIM-3, respectively or co-administered, followed by measuring tumor size until 10 days in chronological order. It is a graph represented by
  • 39a is a graph showing tumor size at 11 days after treatment with T1.03m and cyclophosphamide, respectively or simultaneously, in a mouse model co-injected with FAP-overexpressing fibroblast NIH-3T3 and colon cancer cell line MC38; am.
  • Figure 39b is a fibroblast NIH-3T3 overexpressing FAP and colorectal cancer cell line MC38 co-injected mouse model in which T1.03m and Cyclophosphamide were individually or simultaneously administered, and then the tumor size was measured up to 11 days and shown in chronological order. it's a graph
  • Figure 40a is a graph showing the tumor size at 11 days after treatment with T1.03m and Fluorouracil, respectively or simultaneously, in a mouse model co-injected with FAP-overexpressing fibroblast NIH-3T3 and colon cancer cell line MC38. am.
  • Figure 40b is a mouse model co-injected with FAP-overexpressing fibroblast NIH-3T3 and colon cancer cell line MC38, respectively or co-administered with T1.03m and Fluorouracil, and then measuring tumor size up to 11 days and showing them in chronological order. it's a graph
  • Figure 41a is a graph showing the tumor size at 11 days after treatment with T1.03m and Paclitaxel, respectively or simultaneously, in a mouse model co-injected with FAP-overexpressing fibroblast NIH-3T3 and colon cancer cell line MC38. am.
  • Figure 41b is a mouse model co-injected with FAP-overexpressing fibroblast NIH-3T3 and colorectal cancer cell line MC38, treated with T1.03m and Paclitaxel, respectively or simultaneously, and then measuring tumor size up to 11 days in chronological order. It's a graph
  • Figure 42a is a graph showing the tumor size at 11 days after T1.03m and Camptosar were individually or simultaneously administered in a mouse model co-injected with FAP-overexpressing fibroblast NIH-3T3 and colon cancer cell line MC38. am.
  • Figure 42b is a mouse model co-injected with FAP-overexpressing fibroblast NIH-3T3 and colorectal cancer cell line MC38, respectively or simultaneously treated with T1.03m and Capmtosar, followed by measuring tumor size until day 11, in chronological order. it's a graph
  • FIG. 43 shows the combination of an anti-FAP/IL-12 fusion protein (first from the left), an anti-FAP/IL-12 fusion protein having a dual variable domain (second), and a single chain variable region fragment (scFv) specific to FAP. It is a schematic diagram of an anti-FAP/IL-12 double antibody (third and fourth) and an anti-FAP/IL-12 fusion protein in which IL-12 is coupled to the C-terminus of Fc (fifth).
  • scFv FAP-specific Fab/FAP-specific single chain variable region fragment
  • IL-12 fusion protein left
  • FAP-specific Fab FAP-specific Fab and a fusion protein dimer including IL-12
  • scFv single-chain variable region fragment specific to FAP and an IL-12 fusion protein
  • Fusion proteins including IL-12 and FAP antibodies and combination therapy including anticancer drugs
  • a first monomer comprising IL-12 or a variant thereof; and a fusion protein comprising a second monomer including an antigen-binding site that specifically binds to FAP (Fibroblast activation protein alpha); And it provides a pharmaceutical composition for preventing or treating cancer containing an anticancer agent.
  • FAP Fibroblast activation protein alpha
  • the fusion protein exhibits anticancer effects by IL-12, accumulates IL-2 specifically in tumors with high FAP expression, exhibits tumor-specific anticancer effects, and can reduce systemic toxicity, which is conventionally used. It can be used in combination with various anti-cancer therapies. Specifically, conventional therapies that can be used in combination may be selected from the group consisting of chemotherapy agents for chemotherapy, anticancer viruses, immune checkpoint inhibitors, and combinations thereof.
  • chemo-anticancer agent is also referred to as an antineoplastic agent or a cytotoxic agent. It is a generic term for drugs that exhibit anticancer activity mainly by directly acting on DNA to block DNA replication, transcription, and translation processes, or by interfering with the synthesis of nucleic acid precursors in metabolic pathways and inhibiting cell division. The anti-tumor drug exhibits cytotoxicity by acting not only on tumor cells but also on normal cells. Chemotherapy can be used for maintenance therapy.
  • maintenance therapy refers to treatment of cancer with drugs after initial chemotherapy, and refers to a treatment method performed to prevent or delay the recurrence of cancer.
  • the chemical anti-cancer agent may be any one selected from the group consisting of Alkylating Agent, Microtubule Inhibitor, Anti metabolite and Topoisomerase Inhibitor.
  • the alkylating agent may be cyclophosphamide or cisplatin.
  • the Microtubule Inhibitor may be Paclitaxel.
  • Anti-metabolite may be Fluorouracil or Gemcitabine.
  • the Topoisomerase Inhibitor may be Camptosar or Adriamycin.
  • anti-cancer virus therapeutic agent is a therapeutic agent that kills cancer by inserting a specific gene targeting cancer cells into a proliferating and infectious virus.
  • the anticancer virus therapeutic agent may be Talimogene Laherparepvec (T-VEC).
  • immune checkpoint inhibitor is a substance that inhibits the activity of an immune checkpoint protein that inhibits the differentiation, proliferation, and activity of immune cells, and prevents cancer cells from evading the immune system. It is known to eliminate cancer cells by preventing them from exerting themselves.
  • the immune checkpoint inhibitor is from the group consisting of anti-CTLA-4 antibody, anti-PD-1 antibody, anti-PD-L1 antibody, anti-TIM3 antibody, anti-TIGIT antibody and anti-LAG3 antibody. It may be any one selected.
  • the immune checkpoint inhibitor may be any one selected from the group consisting of Ipilimumab, Pembrolizumab, Nivolumab, Cemiplimab, Atezolizumab, Avelumab, and Durvalumab.
  • the fusion protein can be used in parallel with an anti-cancer vaccine.
  • the anticancer agent may be used in combination with the anticancer agent as well as the anticancer vaccine.
  • the anticancer agent may include one or more anticancer agents.
  • the fusion protein can be used with two anticancer drugs.
  • chemo-cancer agents and anti-cancer viruses for example, chemo-cancer agents and anti-cancer viruses; anticancer viruses and immune checkpoint inhibitors; and chemotherapeutic agents and immune checkpoint inhibitors.
  • the fusion protein can be used with three anticancer agents. In addition to the two anticancer agents, a different anticancer agent may be further included and used.
  • the anticancer agent may be a chemotherapeutic anticancer agent, an anticancer virus, and an immune checkpoint inhibitor.
  • Another aspect of the present invention is a first monomer comprising IL-12 or a variant thereof; and a fusion protein comprising a second monomer including an antigen-binding site that specifically binds to FAP as an active ingredient.
  • the fusion protein is as described below.
  • maintaining anticancer means treating cancer after initial anticancer treatment.
  • it is a treatment method that prevents or delays the recurrence of cancer to increase the effect of cancer treatment.
  • At this time, at least one anticancer agent may be additionally included for maintenance therapy. At this time, the anticancer agent is as described above.
  • Another aspect of the present invention is a first monomer comprising IL-12 or a variant thereof; And a fusion protein comprising a second monomer comprising an antigen-binding site that specifically binds to FAP; And it provides a kit for preventing or treating cancer comprising an anticancer agent as an active ingredient.
  • the fusion protein containing an antigen-binding site that specifically binds to IL-12 or a variant thereof and FAP may include an immunoglobulin Fc region.
  • the IL-12 or a variant thereof may be a variant with reduced heparin binding ability.
  • the fusion protein comprises a first monomer comprising IL-12 or a variant thereof; And it may be a fusion protein comprising a second monomer comprising an antigen binding site that specifically binds to FAP.
  • the fusion protein may be a dimer of a fusion protein including an antigen binding site specifically binding to IL-12 or a variant thereof and FAP.
  • IL-12 is a heterodimeric cytokine composed of p35 and p40 subunits encoded by two separate genes, IL-12A and IL-12B, respectively.
  • IL-12 is produced by antigen presenting cells such as macrophages and binds to cell surface receptors of activated T cells and NK cells.
  • the IL-12 promotes the proliferation of T cells and NK cells and enhances the cytotoxic effect of T cells, NK cells and macrophages.
  • IL-12 induces the production of IFN- ⁇ , TNF- ⁇ and GM-CSF, and acts to induce the activation of Th1 cells.
  • IL-12 binds to the IL-12 receptor, which is a heterodimeric receptor formed by IL-12R ⁇ 1 and IL-12R ⁇ 2.
  • a “variant” of IL-12 includes an amino acid sequence that is similar to or has the same function as the wild-type IL-12 protein. Specifically, the amino acid sequences of the p35 and p40 subunits constituting IL-12 may be substituted, inserted, or deleted compared to the wild type.
  • the IL-12 or a variant thereof may include IL-12A (p35) or a variant thereof and IL-12B (p40) or a variant thereof.
  • the IL-12 or a variant thereof may be IL-12A or a variant thereof; and a structure in which IL-12B or a variant thereof is coupled with a peptide linker.
  • the IL-12 or variant thereof may be a fusion protein comprising the following structural formula (I) or structural formula (II).
  • N' is the N-terminus of the fusion protein
  • C' is the C-terminus of the fusion protein
  • Y is IL-12A or a variant thereof
  • Z is IL-12B or a variant thereof
  • the linker (1) is a peptide linker
  • o may be O or 1.
  • IL-12 or a variant thereof may be a structure in which IL-12B or a variant thereof, a peptide linker, and IL-12A or a variant thereof are sequentially coupled from the N-terminus.
  • IL-12 or a variant thereof may be a structure in which IL-12A or a variant thereof, a peptide linker, and IL-12B or a variant thereof are sequentially coupled from the N-terminus.
  • IL-12A is the 35 kDa subunit (p35) of IL-12, which binds to the 40 kDa subunit (p40) of IL-12 via a disulfide bond to produce an active cytokine. .
  • the amino acid sequence of IL-12A is GenBank accession NO. AAK84425 (see GenBank accession No. AAA39292 for the amino acid sequence of mouse p35).
  • the IL-12A (p35) gene is GenBank accession No.
  • it may be a nucleotide sequence corresponding to a coding sequence (CDS) (for mouse sequences, see GenBank accession No. M86672).
  • a “variant” of IL-12A includes an amino acid sequence that is similar to or has the same function as the wild-type IL-12A protein. Specifically, it means that the amino acid sequence of IL-12A has a substitution, insertion or deletion compared to the wild type.
  • the IL-12A mutant may be a fragment of IL-12A, and may have an amino acid sequence in which amino acids 1 to 22 of SEQ ID NO: 122 are deleted. More specifically, the variant of IL-12A may have the amino acid sequence of SEQ ID NO: 75.
  • the IL-12A used in one embodiment of the present invention may be the amino acid sequence of SEQ ID NO: 75 as human IL-12A.
  • mouse IL-12A may be the amino acid sequence of SEQ ID NO: 87.
  • IL-12B is the 40 kDa subunit (p40) of IL-12, which binds to the 35 kDa subunit (p35) of IL-12 via a disulfide bond to form IL-12 and , and also forms IL-23 by binding to subunit p19 of IL-23. Meanwhile, IL-12B is also called natural killer cell stimulating factor 2.
  • IL-12B The amino acid sequence of "IL-12B” is GenBank accession No. AAD56386 (see GenBank accession No. AAA39296 for the amino acid sequence of mouse p40).
  • the IL-12B (p40) gene as a sequence encoding the IL-12B subunit is GenBank accession No. Among the sequences described in AF180563, it may be a nucleotide sequence corresponding to a coding sequence (CDS) (for a mouse sequence, see GenBank accession No.M86671).
  • IL-12B used in one embodiment of the present invention may be human IL-12B, and IL-12B may specifically be the amino acid sequence of SEQ ID NO: 74.
  • mouse IL-12B may have the amino acid sequence of SEQ ID NO: 86.
  • a “variant” of IL-12B includes an amino acid sequence that is similar to or has the same function as the wild-type IL-12B protein. Specifically, it means having a substitution, insertion or deletion from the wild-type amino acid sequence of IL-12B.
  • the IL-12B mutant may be one in which amino acids 1 to 22 of SEQ ID NO: 121 are deleted. More specifically, the IL-12B variant may be one in which 1 to 8 amino acids are substituted in the sequence of SEQ ID NO: 74. In addition, the IL-12B mutant may be one in which amino acids 1 to 22 of SEQ ID NO: 123 are deleted. More specifically, the IL-12B variant may be one in which up to 1 to 8 amino acids in the sequence of SEQ ID NO: 86 are substituted.
  • the variant of IL-12B (p40) may be one in which an amino acid involved in heparin binding of IL-12 is substituted.
  • the variant of IL-12B (p40) may be a form in which lysine (K) binding to heparin in IL-12B is substituted with another amino acid.
  • lysines at positions 258, 260, 263, and 264 of SEQ ID NO: 74 may be substituted with other amino acids.
  • the variant of IL-12B (p40) may include an amino acid sequence in which one or more substitutions are made in the amino acid sequence of SEQ ID NO: 74 selected from the group consisting of K258A, K260A, K263A and K264A.
  • the variant of IL-12B includes an amino acid sequence in which K258A and K263A are substituted in the amino acid sequence of SEQ ID NO: 74, or further includes K260A and/or K264A mutation in the amino acid sequence of SEQ ID NO: 74. it may be
  • the variant of IL-12B (p40) may be a form in which arginine (R) or lysine (K) binding to heparin in IL-12B is substituted with another amino acid.
  • arginine at 254 of SEQ ID NO: 86 and/or lysine at positions 255, 256, and 260 may be substituted with other amino acids.
  • the variant of IL-12B (p40) may include an amino acid sequence in which one or more substitutions are made in the amino acid sequence of SEQ ID NO: 86 selected from the group consisting of R254A, K255A, K256A and K260A. Specifically, it may include mutations of R254A, K255A, K256A and K260A in the amino acid sequence of SEQ ID NO: 86.
  • the mutant of IL-12B may include the amino acid sequence of SEQ ID NO: 77, SEQ ID NO: 79, SEQ ID NO: 89 or SEQ ID NO: 91.
  • the human IL-12B variant may consist of the following [Structural Formula A].
  • X 1 is the amino acid sequence of SEQ ID NO: 125,
  • X 2 is the amino acid sequence of SEQ ID NO: 126;
  • L is an amino acid sequence consisting of VA 1 -A 2 -QA 3 -K * -A 4 -A 5 -A 6 -A 7 -K * -A 8 .
  • a 1 is R or Q
  • a 2 is V
  • a or I is G or R
  • a 4 is S
  • N or K * is S
  • a 5 is K * , N or E
  • a 6 is R or K
  • a 7 is E, M or T
  • a 8 is K * or E.
  • One or more amino acid residues marked with “ * " may be substituted with non-polar amino acid residues selected from the group consisting of, but not limited to, A, G, I, L, M, F, P and V.
  • the variant of IL-12B includes substitution of an amino acid involved in heparin binding, thereby reducing the cytokine-related toxicity of IL-12 while maintaining the killing effect on cancer cells.
  • FAP and an antigen-binding site that specifically binds to FAP
  • Fibroblast activation protein refers to a fibroblast activation protein, which is a protein expressed on the cell surface and presented in the environment of tumor cells of various tumor types or tumor cells of various tumor types. It is known that FAP is selectively overexpressed on the surface of tumor-associated fibroblast (CAF) in the tumor microenvironment.
  • CAF tumor-associated fibroblast
  • FAP is a homodimer containing two N-glycosylated subunits with a C-terminal extracellular domain in which the enzyme catalytic domain is located, and the glycosylated form of FAP is a post-prolyl die. It has both peptidyl peptidase and gelatinase activity.
  • FAP is a prolyl endopeptidase, which is a membrane-bound gelatinase of about 170 kDa.
  • the Prolyl endopeptidase FAP can recognize and cleave a specific amino acid sequence. Accordingly, FAP is also named FAP ⁇ , seprase, or circulating antiplasmin-cleaving enzyme.
  • FAP The amino acid sequence of the FAP is GenBank accession No. AAC51668, human FAP was first identified in cultured fibroblasts through the use of the monoclonal antibody (mAb) F19 (see International Patent Application Publication No. WO 93/05804). FAP is expressed in many cancers and is utilized as a promising antigenic target for imaging, diagnosis and treatment of various carcinomas due to its limited expression in normal tissues.
  • the FAP includes any variant, isoform and species homolog of human FAP that is naturally expressed by cells or expressed on cells transfected with the FAP gene.
  • Antibodies of the present invention can bind to FAP present on the membrane or cell surface of cancer cells (tumor cells or cells of the tumor stroma) and can cause ADCC or other effector mediated death of cancer cells. It can also be used to block the enzymatic activity of FAP (eg, serine peptidase, gelatinase, collagenase activity), FAP-mediated ECM degradation, and FAP-mediated cell invasion or migration.
  • the term “specifically binds” refers to binding that is measurably different from non-specific interactions. Specific binding can be determined by competing with a control molecule similar to the target that has no binding activity.
  • Epitope refers to a determinant that interacts with a specific antigen binding site in the variable region of an antibody.
  • the antigen binding site is a group of molecules such as amino acids or sugar side chains and usually has specific structural characteristics as well as specific charge characteristics.
  • the antigen-binding site that specifically binds to FAP may be a generic term for molecules capable of antigen-antibody binding specifically to FAP.
  • the antibody or fragment thereof may be used in any form as long as it contains an antigen-binding domain capable of specifically binding to FAP.
  • the antigen-binding site may contain other amino acids not directly involved in binding, or amino acids whose effect is blocked by amino acid residues of the antigen-binding site.
  • the antigen-binding site may be an antibody or fragment thereof that specifically binds to FAP.
  • antibody refers to molecules that contain an antigen-binding site and immunologically active fragments of immunoglobulin molecules that contain an antigen-binding site.
  • the immunoglobulin molecule may be an immunoglobulin molecule of an IgG, IgE, IgM, IgD, IgA, IgY or subclass thereof.
  • Antibodies include synthetic antibodies, monoclonal antibodies, single domain antibodies, single chain antibodies, recombinantly produced antibodies, multispecific antibodies (including bispecific antibodies), human antibodies, humanized antibodies, chimeric antibodies, intrabodies ( intrabody), scFv (including eg monospecific and bispecific, etc.), Fab fragment, F(ab') fragment, disulfide-linked Fv (sdFv), anti-idiotypic (anti-Id) antibodies, and antigen-binding fragments of such antibodies.
  • antibody fragment may be a portion of an antibody, such as F(ab') 2 , F(ab) 2 , Fab', Fab, Fv, scFv. Regardless of structure, antibody fragments bind the same antigen recognized by an intact antibody.
  • the antigen binding site that specifically binds to the FAP is a heavy chain variable region comprising HCDR1 of SEQ ID NO: 96, HCDR2 of SEQ ID NO: 97, and HCDR3 of SEQ ID NO: 98; and a light chain variable region including LCDR1 of SEQ ID NO: 99, LCDR2 of SEQ ID NO: 100, and LCDR3 of SEQ ID NO: 101.
  • the antigen binding site that specifically binds to the FAP may have a heavy chain variable region of SEQ ID NO: 102 and a light chain variable region of SEQ ID NO: 103.
  • a heavy chain variable region comprising HCDR1 of SEQ ID NO: 104, HCDR2 of SEQ ID NO: 105, and HCDR3 of SEQ ID NO: 106; and a light chain variable region including LCDR1 of SEQ ID NO: 107, LCDR2 of SEQ ID NO: 108, and LCDR3 of SEQ ID NO: 109.
  • the antigen binding site that specifically binds to the FAP may have a heavy chain variable region of SEQ ID NO: 110 and a light chain variable region of SEQ ID NO: 111.
  • the antigen binding site that specifically binds to the FAP may be an scFv.
  • the scFv may include the above-described heavy chain and light chain CDRs.
  • the scFv specifically binding to the FAP it may have an amino acid sequence of SEQ ID NO: 72 or SEQ ID NO: 84.
  • the antigen binding site that specifically binds to FAP may include a known anti-FAP antibody or fragment thereof.
  • the anti-FAP antibody or fragment thereof may refer without limitation to antibodies known to those skilled in the art.
  • the anti-FAP antibody or fragment thereof is NG-641, AMG-506 / MP-0310, 28H1 of RG-7827, 4B9 of RG-7827, OMTX-705, 3F2, 4G8, 3D9, 4B3, 19G1, 20G8, 5B8 , 5F1, 14B3, 16F1, 16F8, O3C9, 29B11, may include one or more variable regions selected from the group consisting of O2D7 and 23C10.
  • the antibody is an anti-FAP disclosed in Korean Patent Publication KR 20200037826 A, US Patent Publication US 2020-0385488 A1, US Patent Registration US 3,924,445 B2, US Patent Registration US 9,011,847 B2 or US Patent Publication US 2017-007716 A1 Antibodies or fragments thereof may be used.
  • the anti-FAP antibody may include a variable region of NG-641.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 127, HCDR2 of SEQ ID NO: 128, and HCDR3 of SEQ ID NO: 129, and LCDR1 of SEQ ID NO: 130, LCDR2 of SEQ ID NO: 131, and LCDR3 of SEQ ID NO: 132. It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 248 and a light chain variable region of SEQ ID NO: 249.
  • the anti-FAP antibody may include a variable region of 28H1.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 133, HCDR2 of SEQ ID NO: 134, and HCDR3 of SEQ ID NO: 135, and LCDR1 of SEQ ID NO: 136, LCDR2 of SEQ ID NO: 137, and LCDR3 of SEQ ID NO: 138. It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 250 and a light chain variable region of SEQ ID NO: 251.
  • the anti-FAP antibody may include a variable region of 4B9.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 139, HCDR2 of SEQ ID NO: 140, and HCDR3 of SEQ ID NO: 141, and LCDR1 of SEQ ID NO: 142, LCDR2 of SEQ ID NO: 143, and LCDR3 of SEQ ID NO: 144. It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 252 and a light chain variable region of SEQ ID NO: 253.
  • the anti-FAP antibody may include a variable region of OMTX-705.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 145, HCDR2 of SEQ ID NO: 146, and HCDR3 of SEQ ID NO: 147, and LCDR1 of SEQ ID NO: 148, LCDR2 of SEQ ID NO: 149, and LCDR3 of SEQ ID NO: 150. It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 254 and a light chain variable region of SEQ ID NO: 255.
  • the anti-FAP antibody may include a variable region of 3F2.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 151, HCDR2 of SEQ ID NO: 152, and HCDR3 of SEQ ID NO: 153, and LCDR1 of SEQ ID NO: 154, LCDR2 of SEQ ID NO: 155, and LCDR3 of SEQ ID NO: 156 It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 256 and a light chain variable region of SEQ ID NO: 257.
  • the anti-FAP antibody may include a variable region of 4G8.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 157, HCDR2 of SEQ ID NO: 158, and HCDR3 of SEQ ID NO: 159, and LCDR1 of SEQ ID NO: 160, LCDR2 of SEQ ID NO: 161, and LCDR3 of SEQ ID NO: 162. It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 258 and a light chain variable region of SEQ ID NO: 259.
  • the anti-FAP antibody may include a variable region of 3D9.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 163, HCDR2 of SEQ ID NO: 164, and HCDR3 of SEQ ID NO: 165, and LCDR1 of SEQ ID NO: 166, LCDR2 of SEQ ID NO: 167, and LCDR3 of SEQ ID NO: 168. It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 260 and a light chain variable region of SEQ ID NO: 261.
  • the anti-FAP antibody may include a variable region of 4B3.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 169, HCDR2 of SEQ ID NO: 170, and HCDR3 of SEQ ID NO: 171, and LCDR1 of SEQ ID NO: 172, LCDR2 of SEQ ID NO: 173, and LCDR3 of SEQ ID NO: 174. It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 262 and a light chain variable region of SEQ ID NO: 263.
  • the anti-FAP antibody may include a variable region of 19G1.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 175, HCDR2 of SEQ ID NO: 176, and HCDR3 of SEQ ID NO: 177, and LCDR1 of SEQ ID NO: 178, LCDR2 of SEQ ID NO: 179, and LCDR3 of SEQ ID NO: 180. It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 264 and a light chain variable region of SEQ ID NO: 265.
  • the anti-FAP antibody may include a variable region of 20G8.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 181, HCDR2 of SEQ ID NO: 182, and HCDR3 of SEQ ID NO: 183, and LCDR1 of SEQ ID NO: 184, LCDR2 of SEQ ID NO: 185, and LCDR3 of SEQ ID NO: 186. It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 266 and a light chain variable region of SEQ ID NO: 267.
  • the anti-FAP antibody may include a variable region of 5B8.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 187, HCDR2 of SEQ ID NO: 188, and HCDR3 of SEQ ID NO: 189, and LCDR1 of SEQ ID NO: 190, LCDR2 of SEQ ID NO: 191, and LCDR3 of SEQ ID NO: 192. It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 268 and a light chain variable region of SEQ ID NO: 269.
  • the anti-FAP antibody may include a variable region of 5F1.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 193, HCDR2 of SEQ ID NO: 194, and HCDR3 of SEQ ID NO: 195, and LCDR1 of SEQ ID NO: 196, LCDR2 of SEQ ID NO: 197, and LCDR3 of SEQ ID NO: 198. It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 270 and a light chain variable region of SEQ ID NO: 271.
  • the anti-FAP antibody may include a variable region of 14B3.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 199, HCDR2 of SEQ ID NO: 200, and HCDR3 of SEQ ID NO: 201, and LCDR1 of SEQ ID NO: 202, LCDR2 of SEQ ID NO: 203, and LCDR3 of SEQ ID NO: 204 It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 272 and a light chain variable region of SEQ ID NO: 273.
  • the anti-FAP antibody may include a variable region of 16F1.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 205, HCDR2 of SEQ ID NO: 206, HCDR3 of SEQ ID NO: 207, and LCDR1 of SEQ ID NO: 208, LCDR2 of SEQ ID NO: 209, and LCDR3 of SEQ ID NO: 210 It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 274 and a light chain variable region of SEQ ID NO: 275.
  • the anti-FAP antibody may include a 16F8 variable region.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 211, HCDR2 of SEQ ID NO: 212, and HCDR3 of SEQ ID NO: 213, and LCDR1 of SEQ ID NO: 214, LCDR2 of SEQ ID NO: 215, and LCDR3 of SEQ ID NO: 216 It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 276 and a light chain variable region of SEQ ID NO: 277.
  • the anti-FAP antibody may include a variable region of O3C9.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 217, HCDR2 of SEQ ID NO: 218, and HCDR3 of SEQ ID NO: 219, and LCDR1 of SEQ ID NO: 220, LCDR2 of SEQ ID NO: 221, and LCDR3 of SEQ ID NO: 222 It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 278 and a light chain variable region of SEQ ID NO: 279.
  • the anti-FAP antibody may include a variable region of 22A3.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 223, HCDR2 of SEQ ID NO: 224, and HCDR3 of SEQ ID NO: 225, and LCDR1 of SEQ ID NO: 226, LCDR2 of SEQ ID NO: 227, and LCDR3 of SEQ ID NO: 228 It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 280 and a light chain variable region of SEQ ID NO: 281.
  • the anti-FAP antibody may include a variable region of 29B11.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 229, HCDR2 of SEQ ID NO: 230, and HCDR3 of SEQ ID NO: 231, and LCDR1 of SEQ ID NO: 232, LCDR2 of SEQ ID NO: 233, and LCDR3 of SEQ ID NO: 234 It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 282 and a light chain variable region of SEQ ID NO: 283.
  • the anti-FAP antibody may include a variable region of O2D7.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 235, HCDR2 of SEQ ID NO: 236, and HCDR3 of SEQ ID NO: 237, and LCDR1 of SEQ ID NO: 238, LCDR2 of SEQ ID NO: 239, and LCDR3 of SEQ ID NO: 240. It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 284 and a light chain variable region of SEQ ID NO: 285.
  • the anti-FAP antibody may include a variable region of 23C10.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 241, HCDR2 of SEQ ID NO: 242, and HCDR3 of SEQ ID NO: 243, and LCDR1 of SEQ ID NO: 244, LCDR2 of SEQ ID NO: 245, and LCDR3 of SEQ ID NO: 246 It may contain a light chain variable region.
  • the anti-FAP antibody may include a heavy chain variable region of SEQ ID NO: 286 and a light chain variable region of SEQ ID NO: 287.
  • the anti-FAP antibody may be AMG-506/MP-0310.
  • the antibody may include the amino acid sequence of SEQ ID NO: 247.
  • Any anti-FAP antibody may be used as long as it specifically binds to FAP present on cancer cells and induces the death of cancer cells.
  • the first monomer includes IL-12 or a variant thereof.
  • the first monomer may additionally include an antigen binding site that specifically binds to FAP.
  • the first monomer is IL-12 or a variant thereof; and an Fc region fragment or a variant thereof.
  • the first monomer may include an antigen binding site that specifically binds to IL-12 or a variant thereof, an Fc region fragment or variant thereof, and FAP.
  • the first monomer may include the following Structural Formula (III) or Structural Formula (IV).
  • N' is the N-terminus of the fusion protein
  • C' is the C-terminus of the fusion protein
  • X is the structural formula (I) or (II),
  • the T is an antigen binding site that specifically binds to FAP
  • the linker 2 and the linker 3 are peptide linkers, and p, q and r may each independently represent 0 or 1.
  • the first monomer when r is 0, may be in the form of a fusion protein in which IL-12 or a variant thereof and an Fc region fragment or variant thereof are connected by a peptide linker.
  • the first monomer includes the amino acid sequence of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 15, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, or SEQ ID NO: 32 it may be
  • the first monomer when r is 1 in Structural Formula (III), the first monomer may be a form in which an anti-FAP antibody monomer is bound to IL-12 or a variant thereof.
  • the first monomer is SEQ ID NO: 292, SEQ ID NO: 293, SEQ ID NO: 296, SEQ ID NO: 297, SEQ ID NO: 298, SEQ ID NO: 299, SEQ ID NO: 302 or SEQ ID NO: 303 It may contain the amino acid sequence of.
  • the first monomer may include the amino acid sequence of SEQ ID NO: 294, SEQ ID NO: 295, SEQ ID NO: 300 or SEQ ID NO: 301.
  • Structural Formula (III) may include the following Structural Formulas (III′) and (III′′).
  • T' is a heavy chain region of an antibody that specifically binds to FAP, including a variable region and a CH1 region, or a light chain region of an antibody;
  • T'' is a light chain region of an antibody that specifically binds to FAP, or a variable region and a CH1 region as a heavy chain region of an antibody;
  • T' and T'' combine to form a variable region of an antibody, and at this time, the variable region specifically binds to FAP;
  • the linkers (2) to (3) are peptide linkers, wherein p and q are each independently 0 or 1, and N', X and C' are as defined above.
  • Structural Formula (IV) may include the following Structural Formulas (IV′) and (IV′′).
  • T' is a heavy chain region of an antibody that specifically binds to FAP, including a variable region and a CH1 region, or a light chain region of an antibody;
  • T'' is a light chain region of an antibody that specifically binds to FAP, or a variable region and a CH1 region as a heavy chain region of an antibody;
  • T' and T'' combine to form a variable region of an antibody, and at this time, the variable region specifically binds to FAP;
  • the linkers (2) to (3) are peptide linkers, wherein p and q are each independently 0 or 1, and N', X and C' are as defined above.
  • the first monomer is SEQ ID NO: 10 and SEQ ID NO: 2; SEQ ID NO: 11 and SEQ ID NO: 2; SEQ ID NO: 27 and SEQ ID NO: 19; SEQ ID NO: 28 and SEQ ID NO: 19; SEQ ID NO: 294 and SEQ ID NO: 2; SEQ ID NO: 295 and SEQ ID NO: 2; SEQ ID NO: 300 and SEQ ID NO: 19; Or it may contain the amino acid sequences of SEQ ID NO: 301 and SEQ ID NO: 19.
  • the second monomer may further include an antigen binding site that specifically binds to FAP.
  • the second monomer is a first FAP binding site; And it may be one containing a second FAP binding site.
  • the antigen-binding site that specifically binds to the FAP may be Fab, scFv, Fv, or a fragment thereof.
  • the first FAP binding site may be Fab
  • the second FAP binding site may be Fv or scFv.
  • the second FAP binding site may bind to the N-terminus or C-terminus of the second monomer.
  • the second monomer may be additionally bound to the C-terminus of the heavy chain, the C-terminus of the light chain, and the C-terminus of the variable region.
  • the second monomer may include the following Structural Formula (V).
  • N' is the N-terminus of the fusion protein
  • C' is the C-terminus of the fusion protein
  • R and Q are antigen binding sites that specifically bind to FAP
  • W is an scFv that specifically binds to FAP; or IL-12 or a variant thereof of formula (I) or (II);
  • the linker 4, the linker 5, and the linker 6 are peptide linkers, respectively, and s, t, u, v, and a may each independently represent 0 or 1.
  • the structural formula (V) is SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 14, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 31, SEQ ID NO: 294, SEQ ID NO: 295, SEQ ID NO: 300, and SEQ ID NO: 301.
  • the Structural Formula (V) may include the following Structural Formulas (V′) and (V′′).
  • R' is a heavy chain region of an antibody that specifically binds to FAP, including a variable region and a CH1 region, or a light chain region of an antibody;
  • R'' is a light chain region of an antibody that specifically binds to FAP, or a variable region and a CH1 region as a heavy chain region of an antibody;
  • R' and R'' combine to form a variable region of an antibody, and at this time, the variable region specifically binds to FAP;
  • Q' is a heavy chain region of an antibody that specifically binds to FAP, including a variable region and a CH1 region, or a light chain region of an antibody;
  • Q'' is a light chain region of an antibody that specifically binds to FAP, or a variable region and a CH1 region as a heavy chain region of an antibody;
  • variable region specifically binds to FAP
  • W is an scFv that specifically binds to FAP; or IL-12 or a variant thereof of formula (I) or (II);
  • linker 4, linker 5, linker 6, and linker 7 are peptide linkers, respectively, and s, t, u, x, a, and b may each independently represent 0 or 1.
  • the structural formula (V') is SEQ ID NO: 1, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 14, SEQ ID NO: 18, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 31 SEQ ID NO: 294, SEQ ID NO: 295, SEQ ID NO: 300 or SEQ ID NO: 301.
  • the structural formula (V′′) may be SEQ ID NO: 2, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 19, SEQ ID NO: 24 or SEQ ID NO: 26.
  • the second monomer comprises a heavy chain consisting of the amino acid sequence of SEQ ID NO: 102 and a light chain consisting of the amino acid sequence of SEQ ID NO: 103; Alternatively, it may include a heavy chain consisting of the amino acid sequence of SEQ ID NO: 110 and a light chain consisting of the amino acid sequence of SEQ ID NO: 111.
  • the W when W is scFv, the W may have the amino acid sequence of SEQ ID NO: 72 or SEQ ID NO: 84.
  • peptide linker is a peptide used to establish a physical and chemical distance between domains in a fusion protein or to link them.
  • the linker may include a hinge region of an immunoglobulin.
  • the peptide linkers (1) to (7) refer to peptide linkers composed of amino acids.
  • the peptide linker (2) or the peptide linker (5) may consist of 5 to 80 consecutive amino acids, 7 to 70 consecutive amino acids, or 10 to 60 consecutive amino acids, or 12 to 50 amino acids there is.
  • the peptide linker may include (G S) n (where n is an integer from 1 to 10). In this case, n in (G4S)n may be 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, respectively.
  • the peptide linker (1) may be a peptide linker consisting of the amino acid sequence of SEQ ID NO: 93, SEQ ID NO: 94 or SEQ ID NO: 95.
  • the peptide linker (2) or peptide linker (5) may consist of 5 to 80 consecutive amino acids, 7 to 70 consecutive amino acids, or 10 to 60 consecutive amino acids, or 12 to 50 amino acids. In one embodiment, the peptide linker (2) may consist of 30 amino acids.
  • the peptide linker 2 may include at least one cysteine. Specifically, it may contain one, two or three cysteines.
  • the peptide linker 2 may be derived from an immunoglobulin hinge and may further include (G S)n (where n is an integer from 1 to 10).
  • the peptide linker (2) may include a hinge region consisting of any one of the amino acid sequences of SEQ ID NOs: 112, 113, 114, 115, 116, 117 and 119.
  • the peptide linker (3), the peptide linker (4), the peptide linker (6) and the peptide linker (7) are 1 to 30 consecutive amino acids, 5 to 20 consecutive amino acids, or 10 to 15 consecutive amino acids can be made with
  • the peptide linker may include (G S) n (where n is an integer from 1 to 10). In this case, n in (G4S)n may be 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, respectively.
  • the peptide linker (2), the peptide linker (3), or the peptide linker (5) may include SEQ ID NO: 93 or SEQ ID NO: 94.
  • the peptide linker (2) or the peptide linker (5) may be a peptide linker including the amino acid sequence of SEQ ID NO: 118 or 120.
  • the immunoglobulin fragment described above may be an Fc region of an immunoglobulin.
  • the Fc region of the immunoglobulin may be a wild-type Fc domain as well as an Fc domain variant.
  • the Fc region may be an Fc region of IgG, IgA, IgE, IgD or IgM, and specifically, may be derived from IgG1 or IgG2a.
  • Fc domain variant refers to a glycosylation pattern different from that of the wild-type Fc domain, increased sugar chains compared to the wild-type Fc domain, decreased sugar chains compared to the wild-type Fc domain, or deglycosylated sugar chains.
  • the Fc domain or variant may have sialic acid, fucosylation, and glycosylation of numbers adjusted through culture conditions or genetic manipulation of the host.
  • the sugar chain of the Fc domain of immunoglobulin can be modified by conventional methods such as chemical methods, enzymatic methods, and genetic engineering methods using microorganisms.
  • the Fc domain variant may be a mixed form of an immunoglobulin Fc region of IgG, IgA, IgE, IgD or IgM.
  • the Fc domain variant may be a form in which some amino acids of the Fc domain are substituted with other amino acids.
  • Amino acid introduced by the above substitution and/or addition is lysine (K), alanine (A), arginine (R), asparagine (N), aspartic acid (D), cysteine (C), glutamine (Q ), glutamic acid (E), glycine (G), histidine (H), isoleucine (I), leucine (L), methionine (M), phenylalanine (F), proline (P), serine (S), threonine (T ), it may be any one selected from the group consisting of tryptophan (W), tyrosine (Y) and valine (V).
  • the Fc region may include a knob structure or a hole structure.
  • the term "knob-into-hole” refers to antibodies that specifically bind to different regions, such as bispecific antibodies, multispecific antibodies, or heterodimeric antibodies. It is a design strategy for manufacturing.
  • the knob-into-hole is also referred to as a knob-in-hole.
  • this technique involves placing a knob on the interface of a first polypeptide (e.g., the first CH3 domain of a first antibody heavy chain) and a knob on the interface of a second polypeptide (e.g., the second CH3 domain of a second antibody heavy chain). This may include introducing a corresponding hole, such that a knob is positioned within the hole to promote heterodimer formation and hinder homodimer formation.
  • a 'knob' is constructed by replacing small amino acid side chains from the interface of the first polypeptide (eg the first CH3 domain of the first antibody heavy chain) with larger side chains (eg arginine, phenylalanine, tyrosine or tryptophan).
  • Complementary 'holes' of the same or similar size in the knob may be formed at the interface of the second polypeptide (eg, the second CH3 domain of the second antibody heavy chain) by replacing the large amino acid side chains with smaller side chains (eg, alanine, serine, valine, or threonine).
  • the knobs and holes can be created by altering the nucleic acid encoding the polypeptide, eg, by site-directed mutagenesis or by peptide synthesis.
  • the knob structure of the IgG1 may be SEQ ID NO: 13 or 288, and the hole structure may be SEQ ID NO: 12 or 289.
  • the knob structure or hole structure may have a form in which the 146th, 148th, and 187th amino acids are substituted with other amino acids.
  • the knob structure or the hole structure may have a form in which one or more selected from the group consisting of T146W, T146S, L148A, and Y187V is substituted.
  • the knob structure may be substituted with T146W, and the hole structure may be substituted with T146S, L148A, and Y187V.
  • the knob structure of IgG2a may be SEQ ID NO: 30 or 290, and the hole structure may be SEQ ID NO: 29 or 291.
  • the knob structure or hole structure may have a form in which the 152nd, 154th, and 193rd amino acids are substituted with other amino acids.
  • the knob structure or the hole structure may have a form in which one or more selected from the group consisting of T152W, T152S, M154A, and Y193V is substituted.
  • the Fc domain variant may include a DANG mutation or an NG mutation.
  • DANG mutation refers to the D265A/N297G mutation to abolish effector function in human IgG1 or mouse IgG2a.
  • Effector functions mediated by the Fc region in an IgG molecule include C1q binding, complement dependent cytotoxicity, Fc receptor binding, antibody dependent cell mediated cytotoxicity (ADCC), phagocytosis, cell surface receptors (e.g. B cell receptor, BCR) including control of the lowering of Such effector functions generally require linking an Fc region to a binding domain (eg, an antibody variable domain).
  • Substitution of the amino acid sequence of the non-mutated Fc region can change the effector function, and the Fc region with the effector function changed, for example, by modifying C1q binding and / or FcR binding, thereby changing CDC activity and / or ADCC activity can design That is, the 'DANG mutation' means that the effector function mediated by the Fc region is removed from the IgG molecule so that unwanted effector action does not occur during antibody production.
  • the DANG mutation may be a form in which amino acids in human IgG1 of SEQ ID NO: 289 are substituted with D45A/N77G.
  • amino acids in mouse IgG2a of SEQ ID NO: 291 may be substituted with D51A/N83G.
  • the fusion protein may be an antibody.
  • the antibody may be a heterodimeric antibody having a knob-in-hole structure.
  • the fusion protein has structural formula (III) and structural formula (V); Or it may be one containing structural formula (IV) and structural formula (V).
  • fusion protein is the first monomer of (i) or (ii); and a second monomer of (iii), (iv), (v) or (vi):
  • the fusion protein is a first monomer comprising (i); and a second monomer including (iii) above (first from the left in FIG. 35).
  • the fusion protein is selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, and SEQ ID NO: 22 It may contain one or more amino acid sequences.
  • the fusion protein is SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3; SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 4; SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 5; SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO: 20; SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO: 21; Or it may include SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO: 22.
  • the fusion protein is a first monomer comprising (i); and a second monomer including (iv) above (second from the left in FIG. 35).
  • the fusion protein comprises one or more amino acid sequences selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, and SEQ ID NO: 24 can Specifically, the fusion protein is SEQ ID NO: 3, SEQ ID NO: 6 and SEQ ID NO: 7; SEQ ID NO: 5, SEQ ID NO: 6 and SEQ ID NO: 7; SEQ ID NO: 20, SEQ ID NO: 23 and SEQ ID NO: 24; Or it may include SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 24.
  • the fusion protein is a first monomer comprising (i); and a second monomer including (v) above (third from the left in FIG. 35).
  • the fusion protein comprises one or more amino acid sequences selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 8, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, and SEQ ID NO: 25 can Specifically, the fusion protein is SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 8; SEQ ID NO: 2, SEQ ID NO: 5 and SEQ ID NO: 8; SEQ ID NO: 19, SEQ ID NO: 20 and SEQ ID NO: 25; Or it may include SEQ ID NO: 19, SEQ ID NO: 22 and SEQ ID NO: 25.
  • the fusion protein is a first monomer comprising (i); and a second monomer including (vi) above (fourth from the left in FIG. 35).
  • the fusion protein comprises one or more amino acid sequences selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 9, SEQ ID NO: 18, SEQ ID NO: 20, SEQ ID NO: 22, and SEQ ID NO: 26 can Specifically, the fusion protein is SEQ ID NO: 1, SEQ ID NO: 3 and SEQ ID NO: 9; SEQ ID NO: 1, SEQ ID NO: 5 and SEQ ID NO: 9; SEQ ID NO: 18, SEQ ID NO: 20 and SEQ ID NO: 26; Or it may include SEQ ID NO: 18, SEQ ID NO: 22 and SEQ ID NO: 26.
  • the fusion protein is a first monomer comprising (ii); and a second monomer including (iii) above (fifth from the left in FIG. 35).
  • the fusion protein comprises one or more amino acid sequences selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 27, and SEQ ID NO: 28 can Specifically, the fusion protein is SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 10; SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 11; SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO: 27; Or it may include SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO: 28.
  • the fusion protein dimer comprising an antigen-binding site that specifically binds to IL-12 or a variant thereof and FAP includes a monomer of structural formula (III) and a monomer of structural formula (V). It may be a fusion protein dimer that does (left side of FIG. 36).
  • r is 1, and in the structural formula (V), s, a, and t are 0.
  • the structural formula (V) may include (V') and (V'').
  • s, a, t, and b in (V') and (V'') are 0.
  • the Fc region of the dimer has a knob-in-hole structure, and different fusion proteins can be coupled to each other through this structure.
  • the fusion protein comprises at least one amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 292, SEQ ID NO: 293, SEQ ID NO: 298, and SEQ ID NO: 299
  • the fusion protein is SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 292; SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 293; SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO: 298; Or it may include SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO: 299.
  • the fusion protein dimer including an antigen-binding site that specifically binds to IL-12 or a variant thereof and FAP may be a fusion protein dimer including the structure of Structural Formula (V) above (center of FIG. 36).
  • the fusion protein dimer may include (V') and (V'').
  • Structural Formula (V) s and t are 0 and a is 1.
  • s, t, and b are 0, and a is 1.
  • the fusion protein dimer may be a fusion protein dimer including the structure of Structural Formula (IV). At this time, in Structural Formula (IV), r is 1.
  • the fusion protein may include one or more amino acid sequences selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 19, SEQ ID NO: 294, SEQ ID NO: 295, SEQ ID NO: 300, and SEQ ID NO: 301.
  • the fusion protein is SEQ ID NO: 2 and SEQ ID NO: 294; SEQ ID NO: 2 and SEQ ID NO: 295; SEQ ID NO: 19 and SEQ ID NO: 300 or SEQ ID NO: 19 and SEQ ID NO: 301.
  • the fusion protein dimer comprising an antigen binding site that specifically binds to IL-12 or a variant thereof and FAP may be a fusion protein dimer comprising the structure of Structural Formula (III) above (FIG. 36 right of).
  • r is 1.
  • the fusion protein may include SEQ ID NO: 296, SEQ ID NO: 297, SEQ ID NO: 302 or SEQ ID NO: 303.
  • the multispecific fusion proteins herein may be in chemically modified form.
  • the fusion protein is chemically modified by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization with known protecting/blocking groups, proteolytic cleavage, and/or binding to cellular ligands or other proteins. It can be. A number of these chemical transformations can be performed by known techniques.
  • Another aspect of the present invention provides a polynucleotide encoding the first monomer or a polynucleotide encoding the second monomer.
  • the polypeptide of the first monomer is SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 15, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, sequence SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 32, SEQ ID NO: 292, SEQ ID NO: 293, SEQ ID NO: 294, SEQ ID NO: 295, SEQ ID NO: 296, SEQ ID NO: 297, SEQ ID NO: 298, SEQ ID NO: 299, SEQ ID NO: 300, SEQ ID NO: 301 , at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89% with SEQ ID NO: 302, or SEQ ID NO: 303, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%,
  • the polynucleotide encoding the first monomer is SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 50, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 56 57, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 67 at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least At least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least It may have about 99% identity, or at least about 100% identity.
  • the polypeptide of the second monomer is SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 14, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 19 about 70%, at least about 75%, at least about 80%, at least At least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least amino acid sequences that have about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 100% identity.
  • the polynucleotide encoding the second monomer is SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 49, SEQ ID NO: 53, SEQ ID NO: 53 54, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 66, SEQ ID NO: 306 at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 86% , at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96% , at least about 97%, at least about 98%, at least about 99%, or at least about 100% identity.
  • the polynucleotide may additionally include a nucleic acid encoding a signal sequence or a leader sequence.
  • signal sequence refers to a signal peptide that directs the secretion of a target protein.
  • the signal peptide is cleaved after translation in the host cell.
  • the signal sequence is an amino acid sequence that initiates movement of a protein through an endoplasmic reticulum (ER) membrane.
  • the signal sequence is well known in the art, and usually includes 16 to 30 amino acid residues, but may include more or less amino acid residues.
  • a typical signal peptide consists of three regions: a basic N-terminal region, a central hydrophobic region, and a more polar C-terminal region.
  • the central hydrophobic region contains 4 to 12 hydrophobic residues that anchor the signal sequence throughout the membrane lipid bilayer during migration of the immature polypeptide.
  • the signal sequence is cleaved within the Lumen of the ER by cellular enzymes commonly known as signal peptidases.
  • the signal sequence may be a secretion signal sequence of tPa (Tissue Plasminogen Activation), HSV gDs (Signal sequence of Herpes simplex virus glycoprotein D), or growth hormone.
  • tPa tissue Plasminogen Activation
  • HSV gDs Synignal sequence of Herpes simplex virus glycoprotein D
  • growth hormone e.gDs
  • secretion signal sequences used in higher eukaryotic cells including mammals and the like can be used.
  • the signal sequence may be used by using a wild-type signal sequence or by substituting a codon with a high frequency of expression in the host cell.
  • a fusion protein comprising an antigen-binding site that specifically binds to IL-12 or a variant thereof and FAP of the present invention; And a composition for combined administration containing an anticancer agent as an active ingredient can treat or prevent cancer and/or increase its efficacy.
  • the present invention can provide the use of the fusion protein for treating cancer.
  • the use may be used for treating cancer in combination with the anticancer agent.
  • the present invention provides the use of the fusion protein for preparing a drug for treating cancer in combination with an anticancer drug.
  • the fusion protein and fusion protein dimer are as described above.
  • the cancer is gastric cancer, liver cancer, lung cancer, colon cancer, breast cancer, prostate cancer, skin cancer, bone cancer, multiple myeloma, glioma, ovarian cancer, pancreatic cancer, cervical cancer, thyroid cancer, laryngeal cancer, acute myelogenous leukemia, chronic myelogenous leukemia, acute It may be any one selected from the group consisting of lymphoblastic leukemia, chronic lymphoblastic leukemia, brain tumor, neuroblastoma, retinoblastoma, head and neck cancer, salivary gland cancer, and lymphoma.
  • a preferred dosage of the pharmaceutical composition varies depending on the condition and body weight of the patient, the severity of the disease, the type of drug, the route and duration of administration, but can be appropriately selected by those skilled in the art.
  • the active ingredient can be used in any amount (effective amount) according to the purpose of use, dosage form, combination, etc. It may be included, but a typical effective amount will be determined within the range of 0.001% to 20.0% by weight based on the total weight of the composition.
  • "effective amount” refers to an amount of an active ingredient capable of inducing a condition improvement or treatment effect of a disease, in particular, a condition improvement or treatment effect of cancer. Such an effective amount can be determined empirically within the ordinary skill of the skilled artisan.
  • the term “treatment” may be used to include both therapeutic treatment and prophylactic treatment. At this time, prevention may be used in the sense of alleviating or reducing the pathological condition or disease of the subject.
  • the term “treatment” includes any form of administration or application to treat a disease in a mammal, including humans. The term also includes inhibiting or slowing the progression of a disease; restoring or repairing a damaged or missing function, thereby partially or completely alleviating the disease; or stimulate inefficient processes; It includes the meaning of alleviating serious illness.
  • the term “efficacy” refers to survival or disease-free survival over a period of time, such as 1 year, 5 years, or 10 years, by one or more parameters, such as disease-free survival. can be determined Additionally, the parameter may include inhibition of the size of at least one tumor in the subject.
  • “enhanced efficacy” eg, improvement in efficacy
  • improved efficacy can be attributed to improved pharmacokinetic parameters and enhanced efficacy, and can be measured by comparing parameters such as clearance rate and tumor treatment or improvement in a test animal or human subject.
  • terapéuticaally effective amount or “pharmaceutically effective amount” is an amount of a compound or composition effective for preventing or treating a target disease, sufficient to treat the disease with a reasonable benefit / risk ratio applicable to medical treatment It means an amount that does not cause side effects.
  • the level of the effective amount is the patient's state of health, type of disease, severity, activity of the drug, sensitivity to the drug, method of administration, time of administration, route of administration and excretion rate, duration of treatment, factors including drugs used in combination or concurrently, and It may be determined according to other factors well known in the medical field.
  • a therapeutically effective amount refers to an amount of a drug effective to treat cancer.
  • the pharmaceutical composition may further include a pharmaceutically acceptable carrier.
  • the pharmaceutically acceptable carrier may be any carrier as long as it is a non-toxic material suitable for delivery to a patient. Distilled water, alcohol, fats, waxes and inert solids may be included as carriers. A pharmacologically acceptable adjuvant (buffer, dispersant) may also be included in the pharmaceutical composition.
  • the pharmaceutical composition may be prepared as a parenteral formulation according to an administration route by a conventional method known in the art, including a pharmaceutically acceptable carrier in addition to the active ingredient.
  • pharmaceutically acceptable means that it does not inhibit the activity of the active ingredient and does not have toxicity more than is adaptable to the subject of application (prescription).
  • the pharmaceutical composition When the pharmaceutical composition is prepared as a parenteral formulation, it may be formulated in the form of injection, transdermal administration, nasal inhalation, and suppository along with a suitable carrier according to a method known in the art.
  • a suitable carrier preferably Ringer's solution, PBS (phosphate buffered saline) containing triethanolamine or sterilization for injection water, isotonic solutions such as 5% dextrose, and the like can be used.
  • suitable carriers preferably Ringer's solution, PBS (phosphate buffered saline) containing triethanolamine or sterilization for injection water, isotonic solutions such as 5% dextrose, and the like can be used.
  • Formulation of pharmaceutical compositions is known in the art, and may be specifically referred to in Remington's Pharmaceutical Sciences (19th ed., 1995). These documents are considered as part of this specification.
  • the preferred dosage of the pharmaceutical composition is in the range of 0.01 ⁇ g/kg to 10 g/kg, or 0.01 mg/kg to 1 g/kg per day depending on the condition, weight, sex, age, severity of the patient, and route of administration of the patient. can be Administration can be done once a day or divided into several times. These dosages should not be construed as limiting the scope of the present invention in any respect.
  • Subjects to which the pharmaceutical composition can be applied are mammals and humans, particularly preferably humans.
  • the pharmaceutical composition of the present application may further include any compound or natural extract known to have a tumor treatment effect.
  • Combination treatment method including fusion protein and anticancer agent
  • Another aspect of the present invention is a first monomer comprising IL-12 or a variant thereof; and a fusion protein or dimer thereof comprising a second monomer comprising an antigen-binding site that specifically binds to FAP; And it provides a method for treating or preventing cancer comprising administering an anticancer agent to a subject.
  • the subject may be a subject suffering from cancer.
  • the subject may be a mammal, preferably a human.
  • the fusion protein or dimer thereof, and the anticancer agent are as described above.
  • the administration route, dosage and frequency of administration of the fusion protein or fusion protein dimer can be administered to the subject in various ways and amounts depending on the condition of the patient and the presence or absence of side effects, and the optimal administration method, dosage and frequency of administration are A person skilled in the art can select an appropriate range.
  • the fusion protein or fusion protein dimer is administered in combination with other drugs (eg, anticancer drugs) or physiologically active substances known to have therapeutic effects on the disease to be treated, or in the form of a combination preparation with other drugs. can be formulated.
  • PROTEIN Format Description corresponding sequence T1.01 K&H anti-hu FAP/hu IL-12, hu IgG1 DANG seq1, seq2, seq3 T1.02 K&H anti-hu FAP/hu IL-12 mut1, hu IgG1 DANG seq1, seq2, seq4 T1.03 K&H anti-hu FAP/hu IL-12 mut2, hu IgG1 DANG seq1, seq2, seq5 T1.04 K&H anti-hu FAP/hu IL-12, hu IgG1 DANG (2+1) seq3, seq6, seq7 T1.05 K&H anti-hu FAP/hu IL-12 mut2, hu IgG1 DANG (2+1) seq5, seq6, seq7 T1.06 K&H anti-hu FAP/hu IL-12, hu IgG1 DANG (2+1, HC scFv) seq2, seq3, seq8 T
  • [seq1] is composed of human IgG1 Fc with human anti-FAP heavy chain variable region sequence and effector function removed through DANG mutations (D265A, N297G) and knob structure formed by T366W mutation.
  • [seq2 ] consists of human anti-FAP light chain sequences.
  • [seq3] removes effector functions through human IL-12 p40 (beta) region sequence and linker GGGGSGGGGSGGGGS, human interleukin 12 p35 (alpha) region sequence, linker GGGGSGGGGS, and DANG mutations (D265A, N297G), T366S, L368A and It consists of human IgG1 Fc formed with a hole structure by Y407V mutation.
  • [seq4] is a sequence in which lysine (K) at amino acids 280 and 285 involved in heparin binding in the human IL-12 p40 (beta) region is mutated to alanine (A), linker GGGGSGGGGSGGGGS, human IL-12 p35 (alpha) It consists of the region sequence, linker GGGGSGGGGS and human IgG1 Fc hole DANG.
  • [seq5] is a sequence in which lysine (K) at amino acids 280, 282, 285, and 286 involved in heparin binding in the human IL-12 p40 (beta) region is mutated to alanine (A), linker GGGGSGGGGSGGGGS, human IL -12 p35 (alpha) region sequence, linker GGGGSGGGGS and human IgG1 Fc hole DANG.
  • [seq6] consists of a human anti-FAP heavy chain variable region sequence and linker GGGGSGGGGSGGGGS, a human anti-FAP heavy chain variable region sequence, and a human IgG1 Fc knob DANG.
  • [seq7] consists of a human anti-FAP light chain variable region sequence, a linker GGGGSGGGGSGGGGS, and a human anti-FAP light chain sequence.
  • [seq8] is a human anti-FAP (anti-FAP) heavy chain variable region sequence and human IgG1 Fc knob DANG, linker GGGGSGGGGSGGGGS, human anti-FAP (anti-FAP) heavy chain variable region sequence, linker GGGGSGGGGSGGGGSGGGGS and human anti-FAP (anti-FAP) -FAP) consists of light chain variable region sequences.
  • [seq9] consists of a human anti-FAP light chain sequence, a linker GGGGSGGGGSGGGGS, a human anti-FAP heavy chain variable region sequence, a linker GGGGSGGGGSGGGGSGGGGS, and a human anti-FAP light chain variable region sequence. It consists of
  • [seq10] is a human anti-FAP (anti-FAP) heavy chain sequence and human IgG1 Fc hole DANG, linker GGGGSGGGGSGGGGS, p40 (beta) region sequence of human IL-12, linker GGGGSGGGGSGGGGS and human IL-12 p35 (alpha) region sequence consists of
  • [seq11] is the p40 (beta) region of human IL-12, which contains human anti-FAP heavy chain sequence, human IgG1 Fc hole DANG, linker GGGGSGGGGSGGGGS, and amino acid mutations (4) involved in heparin binding. sequence, linker GGGGSGGGGSGGGGS and human IL-12 p35 (alpha) region sequence.
  • [seq12] consists only of human IgG1 Fc hole DANG.
  • [seq13] consists only of human IgG1 Fc knob DANG.
  • [seq14] consists of human anti-FAP heavy chain variable region sequence and human IgG1 Fc DANG.
  • [seq15] is the p40 (beta) region sequence of human IL-12 containing mutations (4) of amino acids involved in heparin binding, linker GGGGSGGGGSGGGGS, human IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS and human IgG1 It consists of Fc DANG.
  • [seq16] consists of the heavy chain sequence of human anti-CD20 (anti-CD20) antibody and human IgG1 Fc knob DANG.
  • [seq17] is the light chain sequence of human anti-CD20 (anti-CD20) antibody.
  • [seq292] is human IL-12 p40 (beta) region sequence and linker GGGGSGGGGSGGGGS, human IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS and human IgG1 Fc hole DANG, linker GGGGSGGGGSGGGGS, human anti-FAP It consists of a heavy chain variable region sequence, a linker GGGGSGGGGSGGGGSGGGGS and a human anti-FAP light chain variable region sequence.
  • [seq293] includes human IL-12 p40 (beta) region sequence and linker GGGGSGGGGSGGGGS, human IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS, and human IgG1 Fc hole containing amino acid mutations (4) involved in heparin binding DANG, linker GGGGSGGGGSGGGGS, human anti-FAP heavy chain variable region sequence, linker GGGGSGGGGSGGGGSGGGGS, and human anti-FAP light chain variable region sequence.
  • [seq294] consists of human anti-FAP heavy chain sequence, human IgG1 Fc DANG, linker GGGGSGGGGSGGGGS, p40 (beta) region sequence of human IL-12, linker GGGGSGGGGSGGGGS, and human IL-12 p35 (alpha) region sequence. It consists of
  • [seq295] is the p40 (beta) region sequence of human IL-12, including human anti-FAP heavy chain sequence, human IgG1 Fc DANG, linker GGGGSGGGGSGGGGS, and amino acid mutations (4) involved in heparin binding. , linker GGGGSGGGGSGGGGS and human IL-12 p35 (alpha) region sequence.
  • [seq296] is human IL-12 p40 (beta) region sequence and linker GGGGSGGGGSGGGGS, human IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS and human IgG1 Fc DANG, linker GGGGSGGGGSGGGGS, human anti-FAP heavy chain It consists of a variable region sequence, a linker GGGGSGGGGSGGGGSGGGGS and a human anti-FAP light chain variable region sequence.
  • [seq297] is a human IL-12 p40 (beta) region sequence containing amino acid mutations (4) involved in heparin binding, linker GGGGSGGGGSGGGGS, human IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS, and human IgG1 Fc DANG , linker GGGGSGGGGSGGGGS, human anti-FAP heavy chain variable region sequence, linker GGGGSGGGGSGGGGSGGGGS, and human anti-FAP light chain variable region sequence.
  • T1.01 (seq1, seq2, seq3) is a double antibody in which a human anti-FAP sequence targeting the protein FAP and a human IL-12 sequence form a knob-in-hole structure and effector functions are removed.
  • T1.02 (seq1, seq2, seq4) is a knob-in-hole structure in which the human anti-FAP sequence targeting the protein FAP and the human IL-12 sequence containing mutations (2) of amino acids involved in heparin binding are present. It is a bispecific antibody with effector functions removed.
  • T1.03 (seq1, seq2, seq5) is a knob-in-hole structure in which the human anti-FAP sequence targeting the protein FAP and the human IL-12 sequence containing mutations (4) of amino acids involved in heparin binding are present. It is a bispecific antibody with effector functions removed.
  • T1.04 (seq3, seq6, seq7) is a dual variable domain immunoglobulin (dual variable domain Immunoglobulin, DVD-Ig) form of human anti-FAP sequence and human IL-12 sequence form a knob-in-hole structure, and the effector It is a bispecific antibody with the function removed.
  • T1.05 (seq5, seq6, seq7) contains a human anti-FAP sequence in the form of dual variable domain Immunoglobulin (DVD-Ig) and human amino acid mutations (4) involved in heparin binding. It is a double antibody in which the IL-12 sequence forms a knob-in-hole structure and effector functions are removed.
  • T1.06 (seq2, seq3, seq8) is a single chain variable region fragment (single chain fragment variable, scFv) of the human anti-FAP sequence targeting the protein FAP linked to the C-terminus of the heavy chain, and human anti-FAP sequence and human It is a double antibody in which the IL-12 sequence forms a knob-in-hole structure and effector functions are removed.
  • T1.07 (seq2, seq5, seq8) is a single chain variable region fragment (single chain fragment variable, scFv) of a human anti-FAP sequence targeting the protein FAP linked to the C-terminus of the heavy chain and a human anti-FAP sequence and heparin It is a double antibody in which the human IL-12 sequence containing mutations (4) of amino acids involved in binding forms a knob-in-hole structure and the effector function is removed.
  • T1.08 (seq1, seq3, seq9) is a human anti-FAP sequence in which a single chain fragment variable (scFv) of a human anti-FAP sequence targeting the protein FAP is linked to the C-terminus of the light chain and a human anti-FAP sequence. It is a double antibody in which the IL-12 sequence forms a knob-in-hole structure and effector functions are removed.
  • scFv single chain fragment variable
  • T1.09 (seq1, seq5, seq9) is a single chain variable region fragment (single chain fragment variable, scFv) of a human anti-FAP sequence targeting the protein FAP linked to the C-terminus of the light chain and a human anti-FAP sequence and heparin
  • the human IL-12 sequence containing mutations (4) of amino acids involved in binding forms a knob-in-hole structure and is a bispecific antibody with effector functions removed.
  • T1.10 (seq1, seq2, seq10) is an antibody comprising a human FAP sequence targeting the protein FAP and a human anti-FAP sequence in which a human IL-12 sequence is linked to the C-terminus of the heavy chain in a knob-in-hole structure.
  • T1.11 (seq1, seq2, seq11) is a human antibody sequence in which a human FAP sequence targeting the protein FAP is linked to a human IL-12 sequence containing mutations (4) of amino acids involved in heparin binding at the C-terminus of the heavy chain. -An antibody in which the FAP sequence forms a knob-in-hole structure.
  • T1.12 (seq1, seq2, seq12) is an antibody that has only a human anti-FAP sequence targeting the protein FAP and has no effector function of the knob-in-hole structure.
  • T1.13 (seq3, seq13) is an antibody with only the human IL-12 sequence and the effector function of the knob-in-hole structure removed.
  • T1.14 (seq4, seq13) is an antibody with only the human IL-12 sequence containing mutations (2) of amino acids involved in heparin binding, with a knob-in-hole structure and effector functions removed.
  • T1.15 (seq5, seq13) is an antibody with only the human IL-12 sequence containing mutations (4) of amino acids involved in heparin binding, with a knob-in-hole structure and effector function removed.
  • T1.16 (seq2, seq14) is a human anti-FAP antibody targeting the protein FAP.
  • T1.17 (seq15) is an Fc-fusion protein containing only the human IL-12 sequence containing mutations (4) of amino acids involved in heparin binding.
  • T1.18 (seq3, seq16, seq17) is a double antibody in which a human anti-CD20 sequence targeting protein CD20 and a human IL-12 sequence form a knob-in-hole structure and effector functions are removed.
  • T1.19 is a knob-in-hole structure in which the human anti-CD20 sequence targeting the protein CD20 and the human IL-12 sequence containing two amino acid mutations involved in heparin binding It is a bispecific antibody with effector functions removed.
  • T1.20 (seq5, seq16, seq17) is a knob-in-hole structure in which the human anti-CD20 sequence targeting the protein CD20 and the human IL-12 sequence containing mutations (4) of amino acids involved in heparin binding It is a bispecific antibody with effector functions removed.
  • T1.21 (seq12, seq16, seq17) is an antibody with only a human anti-CD20 sequence targeting protein CD20 and having a knock-in-hole structure with no effector function.
  • T1.23 (seq1, seq2, seq292) is a human anti-FAP sequence and a human IL-12 sequence linked to a single chain fragment variable (scFv) of the human anti-FAP sequence at the C-terminus.
  • -It is a bispecific antibody that has a hole structure and has no effector function.
  • T1.24 (seq1, seq2, seq293) is a sequence of amino acids involved in heparin binding with a human anti-FAP heavy chain sequence and a single chain fragment variable (scFv) of the human anti-FAP sequence linked to the C-terminus. It is a double antibody in which the human IL-12 sequence containing mutations (4) forms a knob-in-hole structure and the effector function is removed.
  • T1.25 (seq2, seq294) is an Fc-fusion protein dimer containing a human anti-FAP sequence linked to a human IL-12 sequence at the C-terminus of the heavy chain.
  • T1.26 (seq2, seq295) is an Fc-fusion protein dimer containing a human anti-FAP sequence linked to a human IL-12 sequence containing mutations (4) of amino acids involved in heparin binding at the C-terminus of the heavy chain.
  • T1.27 (seq296) is an Fc-fusion protein dimer composed of human IL-12 sequence linked to a single chain fragment variable (scFv) of human anti-FAP sequence at the C-terminus.
  • T1.28 (seq297) is human IL-12 containing mutations (4) of amino acids involved in heparin binding with a single chain fragment variable (scFv) of human anti-FAP sequence linked to the C-terminus. It is an Fc-fusion protein dimer composed of sequences.
  • [seq18] consists of mouse anti-FAP (anti-FAP) heavy chain variable region sequence and mouse IgG2a Fc in which effector functions are removed through DANG mutations (D265A, N297G) and a knob structure is formed with T321W mutation.
  • [seq19 ] consists of a mouse anti-FAP light chain sequence.
  • [seq20] removes the effector function through mutation of mouse IL-12 p40 (beta) region sequence, linker GGGGSGGGGSGGGGS, mouse IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS, and DANG (D265A, N297G) mutations, T321S, M323A , composed of mouse IgG2a Fc formed with a hole structure by Y362V mutation.
  • [seq21] is a sequence in which lysine (K) at amino acids 277 and 282 involved in heparin binding in the mouse IL-12 p40 (beta) region is mutated to alanine (A), linker GGGGSGGGGSGGGGS, and mouse IL-12 p35 (alpha) It consists of the region sequence, linker GGGGSGGGGS and mouse IgG2a Fc hole DANG.
  • [seq22] converts arginine (R) at amino acid position 276 involved in heparin binding in the mouse IL-12 p40 (beta) region to alanine (A), and lysine (K) at positions 277, 278, and 282 to alanine (A). ), linker GGGGSGGGGSGGGGS, mouse IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS, and mouse IgG2a Fc hole DANG.
  • [seq23] consists of a mouse anti-FAP heavy chain variable region sequence and linker GGGGSGGGGSGGGGS, a mouse anti-FAP heavy chain variable region sequence and a mouse IgG2a Fc knob DANG.
  • [seq24] consists of a mouse anti-FAP light chain variable region sequence, a linker GGGGSGGGGSGGGGS, and a mouse anti-FAP light chain sequence.
  • [seq25] is a mouse anti-FAP (anti-FAP) heavy chain variable region sequence and mouse IgG2a Fc knob DANG, linker GGGGSGGGGSGGGGS, mouse anti-FAP (anti-FAP) heavy chain variable region sequence, linker GGGGSGGGGSGGGGSGGGGS and mouse anti-FAP (anti-FAP) -FAP) consists of light chain variable region sequences.
  • [seq26] is a mouse anti-FAP light chain sequence, a linker GGGGSGGGGSGGGGS, a mouse anti-FAP heavy chain variable region sequence, a linker GGGGSGGGGSGGGGSGGGGS, and a mouse anti-FAP light chain variable region sequence. It consists of
  • [seq27] is the mouse anti-FAP (anti-FAP) heavy chain sequence, mouse IgG2a Fc hole DANG, linker GGGGSGGGGSGGGGS, p40 (beta) region sequence of mouse IL-12, linker GGGGSGGGGSGGGGS and mouse IL-12 p35 (alpha) region sequence consists of
  • [seq28] is the p40 (beta) region of mouse IL-12, which contains mouse anti-FAP heavy chain sequence, mouse IgG2a Fc hole DANG, linker GGGGSGGGGSGGGGS, and amino acid mutations (4) involved in heparin binding. sequence, linker GGGGSGGGGSGGGGS and mouse IL-12 p35 (alpha) region sequence.
  • [seq29] consists only of mouse IgG2a Fc hole DANG.
  • [seq30] consists only of mouse IgG2a Fc knob DANG.
  • [seq31] consists of mouse anti-FAP heavy chain variable region and mouse IgG2a Fc DANG.
  • [seq32] is the p40 (beta) region sequence of mouse IL-12 containing mutations (4) of amino acids involved in heparin binding, linker GGGGSGGGGSGGGGS, mouse IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS, and mouse IgG2a It consists of Fc DANG.
  • [seq33] consists of the heavy chain variable region sequence of mouse anti-CD20 (anti-CD20) antibody 18B12 and mouse IgG2a knob DANG.
  • [seq34] consists of the light chain sequence of mouse anti-CD20 (anti-CD20) antibody 18B12.
  • [seq35] consists only of mouse IgG2a Fc DANG.
  • [seq298] is the mouse IL-12 p40 (beta) region sequence and linker GGGGSGGGGSGGGGS, mouse IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS and mouse IgG2a Fc hole DANG, linker GGGGSGGGGSGGGGS, mouse anti-FAP It consists of a heavy chain variable region sequence, a linker GGGGSGGGGSGGGGSGGGGS, and a mouse anti-FAP light chain variable region sequence.
  • [seq299] is a mouse IL-12 p40 (beta) region sequence containing amino acid mutations (4) involved in heparin binding, linker GGGGSGGGGSGGGGS, mouse IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS, and mouse IgG2a Fc hole DANG, linker GGGGSGGGGSGGGGS, mouse anti-FAP heavy chain variable region sequence, linker GGGGSGGGGSGGGGSGGGGS, and mouse anti-FAP light chain variable region sequence.
  • [seq300] is the mouse anti-FAP (anti-FAP) heavy chain sequence, mouse IgG2a Fc DANG, linker GGGGSGGGGSGGGGS, p40 (beta) region sequence of mouse IL-12, linker GGGGSGGGGSGGGGS and mouse IL-12 p35 (alpha) region sequence. It consists of
  • [seq301] is the p40 (beta) region sequence of mouse IL-12, which includes mouse anti-FAP heavy chain sequence, mouse IgG1 Fc DANG, linker GGGGSGGGGSGGGGS, and amino acid mutations (4) involved in heparin binding. , linker GGGGSGGGGSGGGGS and mouse IL-12 p35 (alpha) region sequence.
  • [seq302] is the mouse IL-12 p40 (beta) region sequence and linker GGGGSGGGGSGGGGS, mouse IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS and mouse IgG2a Fc DANG, linker GGGGSGGGGSGGGGS, mouse anti-FAP heavy chain It consists of a variable region sequence, a linker GGGGSGGGGSGGGGSGGGGS, and a mouse anti-FAP light chain variable region sequence.
  • [seq303] is a mouse IL-12 p40 (beta) region sequence containing amino acid mutations (4) involved in heparin binding, linker GGGGSGGGGSGGGGS, mouse IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS, and mouse IgG2a Fc DANG , linker GGGGSGGGGSGGGGS, mouse anti-FAP heavy chain variable region sequence, linker GGGGSGGGGSGGGGSGGGGS, and mouse anti-FAP light chain variable region sequence.
  • T1.01m (seq18, seq19, seq20) is a double antibody in which a mouse anti-FAP sequence targeting the protein FAP and a mouse IL-12 sequence form a knob-in-hole structure and effector functions are removed.
  • T1.02m (seq18, seq19, seq21) is a mouse anti-FAP sequence targeting protein FAP and mouse IL-12 sequence containing mutations (2) of amino acids involved in heparin binding. It is a bispecific antibody with effector functions removed.
  • T1.03m (seq18, seq19, seq22) is a mouse anti-FAP sequence targeting protein FAP and mouse IL-12 sequence containing mutations (4) of amino acids involved in heparin binding. It is a bispecific antibody with effector functions removed.
  • T1.04m (seq20, seq23, seq24) is a dual variable domain immunoglobulin (dual variable domain Immunoglobulin (DVD-Ig) type protein FAP targeting mouse anti-FAP sequence and mouse IL-12 sequence are knob-in- It is a bispecific antibody with a hole structure and effector functions removed.
  • DVD-Ig dual variable domain Immunoglobulin type protein FAP targeting mouse anti-FAP sequence and mouse IL-12 sequence are knob-in- It is a bispecific antibody with a hole structure and effector functions removed.
  • T1.05m (seq22, seq23, seq24) is a mouse anti-FAP sequence targeting the protein FAP in the form of dual variable domain Immunoglobulin (DVD-Ig) and mutations in amino acids involved in heparin binding (4 It is a double antibody in which the mouse IL-12 sequence containing the dog) forms a knob-in-hole structure and the effector function is removed.
  • DVD-Ig dual variable domain Immunoglobulin
  • T1.06m (seq19, seq20, seq25) is a mouse anti-FAP sequence containing a single chain fragment variable (scFv) of a mouse anti-FAP sequence targeting the protein FAP at the C-terminus of the heavy chain. It is a double antibody in which the mouse IL-12 sequence forms a knob-in-hole structure and the effector function is removed.
  • T1.07m (seq19, seq22, seq25) is a mouse anti-FAP sequence containing a single chain fragment variable (scFv) of a mouse anti-FAP sequence targeting the protein FAP at the C-terminus of the heavy chain. It is a bispecific antibody in which the mouse IL-12 sequence containing mutations (4) of amino acids involved in heparin binding form a knob-in-hole structure and effector functions are removed.
  • T1.08m (seq18, seq20, seq26) is a mouse anti-FAP sequence containing a single chain fragment variable (scFv) of a mouse anti-FAP sequence targeting the protein FAP at the C-terminus of the light chain. It is a double antibody in which the mouse IL-12 sequence forms a knob-in-hole structure and the effector function is removed.
  • T1.09m (seq18, seq22, seq26) is a mouse anti-FAP sequence containing a single chain fragment variable (scFv) of a mouse anti-FAP sequence targeting the protein FAP at the C-terminus of the light chain. It is a bispecific antibody in which the mouse IL-12 sequence containing mutations (4) of amino acids involved in heparin binding form a knob-in-hole structure and effector functions are removed.
  • T1.10m (seq18, seq19, seq27) is an antibody comprising a mouse anti-FAP sequence targeting the protein FAP and a mouse anti-FAP sequence linked to the C-terminus of the heavy chain with a mouse IL-12 sequence in a knob-in-hole structure.
  • T1.11m (seq18, seq19, seq28) is a mouse anti-FAP sequence targeting the protein FAP and a mouse IL-12 sequence containing mutations (4) of amino acids involved in heparin binding at the C-terminus of the heavy chain are linked. It is an antibody in which the mouse anti-FAP sequence constitutes a knob-in-hole structure.
  • T1.12m (seq18, seq19, seq29) is an antibody with only a mouse anti-FAP sequence targeting the protein FAP, and the effector function of the knob-in-hole structure is removed.
  • T1.13m (seq20, seq30) is an antibody with only the mouse IL-12 sequence and the effector function of the knob-in-hole structure removed.
  • T1.14m (seq21, seq30) is an antibody with only the mouse IL-12 sequence containing mutations (two) of amino acids involved in heparin binding, and the effector function of the knob-in-hole structure is removed.
  • T1.15m (seq22, seq30) is an antibody having only the mouse IL-12 sequence containing mutations (4) of amino acids involved in heparin binding, and having a knob-in-hole structure with no effector function.
  • T1.16m (seq19, seq31) is a mouse anti-FAP antibody targeting the protein FAP.
  • T1.17m (seq32) is an Fc-fusion protein containing only the mouse IL-12 sequence containing mutations (4) of amino acids involved in heparin binding.
  • T1.18m (seq20, seq33, seq34) is a double antibody in which a mouse anti-CD20 (18B12) sequence targeting protein CD20 and a mouse IL-12 sequence form a knob-in-hole structure and effector functions are removed.
  • T1.19m is a mouse anti-CD20 (18B12) sequence targeting the protein CD20 and a mouse IL-12 sequence containing mutations (two) of amino acids involved in heparin binding.
  • -It is a bispecific antibody that has a hole structure and has no effector function.
  • T1.20m (seq22, seq33, seq34) is a knob-in-hole structure in which mouse anti-CD20 sequences targeting protein CD20 and mouse IL-12 sequences containing mutations (4) of amino acids involved in heparin binding are present. It is a bispecific antibody with effector functions removed.
  • T1.21m (seq29, seq33, seq34) is an antibody that has only a mouse anti-CD20 sequence targeting the protein CD20 and has a knock-in-hole structure with no effector function.
  • T1.22m (seq35) is a protein with only a mouse Fc sequence and no effector function.
  • T1.23m (seq18, seq19, seq298) is a knob-in mouse IL-12 sequence in which a mouse anti-FAP sequence and a single chain fragment variable (scFv) of the mouse anti-FAP sequence are linked to the C-terminus.
  • -It is a bispecific antibody that has a hole structure and has no effector function.
  • T1.24m (seq18, seq19, seq299) is a sequence of amino acids involved in heparin binding with mouse anti-FAP heavy chain sequence and a single chain fragment variable (scFv) of mouse anti-FAP sequence linked to the C-terminus. It is a bispecific antibody in which the mouse IL-12 sequence containing mutations (4) forms a knob-in-hole structure and the effector function is removed.
  • T1.25m (seq19, seq300) is an Fc-fusion protein dimer containing a mouse anti-FAP sequence linked to a mouse IL-12 sequence at the C-terminus of the heavy chain.
  • T1.26m (seq19, seq301) is an Fc-fusion protein dimer containing a mouse anti-FAP sequence linked to a mouse IL-12 sequence containing mutations (4) of amino acids involved in heparin binding at the C-terminus of the heavy chain.
  • T1.27m (seq302) is an Fc-fusion protein dimer composed of a mouse IL-12 sequence linked to a single chain fragment variable (scFv) of mouse anti-FAP sequence at the C-terminus.
  • T1.28m (seq303) is mouse IL-12 containing mutations (4) of amino acids involved in heparin binding with a single chain fragment variable (scFv) of mouse anti-FAP sequence linked to the C-terminus. It is an Fc-fusion protein dimer composed of sequences.
  • the DNA fragment synthesized by PCR was amplified, and the PCR product was purified using a gel. After cutting the pTT5 vector with restriction enzymes EcoRI and BamHI, the gel was purified. Each PCR product and the linear vector were ligated using an In-Fusion kit. The resulting vector was transformed into ECOS101 DH5 ⁇ competent cells and cultured on 2xYT agar plates containing 100 ⁇ g/ml ampicillin. All manipulations were performed according to standard transformation protocols. Positive recombinants were confirmed by colony PCR, and sequence-verify sequencing was performed on the recombinant plasmid. A single colony was picked and seeded in 5 ml 2xYT medium containing 100 ⁇ g/ml ampicillin.
  • a homogeneous suspension of the precipitate was prepared by inverting the lysate tube 3 times to prevent clogging of the filter. Then, the NucleoBond® Xtra column filter and the NucleoBond® Xtra column were washed with 10 ml of filter washing solution FIL-EF. The NucleoBond® Xtra column filter was removed or the column was turned upside down to remove. The NucleoBond® Xtra column was washed with 90 ml of wash solution ENDO.
  • the NucleoBond® Xtra column was washed with 45 ml of wash solution WASH-EF. Plasmid DNA was eluted with 15 ml of elution solution ELU. Eluates were collected in 50 ml centrifuge tubes. The eluted plasmid DNA was precipitated by adding 10.5 ml of room temperature isopropanol. After vortexing, the mixture was allowed to stand for 2 minutes.
  • 293F seed strain containing Complete medium was maintained in an incubator shaker at 130 rpm, 37°C and 8% CO 2 . It was cultured at a density of 0.3 to 0.4 x 10 6 cell/ml, and the medium was exchanged every 2 to 3 days. 24 hours before transfection, fresh passages of 293F cells were prepared at 2.6 x 10 6 cells/ml. The prepared cells were cultured in an incubator shaker at 130 rpm, 37°C and 8% CO 2 . On the day of transfection, cells were adjusted to a density of 5.0 x 10 6 cells/ml using fresh medium. A total volume of 1 L was performed in a 3 L shaker flask.
  • 0.4 mg HC and 0.6 mg LC plasmids were diluted in 50 ml OPTI MEM I and filtered through a 0.22 ⁇ m filter. Thereafter, 2 mg PEI was diluted with 50 ml OPTI MEM I to prepare a transfection reagent. The diluted PEI was added to the DNA mixture and mixed immediately. Then, it was incubated at room temperature for 15 minutes. The DNA-PEI mixture was added to 293F cells prepared at 2.6 x 10 6 cells/ml. Thereafter, the cells were continuously cultured for 24 hours in an incubator shaker at 130 rpm, 37°C and 8% CO 2 . 24 hours after transfection, 10% peptone was added to 1/20 of the culture so that the final concentration was 0.5%.
  • the cells were continuously cultured in an incubator shaker at 130 rpm, 37°C and 8% CO 2 .
  • Cell density/viability was measured and recorded daily for a period of 2 to 5 days after transfection.
  • Cells were harvested for purification 7 days after transfection or when cell viability was less than 70%.
  • Protein was purified using a Mabselect sure column. Specifically, the supernatant was harvested by centrifugation at 2,000xg and 4° C. for 20 minutes. Then, the supernatant was filtered through a Sartopore 2 filter. The clarified supernatant was loaded onto a 5 mL MabSelect Sure column equilibrated with Solution A. Then, the column was washed with solution A until the A280 absorbance reached the standard value. The column was washed with 10 CV solution B. The column was washed with 10 CV solution A. The bound protein was eluted with 6 CV solution C, and the eluted material was neutralized by adding 1/6 volume of solution D. SDS-PAGE and SEC-HPLC analysis were performed.
  • the protein was purified using an HIC column.
  • the protein was then dialyzed against solution E overnight at 4°C.
  • the supernatant was loaded onto a HIC column equilibrated with Solution E.
  • the column was washed with solution E until the A280 absorbance reached the standard value.
  • Bound proteins were eluted by gradient elution (10 CV solution F 0%-40%). Bound proteins were eluted with 2 CV 100% solution F. SDS-PAGE analysis was performed.
  • the proteins were purified and the proteins were pooled, the proteins were dialyzed against the final solution overnight at 4°C. Then, SDS-PAGE and SEC-HPLC analysis were performed.
  • Table 9 below shows changes in human anti-FAP/IL-12 double antibody production according to human IL-12 mutations.
  • Parentheses mean the production scale of the protein, and the unit is L.
  • the number in front of parentheses is the yield per 1L obtained by dividing the amount of protein by the production scale.
  • PROTEIN Description Amount of protein (mg) after going through the Protein A column (production scale, L) T1.01 anti-hu FAP/hu IL-12, hu IgG1 DANG 40 (1), 132 (1) T1.02 anti-hu FAP/hu IL-12 mut1, hu IgG1 DANG 45 (1), 139.7 (2) T1.03 anti-hu FAP/hu IL-12 mut2, hu IgG1 DANG 250 (1), 220 (5)
  • Table 10 shows changes in mouse anti-FAP/IL-12 double antibody production according to mouse IL-12 mutations.
  • HEK-Blue IL-12 cell line which was transfected with the IL-12 receptor gene and the STAT4-inducible SEAP reporter gene in HEK293 cells, which are human embryonic kidney fibroblast cells, was supplied from Invivogen (San Diego, USA) and used. did HEK-Blue IL-12 cells were maintained in DMEM (GIBCO) containing 10% FBS (GIBCO), 100 ⁇ g/ml Normocin and 1 ⁇ HEK-Blue selection.
  • Human embryonic kidney fibroblast cell line HEK293, mouse colon cancer cell line CT26-WT, mouse melanoma cell line B16F10, and mouse fibroblast NIH-3T3 cell line were supplied from ATCC (American Type Culture Collection, Manassas, VA, USA) and used.
  • HEK293 cells, B16F10 cells and NIH-3T3 cells were maintained in DMEM (GIBCO) containing 10% FBS (GIBCO).
  • a cell line (HEK293-hFAP) in which human FAP (Fibroblast activation protein alpha) was overexpressed in HEK293 cells was prepared using a lentivirus capable of delivering the human FAP gene.
  • HEK293-hFAP cells were maintained in DMEM (GIBCO) containing 10% FBS (GIBCO) and 5 ⁇ g/ml puromycin.
  • CT26-mFAP The cell lines (CT26-mFAP, B16F10-mFAP, and NIH-3T3-mFAP) overexpressing mouse FAP (Fibroblast activation protein alpha) in CT26-WT cells, B16F10 and NIH-3T3 cells are capable of transmitting the mouse FAP gene.
  • lentivirus was used.
  • CT26-mFAP cells were maintained in RPMI-1640 (GIBCO) containing 10% FBS (GIBCO) and 10 ⁇ g/ml Puromycin.
  • B16F10-mFAP cells were maintained in DMEM (GIBCO) containing 10% FBS (GIBCO) and 10 ⁇ g/ml puromycin.
  • NIH-3T3-mFAP cells were maintained in DMEM (GIBCO) containing 10% FBS (GIBCO) and 5 ⁇ g/ml puromycin.
  • PBMCs Peripheral blood mononuclear cells
  • PBMCs Peripheral blood mononuclear cells
  • IRB Institutional Review Board
  • Human NK cells were isolated from the thawed PBMC using the Easy sep (Stem cell, Vancouver, BC, CA) kit by a positive selection method. The isolated NK cells were activated and maintained in RPMI-1640 (GIBCO) and 10% FBS containing 50 IU/ml recombinant human IL-2, rhIL-2 (R&D systems, Minnesota, USA). .
  • Human T cells were isolated from thawed PBMCs using the Easy sep (Stem cell) kit by a negative selection method. Human T cells were cultured on plates coated with 1 ⁇ g/ml anti-CD3 (OKT3, Invitrogen) and activated for 72 hours. Human T cells were maintained in RPMI-1640 (GIBCO) with 10% FBS (GIBCO).
  • T1.01, T1.02 and T1.03 The binding of T1.01, T1.02 and T1.03 to recombinant human FAP was confirmed by surface plasmon resonance (SPR).
  • the surface of the CM5 chip was activated with a 1:1 mixture of 50 nM N-hydroxysuccinimide (NHS) and 200 nM EDC (1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide) and 25 ⁇ g/ml anti-human
  • the IgG (Fc) antibody was immobilized for 400 seconds at a rate of 10 ⁇ l/min. Remaining active ester groups were blocked with 1 M ethanolamine.
  • T1.01, T1.02 and T1.03 were diluted to 2 ⁇ g/ml and reacted on a CM5 chip immobilized with an anti-human IgG (Fc) antibody.
  • Recombinant human FAP was diluted to 200 nM in 1 x HBS-EP+buffer solution and diluted by serial dilution. The diluted recombinant human FAP was reacted at a rate of 30 ⁇ l/min. Association and dissociation times were 180 seconds and 400 seconds, respectively. After stabilization for 60 seconds after the dissociation step, a regeneration step was performed for 30 seconds at a rate of 30 ⁇ l/min with a 10 mM Glycine pH 1.5 solution.
  • T1.01, T1.02 and T1.03 could specifically bind to recombinant human FAP.
  • Binding of T1.04, T1.05, T1.06, T1.07, T1.08, T1.09, T1.10 and T1.11 to recombinant human CD20 was determined by surface plasmon resonance (SPR). Confirmed.
  • the surface of the CM5 chip was activated with a 1:1 mixture of 50 nM NHS (N-hydroxysuccinimide) and 200 nM EDC (1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide) and 25 ⁇ g/ml anti-human IgG (Fc )
  • the antibody was immobilized for 400 seconds at a rate of 10 ⁇ l/min. Remaining active ester groups were blocked with 1 M ethanolamine.
  • human proteins T1.04, T1.05, T1.06, T1.07, T1.08, T1.09, T1.10, and T1.11 were administered at 1 ⁇ g/ml, 1 ⁇ g/ml, and 1 ⁇ g, respectively.
  • /ml, 1 ⁇ g/ml, 0.5 ⁇ g/ml, 0.5 ⁇ g/ml, 0.5 ⁇ g/ml, and 1 ⁇ g/ml were diluted and reacted with the anti-human IgG (Fc) antibody immobilized CM5 chip.
  • Recombinant human FAP was diluted to 25 nM or 50 nM in 1 x HBS-EP+ buffer solution and serially diluted.
  • the diluted recombinant human FAP was reacted at a rate of 30 ⁇ l/min. Association and dissociation times were 180 seconds and 400 seconds, respectively. After stabilization for 60 seconds after the dissociation step, a regeneration step was performed for 30 seconds at a rate of 30 ⁇ l/min with a 10 mM Glycine pH 1.5 solution.
  • FIGS. 9 and 10 it was confirmed that T1.04, T1.05, T1.06 and T1.07 could bind to recombinant human FAP and specifically target FAP.
  • T1.08, T1.09, T1.10 and T1.11 could bind to recombinant human FAP and specifically target FAP. .
  • Example 1.2 Confirmation of mouse protein binding to recombinant mouse FAP The binding of T1.01m, T1.02m and T1.03m to recombinant mouse FAP was confirmed by surface plasmon resonance (SPR).
  • SPR surface plasmon resonance
  • the surface of the CM5 chip was activated with a 1:1 mixture of 50 nM NHS (N-hydroxysuccinimide) and 200 nM EDC (1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide) and 25 ⁇ g/ml anti-mouse IgG (Fc )
  • the antibody was immobilized for 400 seconds at a rate of 10 ⁇ l/min. Remaining active ester groups were blocked with 1 M ethanolamine.
  • T1.01m, T1.02m, and T1.03m were diluted to 2 ⁇ g/ml and reacted on a CM5 chip immobilized with an anti-mouse IgG (Fc) antibody.
  • Recombinant mouse FAP was diluted to 200 nM in 1 x HBS-EP + buffer solution and diluted by serial dilution. The diluted recombinant mouse FAP was reacted at a rate of 30 ⁇ l/min. Association and dissociation times were 180 seconds and 400 seconds, respectively. After stabilization for 60 seconds after the dissociation step, a regeneration step was performed for 30 seconds with a 10 mM glycine pH 1.5 solution at a rate of 30 ⁇ l/min.
  • T1.01m, T1.02m, and T1.03m could specifically target FAP by binding to recombinant mouse FAP.
  • T1.12, T1.01, T1.02 and T1.03 The degree of binding of T1.12, T1.01, T1.02 and T1.03 to HEK293 and HEK293-hFAP cells was confirmed.
  • the cell line was prepared by floating in FACS buffer at 1 ⁇ 10 5 cells/100 ⁇ l, and treated with 1 ⁇ g each of T1.12, T1.01, T1.02 and T1.03. Cells were washed twice using FACS buffer. Cells were stained using an anti-human IgG antibody (Biolegend). Negative control samples were only stained with anti-human IgG antibody (Biolegend). The expression ratio of stained cells was measured using BD LSR and analyzed using FlowJo software.
  • T1.12, T1.01, T1.02 and T1.03 bound to the cell line expressing human FAP by 99% or more.
  • the fusion protein of one embodiment can specifically target FAP by binding to a cell line expressing human FAP.
  • the cell line was prepared by floating in FACS buffer at 1 x 10 5 cells/100 ⁇ l. 1 ⁇ g each of T1.12m, T1.01m, T1.02m and T1.03m was treated. Cells were washed twice using FACS buffer. Cells were stained using an anti-mouse IgG2a antibody (Biolegend). Negative control samples were only stained with anti-mouse IgG2a antibody (Biolegend). The expression ratio of stained cells was measured using BD LSR and analyzed in FlowJo software.
  • T1.12m, T1.01m, T1.02m and T1.03m bound to cell lines expressing FAP by 99% or more.
  • Example 1.4 Confirmation of binding of the fusion protein to the recombinant human IL-12 receptor
  • T1.01, T1.02, T1.03 and T1.12 bind to the recombinant human IL-12 receptor. .
  • T1.01, T1.02 and T1.03 were immobilized on a plate and horseradish peroxidase (HRP) conjugated recombinant human IL-12 receptor protein was conjugated, and the following steps were specifically performed. :
  • T1.01, T1.02, T1.03 and T1.12 were suspended at 5 ⁇ g/ml and diluted by serial dilution. The diluted T1.01, T1.02, T1.03 and T1.12 were dispensed into a 96-well immune plate and treated for 24 hours.
  • T1.01, T1.02 and T1.03 bound to the recombinant human IL-12 receptor protein in a concentration dependent manner.
  • T1.12 was used as a control.
  • IL-12 is known to induce phosphorylation of signal transducer and activator or transcription 4 (STAT4)
  • STAT4 signal transducer and activator or transcription 4
  • STAT4 which is a signaling mediator when bound to the IL-12 receptor
  • IL-12 of the fusion protein of one embodiment The signaling ability in IL-12 sensing cells expressing the -12 receptor was evaluated.
  • HEK-Blue IL-12 cell line which is an IL-12 detection cell
  • Recombinant human IL-12, T1.01m, T1.02m, T1.03m and T1.12m were suspended at 4 nM and diluted by serial dilution.
  • HEK-Blue IL-12 cells were treated with diluted recombinant human IL-12, T1.01m, T1.02m, T1.03m and T1.12m. After 24 hours of treatment, cell supernatants were collected and mixed with QUANTI-Blue Solution (Invivogen) in 96-well plates. The reporter expression level was measured at 620 nm with a spectrophotometer (Thermo Fisher).
  • human proteins IL-12, T1.01, T1.02, T1.03 and T1.12 were suspended at 100 ng/ml and diluted by serial dilution.
  • Human T cells activated with anti-CD3 OKT3, Invitrogen
  • a reagent PerkinElmer
  • pSTAT4 was detected at a stimulation wavelength of 680 nm and an emission wavelength of 615 nm using a spectrophotometer.
  • the half effective concentration (EC50) of the group treated with recombinant human IL-12 was 8.945 pM;
  • the group treated with T1.01 had an EC50 of 14.48 pM;
  • the group treated with T1.02 had an EC50 of 56.51 pM;
  • phosphorylated STAT4 was not confirmed in the control group treated with T1.12.
  • Example 2.3 Confirmation of changes in signaling ability of fusion proteins in human T cells by low-molecular heparin
  • recombinant human IL-12, T1.01, T1.02 and T1.03 were suspended at 100 ng/ml and diluted by serial dilution.
  • Activated human T cells were treated with diluted recombinant human IL-12, T1.01, T1.02 and T1.03 together with low-molecular-weight heparin.
  • cells were lysed and treated with a reagent (PerkinElmer) to detect p-STAT4.
  • pSTAT4 was detected at a stimulation wavelength of 680 nm and an emission wavelength of 615 nm using a spectrophotometer.
  • enzyme-linked immunosorbent assay (ELISA, R&D systems) was performed on the supernatant stored at -20 ° C in the following steps:
  • the capture antibody was diluted according to the Certificate of Analysis (CoA) and coated on a 96-well plate for 24 hours.
  • the detection antibody was diluted according to the certificate of analysis, dispensed into the wells, and treated for 2 hours.
  • IFN- ⁇ Interferon-gamma
  • T1.12, T1.01, T1. 02 and T1.03 were evaluated for IFN- ⁇ secretion ability.
  • human T cells activated with anti-CD3 were diluted to 5 x 10 5 cells/ml and distributed in a 96-well plate at 200 ⁇ l/well.
  • Recombinant human IL-12, T1.12, T1.01, T1.02 and T1.03 were diluted to 10 nM and dispensed at 20 ⁇ l/well. After 48 hours of treatment, cell supernatants were collected and samples were stored at -80°C.
  • the average was 1,640 pg/ml; an average of 1,115 pg/mL for samples treated with T1.01; an average of 845 pg/mL for samples treated with T1.02; In the sample treated with T1.03, an average of 607 pg/ml of IFN- ⁇ was confirmed. In contrast, IFN- ⁇ was not confirmed in the sample treated with T1.12, which was a control group.
  • T1.01, T1.02 and T1.03 act on human T cells to induce IFN- ⁇ secretion.
  • IFN- ⁇ Interferon-gamma
  • IL-12 a major immune response
  • the present inventors activated recombinant human IL-2 (R&D systems) Human NK cells were treated with recombinant human IL-12, T1.12, T1.01, T1.02 and T1.03 to evaluate IFN- ⁇ secretion ability.
  • human NK cells activated with recombinant human IL-2 were diluted to 5 x 10 5 cells/ml and distributed in a 96-well plate at 200 ⁇ l/well.
  • Recombinant human IL-12, T1.12, T1.01, T1.02 and T1.03 were diluted to 10 nM and dispensed at 20 ⁇ l/well. After 24 hours of treatment, cell supernatants were collected and samples were stored at -80°C.
  • Example 4 Colon cancer of fusion protein Evaluation of anticancer efficacy in animal models
  • Example 4.1 Evaluation of anticancer efficacy in colorectal cancer animal models through co-injection of FAP-expressing fibroblasts
  • the fusion protein is in the form of a bispecific antibody having an anti-FAP sequence structure and an IL-12 sequence structure, and that FAP is overexpressed in fibroblasts present in large numbers in the tumor microenvironment, FAP in NIH-3T3 cells, a mouse fibroblast cell line After overexpression, the mouse colon cancer cell line, CT26, was co-injected at a ratio of 1:1, and the tumor growth inhibitory activity was evaluated in a tumor animal model.
  • mouse colon cancer cell line CT26 and mouse fibroblast cell line NIH-3T3 were used. At this time, NIH-3T3 was produced as a cell line overexpressing FAP.
  • the FAP-overexpressing NIH-3T3 cell line and the CT26 cell line in culture were resuspended in Hanks' Balanced salt solution (HBSS, Gibco) at a concentration of 1 x 10 6 Cells/50 ⁇ l, respectively, and the cells were mixed in a 1:1 ratio and then 1 Using a cc syringe (25G), 100 ⁇ l of each mouse was transplanted into the subcutaneous region of the right flank of 6-week-old BALB/c mice to obtain a FAP-expressing fibroblast co-injection animal model.
  • HBSS Hanks' Balanced salt solution
  • the short and long axes of the tumor were measured using a digital vernier caliper, and the tumor size was measured twice a week by a formula of (short axis, mm) 2 x (long axis, mm) x 0.5.
  • each experimental group consisted of 10 mice, and as a control group, 50 ⁇ g of T1.24m was administered intraperitoneally three times at 3-day intervals by 100 ⁇ l.
  • 10 ⁇ g and 50 ⁇ g of T1.02m and 50 ⁇ g of T1.01m were intraperitoneally administered 100 ⁇ l three times at intervals of 3 days to evaluate the tumor growth inhibitory ability.
  • the fusion protein of one embodiment has excellent anticancer efficacy in animal models of colorectal cancer.
  • FAP FAP was overexpressed in CT26, a mouse colorectal cancer cell line, and used. Specifically, the FAP-overexpressing CT26 cell line in culture was resuspended in Hanks' Balanced salt solution (HBSS, Gibco), and then injected into the left dorsal subcutaneous region of 6-week-old BALB/c mice using a 1 cc syringe (25G) for each mouse. 100 ⁇ l of x 10 6 tumor cells were transplanted to obtain a FAP-expressing colorectal cancer animal model.
  • HBSS Hanks' Balanced salt solution
  • the short and long axes of the tumor were measured using a digital vernier caliper, and the tumor size was measured twice a week using a formula of (short axis, mm) 2 x (long axis, mm) x 0.5.
  • each experimental group consisted of 8 animals, and as a control group, 100 ⁇ l of 50 ⁇ g of T1.24m was intraperitoneally administered 4 times at 3-day intervals.
  • 100 ⁇ l of 10 ⁇ g and 100 ⁇ g of T1.01m and 2 ⁇ g, 10 ⁇ g, and 100 ⁇ g of T1.02m were intraperitoneally administered 4 times at 3-day intervals to evaluate tumor growth inhibitory ability.
  • the groups administered with 10 ⁇ g and 100 ⁇ g of T1.01m showed 84.9% and 85.6%, respectively, compared to the group administered with 50 ⁇ g of T1.24m as a control group.
  • the high tumor growth inhibitory ability of was confirmed.
  • T1.02m showed high tumor growth inhibition ability of 80.1%, 90.5% and 89.8%, respectively, for each dose compared to the control group, T1.24m administration.
  • Example 4.3 Evaluation of growth inhibition of recurrent solid cancer in mice with complete remission by fusion protein
  • tumor recurrence was evaluated for subjects in complete remission by administering T1.01m in a tumor model transplanted with FAP-overexpressing CT26 cells ( Tumor re-challenge) was conducted.
  • T1.01m tumor model transplanted with FAP-overexpressing CT26 cells
  • BALB/c mice with no history of treatment were used as control mice.
  • a tumor recurrence model was obtained by subcutaneously injecting 4T1 cells into the left flank and CT26 cells into the right flank of control mice and mice whose complete remission was confirmed by T1.01m administration.
  • a tumor recurrence model was induced in mice that showed complete response (CR) by administering T1.01m in a model transplanted with CT26 cells.
  • CT26 cells and 4T1 cells were suspended in Hanks' balanced salt solution (HBSS, Gibco) at a concentration of 1 x 10 6 cells/100 ⁇ l, respectively, and CT26 cells were implanted subcutaneously in the right flank of the mouse using a 1 cc syringe (25G). did Tumor formation and growth were evaluated by transplanting 4T1 cells subcutaneously into the left flank of the same mouse. 9 animals were used in the control group and 7 animals were used in the test group.
  • HBSS Hanks' balanced salt solution
  • Example 4.4 Evaluation of activity reduction according to IL-12 amino acid mutation of fusion protein
  • the present inventors used an IL-12 sequence structure containing a mutation in the amino acid sequence that binds to heparin to prevent interference with IL-12 receptor binding. A decrease in activity was induced through the use of a tumor, and this was confirmed through a tumor animal model.
  • T1.02m and T1.03m in which amino acids involved in heparin binding were mutated, and T1.01m were used as a control.
  • T1.02m has an anti-FAP sequence structure and a mouse IL-12 sequence structure including mutations (two) of amino acids involved in heparin binding.
  • T1.03m is a fusion protein having an anti-FAP sequence structure and an IL-12 sequence structure containing mutations (4) of amino acids involved in binding to heparin.
  • mouse colon cancer CT26 overexpressing FAP was resuspended in PBS at a concentration of 5 x 10 5 cells / 100 ⁇ l, and the cells were prepared by 5-week-old female BALB The tumor growth inhibitory ability was evaluated in a tumor animal model prepared by transplantation into /c mice.
  • the size of the tumors of the model reached 100 mm 3 , they were randomly divided and grouped.
  • 100 ⁇ l of Phosphate buffered saline (PBS) was administered as a single tail vein, and each of T1.01m, T1.02m, and T1.03m was administered as a single tail vein at a dose of 10 ⁇ g.
  • T1.03m administration group containing the mouse anti-FAP sequence and amino acid mutations (4) IL-12 involved in heparin binding decreased the tumor growth inhibition ability compared to the T1.01m group.
  • Example 4.5 Evaluation of anticancer efficacy of IL-12 amino acid-mutated fusion protein upon single administration
  • CT26 cells In order to evaluate the anticancer effect of the fusion protein with reduced IL-12 activity by the sequence structure containing mutations (4) of amino acids involved in heparin binding, CT26 cells, a mouse colorectal cancer cell line overexpressing FAP, were transplanted. The ability to inhibit tumor growth was evaluated in an allograft tumor model.
  • tumor cells were transplanted to the right dorsal side of 6-week-old BALB/c mice, and when the tumor size of the animal model reached 70 to 100 mm 3 , they were randomly divided into groups and administered.
  • PBS was administered as a control group
  • T1.03m was administered as a single dose to the tail vein of mice at doses of 2 ⁇ g, 10 ⁇ g, and 100 ⁇ g, each 100 ⁇ l, as a test group.
  • Tumor size was measured in the same manner as in Example 4.1.
  • T1.03m in which IL-12 activity is reduced due to the sequence structure containing mutations (4) of amino acids involved in heparin binding, has excellent anticancer efficacy at a certain concentration or higher.
  • Example 5 Evaluation of anticancer efficacy of fusion proteins in melanoma animal models
  • FAP was overexpressed in B16F10, a mouse melanoma cell line known to have low immune cell infiltration, and then transplanted into C57BL/6J mice to evaluate tumor growth inhibitory activity.
  • HBSS Hanks' balanced salt solution
  • T1.03m which has reduced IL-12 activity due to a sequence structure containing mutations (4) of amino acids involved in heparin binding, has excellent anticancer efficacy in melanoma animal models.
  • Example 6.1 Evaluation of anticancer efficacy of IL-12 amino acid-mutated fusion protein in lung cancer animal model
  • the FAP-overexpressing NIH-3T3 cell line and the LLC1 cell line in culture were resuspended in Hanks' Balanced salt solution (HBSS, Gibco) at a concentration of 1 x 10 6 Cells/50 ⁇ l, respectively, and the cells were mixed in a 1:1 ratio and then 1 100 ⁇ l per mouse was implanted into the subcutaneous region of the right flank of 6-week-old C57BL/6J mice using a cc syringe (25G).
  • HBSS Hanks' Balanced salt solution
  • Example 6.2 Evaluation of cancer-targeting efficacy in lung cancer animal models through co-injection of fusion proteins
  • NIH-3T3 cells For comparison of anticancer efficacy according to the cancer target of the dual antibody-type fusion protein in which the anti-FAP sequence structure and the IL-12 sequence structure form a knob-in-hole structure, NIH-3T3 cells, a mouse fibroblast cell line overexpressing FAP, and The ability to inhibit tumor growth was confirmed in an animal model in which LLC1, a mouse lung cancer cell line, was co-injected at a ratio of 1:1.
  • T1.16m or T1.17m alone administration group T1.16m and T1.17m combination administration (T1.16m + T1.17m), and T1.03m administration group were used as test groups to evaluate tumor growth inhibition ability.
  • T1.16m and T1.17m which are dimers of anti-FAP and IL-12, respectively, are 0.01 ⁇ g each, and T1.03m, a monomeric fusion protein, is administered intraperitoneally twice a week at a dose of 0.02 ⁇ g. Growth inhibitory ability was observed.
  • Example 7 Confirmation of anticancer effect when fusion protein and anticancer agent are administered in combination
  • Example 7.1 Confirmation of anticancer effect by combined administration of immune checkpoint inhibitors in lung cancer mouse model
  • a mouse animal model was used in which NIH-3T3 cells, a mouse fibroblast cell line overexpressing FAP, and LLC1, a mouse lung cancer cell line, were co-injected at a 1:1 ratio.
  • T1.03m alone administration group immune checkpoint inhibitor aPD-L1 (clone 10F.9G2, BioXCell), aCTLA-4 (clone 9D9, BioXCell), or aPD-1 (Clone RMP1-14, BioXCell) alone administration group
  • T1.03m and aPD-L1 combined administration FIG. 33a
  • T1.03m and aCTLA-4 combined administration FIG. 33b
  • T1.03m and aPD-1 combined administration group FIG.
  • T1.03m was administered as a single intravenous injection at a dose of 10 ⁇ g, and the immune checkpoint inhibitor was administered at a dose of 200 ⁇ g once every 3 days, and tumor growth inhibitory activity was observed.
  • Example 7.2 Confirmation of anticancer effect by co-administration of immune checkpoint inhibitors in colorectal cancer mouse model
  • a mouse animal model was used in which NIH-3T3 cells, a mouse fibroblast cell line overexpressing FAP, and MC38, a mouse colon cancer cell line, were co-injected at a 1:1 ratio.
  • T1.03m alone, immune checkpoint inhibitor aPD-L1 (clone 10F.9G2, BioXCell) alone, and T1.03m and aPD-L1 combined administration group were used as experimental groups to evaluate tumor growth inhibitory ability.
  • T1.03m was administered as a single intravenous injection at a dose of 2 ⁇ g, and the immune checkpoint inhibitor was administered at a dose of 200 ⁇ g once every 3 days, and tumor growth inhibitory activity was observed.
  • the T1.03m alone administration group, the immune checkpoint inhibitor aPD-L1 (clone 10F.9G2, BioXCell) alone administration group, and the T1.03m and aPD-L1 combination administration group were used as experimental groups.
  • T1.03m alone administration group immune checkpoint inhibitor aTIGIT (clone 1G9, BioXCell), aLAG-3 (clone C9B7W, BioXCell), or aTIM-3 (Clone RMT3-23, BioXCell) alone administration group
  • T1.03m and aTIGIT combination Administration FIG. 36
  • T1.03m and aLAG-3 combined administration FIG. 37
  • T1.03m and aTIM-3 combined administration group FIG. 38
  • Example 7.3 Confirmation of anticancer effect by co-administration of chemotherapy in a mouse model of colorectal cancer
  • a mouse animal model was used in which NIH-3T3 cells, a mouse fibroblast cell line overexpressing FAP, and MC38, a mouse colon cancer cell line, were co-injected at a 1:1 ratio.
  • T1.03m alone administration group Cyclophosphamide (Endoxan Inj., Bukwang Pharm), Fluorouracil (5-Fyu Inj., Joongwae Pharm.), Paclitaxel (Neotak Inj., Joongwae Pharm.), or Camptosar (Irinotecan Inj., Pfizer) alone administration group; T1.03m and Cyclophosphamide combined administration group (Fig. 39), T1.03m and Fluorouracil combined administration group (Fig. 40), T1.03m and Pacliatxel combined administration group (Fig. 41), and T1.03m and Camptosar combined administration group (Fig. 42) were experimental groups. The tumor growth inhibitory ability was evaluated.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Endocrinology (AREA)
  • Toxicology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

본 발명은 IL-12 또는 이의 변이체 및 FAP에 특이적으로 결합하는 항원 결합 부위를 포함하는 융합단백질 및 항암제의 병용 치료제를 제공한다. 상기 이중 특이적 항체는 IL-12에 의한 항암 효과를 나타내며, 특히, 상기 항-FAP 항체를 하나의 항체에서 구현할 경우, 종양 내에서 특이적으로 발현이 높은 FAP을 대상으로 하여 IL-12를 종양 부위에 특이적으로 위치화(localization) 시킴으로써 효율적으로 암을 치료할 수 있다. 상기 융합단백질은 공지된 항암제와 병용 투여하였을 때 항암 치료에 시너지 효과가 있다.

Description

IL-12 및 항-FAP 항체를 포함하는 융합단백질 및 항암제를 포함하는 암 치료용 약학 조성물
본 발명은 IL-12 또는 이의 변이체; 및 항-FAP 항체를 포함하는 신규한 융합단백질 및 항암제를 포함하는 항암용 약학 조성물에 관한 것이다.
인터루킨-12(Interleukin-12)는 대표적인 염증성 사이토카인으로서 세포성 면역 반응을 효과적으로 유도하는데 필수적인 역할을 한다. IL-12는 이황화결합으로 연결된 40 kDa(p40) 및 35 kDa(p35) 서브유닛을 포함하는 헤테로다이머(heterodimeric) 단백질이며, 활성화된 대식세포, 단핵구, 수지상세포 및 활성 B 림프구에 의해 생성된다. IL-12는 T-helper 1 세포 면역을 증진시킬 수 있고, 세포성 T-림프구의 세포독성을 증가시키며, 혈관신생을 억제시킬 수 있다. 일반적으로 IL-12는 T 세포 및 NK 세포에서 IFN-γ 생산을 활성화시킨다.
IL-12의 국소적 발현은 종양세포가 T-세포 매개 세포독성에 민감하게 반응하도록 하며, 결과적으로 종양 성장 억제 및 체액성 면역의 구축을 가져온다. 그러나, IL-12의 임상 적용에 있어서의 단점은 투여 시 사이토카인 연관 독성이 전신에 나타날 수 있다는 점이다. 이러한 임상 결과는 암의 치료를 위한 단일치료제로서의 IL-12의 한계를 보여준다.
한편, 섬유아세포 활성 단백질(Fibroblast activation protein alpha, FAPα)은 활성화된 섬유아세포 상에서 발현된 젤라티나아제이다. FAP은 전립선암 및 췌장암을 포함한 다양한 인간 암종의 암 관련 섬유아세포에서 90% 이상 발현되는 것으로 알려져 있다. 이에, 최근 들어 FAP 발현 세포를 표적화하는 면역 요법을 개발하는데 관심이 급증하고 있다(Fang J. et.al., Mol. Ther. Oncolytics., 3:16007, 2016).
이에 본 발명자들은 효과적인 항암 효과를 가지는 약학 조성물을 개발하기 위해 연구한 결과, IL-12 및 항-FAP 항체를 포함한 융합단백질; 및 항암제를 병용투여할 경우, 항암 효과에 시너지가 있음을 확인함으로써 본 발명을 완성하였다.
본 발명의 일 측면은, IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 FAP(Fibroblast activation protein alpha)에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질; 및 항암제를 포함하는 암 치료용 약학 조성물을 제공한다.
본 발명의 다른 측면은, IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 FAP에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질; 및 항암제를 유효성분으로 포함하는 암 예방 또는 치료용 키트를 제공한다.
IL-12 및 FAP에 특이적으로 결합하는 항원 결합 부위를 포함하는 융합단백질은 IL-12에 의한 항암 효과를 나타낼 수 있다. 뿐만 아니라, 상기 항-FAP 항체를 하나의 항체에서 구현할 경우, FAP의 발현이 높은 종양에 특이적으로 IL-12를 축적시킴으로써 전신 독성(systemic toxicity)을 줄이고, 종양 특이적 항암 효과를 나타냄을 확인하였다. 즉, 종양 내에서 특이적으로 발현이 높은 FAP을 대상으로 하여 IL-12를 종양 부위에 특이적으로 위치화(localization) 시킴으로써 효율적으로 암을 치료할 수 있다. 특히, 상기 융합단백질 및 항암제를 병용 투여하면, 항암 효과에 시너지가 있다.
도 1은 일 실시예에 따른 T1.01, T1.02, T1.03, T1.04, T1.05, T1.06 및 T1.07에 대한 SDS-PAGE 결과이다.
도 2는 일 실시예에 따른 T1.08, T1.09, T1.10, T1.11, T1.12, T1.13, T1.14 및 T1.15에 대한 SDS-PAGE 결과이다.
도 3은 일 실시예에 따른 T1.16, T1.17, T1.18, T1.19 및 T1.21에 대한 SDS-PAGE 결과이다.
도 4는 일 실시예에 따른 T1.01m, T1.02m, T1.03m, T1.04m, T1.05m, T1.06m 및 T1.07m에 대한 SDS-PAGE 결과이다.
도 5는 일 실시예에 따른 T1.08m, T1.09m, T1.10m, T1.11m, T1.12m, T1.13m 및 T1.15m에 대한 SDS-PAGE 결과이다.
도 6은 일 실시예에 따른 T1.16m, T1.17m, T1.18m, T1.19m, T1.20m, T1.21m 및 T1.22m에 대한 SDS-PAGE 결과이다.
도 7은 재조합 인간 FAP(recombinant human FAP, rhFAP)에 대한 T1.01 및 T1.02의 결합력을 표면 플라즈몬 공명 분석방법을 통해 나타낸 그래프이다.
도 8은 재조합 인간 FAP에 대한 T1.03의 결합력을 표면 플라즈몬 공명 분석방법을 통해 나타낸 그래프이다.
도 9는 재조합 인간 FAP에 대한 T1.04 및 T1.05의 결합 정도를 표면 플라즈몬 공명 분석 방법을 통해 나타낸 도면이다.
도 10은 재조합 인간 FAP에 대한 T1.06 및 T1.07의 결합 정도를 표면 플라즈몬 공명 분석 방법을 통해 나타낸 도면이다.
도 11은 재조합 인간 FAP에 대한 T1.08 및 T1.09의 결합 정도를 표면 플라즈몬 공명 분석 방법을 통해 나타낸 도면이다.
도 12는 재조합 인간 FAP에 대한 T1.10 및 T1.11의 결합 정도를 표면 플라즈몬 공명 분석 방법을 통해 나타낸 도면이다.
도 13은 재조합 마우스 FAP에 대한 T1.01m 및 T1.02m의 결합력을 표면 플라즈몬 공명 분석방법을 통해 나타낸 그래프이다.
도 14는 재조합 마우스 FAP에 대한 T1.03m의 결합력을 표면 플라즈몬 공명 분석방법을 통해 나타낸 그래프이다.
도 15는 HEK293-hFAP 세포 및 HEK293 세포에 대한 T1.12, T1.01, T1.02 및 T1.03의 결합력을 유세포 분석을 통해 나타낸 그래프이다.
도 16은 B16F10-mFAP 세포 및 B16F10 세포에 대한 T1.12m, T1.01m, T1.02m 및 T1.03m의 결합력을 유세포 분석을 통해 나타낸 그래프이다.
도 17은 T1.01, T1.02, T1.03 및 T1.12와 IL-12 수용체 베타 1과의 결합력을 효소 결합 면역 침강 분석법을 통해 나타낸 그래프이다.
도 18은 T1.01m, T1.02m, T1.03m 및 T1.12m와 IL-12 활성을 HEKblue 리포터 세포에서의 흡광도를 통해 확인한 그래프이다.
도 19는 T1.01, T1.02, T1.03 및 T1.12와 IL-12 활성을 인간 T 세포의 신호전달능을 통해 나타낸 그래프이다.
도 20은 저분자헤파린(Low molecular weight heparin, LMWH) 존재시, T1.01, T1.02 및 T1.03의 IL-12 활성을 인간 T 세포의 신호전달능을 통해 나타낸 그래프이다.
도 21은 T1.12, T1.01, T1.02 및 T1.03에 의한 인간 T 세포의 사이토카인 IFN-γ 분비능을 측정한 그래프이다.
도 22는 T1.12, T1.01, T1.02 및 T1.03에 의한 인간 NK 세포의 사이토카인 IFN-γ 분비능을 측정한 그래프이다.
도 23은 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 CT26을 공동주입한 마우스 종양 모델의 종양 크기의 변화를 측정하여 T1.01m 및 T1.02m에 의한 종양 성장 억제능을 나타낸 그래프이다.
도 24는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 CT26을 공동주입한 마우스 종양 모델에서 T1.01m 및 T1.02m에 의한 종양 성장 억제능을 확인하기 위해 개체별 종양 크기를 측정하여 나타낸 그래프이다.
도 25는 FAP을 과발현하는 대장암 세포주 CT26을 동종이식한 마우스 종양 모델의 개체별 종양 크기의 변화를 측정하여 T1.01m 및 T1.02m의 농도별 투여에 의한 종양 성장 억제능을 나타낸 그래프이다.
도 26은 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 CT26을 공동주입한 마우스 종양 모델에서 따른 완전관해가 일어난 마우스에 CT26 세포와 4T1 세포를 동종이식하여 종양재발 모델을 구축하였다. 이후 CT26 종양 크기의 변화를 나타낸 그래프이다.
도 27은 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 CT26을 공동주입한 마우스 종양 모델에서 완전관해가 일어난 마우스에 CT26 세포와 4T1 세포를 동종이식하여 종양재발 모델을 구축하였다. 이후 4T1 종양 크기의 변화를 나타낸 그래프이다.
도 28은 FAP을 과발현하는 CT26 세포가 동종이식된 마우스 모델의 개체별 종양 크기를 측정하여, T1.01m, T1.02m 및 T1.03m의 농도별 투여에 의한 개체별 종양 성장 억제능을 나타낸 그래프이다.
도 29는 FAP을 과발현하는 CT26 세포가 동종이식된 마우스 모델의 개체별 종양 크기의 변화를 측정하여, T1.03m의 농도별 투여에 의한 개체별 종양 성장 억제능을 나타낸 그래프이다.
도 30은 FAP을 과발현하는 B16F10 세포가 동종이식된 마우스 모델의 개체별 종양 크기의 변화를 측정하여, T1.03m의 농도별 투여에 의한 종양 성장 억제능을 나타낸 그래프이다.
도 31은 FAP을 과발현하는 섬유아세포 NIH-3T3 및 폐암 세포주 LLC1을 공동주입한 마우스 모델의 개체별 종양 크기의 변화를 측정하여, T1.03m의 농도별 투여에 의한 종양 성장 억제능을 나타낸 그래프이다.
도 32는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 폐암 세포주 LLC1을 공동주입한 마우스 모델에 T1.16m, T1.17m, T1.03m 또는 T1.16m 및 T1.17m 동시투여 처리한 후, 10일이 경과한 시점에서 종양 크기를 측정하여 나타낸 그래프이다.
도 33a는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 폐암 세포주 LLC1을 공동주입한 마우스 모델에 T1.03m 및 aPD-L1을 각각 또는 동시투여 처리한 후, 9일이 결과한 시점에서, 종양 크기를 측정하여 나타낸 그래프이다.
도 33b는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 폐암 세포주 LLC1을 공동주입한 마우스 모델에 T1.03m 및 aCTLA-4를 각각 또는 동시투여 처리한 후, 9일이 경과한 시점에서 종양 크기를 측정하여 나타낸 그래프이다.
도 33c는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 폐암 세포주 LLC1을 공동주입한 마우스 모델에 T1.03m 및 aPD-1을 각각 또는 동시투여 처리한 후, 9일이 경과한 시점에서 종양 크기를 측정하여 나타낸 그래프이다.
도 34a는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 aPD-L1을 각각 또는 동시투여 처리한 후, 16일이 경과한 시점에서 종양 크기를 측정하여 나타낸 그래프이다.
도 34b는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 aPD-L1을 각각 또는 동시투여 처리한 후, 16일 경과까지 종양 크기를 측정하여 시간순으로 나타낸 그래프이다.
도 35a는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 aPD-L1을 각각 또는 동시투여 처리한 후, 11일이 경과한 시점에서 종양크기를 나타낸 그래프이다.
도 35b는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 aPD-L1을 각각 또는 동시투여 처리한 후, 11일 경과까지 종양 크기를 측정하여 시간순으로 나타낸 그래프이다.
도 36a는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 aTIGIT을 각각 또는 동시투여 처리한 후, 10일이 경과한 시점에서 종양크기를 나타낸 그래프이다.
도 36b는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 aTIGIT을 각각 또는 동시투여 처리한 후, 10일 경과까지 종양 크기를 측정하여 시간순으로 나타낸 그래프이다.
도 37a는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 aLAG-3를 각각 또는 동시투여 처리한 후, 10일이 경과한 시점에서 종양크기를 나타낸 그래프이다.
도 37b는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 aLAG-3를 각각 또는 동시투여 처리한 후, 10일 경과까지 종양 크기를 측정하여 시간순으로 나타낸 그래프이다.
도 38a는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 aTIM-3를 각각 또는 동시투여 처리한 후, 10일이 경과한 시점에서 종양크기를 나타낸 그래프이다.
도 38b는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 aTIM-3를 각각 또는 동시투여 처리한 후, 10일 경과까지 종양 크기를 측정하여 시간순으로 나타낸 그래프이다.
도 39a는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 Cyclophosphamide를 각각 또는 동시투여 처리한 후, 11일이 경과한 시점에서 종양크기를 나타낸 그래프이다.
도 39b는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 Cyclophosphamide를 각각 또는 동시투여 처리한 후, 11일 경과까지 종양 크기를 측정하여 시간순으로 나타낸 그래프이다.
도 40a는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 Fluorouracil을 각각 또는 동시투여 처리한 후, 11일이 경과한 시점에서 종양크기를 나타낸 그래프이다.
도 40b는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 Fluorouracil을 각각 또는 동시투여 처리한 후, 11일 경과까지 종양 크기를 측정하여 시간순으로 나타낸 그래프이다.
도 41a는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 Paclitaxel을 각각 또는 동시투여 처리한 후, 11일이 경과한 시점에서 종양크기를 나타낸 그래프이다.
도 41b는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 Paclitaxel을 각각 또는 동시투여 처리한 후, 11일 경과까지 종양 크기를 측정하여 시간순으로 나타낸 그래프이다.
도 42a는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 Camptosar을 각각 또는 동시투여 처리한 후, 11일이 경과한 시점에서 종양크기를 나타낸 그래프이다.
도 42b는 FAP을 과발현하는 섬유아세포 NIH-3T3 및 대장암 세포주 MC38을 공동주입한 마우스 모델에서 T1.03m 및 Capmtosar을 각각 또는 동시투여 처리한 후, 11일 경과까지 종양 크기를 측정하여 시간순으로 나타낸 그래프이다.
도 43는 항-FAP/IL-12 융합단백질(왼쪽으로부터 첫번째), 이중 가변 도메인을 가지는 항-FAP/IL-12 융합단백질(두번째), FAP에 특이적인 단일쇄 가변영역 단편(scFv)이 결합된 항-FAP/IL-12 이중 항체(세번째 및 네번째), IL-12가 Fc의 C 말단에 결합된 항-FAP/IL-12 융합단백질(다섯번째)의 모식도이다.
도 44은 FAP에 특이적인 Fab/FAP에 특이적인 단일쇄 가변영역 단편(scFv) 및 IL-12 융합단백질(왼쪽), FAP에 특이적인 Fab 및 IL-12를 포함하는 융합단백질 이량체(가운데) 및 FAP에 특이적인 단일쇄 가변영역 단편(scFv) 및 IL-12 융합단백질(오른쪽)의 모식도이다.
IL-12 및 FAP 항체를 포함하는 융합단백질 및 항암제를 포함하는 병용 치료제
본 발명의 일 측면은, IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 FAP(Fibroblast activation protein alpha)에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질; 및 항암제를 포함하는 암 예방 또는 치료용 약학 조성물을 제공한다.
상기 융합단백질은 IL-12에 의한 항암 효과를 나타내고, FAP 발현이 높은 종양에 특이적으로 IL-2를 축적시켜 종양 특이적 항암 효과를 나타낼 뿐 아니라, 전신 독성을 줄일 수 있어, 종래에 활용되고 있는 다양한 항암 치료법과 병행하여 이용할 수 있다. 구체적으로, 병용 가능한 종래 치료법은 화학 요법(Chemotherapy)을 위한 화학항암제, 항암 바이러스, 면역관문 억제제 및 이의 조합으로 구성된 군에서 선택될 수 있다.
항암제
본 명세서에서 사용된 용어, "화학항암제"는 항종양 약물(antineoplastic agent) 또는 세포독성 약물(cytotoxic agent)라고도 한다. 주로 DNA에 직접 작용하여 DNA의 복제, 전사, 번역과정을 차단하거나 대사경로에 핵산 전구체의 합성을 방해하고 세포분열을 저해함으로써 항암활성을 나타내는 약물을 총칭하는 것이다. 상기 항종양 약물은 종양세포뿐 아니라, 정상세포에도 작용하여 세포독성을 나타낸다. 화학항암제는 유지요법(maintenance therapy)에 사용될 수 있다. 또한, 본 명세서에서 사용된 용어, "유지요법"은 초기 항암치료 후 약물로 암을 치료하는 것으로, 암의 재발을 예방하거나 지연시키기 위하여 실시하는 치료방법을 의미한다.
상기 화학항암제는 Alkylating Agent, Microtubule Inhibitor, Anti metabolite 및 Topoisomerase Inhibitor으로 이루어진 군에서 선택되는 어느 하나일 수 있다.
일 구체예에 있어서, 상기 Alkylating Agent는 Cyclophosphamide, 또는 Cisplatin일 수 있다. Microtubule Inhibitor는 Paclitaxel일 수 있다. Anti-metabolite은 Fluorouracil 또는 Gemcitabine일 수 있다. Topoisomerase Inhibitor는 Camptosar 또는 Adriamycin일 수 있다.
본 명세서에서 사용된 용어, "항암바이러스 치료제"는 증식이 가능하고 감염력이 있는 바이러스에 암세포를 타겟팅하는 특정 유전자를 삽입하여 암을 사멸시키는 치료제이다. 상기 항암바이러스 치료제는 Talimogene Laherparepvec(T-VEC)일 수 있다.
본 명세서에서 사용된 용어, "면역관문 억제제"는 면역세포의 분화, 증식, 활성을 억제하는 면역관문 단백질(immune checkpoint protein)의 활성을 저해하는 하는 물질로, 암세포가 면역시스템을 회피하는 기능을 발휘하는 것을 막음으로써 암세포를 제거하는 것으로 알려져 있다.
일 구체예에 있어서, 상기 면역관문 억제제는 항-CTLA-4 항체, 항-PD-1 항체, 항-PD-L1 항체, 항-TIM3 항체, 항-TIGIT 항체 및 항-LAG3 항체로 이루어진 군으로부터 선택되는 어느 하나일 수 있다.
일 구체예에 있어서, 상기 면역관문 억제제는 Ipilimumab, Pembrolizumab, Nivolumab, Cemiplimab, Atezolizumab, Avelumab 및 Durvalumab으로 이루어진 군에서 선택되는 어느 하나일 수 있다.
상기 융합단백질은 항암 백신 등과 병행하여 이용할 수 있다. 뿐만 아니라, 항암제는 상술한 항암제뿐 아니라, 항암 백신 등과 함께 이용될 수 있다.
또한, 상기 항암제는 하나 이상의 항암제를 포함할 수 있다. 구체적으로, 상기 융합단백질은 2개의 항암제와 함께 상용될 수 있다. 일 예로, 화학 항암제 및 항암 바이러스; 항암 바이러스 및 면역관문 억제제; 및 화학 항암제 및 면역관문 억제제일 수 있다.
또한, 상기 융합단백질은 3개의 항암제와 함께 사용될 수 있다. 상기 2개의 항암제에 상이한 항암제를 추가로 더 포함하여 사용될 수 있다. 일 실시예로 상기 항암제는 화학항암제, 항암 바이러스 및 면역관문 억제제일 수 있다.
융합단백질의 항암 유지 용도
본 발명의 또 다른 측면은, IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 FAP에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질을 유효성분으로 포함하는 항암 유지용 조성물을 제공한다.
상기 융합단백질은 후술하는 바와 같다.
상술한 바와 같이, "항암 유지"는 초기 항암치료 후에 암을 치료하는 것을 의미한다. 특히, 암의 재발을 예방하거나 지연시켜 암 치료 효과를 높이는 치료 방법이다.
이때, 유지 요법을 위해서 추가적으로 적어도 하나의 항암제를 더 포함할 수 있다. 이때, 상기 항암제는 상술한 바와 같다.
융합단백질 및 항암제를 포함하는 키트
본 발명의 다른 측면은, IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 FAP에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질; 및 항암제를 유효성분으로 포함하는 암 예방 또는 치료용 키트를 제공한다.
IL-12 및 FAP 항체를 포함하는 융합단백질
상기 IL-12 또는 이의 변이체 및 FAP(Fibroblast activation protein alpha)에 특이적으로 결합하는 항원 결합 부위를 포함하는 융합단백질은 면역글로불린 Fc 영역을 포함할 수 있다. 이때, 상기 IL-12 또는 이의 변이체는 헤파린 결합능이 낮아진 변이체일 수 있다.
일 구체예에 있어서, 상기 융합단백질은 IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 FAP에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질일 수 있다.
또 다른 구체예로서, 상기 융합단백질은 IL-12 또는 이의 변이체 및 FAP에 특이적으로 결합하는 항원 결합 부위를 포함하는 융합단백질의 이량체 일 수 있다.
IL-12 또는 이의 변이체
본 명세서에서 사용된 용어, "IL-12"는 각각 IL-12A 및 IL-12B의 2개의 개별적인 유전자에 의해 코딩되는 p35 및 p40 서브유닛으로 구성되는 이종이량체 사이토카인이다. IL-12는 대식세포와 같은 항원제시세포에 의해 생성되어 활성화된 T 세포 및 NK 세포들의 세포 표면의 수용체에 결합한다. 상기 IL-12는 T 세포와 NK 세포들의 증식을 촉진하며, T 세포, NK 세포 및 대식세포의 세포독성 효과를 증진시킨다. 또한, IL-12는 IFN-γ, TNF-α 및 GM-CSF의 생성을 유도하며, Th1 세포의 활성화를 유도하는 작용을 한다. 한편, IL-12는 IL-12Rβ1 및 IL-12Rβ2에 의해 형성된 이종이량체 수용체인 IL-12 수용체에 결합한다.
본 명세서에서 사용된 용어, IL-12의 "변이체"는 야생형 IL-12 단백질과 유사하거나 동일한 기능을 가지는 아미노산 서열을 포함한다. 구체적으로, IL-12를 구성하는 p35 및 p40 서브유닛의 아미노산 서열이 야생형과 비교하여 치환, 삽입 또는 결실된 것일 수 있다.
상기 IL-12 또는 이의 변이체는 IL-12A(p35) 또는 이의 변이체 및 IL-12B(p40) 또는 이의 변이체를 포함할 수 있다.
또한, 상기 IL-12 또는 이의 변이체는 IL-12A 또는 이의 변이체; 및 IL-12B 또는 이의 변이체가 펩타이드 링커로 결합된 구조를 포함할 수 있다.
일 구체예에 있어서, 상기 IL-12 또는 이의 변이체는 하기 구조식 (I) 또는 구조식 (II)를 포함하는 융합단백질 일 수 있다.
N'-Y-[링커(1)]o-Z-C' (I)
N'-Z-[링커(1)]o-Y-C' (II)
이때, 상기 구조식 (I) 및 (II)에 있어서,
상기 N'은 융합단백질의 N-말단이고, 상기 C'는 융합단백질의 C-말단이며,
상기 Y는 IL-12A 또는 이의 변이체이고, 상기 Z는 IL-12B 또는 이의 변이체이며, 상기 링커(1)는 펩타이드 링커이고, 상기 o는 O 또는 1일 수 있다.
상기 IL-12 또는 이의 변이체의 일 구체예는 N 말단으로부터 IL-12B 또는 이의 변이체, 펩타이드 링커 및 IL-12A 또는 이의 변이체가 순차적으로 결합된 구조일 수 있다. 또한, 상기 IL-12 또는 이의 변이체의 일 구체예는 N 말단으로부터 IL-12A 또는 이의 변이체, 펩타이드 링커 및 IL-12B 또는 이의 변이체가 순차적으로 결합된 구조일 수 있다.
본 명세서에서 사용된 용어, "IL-12A"는 IL-12의 35 kDa 서브유닛(p35)으로서, 이황화 결합을 통해 IL-12의 40 kDa 서브유닛(p40)에 결합하여 활성 사이토카인을 생성한다.
상기 IL-12A의 아미노산 서열은 GenBank accession NO. AAK84425에 기재된 것일 수 있다(마우스 p35의 아미노산 서열은 GenBank accession No. AAA39292 참조). 또한, 상기 IL-12A 서브유닛을 코딩하는 서열로서 IL-12A(p35) 유전자는 GenBank accession No. AF404773에 기재된 서열 중 CDS(coding sequence)에 해당하는 뉴클레오타이드 서열일 수 있다(마우스 서열은 GenBank accession No. M86672 참조).
본 명세서에서 사용하는 용어, IL-12A의 "변이체"는 야생형 IL-12A 단백질과 유사하거나 동일한 기능을 가지는 아미노산 서열을 포함한다. 구체적으로, IL-12A의 아미노산 서열이 야생형과 비교하여 치환, 삽입 또는 결실을 갖는 것을 의미한다. 구체적으로, IL-12A 변이체는 IL-12A의 단편일 수 있으며, 서열번호 122의 1 내지 22번째 아미노산이 결실된 아미노산 서열을 가질 수 있다. 보다 구체적으로, IL-12A의 변이체는 서열번호 75의 아미노산 서열을 가질 수 있다.
또한, 본 발명의 일 실시예에서 사용된 IL-12A는 인간 IL-12A로서 서열번호 75의 아미노산 서열일 수 있다. 일 실시예에서 마우스 IL-12A는 서열번호 87의 아미노산 서열일 수 있다.
본 명세서에서 사용된 용어, "IL-12B"는 IL-12의 40 kDa 서브유닛(p40)으로서, 이황화 결합을 통해 IL-12의 35 kDa 서브유닛(p35)에 결합하여 IL-12를 형성하고, 이와 더불어 IL-23의 서브유닛 p19에 결합하여 IL-23을 형성하기도 한다. 한편, IL-12B는 자연살해세포 자극 인자 2(natural killer cell stimulating factor 2)라고도 한다.
상기 "IL-12B"의 아미노산 서열은 GenBank accession No. AAD56386에 기재된 것일 수 있다(마우스 p40의 아미노산 서열은 GenBank accession No. AAA39296 참조). 또한, 상기 IL-12B 서브유닛을 코딩하는 서열로서 IL-12B(p40) 유전자는 GenBank accession No. AF180563에 기재된 서열 중 CDS(coding sequence)에 해당하는 뉴클레오타이드 서열일 수 있다(마우스 서열은 GenBank accession No.M86671 참조).
또한, 본 발명의 일 실시예에서 사용된 IL-12B는 인간 IL-12B일 수 있으며, IL-12B는 구체적으로 서열번호 74의 아미노산 서열일 수 있다. 일 실시예에서 마우스 IL-12B는 서열번호 86의 아미노산 서열을 가질 수 있다.
본 명세서에서 사용된 용어, IL-12B의 "변이체"는 야생형 IL-12B 단백질과 유사하거나 동일한 기능을 가지는 아미노산 서열을 포함한다. 구체적으로, IL-12B의 야생형 아미노산 서열로부터 치환, 삽입 또는 결실을 갖는 것을 의미한다.
구체적으로, IL-12B 변이체는 서열번호 121의 1 내지 22번째 아미노산이 결실된 것일 수 있다. 보다 구체적으로, IL-12B 변이체는 상기 서열번호 74의 서열에서 1개 내지 8개의 아미노산이 치환된 것일 수 있다. 또한, 상기 IL-12B 변이체는 서열번호 123의 1 내지 22번째 아미노산이 결실된 것일 수 있다. 보다 구체적으로, IL-12B 변이체는 상기 서열번호 86의 서열에서 최대 1개 내지 8개의 아미노산이 치환된 것일 수 있다.
상기 IL-12B(p40)의 변이체는 IL-12의 헤파린 결합에 관여하는 아미노산이 치환된 것일 수 있다.
일 구체예에 있어서, 상기 IL-12B(p40)의 변이체는 IL-12B 내의 헤파린과 결합하는 라이신(K)이 다른 아미노산으로 치환된 형태일 수 있다. 구체적으로, 서열번호 74의 258번, 260번, 263번 및 264번의 라이신이 다른 아미노산으로 치환된 형태일 수 있다. 구체적으로, 상기 IL-12B(p40)의 변이체는 서열번호 74의 아미노산 서열에서 K258A, K260A, K263A 및 K264A으로 이루어지는 군으로부터 선택되는 하나 이상의 치환이 일어난 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 상기 IL-12B(p40)의 변이체는 서열번호 74의 아미노산 서열에서 K258A 및 K263A의 치환이 일어난 아미노산 서열을 포함하거나, 서열번호 74의 아미노산 서열에서 K260A 및/또는 K264A의 변이를 더 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 IL-12B(p40)의 변이체는 IL-12B 내의 헤파린과 결합하는 알지닌(R) 또는 라이신(K)이 다른 아미노산으로 치환된 형태일 수 있다. 구체적으로, 서열번호 86의 254의 알지닌 및/또는 255, 256 및 260번의 라이신이 다른 아미노산으로 치환된 형태일 수 있다. 구체적으로, 상기 IL-12B(p40)의 변이체는 서열번호 86의 아미노산 서열에서 R254A, K255A, K256A 및 K260A으로 이루어지는 군으로부터 선택되는 하나 이상의 치환이 일어난 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 서열번호 86의 아미노산 서열에서 R254A, K255A, K256A 및 K260A의 변이를 포함하는 것일 수 있다.
일 구체예에 있어서, IL-12B(p40)의 변이체는 상기 서열번호 77, 서열번호 79, 서열번호 89 또는 서열번호 91의 아미노산 서열을 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 인간 IL-12B 변이체는 하기 [구조식 A]로 이루어진 것일 수 있다.
[구조식 A]
X1-L-X2
여기서, X1은 서열번호 125의 아미노산 서열이고,
X2는 서열번호 126의 아미노산 서열이며,
L은 V-A1-A2-Q-A3-K*-A4-A5-A6-A7-K*-A8로 이루어진 아미노산 서열이다.
상기 A1은 R 또는 Q이고, A2는 V, A 또는 I이며, A3은 G 또는 R이고, A4는 S, N 또는 K*이며, A5는 K*, N 또는 E이고, A6은 R 또는 K이며, A7은 E, M 또는 T이고, A8은 K* 또는 E이다.
상기 "*"로 표시된 하나 이상의 아미노산 잔기는 이에 제한되지는 않으나, A, G, I, L, M, F, P 및 V로 이루어진 군으로부터 선택된 비극성 아미노산 잔기로 치환될 수 있다.
일 구체예에 있어서, 상기 IL-12B(p40)의 변이체는 헤파린 결합에 관여하는 아미노산의 치환을 포함하여 암세포에 대한 사멸 효과는 유지하면서도, IL-12의 사이토카인 연관 독성을 감소시키는 것일 수 있다.
FAP 및 FAP에 특이적으로 결합하는 항원 결합 부위
본 명세서에서 사용된 용어, "FAP(Fibroblast activation protein)"은 세포 표면에서 발현되고 다양한 종양 유형의 종양 세포 또는 다양한 종양 유형의 종양 세포 환경에서 제시되는 단백질인 섬유아세포 활성화 단백질을 지칭한다. FAP은 종양 미세환경의 종양-연관 섬유아세포(cancer-associated fibroblast, CAF) 표면에 선택적으로 과발현하고 있는 것으로 알려져 있다.
또한, FAP은 효소 촉매 도메인이 위치하는 C-말단 세포외 도메인을 갖는 2개의 N-글리코실화된 서브유닛을 함유하는 동종이량체로, 글리코실화된 형태의 FAP은 포스트(post)-프롤릴 다이펩티딜 펩티다제 및 젤라티나제(gelatinase) 활성 모두를 갖는다.
한편, FAP은 프롤릴 엔도 펩티다아제(Prolyl endopeptidase)로서, 약 170 kDa의 막에 결합된 겔라티나제(gelatinase)이다. 상기 Prolyl endopeptidase FAP은 특정 아미노산 서열을 인지하여 절단할 수 있다. 이에 따라, FAP은 FAPα, 세파라제(seprase), 또는 순환 항플라스민-절단 효소(circulating antiplasmin-cleaving enzyme)로도 명명된다.
상기 FAP의 아미노산 서열은 GenBank accession No. AAC51668에 기재된 것일 수 있으며, 인간 FAP은 단일클론 항체(mAb) F19(국제특허출원 공개 제WO 93/05804호 참조)의 사용을 통해 배양된 섬유아세포에서 처음으로 확인되었다. FAP은 많은 암들에서 발현되고 정상 조직에서의 제한된 발현으로 인해 다양한 암종의 영상화, 진단 및 치료를 위한 기대되는 항원성 표적으로 활용된다.
상기 FAP은 세포에 의해 천연적으로 발현되거나 FAP 유전자로 형질감염된 세포 상에서 발현되는 인간 FAP의 임의의 변이체, 동형 및 종 상동체를 포함한다. 본 발명의 항체는 암세포(종양 세포 또는 종양 간질의 세포)의 막 또는 세포 표면 상에 존재하는 FAP에 결합할 수 있고, ADCC 또는 다른 이펙터 매개된 암세포의 사멸을 유발할 수 있다. 또한, FAP의 효소 활성(예를 들면, 세린 펩티다제, 젤라티나제, 콜라게나제 활성), FAP 매개된 ECM 분해, 및 FAP 매개된 세포 침습 또는 이동을 차단하는 데에 사용될 수 있다.
본 명세서에서 사용된 용어 "특이적으로 결합하는"은 비-특이적 상호작용과 측정가능하게 상이한 결합을 의미한다. 특이적 결합은 결합 활성을 갖지 않는 표적과 유사한 대조군 분자와 경쟁함으로써 결정될 수 있다.
본 명세서에서 사용된 용어 "항원 결합 부위(Epitope)"는 항체의 가변 영역에서 특이적 항원 결합 부위와 상호작용하는 결정인자를 지칭한다. 상기 항원 결합 부위는 아미노산 또는 당 측쇄와 같은 분자의 그룹이며, 보통 특이적 구조적 특징뿐만 아니라 특이적 하전 특징을 가진다. 상기 FAP에 특이적으로 결합하는 항원 결합 부위는 FAP에 특이적으로 항원-항체 결합을 할 수 있는 분자를 총칭할 수 있다.
또한, 상기 항체 또는 이의 단편은 FAP과 특이적으로 결합할 수 있는 항원결합도메인을 포함하는 한 어떠한 형태로도 이용될 수 있다.
상기 항원 결합 부위는 결합에 직접적으로 수반되지 않는 다른 아미노산, 또는 항원 결합 부위의 아미노산 잔기에 의해 효과가 차단되는 아미노산을 포함할 수 있다.
구체적으로, 상기 항원 결합 부위는 FAP에 특이적으로 결합하는 항체 또는 이의 단편일 수 있다.
본 명세서에서 사용된 용어 "항체"는, 항원 결합 부위를 함유하는 분자, 및 항원 결합 부위를 함유하는 면역글로불린 분자의 면역학적 활성 단편을 지칭한다. 면역글로불린 분자는 IgG, IgE, IgM, IgD, IgA, IgY 또는 이의 하위부류(subclass)의 면역글로불린 분자일 수 있다. 항체는 합성 항체, 모노클로날 항체, 단일 도메인 항체, 단쇄 항체, 재조합적으로 생산된 항체, 다중특이적 항체(이중특이적 항체를 포함함), 인간 항체, 인간화 항체, 키메라 항체, 인트라바디(intrabody), scFv(예를 들어, 단일특이적 및 이중특이적 등을 포함함), Fab 단편, F(ab') 단편, 이황화-연결 Fv(sdFv), 항-이디오타입(anti-idiotypic)(항-Id) 항체, 및 상기 항체의 항원 결합 단편을 포함하나, 이에 제한되지 않는다.
본 명세서에서 사용된 용어 "항체 단편"은 항체의 일부, 예컨대, F(ab')2, F(ab)2, Fab', Fab, Fv, scFv일 수 있다. 구조와 상관없이, 항체 단편은 온전한(intact) 항체에 의해 인지되는 동일한 항원과 결합한다.
일 구체예에 있어서, 상기 FAP에 특이적으로 결합하는 항원 결합 부위는 서열번호 96의 HCDR1, 서열번호 97의 HCDR2 및 서열번호 98의 HCDR3을 포함하는 중쇄 가변 영역; 및 서열번호 99의 LCDR1, 서열번호 100의 LCDR2, 서열번호 101의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 이때, 일 구체예에 있어서, 상기 FAP에 특이적으로 결합하는 항원 결합 부위는 서열번호 102의 중쇄가변영역 및 서열번호 103의 경쇄가변영역을 가질 수 있다.
또한, 일 구체예에 있어서 서열번호 104의 HCDR1, 서열번호 105의 HCDR2 및 서열번호 106의 HCDR3을 포함하는 중쇄 가변 영역; 및 서열번호 107의 LCDR1, 서열번호 108의 LCDR2, 서열번호 109의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 이때, 일 구체예에 있어서 상기 FAP에 특이적으로 결합하는 항원 결합 부위는 서열번호 110의 중쇄 가변 영역 및 서열번호 111의 경쇄가변영역을 가질 수 있다.
일 구체예에 있어서, 상기 FAP에 특이적으로 결합하는 항원 결합 부위는 scFv일 수 있다. 이때, 상기 scFv는 상술한 중쇄 및 경쇄 CDR을 포함할 수 있다. 상기 FAP에 특이적으로 결합하는 scFv의 일 구체예에 있어서 서열번호 72 또는 서열번호 84의 아미노산 서열을 가질 수 있다.
또한, 상기 FAP에 특이적으로 결합하는 항원 결합 부위는 공지된 항-FAP 항체 또는 이의 단편을 포함하는 것일 수 있다. 상기 항-FAP 항체 또는 이의 단편은 당업자에게 알려진 항체를 제한 없이 의미할 수 있다.
상기 항-FAP 항체 또는 이의 단편은 NG-641, AMG-506/MP-0310, RG-7827의 28H1, RG-7827의 4B9, OMTX-705, 3F2, 4G8, 3D9, 4B3, 19G1, 20G8, 5B8, 5F1, 14B3, 16F1, 16F8, O3C9, 29B11, O2D7 및 23C10으로 이루어지는 군으로부터 선택되는 하나 이상의 가변영역을 포함하는 것일 수 있다.
다른 한가지 예로, 상기 항체는 한국공개특허 KR 20200037826 A, 미국공개특허 US 2020-0385488 A1, 미국등록특허 US 3,924,445 B2, 미국등록특허 US 9,011,847 B2 또는 미국공개특허 US 2017-007716 A1에 개시된 항-FAP 항체 또는 이의 단편을 사용할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 NG-641의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 127의 HCDR1, 서열번호 128의 HCDR2, 서열번호 129의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 130의 LCDR1, 서열번호 131의 LCDR2, 서열번호 132의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 248의 중쇄가변영역 및 서열번호 249의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 28H1의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 133의 HCDR1, 서열번호 134의 HCDR2, 서열번호 135의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 136의 LCDR1, 서열번호 137의 LCDR2, 서열번호 138의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 250의 중쇄가변영역 및 서열번호 251의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 4B9의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 139의 HCDR1, 서열번호 140의 HCDR2, 서열번호 141의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 142의 LCDR1, 서열번호 143의 LCDR2, 서열번호 144의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 252의 중쇄가변영역 및 서열번호 253의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 OMTX-705의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 145의 HCDR1, 서열번호 146의 HCDR2, 서열번호 147의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 148의 LCDR1, 서열번호 149의 LCDR2, 서열번호 150의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 254의 중쇄가변영역 및 서열번호 255의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 3F2의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 151의 HCDR1, 서열번호 152의 HCDR2, 서열번호 153의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 154의 LCDR1, 서열번호 155의 LCDR2, 서열번호 156의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 256의 중쇄가변영역 및 서열번호 257의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 4G8의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 157의 HCDR1, 서열번호 158의 HCDR2, 서열번호 159의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 160의 LCDR1, 서열번호 161의 LCDR2, 서열번호 162의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 258의 중쇄가변영역 및 서열번호 259의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 3D9의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 163의 HCDR1, 서열번호 164의 HCDR2, 서열번호 165의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 166의 LCDR1, 서열번호 167의 LCDR2, 서열번호 168의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 260의 중쇄가변영역 및 서열번호 261의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 4B3의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 169의 HCDR1, 서열번호 170의 HCDR2, 서열번호 171의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 172의 LCDR1, 서열번호 173의 LCDR2, 서열번호 174의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 262의 중쇄가변영역 및 서열번호 263의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 19G1의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 175의 HCDR1, 서열번호 176의 HCDR2, 서열번호 177의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 178의 LCDR1, 서열번호 179의 LCDR2, 서열번호 180의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 264의 중쇄가변영역 및 서열번호 265의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 20G8의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 181의 HCDR1, 서열번호 182의 HCDR2, 서열번호 183의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 184의 LCDR1, 서열번호 185의 LCDR2, 서열번호 186의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 266의 중쇄가변영역 및 서열번호 267의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 5B8의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 187의 HCDR1, 서열번호 188의 HCDR2, 서열번호 189의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 190의 LCDR1, 서열번호 191의 LCDR2, 서열번호 192의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 268의 중쇄가변영역 및 서열번호 269의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 5F1의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 193의 HCDR1, 서열번호 194의 HCDR2, 서열번호 195의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 196의 LCDR1, 서열번호 197의 LCDR2, 서열번호 198의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 270의 중쇄가변영역 및 서열번호 271의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 14B3의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 199의 HCDR1, 서열번호 200의 HCDR2, 서열번호 201의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 202의 LCDR1, 서열번호 203의 LCDR2, 서열번호 204의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 272의 중쇄가변영역 및 서열번호 273의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 16F1의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 205의 HCDR1, 서열번호 206의 HCDR2, 서열번호 207의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 208의 LCDR1, 서열번호 209의 LCDR2, 서열번호 210의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 274의 중쇄가변영역 및 서열번호 275의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 16F8의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 211의 HCDR1, 서열번호 212의 HCDR2, 서열번호 213의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 214의 LCDR1, 서열번호 215의 LCDR2, 서열번호 216의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 276의 중쇄가변영역 및 서열번호 277의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 O3C9의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 217의 HCDR1, 서열번호 218의 HCDR2, 서열번호 219의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 220의 LCDR1, 서열번호 221의 LCDR2, 서열번호 222의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 278의 중쇄가변영역 및 서열번호 279의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 22A3의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 223의 HCDR1, 서열번호 224의 HCDR2, 서열번호 225의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 226의 LCDR1, 서열번호 227의 LCDR2, 서열번호 228의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 280의 중쇄가변영역 및 서열번호 281의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 29B11의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 229의 HCDR1, 서열번호 230의 HCDR2, 서열번호 231의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 232의 LCDR1, 서열번호 233의 LCDR2, 서열번호 234의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 282의 중쇄가변영역 및 서열번호 283의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 O2D7의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 235의 HCDR1, 서열번호 236의 HCDR2, 서열번호 237의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 238의 LCDR1, 서열번호 239의 LCDR2, 서열번호 240의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 284의 중쇄가변영역 및 서열번호 285의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 23C10의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 241의 HCDR1, 서열번호 242의 HCDR2, 서열번호 243의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 244의 LCDR1, 서열번호 245의 LCDR2, 서열번호 246의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-FAP 항체는 서열번호 286의 중쇄가변영역 및 서열번호 287의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-FAP 항체는 AMG-506/MP-0310일 수 있다. 구체적으로, 상기 항체는 서열번호 247의 아미노산 서열을 포함하는 것일 수 있다.
상기 항-FAP 항체는 암세포상에 존재하는 FAP에 특이적으로 결합하여, 암세포의 사멸을 유발할 수 있는 한 어떠한 항체도 이용될 수 있다.
제1 단량체의 구조
상기 제1 단량체는 IL-12 또는 이의 변이체를 포함한다.
상기 제1 단량체는 FAP에 특이적으로 결합하는 항원 결합 부위를 추가적으로 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 제1 단량체는 IL-12 또는 이의 변이체; 및 Fc 영역 단편 또는 이의 변이체를 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 제1 단량체는 IL-12 또는 이의 변이체, Fc 영역 단편 또는 이의 변이체 및 FAP에 특이적으로 결합하는 항원 결합 부위를 포함하는 것일 수 있다.
상기 제1 단량체는 하기 구조식 (III) 또는 구조식 (IV)를 포함하는 것일 수 있다.
N'-X-[링커(2)]p-Fc 영역 단편 또는 이의 변이체-[링커(3)]q-(T)r-C' (III)
N'-(T)r-[링커(2)]q -Fc 영역 단편 또는 이의 변이체-[링커(3)]p-X-C' (IV)
이때, 상기 구조식 (III) 및 (IV)에 있어서,
상기 N'은 융합단백질의 N-말단이고, 상기 C'는 융합단백질의 C-말단이며,
상기 X는 상기 구조식 (I) 또는 (II)이고,
상기 T는 FAP에 특이적으로 결합하는 항원 결합 부위이며,
상기 링커(2) 및 링커(3)는 펩타이드 링커이고, 상기 p, q 및 r은 각각 독립적으로 O 또는 1일 수 있다.
일 구체예에 있어서, 상기 r이 0인 경우, 상기 제1 단량체는 IL-12 또는 이의 변이체 및 Fc 영역 단편 또는 이의 변이체가 펩타이드 링커로 연결된 융합단백질 형태일 수 있다.
이때, 상기 제1 단량체는 서열번호 3번, 서열번호 4번, 서열번호 5번, 서열번호 15번, 서열번호 20번, 서열번호 21번, 서열번호 22번 또는 서열번호 32번의 아미노산 서열을 포함하는 것일 수 있다.
이때, 상기 구조식 (III)에서 r이 1인 경우, 상기 제1 단량체는 IL-12 또는 이의 변이체에 항-FAP 항체의 단량체가 결합된 형태일 수 있다.
이때, 상기 구조식 (III)에서 r이 1인 경우, 상기 제1 단량체는 서열번호 292, 서열번호 293, 서열번호 296, 서열번호 297, 서열번호 298, 서열번호 299, 서열번호 302 또는 서열번호 303의 아미노산 서열을 포함하는 것일 수 있다.
이때, 상기 구조식 (IV)에서 r이 1인 경우, 상기 제1 단량체는 서열번호 294, 서열번호 295, 서열번호 300 또는 서열번호 301의 아미노산 서열을 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 r이 1인 경우, 상기 구조식 (III)은 하기 구조식 (III') 및 (III'')를 포함하는 것일 수 있다.
N'-X-[링커(2)]p-Fc 영역 단편 또는 이의 변이체-[링커(3)]q-(T')-C' (III')
N'-(T'')-C' (III'')
이때, 상기 구조식 (III') 및 (III'')에 있어서,
T'은 FAP에 특이적으로 결합하는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하거나, 또는 항체의 경쇄 영역이고;
T''은 FAP에 특이적으로 결합하는 항체의 경쇄 영역이거나, 또는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하며;
이때, T' 및 T''은 결합하여 항체의 가변 영역을 형성하고, 이때, 상기 가변 영역은 FAP에 특이적으로 결합하며;
상기 링커(2) 내지 링커(3)는 펩타이드 링커이며, 상기 p 및 q은 각각 독립적으로 0 또는 1이고, N', X 및 C'는 상기에서 정의한 바와 같다.
일 구체예에 있어서, 상기 r이 1인 경우, 상기 구조식 (IV)는 하기 구조식 (IV') 및 (IV'')를 포함하는 것일 수 있다.
N'-(T')-[링커(2)]q-Fc 영역 단편 또는 이의 변이체-[링커(3)]p-X-C' (IV'); 및
N'-(T'')-C' (IV'')
이때, 상기 구조식 (IV') 및 (IV'')에 있어서,
T'은 FAP에 특이적으로 결합하는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하거나, 또는 항체의 경쇄 영역이고;
T''은 FAP에 특이적으로 결합하는 항체의 경쇄 영역이거나, 또는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하며;
이때, T' 및 T''은 결합하여 항체의 가변 영역을 형성하고, 이때, 상기 가변 영역은 FAP에 특이적으로 결합하며;
상기 링커(2) 내지 링커(3)는 펩타이드 링커이며, 상기 p 및 q은 각각 독립적으로 0 또는 1이고, N', X 및 C'는 상기에서 정의한 바와 같다.
이때, 상기 제1 단량체는 서열번호 10 및 서열번호 2; 서열번호 11 및 서열번호 2; 서열번호 27 및 서열번호 19; 서열번호 28 및 서열번호 19; 서열번호 294 및 서열번호 2; 서열번호 295 및 서열번호 2; 서열번호 300 및 서열번호 19; 또는 서열번호 301 및 서열번호 19의 아미노산 서열을 포함하는 것일 수 있다.
제2 단량체의 구조
상기 제2 단량체는 FAP에 특이적으로 결합하는 항원 결합 부위를 추가적으로 더 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 제2 단량체는 제1 FAP 결합 부위; 및 제2 FAP 결합 부위를 포함하는 것일 수 있다.
상기 FAP에 특이적으로 결합하는 항원 결합 부위는 Fab, scFv, Fv 또는 이의 단편일 수 있다. 이때, 제1 FAP 결합 부위는 Fab이며, 제2 FAP 결합 부위는 Fv 또는 scFv일 수 있다.
상기 제2 FAP 결합 부위는 제2 단량체의 N 말단 또는 C 말단에 결합하는 것일 수 있다. 구체적으로, 제2 단량체는 중쇄의 C 말단, 경쇄의 C 말단, 가변부위의 C 말단에 추가적으로 결합된 것일 수 있다.
상기 제2 단량체는 하기 구조식 (V)를 포함하는 것일 수 있다.
N'-(R)s-[링커(4)]t-Q-[링커(5)]u-Fc 영역 단편 또는 이의 변이체-[링커(6)]v-(W)a-C' (V)
상기 구조식 (V)에 있어서,
상기 N'은 융합단백질의 N-말단이고, 상기 C'는 융합단백질의 C-말단이며,
상기 R 및 Q는 FAP에 특이적으로 결합하는 항원 결합 부위이고,
상기 W는 FAP에 특이적으로 결합하는 scFv; 또는 구조식 (I) 또는 (II)의 IL-12 또는 이의 변이체이고,
상기 링커(4), 링커(5) 및 링커(6)은 각각 펩타이드 링커이며, 상기 s, t, u, v 및 a는 각각 독립적으로 O 또는 1일 수 있다.
일 구체예에 있어서, 상기 구조식 (V)는 서열번호 1, 서열번호 2, 서열번호 6, 서열번호 7, 서열번호 8, 서열번호 9, 서열번호 14, 서열번호 18, 서열번호 19, 서열번호 23, 서열번호 24, 서열번호 25, 서열번호 26, 서열번호 31, 서열번호 294, 서열번호 295, 서열번호 300 및 서열번호 301으로 이루어지는 군으로부터 선택된 하나 이상의 아미노산 서열을 포함할 수 있다.
일 구체예에 있어서, 상기 구조식 (V)는 하기 구조식 (V') 및 (V'')을 포함하는 것일 수 있다.
N'-(R')s-[링커(4)]t-Q'-[링커(5)]u-Fc 영역 단편 또는 이의 변이체-[링커(6)]p-(W)a-C' (V')
N'-(R'')s-[링커(4)]t-Q''-[링커(7)]x-(W)b-C' (V'')
상기 구조식 (V') 및 (V'')에 있어서,
R'은 FAP에 특이적으로 결합하는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하거나, 또는 항체의 경쇄 영역이고;
R''은 FAP에 특이적으로 결합하는 항체의 경쇄 영역이거나, 또는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하며;
이때, R' 및 R''은 결합하여 항체의 가변 영역을 형성하고, 이때, 상기 가변 영역은 FAP에 특이적으로 결합하며;
Q'은 FAP에 특이적으로 결합하는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하거나, 또는 항체의 경쇄 영역이고;
Q''은 FAP에 특이적으로 결합하는 항체의 경쇄 영역이거나, 또는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하며;
이때, Q' 및 Q''는 결합하여 항체의 가변 영역을 형성하고, 이때, 상기 가변 영역은 FAP에 특이적으로 결합하며,
상기 W는 FAP에 특이적으로 결합하는 scFv; 또는 구조식 (I) 또는 (II)의 IL-12 또는 이의 변이체이고,
상기 링커(4), 링커(5), 링커(6) 및 링커(7)은 각각 펩타이드 링커이며, 상기 s, t, u, x, a 및 b는 각각 독립적으로 O 또는 1일 수 있다.
일 구체예에 있어서, 상기 구조식 (V')는 서열번호 1, 서열번호 6, 서열번호 8, 서열번호 14, 서열번호 18, 서열번호 23, 서열번호 25, 서열번호 31 서열번호 294, 서열번호 295, 서열번호 300 또는 서열번호 301일 수 있다.
일 구체예에 있어서, 상기 구조식 (V'')는 서열번호 2, 서열번호 7, 서열번호 9, 서열번호 19, 서열번호 24 또는 서열번호 26일 수 있다. 일 구체예에 있어서, 상기 제2 단량체는 서열번호 102의 아미노산 서열로 이루어진 중쇄 및 서열번호 103의 아미노산 서열로 이루어진 경쇄; 또는 서열번호 110의 아미노산 서열로 이루어진 중쇄 및 서열번호 111의 아미노산 서열로 이루어진 경쇄를 포함하는 것일 수 있다.
또한, W가 scFv인 경우, 상기 W는 서열번호 72 또는 서열번호 84의 아미노산 서열을 가질 수 있다.
펩타이드 링커
본 명세서에서 사용하는 용어, "펩타이드 링커"는 융합 단백질 내에서 도메인과 도메인 사이에 물리 화학적 거리를 두거나, 혹은 연결을 위하여 사용되는 펩타이드이다. 상기 링커는 면역글로불린의 힌지 영역을 포함할 수 있다.
상기 펩타이드 링커(1) 내지 (7)은 아미노산으로 구성된 펩타이드 링커를 의미한다. 구체적으로, 상기 펩타이드 링커(2) 또는 펩타이드 링커(5)는 5 내지 80개의 연속된 아미노산, 7 내지 70개의 연속된 아미노산, 또는 10 내지 60개의 연속된 아미노산, 또는 12 내지 50개의 아미노산으로 이루어질 수 있다. 상기 펩타이드 링커는 (G4S)n(이때, n은 1 내지 10의 정수)을 포함할 수 있다. 이때, (G4S)n에서 n은 각각 1, 2, 3, 4, 5, 6, 7, 8, 9 또는 10일 수 있다.
일 구체예에 있어서, 상기 펩타이드 링커(1)은 서열번호 93, 서열번호 94 또는 서열번호 95의 아미노산 서열로 이루어진 펩타이드 링커일 수 있다.
상기 펩타이드 링커(2) 또는 펩타이드 링커(5)는 5 내지 80개의 연속된 아미노산, 7 내지 70개의 연속된 아미노산, 또는 10 내지 60개의 연속된 아미노산, 또는 12 내지 50개의 아미노산으로 이루어질 수 있다. 일 구체예에 있어서 펩타이드 링커(2)는 30개의 아미노산으로 이루어질 수 있다. 또한, 펩타이드 링커(2)는 적어도 하나의 시스테인을 포함할 수 있다. 구체적으로, 한 개, 두 개 또는 세 개의 시스테인을 포함할 수 있다. 또한, 상기 펩타이드 링커(2)는 면역글로불린의 힌지에서 유래된 것일 수 있고 (G4S)n(이때, n은 1 내지 10의 정수)을 추가로 더 포함할 수 있다. 구체적으로, 펩타이드 링커(2)는 서열번호 112, 113, 114, 115, 116, 117 및 119 중 어느 하나의 아미노산 서열로 이루어진 힌지 영역을 포함할 수 있다.
또한, 펩타이드 링커(3), 펩타이드 링커(4), 펩타이드 링커(6) 및 펩타이드 링커(7)은 1 내지 30개의 연속된 아미노산, 5 내지 20개의 연속된 아미노산, 또는 10 내지 15개의 연속된 아미노산으로 이루어질 수 있다. 상기 펩타이드 링커는 (G4S)n(이때, n은 1 내지 10의 정수)을 포함할 수 있다. 이때, (G4S)n에서 n은 각각 1, 2, 3, 4, 5, 6, 7, 8, 9 또는 10일 수 있다.
또한, 구체적으로, 상기 펩타이드 링커(2), 펩타이드 링커(3) 또는 펩타이드 링커(5)는 서열번호 93 또는 서열번호 94을 포함할 수 있다.
본 발명의 일 실시예에서 펩타이드 링커(2) 또는 펩타이드 링커 (5)는 서열번호 118 또는 120의 아미노산 서열을 포함하는 펩타이드 링커일 수 있다.
Fc 영역 또는 이의 단편
이때, 상술한 면역글로불린 단편은 면역글로불린의 Fc 영역일 수 있다. 상기 면역글로불린의 Fc 영역은 야생형 Fc 도메인뿐만 아니라, Fc 도메인 변이체일 수 있다. 이때, 상기 Fc 영역은 IgG, IgA, IgE, IgD 또는 IgM의 Fc 영역일 수 있으며, 구체적으로, IgG1 또는 IgG2a에서 유래한 것일 수 있다.
본 명세서에서 사용된 용어 "Fc 도메인 변이체"는 야생형 Fc 도메인의 당쇄 형태(glycosylation pattern)와 다르거나, 야생형 Fc 도메인에 비해 증가된 당쇄, 야생형 Fc 도메인에 비해 감소한 당쇄, 또는 당쇄가 제거된(deglycosylated) 형태일 수 있다. 또한 무당쇄(aglycosylated) Fc 도메인도 포함된다. Fc 도메인 혹은 변이체는 배양조건 혹은 호스트의 유전자 조작을 통해 조정된 숫자의 시알산(sialic acid), 퓨코실화(fucosylation), 당화(glycosylation)를 갖도록 한 것일 수 있다.
또한, 화학적 방법, 효소적 방법 및 미생물을 사용한 유전공학적 엔지니어링 방법 등과 같이 통상적인 방법으로 면역글로불린의 Fc 도메인의 당쇄를 변형시킬 수 있다. 또한, 상기 Fc 도메인 변이체는 면역글로불린은 IgG, IgA, IgE, IgD 또는 IgM의 Fc 영역이 혼합된 형태일 수 있다. 또한, 상기 Fc 도메인 변이체는 상기 Fc 도메인의 일부 아미노산이 다른 아미노산으로 치환된 형태일 수 있다.
상기 치환 및/또는 부가에 의해 도입되는 "아미노산"은 라이신(K), 알라닌(A), 알지닌(R), 아스파라진(N), 아스파르트산(D), 시스테인(C), 글루타민(Q), 글루탐산(E), 글라이신(G), 히스티딘(H), 이소류신(I), 류신(L), 메티오닌(M), 페닐알라닌(F), 프로린(P), 세린(S), 트레오닌(T), 트립토판(W), 타이로신(Y) 및 발린(V)으로 구성된 군에서 선택되는 어느 하나일 수 있다.
또한, 상기 Fc 영역은 놉 구조 또는 홀 구조를 포함할 수 있다.
본 명세서에서 사용된 용어 "놉-인투-홀(knob-into-hole)"은 이중특이적 항체, 다중특이적 항체, 또는 이종이량체 항체 등과 같이, 서로 다른 영역에 특이적으로 결합하는 항체를 제조하기 위한 설계 전략이다. 상기 놉-인투-홀은 놉-인-홀이라고도 명명한다. 일반적으로, 이러한 기술은 제1 폴리펩티드의 경계면(가령, 제1 항체 중쇄의 제1 CH3 도메인)에 놉(knob)을 그리고 제2 폴리펩티드의 경계면(가령, 제2 항체 중쇄의 제2 CH3 도메인)에 상응하는 홀(hole)을 도입하는 것을 포함하고, 그리하여 놉을 홀 내 위치시켜 이종이량체 형성을 촉진시키고 동종이량체 형성을 방해하도록 할 수 있다.
'놉'은 제1 폴리펩티드의 경계면(가령, 제1 항체 중쇄의 제1 CH3 도메인)으로부터의 소형 아미노산 측쇄들을 보다 큰 측쇄들(예컨대, 아르기닌, 페닐알라닌, 티로신 또는 트립토판)로 대체함으로써 구축된다. 상기 놉에 동일하거나 유사한 크기의 상보적 '홀'은 제2 폴리펩티드의 경계면(가령, 제2 항체 중쇄의 제2 CH3 도메인)에서 대형 아미노산 측쇄를 보다 작은 측쇄들(예컨대, 알라닌, 세린, 발린, 또는 트레오닌)로 대체함으로써 생성된다. 상기 놉 및 홀은 폴리펩티드를 인코딩하는 핵산을, 예컨대, 부위-특이적 돌연변이 유발에 의해, 또는 펩티드 합성에 의해 변경함으로써 생성될 수 있다.
일 구체예에 있어서, 상기 IgG1의 놉 구조는 서열번호 13 또는 288일 수 있고, 홀 구조는 서열번호 12 또는 289일 수 있다. 상기 놉 구조 또는 홀 구조는 146번째, 148번째 및 187번째 아미노산이 다른 아미노산으로 치환된 형태일 수 있다. 구체적으로, 본 발명의 일 실시예에서 놉 구조는 또는 홀 구조는 T146W, T146S, L148A 및 Y187V으로 구성된 군으로부터 선택된 하나 이상이 치환된 형태일 수 있다. 구체적으로, 놉 구조는 T146W로 치환된 형태일 수 있고, 홀 구조는 T146S, L148A 및 Y187V로 치환된 형태일 수 있다.
한편, 본 발명의 일 실시예에서 IgG2a의 놉 구조는 서열번호 30 또는 290일 수 있고, 홀 구조는 서열번호 29 또는 291일 수 있다. 상기 놉 구조 또는 홀 구조는 152번째, 154번째 및 193번째 아미노산이 다른 아미노산으로 치환된 형태일 수 있다. 구체적으로, 본 발명의 일 실시예에서 놉 구조는 또는 홀 구조는 T152W, T152S, M154A 및 Y193V로 구성된 군으로부터 선택된 하나 이상이 치환된 형태일 수 있다.
일 구체예에 있어서, 상기 Fc 도메인 변이체는 DANG 변이 또는 NG 변이를 포함하는 것일 수 있다. 이때, "DANG 변이"는 인간 IgG1 또는 마우스 IgG2a 내의 효과기 기능을 제거하기 위한 D265A/N297G 돌연변이를 지칭한다.
IgG 분자에서 상기 Fc 영역이 매개하는 효과기 기능은 C1q 결합, 보체 의존성 세포독성, Fc 수용체 결합, 항체 의존성 세포 매개의 세포독성(ADCC), 식균작용, 세포 표면 수용체(예컨대, B 세포 수용체, BCR)의 저하 조절 등을 포함한다. 이러한 효과기 기능은 일반적으로 Fc 영역을 결합 도메인(예컨대, 항체 가변 도메인)과 결합시키는 것을 필요로 한다.
비변이 Fc 영역의 아미노산 서열의 치환으로 효과기 기능을 변화시킬 수 있으며, 효과기 기능이 변화된 Fc 영역은 예를 들어 C1q 결합 및/또는 FcR 결합을 변형시켜 이에 따라 CDC 활성 및/또는 ADCC 활성을 변화시킴으로써 설계할 수 있다. 즉, 상기 'DANG 변이'는 항체 제조시 원하지 않는 효과기 작용이 발생하지 않도록 IgG 분자에서 상기 Fc 영역이 매개하는 효과기 기능을 제거함을 의미한다.
일 실시예에 있어서, 상기 DANG 변이는 서열번호 289의 인간 IgG1 내 아미노산이 D45A/N77G로 치환된 형태일 수 있다. 또한, 서열번호 291의 마우스 IgG2a 내 아미노산이 D51A/N83G로 치환된 형태일 수 있다.
융합단백질의 구조
상기 융합단백질은 항체일 수 있다. 구체적으로, 상기 항체는 놉-인-홀 구조를 포함하는 헤테로다이머 항체일 수 있다.
상기 융합단백질은 구조식 (III) 및 구조식 (V); 또는 구조식 (IV) 및 구조식 (V)를 포함하는 것일 수 있다.
보다 구체적으로, 상기 융합단백질의 일 구체예는 하기 (i) 또는 (ii)의 제1 단량체; 및 하기 (iii), (iv), (v) 또는 (vi)의 제2 단량체를 포함할 수 있다:
제1 단량체의 예시:
(i) r이 0인 경우의 구조식 (III)
(ii) r이 1인 경우의 구조식 (IV)
제2 단량체의 예시:
(iii) s, a 및 b가 0인 구조식 (V') 및 구조식 (V'')
(iv) s는 1이고, a 및 b가 0인 구조식 (V') 및 구조식 (V'')
(v) s 및 b는 0이고, a는 1인 구조식 (V') 및 구조식 (V'')
(vi) b는 1이고, s 및 a가 0인 구조식 (V') 및 구조식 (V'').
일 구체예에 있어서, 상기 융합단백질은 상기 (i)을 포함하는 제1 단량체; 및 상기 (iii)을 포함하는 제2 단량체를 포함할 수 있다(도 35의 왼쪽으로부터 첫번째). 이때, 상기 융합단백질은 서열번호 1, 서열번호 2, 서열번호 3, 서열번호 4, 서열번호 5, 서열번호 18, 서열번호 19, 서열번호 20, 서열번호 21 및 서열번호 22으로 이루어진 군으로부터 선택된 하나 이상의 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 상기 융합단백질은 서열번호 1, 서열번호 2 및 서열번호 3; 서열번호 1, 서열번호 2 및 서열번호 4; 서열번호 1, 서열번호 2 및 서열번호 5; 서열번호 18, 서열번호 19 및 서열번호 20; 서열번호 18, 서열번호 19 및 서열번호 21; 또는 서열번호 18, 서열번호 19 및 서열번호 22를 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 융합단백질은 상기 (i)을 포함하는 제1 단량체; 및 상기 (iv)를 포함하는 제2 단량체를 포함할 수 있다(도 35의 왼쪽으로부터 두번째). 이때, 상기 융합단백질은 서열번호 3, 서열번호 5, 서열번호 6, 서열번호 7, 서열번호 20, 서열번호 22, 서열번호 23 및 서열번호 24으로 이루어진 군으로부터 선택된 하나 이상의 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 상기 융합단백질은 서열번호 3, 서열번호 6 및 서열번호 7; 서열번호 5, 서열번호 6 및 서열번호 7; 서열번호 20, 서열번호 23 및 서열번호 24; 또는 서열번호 22, 서열번호 23 및 서열번호 24를 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 융합단백질은 상기 (i)을 포함하는 제1 단량체; 및 상기 (v)를 포함하는 제2 단량체를 포함할 수 있다(도 35의 왼쪽으로부터 세번째). 이때, 상기 융합단백질은 서열번호 2, 서열번호 3, 서열번호 5, 서열번호 8, 서열번호 19, 서열번호 20, 서열번호 22 및 서열번호 25으로 이루어진 군으로부터 선택된 하나 이상의 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 상기 융합단백질은 서열번호 2, 서열번호 3 및 서열번호 8; 서열번호 2, 서열번호 5 및 서열번호 8; 서열번호 19, 서열번호 20 및 서열번호 25; 또는 서열번호 19, 서열번호 22 및 서열번호 25를 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 융합단백질은 상기 (i)을 포함하는 제1 단량체; 및 상기 (vi)을 포함하는 제2 단량체를 포함할 수 있다(도 35의 왼쪽으로부터 네번째). 이때, 상기 융합단백질은 서열번호 1, 서열번호 3, 서열번호 5, 서열번호 9, 서열번호 18, 서열번호 20, 서열번호 22 및 서열번호 26으로 이루어진 군으로부터 선택된 하나 이상의 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 상기 융합단백질은 서열번호 1, 서열번호 3 및 서열번호 9; 서열번호 1, 서열번호 5 및 서열번호 9; 서열번호 18, 서열번호 20 및 서열번호 26; 또는 서열번호 18, 서열번호 22 및 서열번호 26을 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 융합단백질은 상기 (ii)을 포함하는 제1 단량체; 및 상기 (iii)을 포함하는 제2 단량체를 포함할 수 있다(도 35의 왼쪽으로부터 다섯번째). 이때, 상기 융합단백질은 서열번호 1, 서열번호 2, 서열번호 10, 서열번호 11, 서열번호 18, 서열번호 19, 서열번호 27 및 서열번호 28으로 이루어진 군으로부터 선택된 하나 이상의 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 상기 융합단백질은 서열번호 1, 서열번호 2 및 서열번호 10; 서열번호 1, 서열번호 2 및 서열번호 11; 서열번호 18, 서열번호 19 및 서열번호 27; 또는 서열번호 18, 서열번호 19 및 서열번호 28을 포함하는 것일 수 있다.
또한, 일 구체예에 있어서, IL-12 또는 이의 변이체 및 FAP에 특이적으로 결합하는 항원 결합 부위를 포함하는 융합단백질 이량체는 상기 구조식 (III)의 단량체 및 상기 구조식 (V)의 단량체를 포함하는 융합단백질 이량체일 수 있다(도 36의 왼쪽). 이때, 상기 상기 구조식 (III)에서 r은 1이고, 상기 구조식 (V)에서 s, a 및 t는 0이다. 이때, 상기 구조식 (V)는 (V') 및 (V'')를 포함할 수 있다. 이때, 상기 (V') 및 (V'')에서 s, a, t 및 b는 0이다. 또한, 상기 이량체의 Fc 영역은 놉-인-홀 구조를 가지며, 이러한 구조를 통해 서로 상이한 융합단백질이 결합될 수 있다.
구체적으로, 상기 융합단백질은 서열번호 1, 서열번호 2, 서열번호 18, 서열번호 19 서열번호 292, 서열번호 293, 서열번호 298 및 서열번호 299로 이루어진 군으로부터 선택된 하나 이상의 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 상기 융합단백질은 서열번호 1, 서열번호 2 및 서열번호 292; 서열번호 1, 서열번호 2 및 서열번호 293; 서열번호 18, 서열번호 19 및 서열번호 298; 또는 서열번호 18, 서열번호 19 및 서열번호 299을 포함하는 것일 수 있다.
또한, IL-12 또는 이의 변이체 및 FAP에 특이적으로 결합하는 항원 결합 부위를 포함하는 융합단백질 이량체는 상기 구조식 (V)의 구조를 포함하는 융합단백질 이량체일 수 있다(도 36의 가운데). 이때, 상기 융합단백질 이량체는 (V') 및 (V'')를 포함할 수 있다. 이때, 상기 구조식 (V)에서 s 및 t는 0, a는 1이다. 또한, 상기 (V') 및 (V'')에서 s, t 및 b는 0, a는 1이다. 또한, 상기 융합단백질 이량체는 상기 구조식 (IV)의 구조를 포함하는 융합단백질 이량체일 수 있다. 이때, 상기 구조식 (IV)에서 r은 1이다.
구체적으로, 상기 융합단백질은 서열번호 2, 서열번호 19, 서열번호 294, 서열번호 295, 서열번호 300 및 서열번호 301으로 이루어진 군으로부터 선택된 하나 이상의 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 상기 융합단백질은 서열번호 2 및 서열번호 294; 서열번호 2 및 서열번호 295; 서열번호 19 및 서열번호 300 또는 서열번호 19 및 서열번호 301을 포함하는 것일 수 있다.
일 구체예에 있어서, IL-12 또는 이의 변이체 및 FAP에 특이적으로 결합하는 항원 결합 부위를 포함하는 융합단백질 이량체는 상기 구조식 (III)의 구조를 포함하는 융합단백질 이량체일 수 있다(도 36의 오른쪽). 이때, 상기 구조식 (III)에서 r은 1이다.
구체적으로, 상기 융합단백질은 서열번호 296, 서열번호 297, 서열번호 302 또는 서열번호 303을 포함하는 것일 수 있다.
본원 다중 특이적 융합 단백질은 화학적으로 변형된 형태일 수 있다. 일 실시예에서, 상기 융합 단백질은 글리코실화, 아세틸화, 페길화, 인산화, 아미드화, 공지된 보호기/차단기에 의한 유도체화, 단백질 분해 절단 및/또는 세포 리간드 또는 다른 단백질을 결합하여 화학적으로 변형될 수 있다. 이처럼 수많은 화학적 변형은 알려진 기술에 의해 수행될 수 있다.
융합단백질을 코딩하는 폴리뉴클레오티드
본 발명의 다른 측면은, 상기 제1 단량체를 코딩하는 폴리뉴클레오티드 또는 상기 제2 단량체를 코딩하는 폴리뉴클레오티드를 제공한다.
일 구체예에 있어서, 상기 제1 단량체의 폴리펩티드는 서열번호 3, 서열번호 4, 서열번호 5, 서열번호 10, 서열번호 11, 서열번호 15, 서열번호 20, 서열번호 21, 서열번호 22, 서열번호 27, 서열번호 28, 서열번호 32, 서열번호 292, 서열번호 293, 서열번호 294, 서열번호 295, 서열번호 296, 서열번호 297, 서열번호 298, 서열번호 299, 서열번호 300, 서열번호 301, 서열번호 302, 또는 서열번호 303과 적어도 약 70%, 적어도 약 75%, 적어도 약 80%, 적어도 약 85%, 적어도 약 86%, 적어도 약 87%, 적어도 약 88%, 적어도 약 89%, 적어도 약 90%, 적어도 약 91%, 적어도 약 92%, 적어도 약 93%, 적어도 약 94%, 적어도 약 95%, 적어도 약 96%, 적어도 약 97%, 적어도 약 98%, 적어도 약 99%, 또는 적어도 약 100%의 동일성을 가지는 아미노산 서열을 포함할 수 있다.
일 구체예에 있어서, 상기 제1 단량체를 코딩하는 폴리뉴클레오티드는 서열번호 38, 서열번호 39, 서열번호 40, 서열번호 45, 서열번호 46, 서열번호 50, 서열번호 55, 서열번호 56, 서열번호 57, 서열번호 62, 서열번호 63, 서열번호 67와 적어도 약 70%, 적어도 약 75%, 적어도 약 80%, 적어도 약 85%, 적어도 약 86%, 적어도 약 87%, 적어도 약 88%, 적어도 약 89%, 적어도 약 90%, 적어도 약 91%, 적어도 약 92%, 적어도 약 93%, 적어도 약 94%, 적어도 약 95%, 적어도 약 96%, 적어도 약 97%, 적어도 약 98%, 적어도 약 99%, 또는 적어도 약 100%의 동일성을 가지는 것일 수 있다.
일 구체예에 있어서, 상기 제2 단량체의 폴리펩티드는 서열번호 1, 서열번호 2, 서열번호 6, 서열번호 7, 서열번호 8, 서열번호 9, 서열번호 14, 서열번호 18, 서열번호 19, 서열번호 23, 서열번호 24, 서열번호 25, 서열번호 26, 서열번호 31, 서열번호 294, 서열번호 295, 서열번호 300 또는 서열번호 301과 약 70%, 적어도 약 75%, 적어도 약 80%, 적어도 약 85%, 적어도 약 86%, 적어도 약 87%, 적어도 약 88%, 적어도 약 89%, 적어도 약 90%, 적어도 약 91%, 적어도 약 92%, 적어도 약 93%, 적어도 약 94%, 적어도 약 95%, 적어도 약 96%, 적어도 약 97%, 적어도 약 98%, 적어도 약 99%, 또는 적어도 약 100%의 동일성을 가지는 아미노산 서열을 포함할 수 있다.
일 구체예에 있어서, 상기 제2 단량체를 코딩하는 폴리뉴클레오티드는 서열번호 36, 서열번호 37, 서열번호 41, 서열번호 42, 서열번호 43, 서열번호 44, 서열번호 49, 서열번호 53, 서열번호 54, 서열번호 58, 서열번호 59, 서열번호 60, 서열번호 61, 서열번호 66, 서열번호 306과 적어도 약 70%, 적어도 약 75%, 적어도 약 80%, 적어도 약 85%, 적어도 약 86%, 적어도 약 87%, 적어도 약 88%, 적어도 약 89%, 적어도 약 90%, 적어도 약 91%, 적어도 약 92%, 적어도 약 93%, 적어도 약 94%, 적어도 약 95%, 적어도 약 96%, 적어도 약 97%, 적어도 약 98%, 적어도 약 99%, 또는 적어도 약 100%의 동일성을 가지는 것일 수 있다.
상기 폴리뉴클레오티드는 신호서열(Signal sequence) 또는 리더 서열(Leader sequence)을 코딩하는 핵산을 추가적으로 포함할 수 있다. 본 명세서에서 사용된 용어 "신호서열"은 목적 단백질의 분비를 지시하는 신호펩타이드를 의미한다. 상기 신호펩타이드는 숙주 세포에서 번역된 후에 절단된다. 구체적으로, 상기 신호서열은 ER(Endoplasmic reticulum) 막을 관통하는 단백질의 이동을 개시하는 아미노산 서열이다.
상기 신호서열은 당업계에 그 특징이 잘 알려져 있으며, 통상 16 내지 30개의 아미노산 잔기를 포함하나, 그보다 더 많거나 적은 아미노산 잔기를 포함할 수 있다. 통상적인 신호 펩타이드는 기본 N-말단 영역, 중심의 소수성 영역, 및 보다 극성인(polar) C-말단 영역의 세 영역으로 구성된다. 중심 소수성 영역은 미성숙 폴리펩타이드가 이동하는 동안 막지질 이중층을 통하여 신호서열을 고정시키는 4 내지 12개의 소수성 잔기를 포함한다.
개시 이후에, 신호서열은 흔히 신호 펩티다아제(Signal peptidases)로 알려진 세포 효소에 의하여 ER의 루멘(Lumen) 내에서 절단된다. 이때, 상기 신호서열은 tPa(Tissue Plasminogen Activation), HSV gDs(Signal sequence of Herpes simplex virus glycoprotein D), 또는 성장 호르몬(Growth hormone)의 분비신호서열일 수 있다. 바람직하게, 포유동물 등을 포함하는 고등 진핵 세포에서 사용되는 분비 신호서열을 사용할 수 있다. 또한, 상기 신호서열은 야생형 신호서열을 사용하거나, 숙주세포에서 발현 빈도가 높은 코돈으로 치환하여 사용할 수 있다.
융합단백질 및 항암제를 포함하는 약학 조성물의 용도
본 발명의 IL-12 또는 이의 변이체 및 FAP에 특이적으로 결합하는 항원 결합 부위를 포함하는 융합단백질; 및 항암제를 유효성분으로 포함하는 병용 투여용 조성물은 암 치료 또는 예방용, 및/또는 치료효과(efficacy)를 증가시킬 수 있다.
따라서, 본 발명은 암을 치료하기 위한 상기 융합단백질의 용도를 제공할 수 있다. 또한, 상기 용도는 상기 항암제와 병용하여 암을 치료하기 위한 용도일 수 있다. 더불어, 본 발명은 항암제와 병용하여 암을 치료하기 위한 약제를 제조하기 위한 상기 융합단백질의 용도를 제공한다.
상기 융합단백질 및 융합단백질 이량체는 상술한 바와 같다.
이때, 상기 암은 위암, 간암, 폐암, 대장암, 유방암, 전립선암, 피부암, 골암, 다발성골수종, 신경교종, 난소암, 췌장암, 자궁경부암, 갑상선암, 후두암, 급성 골수성 백혈병, 만성 골수성 백혈병, 급성 림프모구성 백혈병, 만성 립프모구성 백혈병, 뇌종양, 신경모세포종, 망막 모세포종, 두경부암, 침샘암 및 림프종으로 구성된 군에서 선택되는 어느 하나일 수 있다.
상기 약학 조성물의 바람직한 투여량은 환자의 상태 및 체중, 질병의 정도, 약물형태, 투여경로 및 기간에 따라 다르지만, 당업자에 의해 적절하게 선택될 수 있다. 본 발명의 종양 치료용 또는 예방용 약학 조성물에서 그 유효성분은 종양 치료 활성을 나타내거나, 특히, 암에 치료 효과를 나타낼 수 있는 한, 용도, 제형, 배합 목적 등에 따라 임의의 양(유효량)으로 포함될 수 있는데, 통상적인 유효량은 조성물 전체 중량을 기준으로 할 때 0.001 중량% 내지 20.0 중량% 범위 내에서 결정될 것이다. 여기서 "유효량"이란 질환의 상태 개선 또는 치료(treatment) 효과, 특히 암의 상태 개선 또는 치료 효과를 유도할 수 있는 유효성분의 양을 말한다. 이러한 유효량은 당업자의 통상의 능력 범위 내에서 실험적으로 결정될 수 있다.
본 명세서에서 사용된 용어, "치료"는 치료학적 처리 및 예방적 처리를 모두 포함하는 의미로 사용될 수 있다. 이때, 예방은 개체의 병리학적 상태 또는 질환을 완화시키거나 감소시키는 의미로 사용될 수 있다. 일 구체예에서, 용어 "치료"는 인간을 포함한 포유류에서 질환을 치료하기 위한 적용이나 어떠한 형태의 투약을 모두 포함한다. 또한, 상기 용어는 질환의 진행을 억제하거나 늦추는 것을 포함하며; 손상되거나, 결손된 기능을 회복시키거나, 수리하여, 질환을 부분적이거나 완전하게 완화시키거나; 또는 비효율적인 프로세스를 자극하거나; 심각한 질환을 완화하는 의미를 포함한다.
본 명세서에서 사용된 용어, "효능(efficacy)"은 1년, 5년, 또는 10년과 같이 일정 기간에 걸쳐 생존 또는 질병이 없는 상태에서 생존(disease-free survival)과 같은 하나 이상의 파라미터에 의해 결정될 수 있다. 뿐만 아니라, 상기 파라미터는 개체에서 적어도 하나의 종양의 크기가 억제되는 것을 포함할 수 있다.
생체이용률과 같은 약동학적 파라미터(Pharmacokinetic parameters) 및 클리어런스율(clearance rate)과 같은 기본적인 파라미터(underlying parameters)도 효능에 영향을 줄 수 있다. 따라서, "향상된 효능" (예를 들어, 효능의 개선)은 향상된 약동학적 파라미터 및 향상된 효능에 기인할 수 있으며, 시험 동물 또는 인간 대상체에서 클리어런스율 및 종양 치료 또는 개선과 같은 파라미터를 비교하여 측정될 수 있다.
여기서 "치료학적으로 유효한 양" 또는 "약학적으로 유효한 양"이란 대상 질환을 예방 또는 치료하는데 유효한 화합물 또는 조성물의 양으로서, 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분하며 부작용을 일으키지 않을 정도의 양을 의미한다. 상기 유효량의 수준은 환자의 건강상태, 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 방법, 투여 시간, 투여 경로 및 배출 비율, 치료 기간, 배합 또는 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다. 일 구체예에서 치료학적으로 유효한 양은 암을 치료하는데 효과적인 약물의 양을 의미한다.
이때, 상기 약학 조성물은 약학적으로 허용 가능한 담체를 더 포함할 수 있다. 상기 약학적으로 허용 가능한 담체는 환자에게 전달하기에 적절한 비-독성 물질이면 어떠한 담체라도 가능하다. 증류수, 알코올, 지방, 왁스 및 비활성 고체가 담체로 포함될 수 있다. 약물학적으로 허용되는 애쥬번트(완충제, 분산제) 또한 약학 조성물에 포함될 수 있다.
구체적으로, 상기 약학 조성물은 유효성분 이외에 약제학적으로 허용되는 담체를 포함하여 당업계에 공지된 통상의 방법으로 투여 경로에 따라 비경구용 제형으로 제조될 수 있다. 여기서 "약제학적으로 허용되는" 의미는 유효성분의 활성을 억제하지 않으면서 적용(처방) 대상이 적응 가능한 이상의 독성을 지니지 않는다는 의미이다.
상기 약학 조성물이 비경구용 제형으로 제조될 경우, 적합한 담체와 함께 당업계에 공지된 방법에 따라 주사제, 경피 투여제, 비강 흡입제 및 좌제의 형태로 제제화될 수 있다. 주사제로 제제화할 경우 적합한 담체로서는 멸균수, 에탄올, 글리세롤이나 프로필렌 글리콜 등의 폴리올 또는 이들의 혼합물을 사용할 수 있으며, 바람직하게는 링거 용액, 트리에탄올 아민이 함유된 PBS(phosphate buffered saline)나 주사용 멸균수, 5% 덱스트로스 같은 등장 용액 등을 사용할 수 있다. 약제학적 조성물의 제제화와 관련하여서는 당업계에 공지되어 있으며, 구체적으로 문헌[Remington's Pharmaceutical Sciences(19th ed., 1995)] 등을 참조할 수 있다. 상기 문헌은 본 명세서의 일부로서 간주된다.
상기 약학 조성물의 바람직한 투여량은 환자의 상태, 체중, 성별, 연령, 환자의 중증도, 투여 경로에 따라 1일 0.01 ㎍/㎏ 내지 10 g/㎏ 범위, 또는 0.01 ㎎/㎏ 내지 1 g/㎏ 범위일 수 있다. 투여는 1일 1회 또는 수회로 나누어 이루어질 수 있다. 이러한 투여량은 어떠한 측면으로든 본원 발명의 범위를 제한하는 것으로 해석되어서는 아니 된다.
상기 약학 조성물이 적용(처방)될 수 있는 대상은 포유동물 및 사람이며, 특히 사람인 경우가 바람직하다. 본원의 약학 조성물은 유효성분 이외에, 종양 치료 효과를 갖는 것으로 공지된 임의의 화합물이나 천연 추출물을 추가로 포함할 수 있다.
융합단백질 및 항암제를 포함하는 병용 치료 방법
본 발명의 또 다른 측면은, IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 FAP에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질 또는 이의 이량체; 및 항암제를 개체에 투여하는 단계를 포함하는 암을 치료 또는 예방하는 방법을 제공한다.
이때, 상기 개체는 암을 앓고 있는 개체일 수 있다. 또한 상기 개체는 포유동물일 수 있으며, 바람직하게는 인간일 수 있다. 상기 융합단백질 또는 이의 이량체, 항암제는 상술한 바와 같다.
상기 융합단백질 또는 융합단백질 이량체의 투여경로, 투여량 및 투여횟수는 환자의 상태 및 부작용의 유무에 따라 다양한 방법 및 양으로 대상에게 투여될 수 있고, 최적의 투여방법, 투여량 및 투여횟수는 통상의 기술자가 적절한 범위로 선택할 수 있다. 또한, 상기 융합 단백질 또는 융합단백질 이량체는 치료하고자 하는 질환에 대하여 치료효과가 공지된 다른 약물(예를 들어, 항암제) 또는 생리학적 활성물질과 병용하여 투여되거나, 다른 약물과의 조합 제제 형태로 제형화될 수 있다.
이하, 본원 발명을 하기 실시예에 의하여 더욱 상세하게 설명한다. 단, 하기 실시예는 본원 발명을 예시하기 위한 것일 뿐, 본원 발명의 범위가 한정되는 것은 아니다.
준비예 1. anti-FAP/IL-12 IgG1 DANG, 인간 융합단백질의 개요
PROTEIN Format Description 해당서열
T1.01 K&H anti-hu FAP/hu IL-12, hu IgG1 DANG seq1, seq2, seq3
T1.02 K&H anti-hu FAP/hu IL-12 mut1, hu IgG1 DANG seq1, seq2, seq4
T1.03 K&H anti-hu FAP/hu IL-12 mut2, hu IgG1 DANG seq1, seq2, seq5
T1.04 K&H anti-hu FAP/hu IL-12, hu IgG1 DANG (2+1) seq3, seq6, seq7
T1.05 K&H anti-hu FAP/hu IL-12 mut2, hu IgG1 DANG (2+1) seq5, seq6, seq7
T1.06 K&H anti-hu FAP/hu IL-12, hu IgG1 DANG (2+1, HC scFv) seq2, seq3, seq8
T1.07 K&H anti-hu FAP/hu IL-12 mut2, hu IgG1 DANG (2+1, HC scFv) seq2, seq5, seq8
T1.08 K&H anti-hu FAP/hu IL-12, hu IgG1 DANG (2+1, LC scFv) seq1, seq3, seq9
T1.09 K&H anti-hu FAP/hu IL-12 mut2, hu IgG1 DANG (2+1, LC scFv) seq1, seq5, seq9
T1.10 K&H anti-hu FAP/anti-hu FAP-hu IL-12, hu IgG1 DANG (2+1) seq1, seq2, seq10
T1.11 K&H anti-hu FAP/anti-hu FAP-hu IL-12 mut2, hu IgG1 DANG (2+1) seq1, seq2, seq11
T1.12 K&H anti-hu FAP/null, hu IgG1 DANG seq1, seq2, seq12
T1.13 K&H null/hu IL-12, hu IgG1 DANG seq3, seq13
T1.14 K&H null/hu IL-12 mut1, hu IgG1 DANG seq4, seq13
T1.15 K&H null/hu IL-12 mut2, hu IgG1 DANG seq5, seq13
T1.16 Mab anti-hu FAP, hu IgG1 DANG seq2, seq14
T1.17 Fc-fusion hu IL-12 mut2, hu IgG1 DANG seq15
T1.18 K&H anti-hu CD20/hu IL-12, hu IgG1 DANG seq3, seq16, seq17
T1.19 K&H anti-hu CD20/hu IL-12 mut1, hu IgG1 DANG seq4, seq16, seq17
T1.20 K&H anti-hu CD20/hu IL-12 mut2, hu IgG1 DANG seq5, seq16, seq17
T1.21 K&H anti-hu CD20/null, hu IgG1 DANG seq12, seq16, seq17
T1.23 K&H anti-hu FAP/hu IL-12-anti-hu FAP scFv, hu IgG1 DANG (2+1) seq1, seq2, seq292
T1.24 K&H anti-hu FAP/hu IL-12 mut2-anti-hu FAP scFv, hu IgG1 DANG (2+1) seq1, seq2, seq293
T1.25 Fc-fusion anti-hu FAP-hu IL-12, hu IgG1 DANG seq2, seq294
T1.26 Fc-fusion anti-hu FAP-hu IL-12 mut2, hu IgG1 DANG seq2, seq295
T1.27 Fc-fusion hu IL-12-anti-hu FAP scFv, hu IgG1 DANG Seq296
T1.28 Fc-fusion hu IL-12 mut2-anti-hu FAP scFv, hu IgG1 DANG Seq297
[seq1]은 인간 항-FAP(anti-FAP) 중쇄 가변영역 서열과 DANG 변이(D265A, N297G)를 통해 이펙터 기능을 제거하고, T366W 변이로 놉 구조를 형성한 인간 IgG1 Fc로 구성된다.[seq2]는 인간 항-FAP(anti-FAP) 경쇄 서열로 구성된다.
[seq3]은 인간 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 인간 인터루킨 12 p35(알파) 영역 서열, 링커 GGGGSGGGGS, DANG 변이(D265A, N297G)를 통해 이펙터 기능을 제거하고, T366S, L368A 및 Y407V 변이로 홀 구조를 형성한 인간 IgG1 Fc로 구성된다.
[seq4]는 인간 IL-12 p40(베타) 영역에서 헤파린 결합에 관여하는 아미노산 280번, 285번 라이신(K)을 알라닌(A)으로 변이한 서열, 링커 GGGGSGGGGSGGGGS, 인간 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 인간 IgG1 Fc hole DANG으로 구성된다.
[seq5]는 인간 IL-12 p40(베타) 영역에서 헤파린 결합에 관여하는 아미노산 280번, 282번, 285번, 286번 라이신(K)을 알라닌(A)으로 변이한 서열, 링커 GGGGSGGGGSGGGGS, 인간 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 인간 IgG1 Fc hole DANG으로 구성된다.
[seq6]은 인간 항-FAP(anti-FAP) 중쇄 가변영역 서열과 링커 GGGGSGGGGSGGGGS, 인간 항-FAP(anti-FAP) 중쇄 가변영역 서열 및 인간 IgG1 Fc knob DANG으로 구성된다.
[seq7]은 인간 항-FAP(anti-FAP) 경쇄 가변영역 서열과 링커 GGGGSGGGGSGGGGS, 인간 항-FAP(anti-FAP) 경쇄 서열로 구성된다.
[seq8]은 인간 항-FAP(anti-FAP) 중쇄 가변영역 서열과 인간 IgG1 Fc knob DANG, 링커 GGGGSGGGGSGGGGS, 인간 항-FAP(anti-FAP) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 인간 항-FAP(anti-FAP) 경쇄 가변영역 서열로 구성된다.
[seq9]는 인간 항-FAP(anti-FAP) 경쇄 서열과 링커 GGGGSGGGGSGGGGS, 인간 항-FAP(anti-FAP) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 인간 항-FAP(anti-FAP) 경쇄 가변영역 서열로 구성된다.
[seq10]은 인간 항-FAP(anti-FAP) 중쇄 서열과 인간 IgG1 Fc hole DANG, 링커 GGGGSGGGGSGGGGS, 인간 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS 및 인간 IL-12 p35(알파) 영역 서열로 구성된다.
[seq11]은 인간 항-FAP(anti-FAP) 중쇄 서열과 인간 IgG1 Fc hole DANG, 링커 GGGGSGGGGSGGGGS, 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS 및 인간 IL-12 p35(알파) 영역 서열로 구성된다.
[seq12]는 인간 IgG1 Fc hole DANG만으로 구성된다.
[seq13]은 인간 IgG1 Fc knob DANG만으로 구성된다.
[seq14]는 인간 항-FAP(anti-FAP) 중쇄 가변영역 서열 및 인간 IgG1 Fc DANG으로 구성된다.
[seq15]는 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS, 인간 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 인간 IgG1 Fc DANG으로 구성된다.
[seq16]은 인간 항-CD20(anti-CD20) 항체의 중쇄 서열 및 인간 IgG1 Fc knob DANG으로 구성된다.
[seq17]은 인간 항-CD20(anti-CD20) 항체의 경쇄 서열이다.
[seq292]는 인간 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 인간 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 인간 IgG1 Fc hole DANG, 링커 GGGGSGGGGSGGGGS, 인간 항-FAP(anti-FAP) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 인간 항-FAP(anti-FAP) 경쇄 가변영역 서열로 구성된다.
[seq293]는 헤파린 결합에 관여하는 아미노산 변이(4개)가 포함된 인간 IL-12 p40(베타) 영역 서열 과 링커 GGGGSGGGGSGGGGS, 인간 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 인간 IgG1 Fc hole DANG, 링커 GGGGSGGGGSGGGGS, 인간 항-FAP(anti-FAP) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 인간 항-FAP(anti-FAP) 경쇄 가변영역 서열로 구성된다.
[seq294]는 인간 항-FAP(anti-FAP) 중쇄 서열과 인간 IgG1 Fc DANG, 링커 GGGGSGGGGSGGGGS, 인간 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS 및 인간 IL-12 p35(알파) 영역 서열로 구성된다.
[seq295]는 인간 항-FAP(anti-FAP) 중쇄 서열과 인간 IgG1 Fc DANG, 링커 GGGGSGGGGSGGGGS, 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS 및 인간 IL-12 p35(알파) 영역 서열로 구성된다.
[seq296]는 인간 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 인간 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 인간 IgG1 Fc DANG, 링커 GGGGSGGGGSGGGGS, 인간 항-FAP(anti-FAP) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 인간 항-FAP(anti-FAP) 경쇄 가변영역 서열로 구성된다.
[seq297]는 헤파린 결합에 관여하는 아미노산 변이(4개)가 포함된 인간 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 인간 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 인간 IgG1 Fc DANG, 링커 GGGGSGGGGSGGGGS, 인간 항-FAP(anti-FAP) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 인간 항-FAP(anti-FAP) 경쇄 가변영역 서열로 구성된다.
T1.01(seq1, seq2, seq3)는 단백질 FAP을 표적으로 하는 인간 항-FAP 서열과 인간 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.02(seq1, seq2, seq4)은 단백질 FAP을 표적으로 하는 인간 항-FAP 서열과 헤파린 결합에 관여하는 아미노산의 변이(2개)가 포함된 인간 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.03(seq1, seq2, seq5)는 단백질 FAP을 표적으로 하는 인간 항-FAP 서열과 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.04(seq3, seq6, seq7)는 이중 가변 도메인 면역글로블린(dual variable domain Immunoglobulin, DVD-Ig) 형태의 인간 항-FAP 서열과 인간 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.05(seq5, seq6, seq7)는 이중 가변 도메인 면역글로블린(dual variable domain Immunoglobulin, DVD-Ig) 형태의 인간 항-FAP 서열과 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.06(seq2, seq3, seq8)은 중쇄의 C 말단에 단백질 FAP을 표적으로 하는 인간 항-FAP 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 인간 항-FAP 서열과 인간 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.07(seq2, seq5, seq8)은 중쇄의 C 말단에 단백질 FAP을 표적으로 하는 인간 항-FAP 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 인간 항-FAP 서열과 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.08(seq1, seq3, seq9)은 경쇄의 C 말단에 단백질 FAP을 표적으로 하는 인간 항-FAP 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 인간 항-FAP 서열과 인간 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.09(seq1, seq5, seq9)는 경쇄의 C 말단에 단백질 FAP을 표적으로 하는 인간 항-FAP 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 인간 항-FAP 서열과 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.10(seq1, seq2, seq10)은 단백질 FAP을 표적으로 하는 인간 FAP 서열과 중쇄의 C말단에 인간 IL-12 서열이 연결된 인간 항-FAP 서열이 놉-인-홀 구조를 이루는 항체이다.
T1.11(seq1, seq2, seq11)은 단백질 FAP을 표적으로 하는 인간 FAP 서열과 중쇄의 C말단에 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열이 연결된 인간 항-FAP 서열이 놉-인-홀 구조를 이루는 항체이다.
T1.12(seq1, seq2, seq12)는 단백질 FAP을 표적으로 하는 인간 항-FAP 서열만을 갖는 놉-인-홀 구조의 이펙터 기능이 제거된 항체이다.
T1.13(seq3, seq13)은 인간 IL-12 서열만을 갖는 놉-인-홀 구조의 이펙터 기능이 제거된 항체이다.
T1.14(seq4, seq13)는 헤파린 결합에 관여하는 아미노산의 변이(2개)가 포함된 인간 IL-12 서열만을 갖는 놉-인-홀 구조의 이펙터 기능이 제거된 항체이다.
T1.15(seq5, seq13)는 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열만을 갖는 놉-인-홀 구조의 이펙터 기능이 제거된 항체이다.
T1.16(seq2, seq14)은 단백질 FAP을 표적으로 하는 인간 항-FAP 항체다.
T1.17(seq15)은 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열만을 갖는 Fc-fusion protein이다.
T1.18(seq3, seq16, seq17)은 단백질 CD20를 표적으로 하는 인간 항-CD20 서열과 인간 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.19(seq4, seq16, seq17)는 단백질 CD20를 표적으로 하는 인간 항-CD20 서열과 헤파린 결합에 관여하는 아미노산의 변이(2개)가 포함된 인간 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.20(seq5, seq16, seq17)은 단백질 CD20를 표적으로 하는 인간 항-CD20 서열과 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.21(seq12, seq16, seq17)은 단백질 CD20를 표적으로 하는 인간 항-CD20 서열만을 갖는 놉-인-홀 구조의 이펙터 기능이 제거된 항체이다.
T1.23(seq1, seq2, seq292)는 인간 항-FAP 서열과 C 말단에 인간 항-FAP 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 인간 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.24(seq1, seq2, seq293)는 인간 항-FAP 중쇄 서열과 C 말단에 인간 항-FAP 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 채 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.25(seq2, seq294)는 중쇄의 C 말단에 인간 IL-12 서열이 연결된 인간 항-FAP 서열을 포함한 Fc-퓨전 단백질 이량체이다.
T1.26(seq2, seq295)는 중쇄의 C 말단에 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열이 연결된 인간 항-FAP 서열을 포함한 Fc-퓨전 단백질 이량체이다.
T1.27(seq296)는 C 말단에 인간 항-FAP 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 인간 IL-12 서열로 구성된 Fc-퓨전 단백질 이량체이다.
T1.28(seq297)는 C 말단에 인간 항-FAP 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 채 헤파린 결합에 관여하는 아미노산의 변이(4개)를 포함한 인간 IL-12 서열로 구성된 Fc-퓨전 단백질 이량체이다.
[seq1] anti-hu FAP HC hu IgG1 Fc knob DANG
QVQLVQSGAEVKKPGASVKVSCKTSRYTFTEYTIHWVRQAPGQRLEWIGGI
NPNNGIPNYNQKFKGRVTITVDTSASTAYMELSSLRSEDTAVYYCARRRIA
YGYDEGHAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK
DTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT
LPPSRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[seq2] anti-hu FAP LC
DIVMTQSPDSLAVSLGERATINCKSSQSLLYSRNQKNYLAWYQQKPGQPPK
LLIFWASTRESGVPDRFSGSGFGTDFTLTISSLQAEDVAVYYCQQYFSYPL
TFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ
WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH
QGLSSPVTKSFNRGEC
[seq3] hu scIL-12-hu IgG1 Fc hole DANG
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGK
TLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPK
NKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATL
SAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSS
FFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQV
QGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
GGGGSGGGGSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKAR
QTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFIT
NGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLD
QNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAV
TIDRVMSYLNASGGGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKD
TLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTY
RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL
PPSRDELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG
SFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[seq4] hu scIL-12 mut1-hu IgG1 Fc hole DANG
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTL
TIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTF
LRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVR
GDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKP
DPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGASKREAKDRV
FTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSGGGGSGGGGSR
NLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDK
TSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMY
QVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYK
TKIKLCILLHAFRIRAVTIDRVMSYLNASGGGGSGGGGSDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPRE
EQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY
TLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG
SFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[seq5] hu scIL-12 mut2-hu IgG1 Fc hole DANG
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKT
LTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNK
TFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAE
RVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFI
RDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGA
SAREAADRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGG
GGSGGGGSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTL
EFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGS
CLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLD
QNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRA
VTIDRVMSYLNASGGGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPK
PKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ
YGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP
REPQVYTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEAL
HNHYTQKSLSLSPGK
[seq6] (anti-hu FAP VH)2-hu IgG1 Fc knob DANG
QVQLVQSGAEVKKPGASVKVSCKTSRYTFTEYTIHWVRQAPGQRLEWIG
GINPNNGIPNYNQKFKGRVTITVDTSASTAYMELSSLRSEDTAVYYCAR
RRIAYGYDEGHAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSQVQLVQS
GAEVKKPGASVKVSCKTSRYTFTEYTIHWVRQAPGQRLEWIGGINPNNG
IPNYNQKFKGRVTITVDTSASTAYMELSSLRSEDTAVYYCARRRIAYG
YDEGHAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC
LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFL
FPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA
KGQPREPQVYTLPPSRDELTKNQVSLWCLVKGFYPSD
IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF
SCSVMHEALHNHYTQKSLSLSPGK
[seq7] (anti-hu FAP VL)2
DIVMTQSPDSLAVSLGERATINCKSSQSLLYSRNQKNYLAWYQQKPGQPP
KLLIFWASTRESGVPDRFSGSGFGTDFTLTISSLQAEDVAVYYCQQYFS
YPLTFGQGTKVEIKGGGGSGGGGSGGGGSDIVMTQSPDSLAVSLGERAT
INCKSSQSLLYSRNQKNYLAWYQQKPGQPPKLLIFWASTRESGVPDRF
SGSGFGTDFTLTISSLQAEDVAVYYCQQYFSYPLTFGQGTKVEIKR
TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL
SSPVTKSFNRGEC
[seq8] anti-hu FAP HC hu IgG1 Fc knob DANG-anti-hu FAP scFv
QVQLVQSGAEVKKPGASVKVSCKTSRYTFTEYTIHWVRQAPGQRL
EWIGGINPNNGIPNYNQKFKGRVTITVDTSASTAYMELSSLRSED
TAVYYCARRRIAYGYDEGHAMDYWGQGTLVTVSSASTKGPSVFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD
KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVS
HEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDW
LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT
KNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGG
SGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKTSRYTFTEYTIH
WVRQAPGQRLEWIGGINPNNGIPNYNQKFKGRVTITVDTSASTAYM
ELSSLRSEDTAVYYCARRRIAYGYDEGHAMDYWGQGTLVTVSSGGG
GSGGGGSGGGGSGGGGSDIVMTQSPDSLAVSLGERATINCKSSQSL
LYSRNQKNYLAWYQQKPGQPPKLLIFWASTRESGVPDRFSGSGFGT
DFTLTISSLQAEDVAVYYCQQYFSYPLTFGQGTKVEIK
[seq9] anti-hu FAP LC-anti-hu FAP scFv
DIVMTQSPDSLAVSLGERATINCKSSQSLLYSRNQKNYLAWYQQK
PGQPPKLLIFWASTRESGVPDRFSGSGFGTDFTLTISSLQAEDVA
VYYCQQYFSYPLTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGT
ASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS
LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECGGGGS
GGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKTSRYTFTEYTIH
WVRQAPGQRLEWIGGINPNNGIPNYNQKFKGRVTITVDTSASTAY
MELSSLRSEDTAVYYCARRRIAYGYDEGHAMDYWGQGTLVTVSSG
GGGSGGGGSGGGGSGGGGSDIVMTQSPDSLAVSLGERATINCKSS
QSLLYSRNQKNYLAWYQQKPGQPPKLLIFWASTRESGVPDRFSGS
GFGTDFTLTISSLQAEDVAVYYCQQYFSYPLTFGQGTKVEIK
[seq10] anti-hu FAP HC hu IgG1 Fc hole DANG-hu scIL-12
QVQLVQSGAEVKKPGASVKVSCKTSRYTFTEYTIHWVRQAPGQRLEWIGGINPNNG
IPNYNQKFKGRVTITVDTSASTAYMELSSLRSEDTAVYYCARRRIAYGYDEGHAMD
YWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG
ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEV
KFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL
PAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWESN
GQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS
LSLSPGGGGGSGGGGSGGGGSIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEED
GITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGI
WSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDP
QGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLK
YENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTF
CVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVP
CSGGGGSGGGGSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQT
LEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCL
ASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVID
ELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
[seq11] anti-hu FAP HC hu IgG1 Fc hole DANG-hu scIL-12 mut2
QVQLVQSGAEVKKPGASVKVSCKTSRYTFTEYTIHWVRQAPGQR
LEWIGGINPNNGIPNYNQKFKGRVTITVDTSASTAYMELSSLRS
EDTAVYYCARRRIAYGYDEGHAMDYWGQGTLVTVSSASTKGPSVF
PLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF
PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK
VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE
VTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRV
VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP
QVYTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHN
HYTQKSLSLSPGGGGGSGGGGSGGGGSIWELKKDVYVVELDWY
PDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEF
GDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKT
FLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCG
AATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAV
HKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEY
PDTWSTPHSYFSLTFCVQVQGASAREAADRVFTDKTSATVICRK
NASISVRAQDRYYSSSWSEWASVPCSGGGGSGGGGSGGGGSRNL
PVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEI
DHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLAS
RKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQ
NMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAF
RIRAVTIDRVMSYLNAS
[seq12] hu IgG1 Fc hole DANG
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVK
FNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL
PAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALH
NHYTQKSLSLSPGK
[seq13] hu IgG1 Fc knob DANG
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEV
KFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNK
ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLWCLVKGFYPSDIAV
EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL
NHYTQKSLSLSPGK
[seq14] anti-hu FAP HC hu IgG1 Fc DANG
QVQLVQSGAEVKKPGASVKVSCKTSRYTFTEYTIHWVRQAPGQRLEWIGGI
NPNNGIPNYNQKFKGRVTITVDTSASTAYMELSSLRSEDTAVYYCARRRIA
YGYDEGHAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT
LMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV
YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL
DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[seq15] hu scIL-12 mut2-hu IgG1 Fc DANG
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTL
TIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTF
LRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVR
GDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKP
DPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGASAREAADR
VFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSGGGGSGG
GGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEID
HEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMAL
CLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNS
ETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASGGGGSGG
GGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSH
EDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEY
KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN
VFSCSVMHEALHNHYTQKSLSLSPGK
[seq16] anti-hu CD20 HC hu IgG1 Fc knob DANG
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAI
YPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTY
YGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP
PKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPR
EEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG
QPREPQVYTLPPSRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPE
NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEA
LHNHYTQKSLSLSPGK
[seq17] anti-hu CD20 LC
QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLAS
GVPVRFSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTVA
APSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE
QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Figure PCTKR2023002030-appb-img-000001
Figure PCTKR2023002030-appb-img-000002
Figure PCTKR2023002030-appb-img-000003
Figure PCTKR2023002030-appb-img-000004
Figure PCTKR2023002030-appb-img-000005
Figure PCTKR2023002030-appb-img-000006
준비예 2. anti-FAP/IL-12 IgG2a DANG, 마우스 융합단백질의 개요
Code Format Description 해당서열
T1.01m K&H anti-mu FAP/mu IL-12, mu IgG2a DANG seq18, seq19, seq20
T1.02m K&H anti-mu FAP/mu IL-12 mut1, mu IgG2a DANG seq18, seq19, seq21
T1.03m K&H anti-mu FAP/mu IL-12 mut2, mu IgG2a DANG seq18, seq19, seq22
T1.04m K&H anti-mu FAP/mu IL-12, mu IgG2a DANG (2+1) seq20, seq23, seq24
T1.05m K&H anti-mu FAP/mu IL-12 mut2, mu IgG2a DANG (2+1) seq22, seq23, seq24
T1.06m K&H anti-mu FAP/mu IL-12, mu IgG2a DANG (2+1, HC scFv) seq19, seq20, seq25
T1.07m K&H anti-mu FAP/mu IL-12 mut2, mu IgG2a DANG (2+1, HC scFv) seq19, seq22, seq25
T1.08m K&H anti-mu FAP/mu IL-12, mu IgG2a DANG (2+1, LC scFv) seq18, seq20, seq26
T1.09m K&H anti-mu FAP/mu IL-12 mut2, mu IgG2a DANG (2+1, LC scFv) seq18, seq22, seq26
T1.10m K&H anti-mu FAP/anti-mu FAP-mu IL-12, mu IgG2a DANG (2+1) seq18, seq19, seq27
T1.11m K&H anti-mu FAP/anti-mu FAP-mu IL-12 mut2, mu IgG2a DANG (2+1) seq18, seq19, seq28
T1.12m K&H anti-mu FAP/null, mu IgG2a DANG seq18, seq19, seq29
T1.13m K&H null/mu IL-12, mu IgG2a DANG seq20, seq30
T1.14m K&H null/mu IL-12 mut1, mu IgG2a DANG seq21, seq30
T1.15m K&H null/mu IL-12 mut2, mu IgG2a DANG seq22, seq30
T1.16m Mab anti-mu FAP, mu IgG2a DANG seq19, seq31
T1.17m Fc-fusion mu IL-12 mut2, mu IgG2a DANG seq32
T1.18m K&H anti-mu CD20/mu IL-12, mu IgG2a DANG seq20, seq33, seq34
T1.19m K&H anti-mu CD20/mu IL-12 mut1, mu IgG2a DANG seq21, seq33, seq34
T1.20m K&H anti-mu CD20/mu IL-12 mut2, mu IgG2a DANG seq22, seq33, seq34
T1.21m K&H anti-mu CD20/null, mu IgG2a DANG seq29, seq33, seq34
T1.22m Fc fusion mu IgG2a Fc DANG seq35
T1.23m K&H anti-mu FAP/mu IL-12-anti-mu FAP scFv, mu IgG2a DANG (2+1) seq18, seq19, seq298
T1.24m K&H anti-mu FAP/mu IL-12 mut2-anti-mu FAP scFv, mu IgG2a DANG (2+1) seq18, seq19, seq299
T1.25m Fc-fusion anti-mu FAP-mu IL-12, mu IgG2a DANG seq19, seq300
T1.26m Fc-fusion anti-mu FAP-mu IL-12 mut2, mu IgG2a DANG seq19, seq301
T1.27m Fc-fusion mu IL-12-anti-mu FAP scFv, mu IgG2a DANG Seq302
T1.28m Fc-fusion mu IL-12 mut2-anti-mu FAP scFv, mu IgG2a DANG Seq303
[seq18]은 마우스 항-FAP(anti-FAP) 중쇄 가변영역 서열과 DANG 변이(D265A, N297G)를 통해 이펙터 기능을 제거하고, T321W 변이로 놉 구조를 형성한 마우스 IgG2a Fc로 구성된다.[seq19]는 마우스 항-FAP(anti-FAP) 경쇄 서열로 구성된다.
[seq20]은 마우스 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS, DANG(D265A, N297G)변이를 통해 이펙터 기능을 제거하고, T321S, M323A, Y362V 변이로 홀 구조를 형성한 마우스 IgG2a Fc로 구성된다.
[seq21]은 마우스 IL-12 p40(베타) 영역에서 헤파린 결합에 관여하는 아미노산 277번, 282번 라이신(K)을 알라닌(A)으로 변이한 서열, 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 마우스 IgG2a Fc hole DANG으로 구성된다.
[seq22]는 마우스 IL-12 p40(베타) 영역에서 헤파린 결합에 관여하는 아미노산 276번 알지닌(R)을 알라닌(A)로, 277번, 278번, 282번 라이신(K)을 알라닌(A)으로 변이한 서열, 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 마우스 IgG2a Fc hole DANG으로 구성된다.
[seq23]은 마우스 항-FAP(anti-FAP) 중쇄 가변영역 서열과 링커 GGGGSGGGGSGGGGS, 마우스 항-FAP(anti-FAP) 중쇄 가변영역 서열 및 마우스 IgG2a Fc knob DANG으로 구성된다.
[seq24]는 마우스 항-FAP(anti-FAP) 경쇄 가변영역 서열과 링커 GGGGSGGGGSGGGGS, 마우스 항-FAP(anti-FAP) 경쇄 서열로 구성된다.
[seq25]는 마우스 항-FAP(anti-FAP) 중쇄 가변영역 서열과 마우스 IgG2a Fc knob DANG, 링커 GGGGSGGGGSGGGGS, 마우스 항-FAP(anti-FAP) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 마우스 항-FAP(anti-FAP) 경쇄 가변영역 서열로 구성된다.
[seq26]은 마우스 항-FAP(anti-FAP) 경쇄 서열과 링커 GGGGSGGGGSGGGGS, 마우스 항-FAP(anti-FAP) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 마우스 항-FAP(anti-FAP) 경쇄 가변영역 서열로 구성된다.
[seq27]은 마우스 항-FAP(anti-FAP) 중쇄 서열과 마우스 IgG2a Fc hole DANG, 링커 GGGGSGGGGSGGGGS, 마우스 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS 및 마우스 IL-12 p35(알파) 영역 서열로 구성된다.
[seq28]은 마우스 항-FAP(anti-FAP) 중쇄 서열과 마우스 IgG2a Fc hole DANG, 링커 GGGGSGGGGSGGGGS, 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS 및 마우스 IL-12 p35(알파) 영역 서열로 구성된다.
[seq29]는 마우스 IgG2a Fc hole DANG만으로 구성된다.
[seq30]은 마우스 IgG2a Fc knob DANG만으로 구성된다.
[seq31]은 마우스 항-FAP(anti-FAP) 중쇄 가변영역과 마우스 IgG2a Fc DANG으로 구성된다.
[seq32]는 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 마우스 IgG2a Fc DANG으로 구성된다.
[seq33]은 마우스 항-CD20(anti-CD20) 항체 18B12의 중쇄 가변영역 서열과 마우스 IgG2a knob DANG으로 구성된다.
[seq34]는 마우스 항-CD20(anti-CD20) 항체 18B12의 경쇄 서열로 구성된다.
[seq35]는 마우스 IgG2a Fc DANG만으로 구성된다.
[seq298]은 마우스 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 마우스 IgG2a Fc hole DANG, 링커 GGGGSGGGGSGGGGS, 마우스 항-FAP(anti-FAP) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 마우스 항-FAP(anti-FAP) 경쇄 가변영역 서열로 구성된다.
[seq299]는 헤파린 결합에 관여하는 아미노산 변이(4개)가 포함된 마우스 IL-12 p40(베타) 영역 서열 과 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 마우스 IgG2a Fc hole DANG, 링커 GGGGSGGGGSGGGGS, 마우스 항-FAP(anti-FAP) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 마우스 항-FAP(anti-FAP) 경쇄 가변영역 서열로 구성된다.
[seq300]은 마우스 항-FAP(anti-FAP) 중쇄 서열과 마우스 IgG2a Fc DANG, 링커 GGGGSGGGGSGGGGS, 마우스 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS 및 마우스 IL-12 p35(알파) 영역 서열로 구성된다.
[seq301]은 마우스 항-FAP(anti-FAP) 중쇄 서열과 마우스 IgG1 Fc DANG, 링커 GGGGSGGGGSGGGGS, 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS 및 마우스 IL-12 p35(알파) 영역 서열로 구성된다.
[seq302]는 마우스 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 마우스 IgG2a Fc DANG, 링커 GGGGSGGGGSGGGGS, 마우스 항-FAP(anti-FAP) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 마우스 항-FAP(anti-FAP) 경쇄 가변영역 서열로 구성된다.
[seq303]은 헤파린 결합에 관여하는 아미노산 변이(4개)가 포함된 마우스 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 마우스 IgG2a Fc DANG, 링커 GGGGSGGGGSGGGGS, 마우스 항-FAP(anti-FAP) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 마우스 항-FAP(anti-FAP) 경쇄 가변영역 서열로 구성된다.
T1.01m(seq18, seq19, seq20)은 단백질 FAP을 표적으로 하는 마우스 항-FAP 서열과 마우스 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.02m(seq18, seq19, seq21)은 단백질 FAP을 표적으로 하는 마우스 항-FAP 서열과 헤파린 결합에 관여하는 아미노산의 변이(2개)가 포함된 마우스 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.03m(seq18, seq19, seq22)은 단백질 FAP을 표적으로 하는 마우스 항-FAP 서열과 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.04m(seq20, seq23, seq24)은 이중 가변 도메인 면역글로블린(dual variable domain Immunoglobulin, DVD-Ig) 형태의 단백질 FAP을 표적으로 하는 마우스 항-FAP 서열과 마우스 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.05m(seq22, seq23, seq24)은 이중 가변 도메인 면역글로블린(dual variable domain Immunoglobulin, DVD-Ig) 형태의 단백질 FAP을 표적으로 하는 마우스 항-FAP 서열과 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.06m(seq19, seq20, seq25)은 중쇄의 C 말단에 단백질 FAP을 표적으로 하는 마우스 항-FAP 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 포함된 마우스 항-FAP 서열과 마우스 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.07m(seq19, seq22, seq25)은 중쇄의 C 말단에 단백질 FAP을 표적으로 하는 마우스 항-FAP 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 포함된 마우스 항-FAP 서열과 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.08m(seq18, seq20, seq26)은 경쇄의 C 말단에 단백질 FAP을 표적으로 하는 마우스 항-FAP 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 포함된 마우스 항-FAP 서열과 마우스 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.09m(seq18, seq22, seq26)은 경쇄의 C 말단에 단백질 FAP을 표적으로 하는 마우스 항-FAP 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 포함된 마우스 항-FAP 서열과 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.10m(seq18, seq19, seq27)은 단백질 FAP을 표적으로 하는 마우스 항-FAP 서열과 중쇄의 C 말단에 마우스 IL-12 서열이 연결된 마우스 항-FAP 서열이 놉-인-홀 구조를 이루는 항체이다.
T1.11m(seq18, seq19, seq28)은 단백질 FAP을 표적으로 하는 마우스 항-FAP 서열과 중쇄의 C말단에 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열이 연결된 마우스 항-FAP 서열이 놉-인-홀 구조를 이루는 항체이다.
T1.12m(seq18, seq19, seq29)은 단백질 FAP을 표적으로 하는 마우스 항-FAP 서열만을 갖는 놉-인-홀 구조의 이펙터 기능이 제거된 항체이다.
T1.13m(seq20, seq30)은 마우스 IL-12 서열만을 갖는 놉-인-홀 구조의 이펙터 기능이 제거된 항체이다.
T1.14m(seq21, seq30)은 헤파린 결합에 관여하는 아미노산의 변이(2개)가 포함된 마우스 IL-12 서열만을 갖는 놉-인-홀 구조의 이펙터 기능이 제거된 항체이다.
T1.15m(seq22, seq30)은 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열만을 갖는 놉-인-홀 구조의 이펙터 기능이 제거된 항체이다.
T1.16m(seq19, seq31)은 단백질 FAP을 표적으로 하는 마우스 항-FAP 항체다.
T1.17m(seq32)은 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열만을 갖는 Fc-fusion protein이다.
T1.18m(seq20, seq33, seq34)은 단백질 CD20을 표적으로 하는 마우스 항-CD20(18B12) 서열과 마우스 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.19m(seq21, seq33, seq34)은 단백질 CD20을 표적으로 하는 마우스 항-CD20(18B12) 서열과 헤파린 결합에 관여하는 아미노산의 변이(2개)가 포함된 마우스 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.20m(seq22, seq33, seq34)은 단백질 CD20을 표적으로 하는 마우스 항-CD20 서열과 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.21m(seq29, seq33, seq34)은 단백질 CD20을 표적으로 하는 마우스 항-CD20 서열만을 갖는 놉-인-홀 구조의 이펙터 기능이 제거된 항체이다.
T1.22m(seq35)은 마우스 Fc 서열만을 갖는 이펙터 기능이 제거된 단백질이다.
T1.23m(seq18, seq19, seq298)은 마우스 항-FAP 서열과 C 말단에 마우스 항-FAP 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 마우스 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.24m(seq18, seq19, seq299)은 마우스 항-FAP 중쇄 서열과 C 말단에 마우스 항-FAP 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 채 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열이 놉-인-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T1.25m(seq19, seq300)은 중쇄의 C 말단에 마우스 IL-12 서열이 연결된 마우스 항-FAP 서열을 포함한 Fc-퓨전 단백질 이량체이다.
T1.26m(seq19, seq301)은 중쇄의 C 말단에 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열이 연결된 마우스 항-FAP 서열을 포함한 Fc-퓨전 단백질 이량체이다.
T1.27m(seq302)은 C 말단에 마우스 항-FAP 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 마우스 IL-12 서열로 구성된 Fc-퓨전 단백질 이량체이다.
T1.28m(seq303)은 C 말단에 마우스 항-FAP 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 채 헤파린 결합에 관여하는 아미노산의 변이(4개)를 포함한 마우스 IL-12 서열로 구성된 Fc-퓨전 단백질 이량체이다.
[seq18] anti-mu FAP HC mu IgG2a Fc knob DANG
QVQLQQSGAELARPGASVNLSCKASGYTFTNNGINWLKQRTGQGLEWIGEIY
PRSTNTLYNEKFKGKATLTADRSSNTAYMELRSLTSEDSAVYFCARTLTAPFA
FWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKK
IEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVAVS
EDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKC
KVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLWCMVTDFMPE
DIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVH
EGLHNHHTTKSFSRTPGK
[seq19] anti-mu FAP LC
QIVLTQSPAIMSASPGEKVTMTCSASSGVNFMHWYQQKSGTSPKRWIFDTSKLAS
GVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSFNPPTFGGGTKLEIKRADA
APTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQ
DSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
[seq20] mu scIL-12-mu IgG2a Fc hole DANG
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTIT
VKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYS
GRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSC
QEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQ
VEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTE
VQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSGGGGSGGGGSGGGGSRVIPVSG
PARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPL
ELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINA
ALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCI
LLHAFSTRVVTINRVMGYLSSAGGGGSGGGGSEPRGPTIKPCPPCKCPAPNLLGG
PSVFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQISWFVNNVEVHTAQTQTH
REDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQ
VYVLPPPEEEMTKKQVTLSCAVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDG
SYFMVSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq21] mu scIL-12 mut1-mu IgG2a Fc hole DANG
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITV
KEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGR
FTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQE
DVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVE
VSWEYPDSWSTPHSYFSLKFFVRIQRAKEKMAETEEGCNQKGAFLVEKTSTEVQCKG
GNVCVQAQDRYYNSSCSKWACVPCRVRSGGGGSGGGGSGGGGSRVIPVSGPARCL
SQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKN
ESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQ
NHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCIL
LHAFSTRVVTINRVMGYLSSAGGGGSGGGGSEPRGPTIKPCPPCKCPAPNLL
GGPSVFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQISWFVNNVEVHTA
QTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKP
KGSVRAPQVYVLPPPEEEMTKKQVTLSCAVTDFMPEDIYVEWTNNGKTELNY
KNTEPVLDSDGSYFMVSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSR
TPGK
[seq22] mu scIL-12 mut2-mu IgG2a Fc hole DANG
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTL
TITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKC
EAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTL
DQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIK
PDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQAAAEKMAET
EEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSG
GGGSGGGGSGGGGSRVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCT
AEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLM
MTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLN
HNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSAGGGG
SGGGGSEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTC
VVVAVSEDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQD
WMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQV
TLSCAVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMVSKLRVEK
KNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq23] (anti-mu FAP VH)2, mu IgG2a Fc knob DANG
QVQLQQSGAELARPGASVNLSCKASGYTFTNNGINWLKQRTGQGLEWIGEIYP
RSTNTLYNEKFKGKATLTADRSSNTAYMELRSLTSEDSAVYFCARTLTAPFAF
WGQGTLVTVSAGGGGSGGGGSGGGGSQVQLQQSGAELARPGASVNLSCKASGY
TFTNNGINWLKQRTGQGLEWIGEIYPRSTNTLYNEKFKGKATLTADRSSNTAY
MELRSLTSEDSAVYFCARTLTAPFAFWGQGTLVTVSAAKTTAPSVYPLAPVCG
DTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVT
VTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPS
VFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQISWFVNNVEVHTAQTQTH
REDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRA
PQVYVLPPPEEEMTKKQVTLWCMVTDFMPEDIYVEWTNNGKTELNYKNTEPV
LDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq24] (anti-mu FAP VL)2
QIVLTQSPAIMSASPGEKVTMTCSASSGVNFMHWYQQKSGTSPKRWIFDTS
KLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSFNPPTFGGGTKL
EIKGGGGSGGGGSGGGGSQIVLTQSPAIMSASPGEKVTMTCSASSGVNFMHW
YQQKSGTSPKRWIFDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATY
YCQQWSFNPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLN
NFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYE
RHNSYTCEATHKTSTSPIVKSFNRNEC
[seq25] anti-mu FAP HC mu IgG2a Fc knob DANG-anti-mu FAP scFv
QVQLQQSGAELARPGASVNLSCKASGYTFTNNGINWLKQRTGQGLEWIGEIY
PRSTNTLYNEKFKGKATLTADRSSNTAYMELRSLTSEDSAVYFCARTLTAPF
AFWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTL
TWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASST
KVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVT
CVVVAVSEDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQ
DWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKK
QVTLWCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLR
VEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGKGGGGSGGGGSGGGGS
QVQLQQSGAELARPGASVNLSCKASGYTFTNNGINWLKQRTGQGLEWIGEI
YPRSTNTLYNEKFKGKATLTADRSSNTAYMELRSLTSEDSAVYFCARTLTA
PFAFWGQGTLVTVSAGGGGSGGGGSGGGGSGGGGSQIVLTQSPAIMSASPG
EKVTMTCSASSGVNFMHWYQQKSGTSPKRWIFDTSKLASGVPARFSGSGS
GTSYSLTISSMEAEDAATYYCQQWSFNPPTFGGGTKLEIK
[seq26] anti-mu FAP LC-anti-mu FAP scFv
QIVLTQSPAIMSASPGEKVTMTCSASSGVNFMHWYQQKSGTSPKRWIFDTSKLASGVP
ARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSFNPPTFGGGTKLEIKRADAAPTVSI
FPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECGGGGSGGGGSGGGGSQVQ
LQQSGAELARPGASVNLSCKASGYTFTNNGINWLKQRTGQGLEWIGEIYPRSTNTLY
NEKFKGKATLTADRSSNTAYMELRSLTSEDSAVYFCARTLTAPFAFWGQGTLVTVS
AGGGGSGGGGSGGGGSGGGGSQIVLTQSPAIMSASPGEKVTMTCSASSGVNFMHWY
QQKSGTSPKRWIFDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQW
SFNPPTFGGGTKLEIK
[seq27] anti-mu FAP HC mu IgG2a Fc hole DANG-mu scIL-12
QVQLQQSGAELARPGASVNLSCKASGYTFTNNGINWLKQRTGQGLEWIGEIYPRS
TNTLYNEKFKGKATLTADRSSNTAYMELRSLTSEDSAVYFCARTLTAPFAFWGQ
GTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLS
SGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
IKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQI
SWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPA
PIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLSCAVTDFMPEDIYVEWTNNGK
TELNYKNTEPVLDSDGSYFMVSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFS
RTPGGGGGSGGGGSGGGGSMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDIT
WTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTE
ILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMAS
LSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFI
RDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKE
TEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSGGGG
SGGGGSGGGGSRVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDH
EDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIY
EDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPV
GEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA
[seq28] anti-mu FAP HC mu IgG2a Fc hole DANG-mu scIL-12 mut2
QVQLQQSGAELARPGASVNLSCKASGYTFTNNGINWLKQRTGQGLEWIGEIYP
RSTNTLYNEKFKGKATLTADRSSNTAYMELRSLTSEDSAVYFCARTLTAPFAF
WGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTW
NSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKV
DKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTC
VVVAVSEDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQD
WMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQ
VTLSCAVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMVSKLRV
EKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGGGGGSGGGGSGGGGSM
WELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSG
KTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKN
KTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMAS
LSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYS
TSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVR
IQAAAEKMAETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCS
KWACVPCRVRSGGGGSGGGGSGGGGSRVIPVSGPARCLSQSRNLLKTTDDM
VKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRET
SSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHN
HQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCIL
LHAFSTRVVTINRVMGYLSSA
[seq29] mu IgG2a Fc hole DANG
EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVA
VSEDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWM
SGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQV
TLSCAVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMVSKL
RVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq30] mu IgG2a Fc knob DANG
EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVAVSEDD
PDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNK
DLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLWCMVTDFMPEDIYVEWT
NNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTT
KSFSRTPGK
[seq31] anti-mu FAP HC mu IgG2a Fc DANG
QVQLQQSGAELARPGASVNLSCKASGYTFTNNGINWLKQRTGQGLEWIGEIYPRST
NTLYNEKFKGKATLTADRSSNTAYMELRSLTSEDSAVYFCARTLTAPFAFWGQGTL
VTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVH
TFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPC
PPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQISWFVN
NVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTI
SKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYK
NTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq32] mu scIL-12 mut2-mu IgG2a Fc DANG
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKT
LTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLK
CEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTL
DQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDII
KPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQAAAEKMAE
TEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
GGGGSGGGGSGGGGSRVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHY
SCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPP
QKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAID
ELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINR
VMGYLSSAGGGGSGGGGSEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKI
KDVLMISLSPIVTCVVVAVSEDDPDVQISWFVNNVEVHTAQTQTHREDY
GSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVR
APQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYK
NTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKS
FSRTPGK
[seq33] anti-mu CD20 HC mu IgG2a Fc knob DANG
QVQLQQPGAELVRPGTSVKLSCKASGYTFTSYWMHWIKQRPGQGLEWIG
VIDPSDNYTKYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCAR
EGYYGSSPWFAYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLG
CLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSST
WPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPS
VFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQISWFVNNVEVHT
AQTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIER
TISKPKGSVRAPQVYVLPPPEEEMTKKQVTLWCMVTDFMPEDIYVEW
TNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVV
HEGLHNHHTTKSFSRTPGK
[seq34] anti-mu CD20 LC
QIVMSQSPAILSASPGEKVTMTCRARSSVSYIHWYQQKPGSSPKPWIYATSNLASGV
PGRFSGSGSGTSYSLTITRVEAEDAATYYCQQWSSKPPTFGGGTKLEIKRTDAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDST
YSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
[seq35] mu IgG2a Fc DANG
EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVAV
SEDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWMSGKEF
KCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTD
FMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSY
SCSVVHEGLHNHHTTKSFSRTPGK
Figure PCTKR2023002030-appb-img-000007
Figure PCTKR2023002030-appb-img-000008
Figure PCTKR2023002030-appb-img-000009
Figure PCTKR2023002030-appb-img-000010
Figure PCTKR2023002030-appb-img-000011
Figure PCTKR2023002030-appb-img-000012
제조예 1. 융합단백질의 제조
하기 표 3 및 표 4에 시약 및 장비를 기재하였다.
시약 제조사 Catalog#
pTT5 chempartner
In-Fusion HD cloning kit Clontech 639648
Accuprime pfx DNA polymerase Invitrogen 12344-04
Gel DNA fragment purification Kit TaKaRa D823A
FastDigest®BamHI Fermentas FD0055
FastDigest®EcoRI Fermentas FD0275
장비 및 도구 제조사 모델명
생물 안전 작업대 NUAIRE LabGard class ±
원심분리기 Eppendorf 5424
젤 이미징 시스템 Tanon 2500R
PCR을 통해 합성한 DNA 단편을 증폭시키고, 젤로 PCR 생성물을 정제하였다. 제한효소 EcoRI와 BamHI로 pTT5 벡터를 자르고 난 후 젤을 정제하였다. In-Fusion 키트를 이용해 각각의 PCR 생성물과 선형 벡터를 연결하였다. 생성된 벡터를 ECOS101 DH5α competent cell에 형질전환 시키고, 100 ㎍/㎖ 엠피실린을 함유하는 2xYT 한천 판에 배양하였다. 모든 조작 과정은 표준 형질 전환 프로토콜을 따라 수행하였다. 콜로니 PCR로 양성 재조합체를 확인하고, 재조합 플라스미드를 sequence-verify Sequencing을 수행하였다. 단일 콜로니를 선택하여 100 ㎍/㎖ 엠피실린을 함유하는 5 ㎖ 2xYT 배지에 종균을 접종하였다. 37℃에서 8시간 동안 흔들면서 배양하였다.이후, 종균을 1:1,000의 비율로 200 ㎖의 선택적 2xYT 배지에 희석하였다. 37℃에서 16시간 동안 흔들면서 배양하였다. 4℃, 4,700 rpm에서 10분 동안 원심 분리하여 박테리아 세포를 수확하였다. 12 ㎖의 RES-EF 용액에 박테리아 펠릿을 재부유 시켰다. 그 후, 12 ㎖의 LYS-EF 용액을 첨가하고, 밀봉한 튜브를 힘차게 뒤집어 완전히 혼합한 뒤, 실온에서 5분간 배양하였다. 12 ㎖의 NEU-EF 용액을 용해물에 첨가하고, 힘차게 뒤집어 빠르게 완전히 혼합하였다.
NucleoBond® Xtra 컬럼 필터에 용해물을 주입하기 전, 필터의 막힘을 방지하기 위해 용해물 튜브를 3번 정도 뒤집어 침전물의 균질한 현탁을 제조하였다. 그 후, 10 ㎖의 필터 세척 용액 FIL-EF로 NucleoBond® Xtra 컬럼 필터와 NucleoBond® Xtra 컬럼을 세척하였다. NucleoBond® Xtra 컬럼 필터를 빼내거나 컬럼을 거꾸로 뒤집어 제거하였다. 90 ㎖의 세척 용액 ENDO로 NucleoBond® Xtra 컬럼을 세척하였다.
45 ㎖의 세척 용액 WASH-EF로 NucleoBond® Xtra 컬럼을 세척하였다. 15 ㎖의 용출 용액 ELU로 플라스미드 DNA를 용출시켰다. 용출액은 50 ㎖ 원심분리 튜브에 수집하였다. 10.5 ㎖의 상온 이소프로판올을 첨가하여 용출된 플라스미드 DNA를 침전시켰다. Vortex 후, 혼합물을 2분간 그대로 방치하였다.
그 후, 5 ㎖의 70% 에탄올을 펠릿에 첨가하였다. 파이펫 팁을 이용해 튜브에서 에탄올을 조심스럽게 완전히 제거하였다. 펠릿을 상온(20℃)에서 건조시켰다. 그 후, DNA 펠릿을 1,000 ㎕의 H2O로 용해시켰다.
제조예 2. 세포 형질 주입과 단백질 발현
제조예 2.1. 세포 형질 주입
하기 표 5에 사용한 재료 및 시약 기재하였다.
재료 및 시약 제조사 (Product #)
293F cells Invitrogen (R790-07)
OPM 293 OPM (81075-001)
Pluronic®F-68, 10% (100X) Gibco (24040-032)
1 ㎎/㎖ PEI Polyscience (23966)
OPTI MEM I Gibco (31985088)
Peptone (20x) FLUKA(P0521-1KG)
셰이커 플라스크
ISF1-X 배양기 셰이커 Kuhner shaker
Complete 배지를 넣은 293F seed strain을 130 rpm, 37℃ 8% CO2의 배양기 셰이커에서 유지하였다. 0.3 내지 0.4 x 106 cell/㎖의 밀도로 배양하고, 매 2 내지 3일마다 배지를 교환하였다. 형질 주입 24시간 전, 새로운 파사쥬의 293F 세포를 2.6 x 106 cell/㎖로 준비하였다. 준비한 세포는 130 rpm, 37℃ 8% CO2의 배양기 셰이커에서 배양하였다. 형질 주입 당일, 새로운 배지를 사용하여 5.0 x 106 cells/㎖의 밀도로 세포를 조정하였다. 3 L 셰이커 플라스크에서 1 L의 총 부피로 수행하였다. 0.4 ㎎ HC 및 0.6 ㎎ LC 플라스미드를 50 ㎖ OPTI MEM I으로 희석하고, 0.22 ㎛ 필터로 여과하였다. 그 후, 2 ㎎ PEI를 50 ㎖ OPTI MEM I으로 희석하여 형질 주입 시약을 준비하였다.희석된 PEI를 DNA 혼합물에 첨가한 뒤, 즉시 혼합하였다. 이후 15분간 상온에서 배양하였다. 2.6 x 106 cell/㎖로 준비한 293F 세포에 DNA-PEI 혼합물을 첨가하였다. 이후, 세포는 130 rpm, 37℃ 8% CO2의 배양기 셰이커에서 24시간 동안 계속 배양하였다. 형질 주입 24시간 후, 최종 농도가 0.5%가 되도록 배양액의 1/20에 10% 펩톤을 첨가하였다. 이후 세포는 130 rpm, 37℃ 8% CO2의 배양기 셰이커에서 계속 배양하였다. 형질 주입 후 2 내지 5일 기간에는 매일 세포 밀도/생존 능력을 측정하고 기록하였다. 형질 주입 7일 후 혹은 세포 생존 능력이 70% 미만에서 정제를 위해 세포를 수확하였다.
제조예 2.2. 단백질 정제
하기 표 6 내지 표 8에 단백질 정제를 위해 사용한 시약, 용액의 구성 및 장비를 기술하였다.
시약 제조사 Catalog#
Mabselect SuRe GE Healthcare 11003493
Tris SIGMA 77-86-1
NaCl ACROS ORGANIVS 7647-14-5
Sodium citrate Adamas-beta 76198B
Citric acid GENERAL-Reagent G83162B
Arginine VETEC V900343-500G
Succinic acid Sigma-Aldrich S9512-500G
Triton X-100 ABCONE X10010-1L
TRITON X-114 SIGMA-ALDRICH X114
Millex-GP Filter Unit 0.22 μm Sterile MILLIPORE SLGP033RS
NaOH Merck B146369740
용액 A 25 mM Tris, 150 mM NaCl, pH 8.0
용액 B 25 mM Tris, 150 mM NaCl,0.1% Triton X-100, 0.1% Triton X-114 pH 8.0
용액 C 100 mM Sodium Citrate, 150 mM NaCl, pH 3.0
용액 D 1 M Arginine, 400 mM Succinic acid, pH 9.0
용액 E 20 mM PB pH 6.5, 1 M (NH4)2SO4
용액 F 20 mM PB pH 6.5, 25% isopropyl alcohol
최종용액 20 mM HEPES, pH 7.5, 240 mM sucrose 혹은 20 mM his acetate pH 5.5, 240 mM sucrose
기기 제조사 모델명
AKTA Pure GE Healthcare 29-0182-24
원심분리기 Beckman J-26xp
젤 이미징 시스템 Tanon 2500R
Sartopore 2 filter Sartorius 5445307H9-OO-A
Mabselect sure 컬럼을 이용해 단백질을 정제하였다. 구체적으로, 2,000xg, 4℃에서 20분간 원심 분리하여 상층액을 수확하였다. 그 후, Sartopore 2 필터로 상층액을 여과하였다. 용액 A로 평형화된 5 ㎖ MabSelect Sure 컬럼에 정화된 상층액을 로딩하였다. 그 후, A280 흡광도가 기준치에 도달할 때까지 용액 A로 컬럼을 세척하였다. 10 CV 용액 B로 컬럼을 세척하였다. 10 CV 용액 A로 컬럼을 세척하였다. 6 CV 용액 C로 결합된 단백질을 용출하고, 1/6 부피의 용액 D를 넣어 용출한 물질을 중화하였다. SDS-PAGE와 SEC-HPLC 분석을 진행하였다.그 후, HIC 컬럼을 이용해 단백질을 정제하였다. 그 후, 밤새 4℃에서 용액 E에 대해 단백질을 투석하였다. 용액 E로 평형화된 HIC 컬럼에 상층액을 로딩하였다. 그 후, A280 흡광도가 기준치에 도달할 때까지 용액 E로 컬럼을 세척하였다. 기울기 용리(10 CV 용액 F 0%-40%)로 결합된 단백질을 용출하였다. 2 CV 100% 용액 F로 결합된 단백질을 용출하였다. SDS-PAGE 분석을 진행하였다.
단백질을 정제한 후 해당 단백질들을 한 군데로 모아준 후, 밤새 4℃에서 최종 용액에 대해 단백질을 투석하였다. 그 후, SDS-PAGE와 SEC-HPLC 분석을 수행하였다.
그 결과, 도 1 내지 도 6에 나타낸 것과 같이, 일 실시예의 인간 단백질 및 마우스 단백질이 정제되었음을 확인하였다.
제조예 3. 이중 항체 생산량 개선
제조예 3.1. 인간 IL-12를 포함하는 융합단백질 생산량 개선 변화 확인
하기 표 9에는 인간 IL-12 변이에 따른 인간 항-FAP/IL-12 이중 항체 생산량의 변화를 나타내었다. 괄호는 단백질의 생산 규모를 의미하며, 단위는 L이다. 괄호 앞의 숫자는 단백질의 양을 생산규모로 나누어 얻은 1L 당 생산량이다.
PROTEIN Description Protein A 컬럼을 거친 후 단백질의 양(mg)(생산 규모, L)
T1.01 anti-hu FAP/hu IL-12, hu IgG1 DANG 40 (1), 132 (1)
T1.02 anti-hu FAP/hu IL-12 mut1, hu IgG1 DANG 45 (1), 139.7 (2)
T1.03 anti-hu FAP/hu IL-12 mut2, hu IgG1 DANG 250 (1), 220 (5)
상기 표 9에 나타낸 것과 같이, 인간 IL-12 p40 (베타) 영역에서 헤파린 결합에 관여하는 아미노산의 변이 개수를 증가시킴에 따라 Protein A 컬럼 (MabSelect Sure 컬럼)을 통한 단백질 정제 이후 양이 향상되었다. 아미노산 280번, 285번의 라이신(K)을 알라닌(A)으로 변이한 이중 항체 T1.02는 T1.01과 비교하여 생산량이 개선되었음을 확인하였다. 아미노산 280번, 282번, 285번, 286번의 라이신(K)을 알라닌(A)으로 변이한 이중항체 T1.03은 T1.01과 비교하여 약 2.5배로 생산량이 개선되었음을 확인하였다.제조예 3.2. 마우스 IL-12를 포함하는 융합단백질 생산량 개선 변화 확인
하기 표 10에는 마우스 IL-12 변이에 따른 마우스 항-FAP/IL-12 이중 항체 생산량의 변화를 나타내었다.
PROTEIN Description Protein A 컬럼을 거친 후 단백질의 양(mg)(생산 규모, L)
T1.01m anti-mu FAP/mu IL-12, mu IgG2a DANG 5.725(4), 3.967(12), 3.667(12)
T1.02m anti-mu FAP/mu IL-12 mut1, mu IgG2a DANG 5.825(4), 9.86(2), 5.74(20)
T1.03m anti-mu FAP/mu IL-12 mut2, mu IgG2a DANG 9.54(1), 126.8(1)
상기 표 10에 나타낸 것과 같이, 마우스 IL-12 p40 (베타) 영역에서 헤파린 결합에 관여하는 아미노산의 변이 개수를 증가시킴에 따라 Protein A 컬럼 (MabSelect Sure 컬럼)을 통해 단백질을 정제한 결과 단백질의 양이 증가되었다.각 표에서 Protein A 컬럼을 거친 후 단백질의 양은 총 단백질 생산량을 생산규모로 나누어 비교하였다. 아미노산 277번, 282번 라이신(K)을 알라닌(A)으로 변이한 이중 항체 T1.02m, 아미노산 276번 알지닌(R)을 알라닌(A)으로, 277번, 278번, 282번, 라이신(K)을 알라닌(A)으로 변이한 이중 항체 T1.03m은 T1.01m 및 T1.02m과 비교하여 단백질 생산량이 점진적으로 개선됨을 확인하였다. 이와 함께, CHO 세포주를 이용한 T1.03m의 생산은 HEK 293 세포주를 이용한 생산량과 비교하여 약 13배 개선됨을 확인하였다.
제조예 4. 세포주 및 세포주 배양
인간 배아 신장 섬유아세포(Human embryonic kidney fibroblast)인 HEK293 세포에 IL-12 수용체 유전자와 STAT4 유도적인 SEAP 리포터 유전자를 형질전환 시킨 HEK-Blue IL-12 세포주는 Invivogen(San Diego, USA)로부터 공급받아 사용하였다. HEK-Blue IL-12 세포는 10% FBS(GIBCO), 100 ㎍/㎖ 노르모신(Normocin)과 1ΥHEK-Blue 선별(selection)을 포함하는 DMEM(GIBCO)에서 유지되었다.
인간 배아 신장 섬유아세포주 HEK293, 마우스 대장암 세포주 CT26-WT, 마우스 흑색종 세포주 B16F10 및 마우스 섬유아세포주인 NIH-3T3 세포주는 ATCC(American Type Culture Collection, Manassas, VA, USA)로부터 공급받아 사용하였다. HEK293 세포, B16F10세포 및 NIH-3T3 세포는 10% FBS(GIBCO)를 포함하는 DMEM(GIBCO)에서 유지되었다. HEK293세포에 인간 FAP(Fibroblast activation protein alpha)를 과발현 시킨 세포주(HEK293-hFAP)는 인간 FAP 유전자를 전달할 수 있는 렌티바이러스(lentivirus)를 이용하여 제작하였다. HEK293-hFAP 세포는 10% FBS(GIBCO), 5 ㎍/㎖ 퓨로마이신(Puromycin)을 포함하는 DMEM(GIBCO)에서 유지되었다.
CT26-WT 세포, B16F10 및 NIH-3T3 세포에 마우스 FAP(Fibroblast activation protein alpha)을 과발현 시킨 세포주(CT26-mFAP, B16F10-mFAP 및 NIH-3T3-mFAP)는 마우스 FAP 유전자를 전달할 수 있는 렌티바이러스(lentivirus)를 이용하여 제작하였다. CT26-mFAP 세포는 10% FBS(GIBCO), 10 ㎍/㎖ 퓨로마이신(Puromycin)을 포함하는 RPMI-1640(GIBCO)에서 유지되었다. B16F10-mFAP 세포는 10% FBS(GIBCO), 10 ㎍/㎖ 퓨로마이신(Puromycin)을 포함하는 DMEM(GIBCO)에서 유지되었다. NIH-3T3-mFAP 세포는 10% FBS(GIBCO), 5 ㎍/㎖ 퓨로마이신(Puromycin)을 포함하는 DMEM(GIBCO)에서 유지되었다.
제조예 5. 인간 면역세포 분리 및 활성화
IRB(Institutional Review Board)의 승인을 받아 대한적십자사(Korean Red Cross, Korea)로부터 혈액팩을 공급받아 말초혈 단핵세포(Peripheral blood mononuclear cell, PBMC)를 분리하여 동결하였다. 해동한 PBMC는 양성선택(Positive selection) 방법으로 Easy sep(Stem cell, Vancouver, BC, CA) 키트(Kit)로 인간 NK 세포를 분리하였다. 분리한 NK 세포는 50 IU/㎖ 재조합 인간 IL-2(Recombinant human IL-2, rhIL-2, R&D systems, Minnesota, USA)가 포함된 10% FBS와 RPMI-1640(GIBCO)에서 활성화되고 유지되었다.
해동한 PBMC는 음성선택(Negative selection) 방법으로 Easy sep(Stem cell) 키트(Kit)로 인간 T 세포를 분리하였다. 인간 T 세포는 1 ㎍/㎖ 항-CD3(OKT3, Invitrogen)가 코팅된 플레이트에서 배양하여 72시간 활성화시켰다. 인간 T 세포는 10% FBS(GIBCO)가 포함된 RPMI-1640(GIBCO)에서 유지되었다.
실시예 1. 융합단백질의 결합 친화도 확인
실시예 1.1. 재조합 인간 FAP에 대한 융합 단백질의 결합 확인
T1.01, T1.02 및 T1.03의 재조합 인간 FAP에 대한 결합을 표면 플라즈몬 공명(Surface plasmon resonance, SPR)으로 확인하였다.
구체적으로, CM5 칩의 표면을 50 nM NHS(N-hydroxysuccinimide)와 200 nM EDC(1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide)의 1:1 혼합물로 활성화시키고 25 ㎍/㎖의 항-인간 IgG(Fc) 항체를 10 ㎕/min의 속도로 400초간 고정화(Immobilization) 하였다. 남아있는 활성화 에스터 그룹(Active ester groups)은 1 M 에탄올아민(ethanolamine)으로 블로킹(Blocking) 하였다. T1.01, T1.02 및 T1.03을 2 ㎍/㎖로 희석하여 항-인간 IgG(Fc) 항체가 고정화된 CM5 칩에 반응시켰다. 재조합 인간 FAP을 1 x HBS-EP+버퍼용액에 200 nM로 희석하고 연속 희석법으로 희석하였다. 희석한 재조합 인간 FAP을 30 ㎕/min의 속도로 반응시켰다. 결합과 해리 시간은 각각 180초와 400초였다. 해리 단계 후 60초간 안정화한 후, 10 mM 글라이신(Glycine) pH1.5 용액으로 30 ㎕/min의 속도로 30초간 재생(Regeneration) 단계를 수행하였다.
그 결과, 도 7 및 도 8에 나타낸 것과 같이, T1.01, T1.02 및 T1.03이 재조합 인간 FAP에 특이적으로 결합할 수 있음을 확인하였다.
T1.04, T1.05, T1.06, T1.07, T1.08, T1.09, T1.10 및 T1.11의 재조합 인간 CD20에 대한 결합을 표면 플라즈몬 공명(Surface plasmon resonance, SPR)으로 확인하였다. CM5 칩의 표면을 50 nM NHS(N-hydroxysuccinimide)와 200 nM EDC(1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide)의 1:1 혼합물로 활성화시키고 25 ㎍/㎖의 항-인간 IgG(Fc) 항체를 10 ㎕/min의 속도로 400초간 고정화(Immobilization) 하였다. 남아있는 활성화 에스터 그룹(Active ester groups)은 1 M 에탄올아민(ethanolamine)으로 블로킹(Blocking) 하였다.
구체적으로, 인간 단백질 T1.04, T1.05, T1.06, T1.07, T1.08, T1.09, T1.10 및 T1.11을 각각 1 ㎍/㎖, 1 ㎍/㎖, 1 ㎍/㎖, 1 ㎍/㎖, 0.5 ㎍/㎖, 0.5 ㎍/㎖, 0.5 ㎍/㎖, 1 ㎍/㎖로 희석하여 항-인간 IgG(Fc) 항체가 고정화된 CM5 칩에 반응시켰다. 재조합 인간 FAP을 1 x HBS-EP+ 버퍼용액에 25nM 혹은 50 nM로 희석하고 연속 희석법으로 희석하였다. 희석한 재조합 인간 FAP을 30 ㎕/min의 속도로 반응시켰다. 결합과 해리 시간은 각각 180초와 400초였다. 해리 단계 후 60초간 안정화한 후, 10 mM 글라이신(Glycine) pH1.5 용액으로 30 ㎕/min의 속도로 30초간 재생(Regeneration) 단계를 수행하였다.
그 결과, 표 11, 도 9 및 도 10, T1.04, T1.05, T1.06 및 T1.07이 재조합 인간 FAP에 결합하여, FAP을 특이적으로 표적할 수 있음을 확인하였다. 또한, 표 12, 도 11 및 도 12에 나타낸 것과 같이, T1.08, T1.09, T1.10 및 T1.11이 재조합 인간 FAP에 결합하여, FAP을 특이적으로 표적할 수 있음을 확인하였다.
Kinetics model Capture 1 Solution Analyte 1 Solution Kinetics Chi² (RU²) ka (1/Ms) kd (1/s) KD (M)
1:1 binding 1ug/ml T1.04 human FAP 2.70E-01 5.83E+05 1.50E-05 2.57E-11
1:1 binding 1ug/ml T1.05 human FAP 2.80E-01 6.25E+05 5.83E-05 9.32E-11
1:1 binding 1ug/ml T1.06 human FAP 1.32E-01 1.04E+05 6.22E-05 5.96E-10
1:1 binding 1ug/ml T1.07 human FAP 2.33E-01 5.97E+05 7.64E-05 1.28E-10
Kinetics model Capture 1 Solution Analyte 1 Solution Kinetics Chi² (RU²) ka (1/Ms) kd (1/s) KD (M)
1:1 binding 0.5ug/ml T1.08 human FAP 4.70E-01 4.46E+05 7.87E-05 1.77E-10
1:1 binding 0.5ug/ml T1.09 human FAP 3.31E-01 5.17E+05 1.11E-04 2.14E-10
1:1 binding 0.5ug/ml T1.10 human FAP 1.84E-01 1.56E+05 7.48E-05 4.79E-10
1:1 binding 1ug/ml T1.11 human FAP 2.85E-01 1.20E+05 3.19E-05 2.67E-10
실시예 1.2. 재조합 마우스 FAP에 대한 마우스 단백질의 결합 확인T1.01m, T1.02m 및 T1.03m의 재조합 마우스 FAP에 대한 결합을 표면 플라즈몬 공명(Surface plasmon resonance, SPR)으로 확인하였다. CM5 칩의 표면을 50 nM NHS(N-hydroxysuccinimide)와 200 nM EDC(1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide)의 1:1 혼합물로 활성화시키고 25 ㎍/㎖의 항-마우스 IgG(Fc) 항체를 10 ㎕/min의 속도로 400초간 고정화(Immobilization) 하였다. 남아있는 활성화 에스터 그룹(Active ester groups)은 1 M 에탄올아민(ethanolamine)으로 블로킹(Blocking)하였다. T1.01m, T1.02m 및 T1.03m을 2 ㎍/㎖로 희석하여 항-마우스 IgG(Fc) 항체가 고정화된 CM5 칩에 반응시켰다. 재조합 마우스 FAP을 1 x HBS-EP+버퍼용액에 200 nM로 희석하고 연속 희석법으로 희석하였다. 희석한 재조합 마우스 FAP을 30 ㎕/min의 속도로 반응시켰다. 결합과 해리 시간은 각각 180초와 400초였다. 해리 단계 후 60초간 안정화한 후, 10 mM 글라이신(Glycine) pH 1.5 용액으로 30 ㎕/min의 속도로 30초간 재생(Regeneration) 단계를 수행하였다.
그 결과, 도 13 및 도 14에 나타낸 것과 같이, T1.01m, T1.02m 및 T1.03m이 재조합 마우스 FAP에 결합하여, FAP을 특이적으로 표적할 수 있음을 확인하였다.
실시예 1.3. FAP 발현 세포와의 결합 확인
T1.12, T1.01, T1.02 및 T1.03의 HEK293 및 HEK293-hFAP 세포에 대한 결합 정도를 확인하였다.
구체적으로, 세포주를 1 x 105 cells/100 ㎕로 FACS 완충용액에 부유하여 준비하고, T1.12, T1.01, T1.02 및 T1.03를 각각 1 ㎍씩 처리하였다. 세포들은 FACS 완충용액을 이용하여 두 차례 세척되었다. 세포들은 항-인간 IgG 항체(Biolegend)를 사용하여 염색하였다. 음성대조군(Negative control) 시료는 항-인간 IgG 항체(Biolegend)로만 염색되었다. 염색된 세포들의 발현 비율은 BD LSR를 사용하여 측정되었고, 플로우조(FlowJo) 소프트웨어를 이용하여 분석되었다.
그 결과, 도 15에 나타낸 것과 같이, T1.12, T1.01, T1.02 및 T1.03이 인간 FAP을 발현하는 세포주에 99% 이상 결합함을 확인하였다. 이러한 결과는, 일 구체예의 융합 단백질이 인간 FAP을 발현하는 세포주에 결합하여, FAP을 특이적으로 표적할 수 있음을 의미한다.
또한, T1.12m, T1.01m, T1.02m 및 T1.03m의 B16F10 및 B16F10-mFAP 세포에 대한 결합 정도를 확인하였다.
구체적으로, 세포주를 1 x 105 cells/100 ㎕로 FACS 완충용액에 부유하여 준비하였다. T1.12m, T1.01m, T1.02m 및 T1.03m를 각각 1 ㎍ 처리하였다. 세포들은 FACS 완충용액을 이용하여 두 차례 세척되었다. 세포들은 항-마우스 IgG2a 항체(Biolegend)를 사용하여 염색하였다. 음성대조군(Negative control) 시료는 항-마우스 IgG2a 항체(Biolegend)로만 염색되었다. 염색된 세포들의 발현 비율은 BD LSR를 사용하여 측정되었고, 플로우조(FlowJo) 소프트웨어에서 분석되었다.
그 결과, 도 16에 나타낸 것과 같이, T1.12m, T1.01m, T1.02m 및 T1.03m이 FAP을 발현하는 세포주에 99% 이상 결합함을 확인하였다. 이러한 결과는, 일 구체예의 융합 단백질이 마우스 FAP을 발현하는 세포주에 결합하여, FAP을 특이적으로 표적할 수 있음을 의미한다.
실시예 1.4. 재조합 인간 IL-12 수용체에 대한 융합 단백질의 결합 확인
융합 단백질의 IL-12가 작용하기 위해 IL-12 수용체에 결합해야 함을 고려하여, T1.01, T1.02, T1.03 및 T1.12이 재조합 인간 IL-12 수용체에 결합하는 것을 확인하였다.
T1.01, T1.02 및 T1.03를 플레이트에 고정하고 겨자무과산화효소(Horseradish peroxidase, HRP)가 접합된 재조합 인간 IL-12 수용체 단백질을 결합시켰으며, 구체적으로 하기와 같은 단계를 수행하였다:
(i) T1.01, T1.02, T1.03 및 T1.12를 5 ㎍/㎖로 부유하여 연속 희석법으로 희석하였다. 희석한 T1.01, T1.02, T1.03 및 T1.12를 96-웰 면역 플레이트(96-well immune plate)에 분주하고 24시간 처리하였다.
(ii) 세척용액으로 웰(well)을 세척한 후, 1% BSA(Bovine serum albumin, Sigma) 용액으로 1시간 블로킹(Blocking) 하였다.
(iii) 세척용액으로 웰을 세척한 후, 1 nM의 IL-12 수용체 베타 1-바이오틴(IL-12Rβ1-Biotin; Acrobiosystems, Newark, USA)을 2시간 처리하였다.
(iv) 세척용액으로 웰을 세척한 후, 스트렙타비딘-HRP(Streptavidin-HRP)로 20분간 처리하였다.
(v) 세척용액으로 웰을 세척한 후, 기질 용액(Substrate solution)을 20분간 처리하였다.
(vi) 정지 용액(Stop solution)을 처리하고 450 ㎚ 흡광도에서 측정되었다.
그 결과, 도 17에 나타낸 것과 같이, T1.01, T1.02 및 T1.03 이 농도 의존적인 방법(Concentration dependent manner)으로 재조합 인간 IL-12 수용체 단백질에 결합함을 확인하였다. T1.12는 대조군으로 사용하였다.
실시예 2. 융합단백질의 신호전달 유도능 확인
실시예 2.1. IL-12 감지 세포에서의 신호전달능 확인
IL-12는 IL-12 수용체에 결합하였을 때 신호전달 매개 물질인 STAT4(Signal transducer and activator or transcription 4)의 인산화를 유도하여 신호전달을 진행한다고 알려져 있음을 고려하여, 일 구체예의 융합 단백질의 IL-12 수용체를 발현하는 IL-12 감지 세포에서의 신호전달능력을 평가하였다.
구체적으로, IL-12 감지 세포인 HEK-Blue IL-12 세포주를 2.8 x 105 cells/㎖ 로 희석하여 180 ㎕/well로 분배되었다. 재조합 인간 IL-12(Recombinant human IL-12), T1.01m, T1.02m, T1.03m 및 T1.12m를 4 nM로 부유하여 연속 희석법으로 희석하였다. 희석한 재조합 인간 IL-12(Recombinant human IL-12), T1.01m, T1.02m, T1.03m 및 T1.12m을 HEK-Blue IL-12 세포에 처리하였다. 처리 24시간 후, 세포 상층액이 수집되었고, 96-웰(well) 플레이트에서 QUANTI-Blue Solution(Invivogen)과 혼합되었다. 분광광도계(Spectrophotometer, Thermo Fisher)로 620 ㎚에서 리포터 발현 정도를 측정하였다.
그 결과, 도 18에 나타낸 것과 같이, IL-12, T1.01m, T1.02m 및 T1.03m 처리군의 경우 IL-12를 감지하여 STAT4가 인산화를 유도함으로써 리포터 유전자를 발현시켰음을 620 ㎚ 흡광도에서 확인하였다. 이에 비해, 대조군인 T1.12m은 IL-12 감지 세포에 처리하였을 때, IL-12를 감지하지 못함을 확인하였다. 이러한 결과는, 일 구체예의 융합 단백질이 IL-12 수용체에 특이적으로 결합하여 신호전달을 유도함을 의미한다.
실시예 2.2. 인간 T 세포에서의 신호전달능 확인
인간 T 세포의 IL-12 수용체에 IL-12가 결합되었을 때, 신호전달 매개 물질인 STAT4의 인산화를 유도하여 신호전달이 진행되는지 확인하기 위하여, 항-CD3(OKT3, Invitrogen)으로 활성화시킨 인간 T 세포를 AlphaLISA SureFire Ultra p-STAT4(Tyr693) Assay Kit(PerkinElmer, Massachusetts, USA)를 사용하였다.
구체적으로, 인간 단백질 IL-12, T1.01, T1.02, T1.03 및 T1.12를 100 ng/㎖로 부유하여 연속 희석법으로 희석하였다. 희석한 재조합 인간 IL-12, T1.01, T1.02, T1.03 및 T1.12를 항-CD3(OKT3, Invitrogen)으로 활성화시킨 인간 T 세포에 처리하였다. 처리 2시간 후, 세포를 용해시키고 p-STAT4를 감지하는 시약(PerkinElmer)을 처리하였다. 분광광도계(Spectrophotometer)로 자극파장 680 ㎚ 및 발광파장 615 ㎚에서 pSTAT4를 감지하였다.
그 결과, 도 19에 나타낸 것과 같이, 재조합 인간 IL-12를 처리한 군의 반수유효농도(EC50)는 8.945 pM; T1.01를 처리한 군은 EC50 14.48 pM; T1.02를 처리한 군은 EC50 56.51 pM; T1.03을 처리한 군은 EC50 147.2 pM임을 확인하였다. 이에 반해, 대조군인 T1.12를 처리한 군은 인산화된 STAT4가 확인되지 않았다.
이러한 결과는, IL-12 돌연변이가 T 세포 신호전달 능력을 약화시켰음을(attenuated) 의미한다.
실시예 2.3. 인간 T세포에서의 융합단백질의 저분자헤파린에 의한 신호전달능 변화 확인
다음으로, IL-12 mutation(IL-12 mut1) 융합단백질의 저분자헤파린에 의한 신호 전달 능력 강화를 항-CD3(OKT3, Invitrogen)으로 활성화시킨 인간 T 세포 및 AlphaLISA SureFire Ultra p-STAT4(Tyr693) Assay Kit를 사용하여 확인하였다.
특히, 인간 T 세포의 IL-12 수용체에 약화된 IL-12 mut2가 결합하였을 때 신호전달 매개 물질인 STAT4의 인산화의 유도가 약화되었는지 관찰하여, 인간 T 세포에서의 저분자헤파린(Low molecular weight heparin, LMWH)의 유무에 따른 신호전달능을 확인하였다.
구체적으로, 재조합 인간 IL-12, T1.01, T1.02 및 T1.03를 100 ng/㎖로 부유하여 연속 희석법으로 희석하였다. 희석한 재조합 인간 IL-12, T1.01, T1.02 및 T1.03를 저분자헤파린과 함께 활성화시킨 인간 T 세포에 처리하였다. 처리 2시간 후, 세포를 용해시키고 p-STAT4를 감지하는 시약(PerkinElmer)을 처리하였다. 분광광도계(Spectrophotometer)로 자극파장 680 ㎚ 및 발광파장 615 ㎚에서 pSTAT4를 감지하였다.
그 결과, 도 20에 나타낸 것과 같이, T1.01을 저분자헤파린과 처리하였을 때 반수유효농도(EC50)가 T1.01 처리 대비 9.4배 증가, T1.02를 저분자헤파린과 처리하였을 때 반수유효농도(EC50)가 T1.02 처리 대비 5.5배 증가, T1.03을 저분자헤파린과 처리하였을 때 반수유효농도(EC50)가 T1.03 처리 대비 4배가 증가함을 보였다.
이러한 결과는, 기존 IL-12 mutation(IL-12 mut1)에 IL-12 mutation을 추가하였을 때(IL-12 mut2), 저분자헤파린의 추가에 의한 신호전달능력강화 정도가 줄어드는 것으로 보아 IL-12가 효과적으로 약화되었음을 의미한다.
실시예 3. 융합단백질의 사이토카인 분비능 확인
실시예 3.1. 사이토카인 측정을 위한 효소 결합 면역 침강 분석
사이토카인 측정을 위해, 하기와 같은 단계로 -20℃에서 보관된 상층액에서 효소 결합 면역 침강 분석(Enzyme-linked immunosorbent assay, ELISA, R&D systems)을 진행하였다:
(i) 포획 항체(Capture antibody)를 분석증명서(Certificate of Analysis, CoA)에 따라 희석하여 96-웰 플레이트(96-well plate)에 24시간 코팅하였다.
(ii) 세척용액으로 웰(well)을 세척한 후, 1% BSA(Bovine serum albumin, Sigma) 용액으로 1시간 블로킹(Blocking) 하였다.
(iii) 세척용액으로 웰을 세척한 후, 시료를 2시간 처리하였다.
(iv) 세척용액으로 웰을 세척한 후, 탐지 항체(Detection antibody)를 분석증명서에 따라 희석하여 웰에 분주한 후 2시간 처리하였다.
(v) 세척용액으로 웰을 세척한 후, 스트렙타비딘-HRP(Streptavidin-HRP)로 20분간 처리하였다.
(vi) 세척용액으로 웰을 세척한 후, 기질 용액(Substrate solution)으로 20분간 처리하였다.
(vii) 정지 용액(Stop solution)을 처리하고 450 ㎚에서 흡광도를 측정하였다.
실시예 3.2. 인간 T 세포에서의 사이토카인 분비능 확인
인간 T 세포에 IL-12를 처리하였을 때 주요 면역반응인 IFN-γ(Interferon-gamma) 분비가 일어남을 고려하여, 간 T 세포에 재조합 인간 IL-12, T1.12, T1.01, T1.02 및 T1.03을 처리하였을 경우의 IFN-γ 분비능을 평가하였다.
구체적으로, 항-CD3(OKT3, Invitrogen)으로 활성화시킨 인간 T 세포를 5 x 105 cells/㎖로 희석하여 96-웰(well) 플레이트에 200 ㎕/well로 분배하였다. 재조합 인간 IL-12, T1.12, T1.01, T1.02 및 T1.03는 10 nM로 희석하여 20 ㎕/well로 분배하였다. 처리 48시간 후, 세포 상층액이 수집되었고, 시료들은 -80℃에서 보관되었다.
그 결과, 도 21에 나타낸 것과 같이, 재조합 인간 IL-12를 처리한 시료에서는 평균 1,640 pg/㎖; T1.01을 처리한 시료에서는 평균 1,115 pg/㎖; T1.02를 처리한 시료에서는 평균 845 pg/㎖; T1.03을 처리한 시료에서는 평균 607 pg/㎖의 IFN-γ가 확인되었다. 이에 반해, 대조군인 T1.12를 처리한 시료에서는 IFN-γ가 확인되지 않았다.
이러한 결과는, T1.01, T1.02 및 T1.03이 인간 T 세포에 작용하여 IFN-γ 분비를 유도함을 의미한다.
실시예 3.3. 인간 NK 세포에서의 사이토카인 분비능 확인
인간 NK 세포에 IL-12를 처리하였을 때 주요 면역반응인 IFN-γ(Interferon-gamma) 분비가 일어남을 고려하여, 본 발명자들은 재조합 IL-2(recombinant human IL-2, R&D systems)로 활성화시킨 인간 NK 세포에 재조합 인간 IL-12, T1.12, T1.01, T1.02 및 T1.03을 처리하여 IFN-γ 분비능을 평가하였다.
구체적으로, 재조합 IL-2(recombinant human IL-2, R&D Systems)로 활성화시킨 인간 NK 세포를 5 x 105 cells/㎖로 희석하여 96-웰(well) 플레이트에 200 ㎕/well로 분배하였다. 재조합 인간 IL-12, T1.12, T1.01, T1.02 및 T1.03을 10 nM로 희석하여 20 ㎕/well로 분배하였다. 처리 24시간 후, 세포 상층액이 수집되었고, 시료들은 -80℃에서 보관되었다.
그 결과, 도 22에 나타낸 것과 같이, 재조합 인간 IL-12를 처리한 시료에서는 평균 180 pg/㎖; T1.01을 처리한 시료에서는 평균 205 pg/㎖; T1.02를 처리한 시료에서는 평균 133 pg/㎖; T1.03을 처리한 시료에서는 평균 80 pg/㎖의 IFN-γ가 확인되었다. 이에 반해, 대조군인 T1.12를 처리한 시료에서는 IFN-γ가 확인되지 않았다. 이러한 결과는, T1.01, T1.02 및 T1.03이 인간 NK 세포에 작용하여 IFN-γ 분비를 유도함을 의미한다.
실시예 4. 융합단백질의 대장암 동물모델에서의 항암효능 평가
실시예 4.1. FAP 발현 섬유아세포 공동주입을 통한 대장암 동물모델에서의 항암효능 평가
융합단백질이 항-FAP 서열 구조와 IL-12 서열 구조를 갖는 이중항체 형태이고 종양미세환경에 다수 존재하는 섬유아세포에서 FAP이 과발현 되있음을 고려하여, 마우스 섬유아세포 세포주인 NIH-3T3 세포에 FAP을 과발현 시킨 후 마우스 대장암 세포주인 CT26을 1:1로 공동주입한 종양 동물모델에서 종양성장억제능을 평가하였다.
FAP 발현 종양 동물모델 제작을 위하여 마우스 대장암 세포주인 CT26와 마우스 섬유아세포 세포주인 NIH-3T3를 사용하였다. 이때, NIH-3T3은 FAP 과발현 세포주로 제작하였다.
구체적으로, 배양중인 FAP 과발현 NIH-3T3 세포주와 CT26 세포주를 각각 1 x 106 Cells/50 ㎕ 농도로 Hanks' Balanced salt solution(HBSS, Gibco)에 재부유하여 세포를 1:1 비율로 섞은 후 1 ㏄ 주사기(25G)를 이용하여 6주령의 BALB/c 마우스의 오른쪽 옆구리 피하부위에 각 마우스당 100 ㎕씩 이식하여 FAP 발현 섬유아세포 공동주입 동물모델을 수득하였다. 종양 크기는 디지털 버니어 캘리퍼스를 이용하여 종양의 단축과 장축를 측정하였으며, 종양 크기는 (단축, ㎜)2 x (장축, ㎜) x 0.5의 계산식으로 주 2회 측정하였다.
다음으로, 약효평가를 위하여 종양의 크기가 100 ㎣에 도달하였을 때, 무작위로 나누어 그룹화하였다. 각 실험군당 10 마리씩 구성하였으며, 대조군 (Control)으로 50 ㎍의 T1.24m를 100 ㎕씩 3일 간격으로 3회 복강투여하였다. 시험군은 각각 10 ㎍ 및 50 ㎍의 T1.02m와 50 ㎍의 T1.01m를 100 ㎕씩 3일 간격으로 3회 복강투여하여 종양성장 억제능을 평가하였다.
그 결과, 도 23에 나타낸 것과 같이, 14일째 종양 크기를 비교하였을 때, 대조군인 T1.24m을 50 ㎍ 투여한 군에 비하여 T1.02m을 10 ㎍ 및 50 ㎍을 투여한 군에서 각각 93.2%와 92.7%의 우수한 종양성장 억제능이 있음을 확인하였다. 더불어, T1.01m을 50 ㎍ 투여한 군의 경우 대조군인 T1.24m를 50 ㎍ 투여한 군에 비하여 91.9%의 종양성장 억제가 관찰되었다.
또한, 도 24에 나타낸 것과 같이, 투여 후 24일 시점에서 대조군 대비 T1.01m 및 T1.02m 투여군에서 완전관해 개체가 관찰되었다.
이러한 결과는, 일 구체예의 융합 단백질이 대장암 동물모델에서 우수한 항암효능이 있음을 의미한다.
실시예 4.2. FAP 발현 대장암 동물모델에서의 항암효능 평가
대장암의 경우 종양세포 자체에서도 FAP 발현이 높음을 고려하여, 항암효과를 평가하기 마우스 대장암 세포주인 CT26 세포에 FAP을 과발현을 유도한 종양모델에서 종양성장억제능을 평가하였다.
FAP 발현 종양 동물모델 제작을 위하여 마우스 대장암 세포주인 CT26에 FAP을 과발현하여 사용하였다. 구체적으로, 배양중인 FAP 과발현 CT26 세포주를 Hanks' Balanced salt solution(HBSS, Gibco)에 재부유한 후 1 ㏄ 주사기(25G)를 이용하여 6주령 BALB/c 마우스의 좌측 등쪽 피하부위에 각 마우스당 1 x 106 개의 종양세포를 100 ㎕씩 이식하여 FAP 발현 대장암 동물모델을 수득하였다. 종양 크기는 디지털 버니어 캘리퍼스를 이용하여 종양의 단축과 장축을 측정하였으며, (단축, ㎜)2 x (장축, ㎜) x 0.5의 계산식으로 종양 크기를 주 2회 측정하였다.
다음으로, 약효평가를 위하여 종양의 크기가 100 ㎣에 도달하였을 때, 무작위로 나누어 그룹화하였다. 각 실험군당 8 마리씩 구성하였으며, 대조군으로 50 ㎍의 T1.24m를 100 ㎕씩 3일 간격으로 4회 복강투여하였다. 시험군은 각각 10 ㎍ 및 100 ㎍의 T1.01m와 2 ㎍, 10 ㎍, 100 ㎍의 T1.02m 용량으로 100 ㎕씩 3일 간격으로 4회 복강투여하여 종양성장 억제능을 평가하였다.
그 결과, 도 25에 나타낸 것과 같이, 투여 후 18일 경과 시점에서 10 ㎍ 및 100 ㎍의 T1.01m를 투여한 군에서 대조군인 T1.24m을 50 ㎍ 투여한 군에 비하여 각각 84.9%와 85.6%의 높은 종양성장 억제능이 확인되었다. 더불어, T1.02m는 대조군인 T1.24m 투여군에 비하여 용량별로 각각 80.1%, 90.5% 및 89.8%의 높은 종양성장 억제능이 확인되었다.
더불어, 종양성장 억제와 함께 투여 후 30일 경과 시점에서 각 투여군에서 완전관해(Complete response, CR) 개체가 존재함을 확인하였으며, 시험진행에 투여에 따른 체중변화는 관찰되지 않았다. 이러한 결과는, 일 구체예의 융합 단백질이 대장암 동물모델에서 우수한 항암효능이 있음을 의미한다.
실시예 4.3. 융합단백질에 의해 완전관해가 일어난 마우스에서의 고형암 재발암의 성장억제 평가
융합단백질 치료 후 장기면역반응 유도를 통한 종양재발을 억제할 수 있는지 평가하기 위하여, FAP이 과발현된 CT26 세포를 이식한 종양모델에서 T1.01m을 투여하여 완전관해가 일어난 개체를 대상으로 종양재발평가(Tumor re-challenge)를 진행하였다. 대조군 마우스로는 치료이력이 없는 BALB/c 마우스를 사용하였다.
대조군 마우스 및 T1.01m 투여에 따라 완전관해가 확인된 마우스의 왼쪽 옆구리에 4T1 세포, 오른쪽 옆구리에 CT26 세포를 피하주사하여 종양재발모델을 수득하였다.
구체적으로, CT26 세포를 이식한 모델에서 T1.01m를 투여하여 완전관해(Complete response, CR)가 나타난 마우스를 대상으로 종양 재발 모델을 유도하였다. CT26 세포 및 4T1 세포를 각각 Hanks' Balanced salt solution(HBSS, Gibco)에 1 x 106 cells/100 ㎕ 농도로 부유하고, 마우스의 오른쪽 옆구리에 CT26 세포를 1 ㏄ 주사기(25G)를 이용하여 피하이식하였다. 동일 마우스의 왼쪽 옆구리에 4T1 세포를 피하이식 하여 종양 형성 및 성장을 평가하였다. 대조군은 9마리, 시험군은 7마리가 사용되었다.
그 결과, 도 26 및 도 27에 나타낸 것과 같이, 치료 이력이 없는 대조군 마우스에서는 이식한 4T1 종양과 CT26 종양 모두 성장하는 반면, T1.01m 투여 후 완전관해가 일어난 마우스에서는 4T1 종양이 성장하지만, CT26 종양은 성장이 억제됨을 확인하였다. 이러한 결과는, 일 구체예의 융합단백질이 종양재발을 억제할 수 있음을 의미한다.
실시예 4.4. 융합 단백질의 IL-12 아미노산 변이에 따른 활성 감소 평가
본 발명자들은 IL-12에 의한 면역체계의 과도한 활성화에 따른 생체내 독성을 줄이기 위하여 헤파린과 결합하는 아미노산 서열의 변이가 포함된 IL-12 서열 구조를 이용하여, IL-12 수용체와의 결합 방해를 통한 활성감소를 유도하였고 이를 종양 동물모델을 통하여 확인하였다.
항-FAP 항체 중 헤파린 결합에 관여하는 아미노산에 변이가 일어난 T1.02m 및 T1.03m 및 대조군으로서 T1.01m을 이용하였다. 이때 T1.02m은 항-FAP 서열 구조와 함께 헤파린 결합에 관여하는 아미노산의 변이(2개)가 포함된 마우스 IL-12 서열 구조를 가지고 있다. T1.03m은 항-FAP 서열 구조와 함께 헤파린에 결합에 관여하는 아미노산의 변이(4개)가 포함된 IL-12 서열 구조를 가지는 융합단백질이다.
아미노산 변이 여부 및 정도에 따른 IL-12 활성 변화를 평가하기 위하여, FAP을 과발현 시킨 마우스 대장암 CT26을 PBS에 5 x 105 cells/100 ㎕ 농도로 재부유 하여 준비하고, 세포를 5주령 암컷 BALB/c 마우스에 이식하여 제작한 종양동물모델에서 종양성장 억제능을 평가하였다.
구체적으로, 상기 모델의 종양의 크기가 100 ㎣에 도달하였을 때, 무작위로 나누어 그룹화하였다. 대조군에는 Phosphate buffered saline(PBS)를 100 ㎕씩 단회 미정맥 투여하고, T1.01m, T1.02m 및 T1.03m 각각을 10 ㎍ 용량으로 단회 미정맥 투여하였다.
그 결과, 도 28에 나타낸 것과 같이, 투여 후 15일 경과시 T1.01m, T1.02m 및 T1.03m 투여군 모두 대조군 대비 우수한 종양 성장 억제능이 있음을 확인하였다.
또한, 마우스 항-FAP 서열과 헤파린 결합에 관여하는 아미노산 변이(4개) IL-12를 포함하는 T1.03m 투여군에서 T1.01m 군 대비 종양성장 억제능이 감소되었음을 확인하였다. 이러한 결과는, 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열 구조를 가지는 T1.03m가 타 실험군 및 대조군 대비 IL-12 활성이 감소하였음을 의미한다.
실시예 4.5. IL-12 아미노산 변이 융합단백질의 단회 투여시 항암효능 평가
헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 서열 구조에 의하여 IL-12 활성이 감소된 융합단백질의 항암효과를 평가하기 위하여, FAP을 과발현 시킨 마우스 대장암 세포주인 CT26 세포를 이식한 동종이식 종양모델에서 종양성장 억제능을 평가하였다.
구체적으로, 종양세포를 6주령 BALB/c 마우스에 우측 등쪽에 이식하고, 상기 동물모델의 종양 크기가 70 내지 100 ㎣에 도달하였을 때, 무작위로 나누어 그룹화하여 투여를 진행하였다. 대조군(Control)으로 PBS를 투여하였고, 시험군으로 T1.03m을 2 ㎍, 10 ㎍ 및 100 ㎍의 용량으로 100 ㎕씩 마우스 미정맥에 단회 투여하였다. 상기 실시예 4.1의 방법과 동일하게 종양 크기를 측정하였다.
그 결과, 도 29에 나타낸 것과 같이, 2 ㎍, 10 ㎍ 및 100 ㎍의 T1.03m를 투여한 군에서 대조군에 비해 높은 종양성장 억제능이 관찰되었다. 시험을 진행하는 기간동안 체중변화는 관찰되지 않았다. 이러한 결과는, 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 서열 구조에 의하여 IL-12 활성이 감소된 T1.03m이 일정 농도 이상에서 우수한 항암효능이 있음을 의미한다.
실시예 5. 융합단백질의 흑색종 동물모델에서의 항암효능 평가
융합단백질의 면역활성화를 통한 항암효과를 확인하기 위하여 면역세포 침윤이 적은 것으로 알려져있는 마우스 흑색종 세포주인 주인 B16F10에 FAP을 과발현 시킨 후 C57BL/6J 마우스에 이식하여 종양성장억제능을 평가하였다.
구체적으로, 배양중인 세포를 Hanks' Balanced salt solution(HBSS, Gibco)에 재부유한 후 6주령 C57BL/6J 마우스의 좌측 등쪽 피하부위에 각 마우스당 1 x 106 개의 종양세포를 100 ㎕씩 이식하였다.
다음으로, 약효평가를 위하여 종양의 크기가 70 내지 100 ㎣에 도달하였을 때, 무작위로 나누어 그룹화하였다. 대조군 (Control)으로 PBS를 투여하였고, 시험군은 T1.03m을 10, 100 ㎍ 용량으로 마우스 미정맥에 단회 투여하였다.
그 결과, 도 30에 나타낸 것과 같이, 10 ㎍ 및 100 ㎍의 T1.01m를 투여한 군 모두 대조군에 비해 높은 종양성장 억제능이 관찰되었다. 시험을 진행하는 기간동안 체중변화는 관찰되지 않았다. 이러한 결과는, 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 서열 구조에 의하여 IL-12 활성이 감소된 T1.03m이 흑색종 동물모델에서도 우수한 항암효능이 있음을 의미한다.
실시예 6. 융합단백질의 폐암 동물모델에서의 항암효능 평가
실시예 6.1. IL-12 아미노산 변이 융합단백질의 폐암 동물모델에서의 항암효능 평가
종양주위 미세환경에 존재하는 섬유아세포에서 FAP이 과발현되어 있음을 고려하여, 마우스 섬유아세포 세포주인 NIH-3T3 세포에 FAP을 과발현 시킨 후 마우스 폐암 세포주인 LLC1 세포를 1:1 비율로 공동주입하여 종양동물모델을 제작하여 종양성장억제능을 평가하였다.
구체적으로, 배양중인 FAP 과발현 NIH-3T3 세포주와 LLC1 세포주를 각각 1 x 106 Cells/50 ㎕ 농도로 Hanks' Balanced salt solution(HBSS, Gibco)에 재부유하여 세포를 1:1 비율로 섞은 후 1 ㏄ 주사기(25G)를 이용하여 6주령의 C57BL/6J 마우스의 오른쪽 옆구리 피하부위에 각 마우스당 100 ㎕씩 이식하였다.
다음으로, 약효평가를 위하여 종양의 크기가 70 내지 100 ㎣에 도달하였을 때, 무작위로 나누어 그룹화하였다. 대조군(Control)으로 PBS를 투여하였고, 시험군은 T1.03m을 10 ㎍ 및 100 ㎍ 용량 마우스 미정맥에 단회 투여하였다.
그 결과, 도 31에 나타낸 것과 같이, T1.03m을 10 ㎍ 또는 100 ㎍ 투여한 군 모두 대조군 대비 우수한 종양성장 억제능이 관찰되었다. 시험을 진행하는 기간동안 체중변화는 없었다. 이러한 결과는, 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 서열 구조에 의하여 IL-12 활성이 감소된 T1.03m이 종양 미세환경의 표적인자를 인지함으로서 폐암 동물모델에서도 우수한 항암효능이 있음을 의미한다.
실시예 6.2. 융합단백질의 공동주입을 통한 폐암 동물모델에서의 암표적 효능 평가
항-FAP 서열 구조와 IL-12 서열 구조가 놉-인-홀 구조를 이루는 이중 항체형태 융합단백질의 암표적에 따른 항암효능 비교를 위해, FAP을 과발현 시킨 마우스 섬유아세포 세포주인 NIH-3T3 세포와 마우스 폐암 세포주인 LLC1을 1:1 비율로 공동주입한 동물모델에서의 종양성장억제능을 확인하였다.
구체적으로, 약효평가를 위하여 종양의 크기가 70 내지 100 ㎣에 도달하였을 때, 무작위로 나누어 그룹화하여 대조군(Control)으로 PBS를 주 2회 복강 투여하였다. T1.16m 또는 T1.17m 단독 투여군, T1.16m 및 T1.17m 병용투여(T1.16m + T1.17m) 및 T1.03m 투여군을 시험군으로 하여 종양성장 억제능을 평가하였다. 항-FAP 과 IL-12가 각각 이량체(dimer)인 T1.16m 과 T1.17m은 각각 0.01 ㎍ 씩, 단량체(monomer) 융합단백질인 T1.03m은 0.02 ㎍ 용량으로 주2회 복강투여하여 종양성장 억제능을 관찰하였다.
그 결과, 도 32에 나타낸 것과 같이, 투여 후 10일이 경과한 시점에서 대조군에 대비하여 T1.03m 투여군에서 우수한 종양성장 억제능이 관찰되었으며, T1.16m와 T1.17m 단독투여군 및 각각의 병용투여군과 비교하여 T1.03m 단독투여군에서 우수한 종양성장 억제능이 확인되었다. 이러한 결과는, FAP만 표적하는 경우 또는 암표적이 없는 IL-12와 비교하였을 경우보다 일 구체예의 융합단백질이 시너지 효과가 현저함을 의미한다.
실시예 7. 융합단백질 및 항암제 병용 투여시 항암 효과 확인
실시예 7.1. 폐암 마우스 모델에서 면역관문 억제제 병용 투여에 의한 항암 효과 확인
항-FAP 서열 구조와 IL-12 서열 구조가 놉-인-홀 구조를 이루는 융합단백질 및 면역관문 억제제의 병용시 항암 효능 비교를 위해, 마우스 동물모델에서의 종양성장억제능을 확인하였다. 구체적으로, FAP을 과발현 시킨 마우스 섬유아세포 세포주인 NIH-3T3 세포와 마우스 폐암 세포주인 LLC1을 1:1 비율로 공동주입한 마우스 동물모델을 이용하였다.
약효평가를 위하여 종양의 크기가 평균 110 내지 120 ㎣에 도달하였을 때, 무작위로 나누어 그룹화하여 대조군(Control)으로 PBS를 3일에 1번 총 3회 복강 투여하였다. T1.03m 단독 투여군, 면역관문 억제제인 aPD-L1(clone 10F.9G2, BioXCell), aCTLA-4(clone 9D9, BioXCell), 또는 aPD-1(Clone RMP1-14, BioXCell) 단독 투여군, T1.03m 및 aPD-L1 병용투여(도 33a), T1.03m 및 aCTLA-4 병용투여(도 33b) 및 T1.03m 및 aPD-1 병용투여군(도 33c)을 실험군으로 하여 종양성장 억제능을 평가하였다. T1.03m은 10 ㎍ 용량으로 단회 정맥주사하였으며, 면역관문 억제제는 200 ㎍ 용량으로 3일에 1번 투여하여 종양성장 억제능을 관찰하였다.
그 결과, 도 33a 내지 도 33c에 나타낸 것과 같이, 투여 후 9일이 경과한 시점에서 대조군 및 T1.03m 투여군에 대비하여 면역관문 억제제 병용 투여군에서 더 우수한 종양성장 억제능이 관찰되었다. 이러한 결과는, 항-FAP 과 IL-12 단량체(monomer) 융합단백질인 T1.03m이 면역관문 억제제와 병용 투여 시, 폐암 마우스 모델에서 시너지 효과가 현저함을 의미한다.
실시예 7.2. 대장암 마우스 모델에서 면역관문 억제제 병용 투여에 의한 항암 효과 확인
항-FAP 서열 구조와 IL-12 서열 구조가 놉-인-홀 구조를 이루는 이중 항체 형태 융합단백질과 면역관문 억제제와 병용 투여시의 항암 효능 비교를 위해, 마우스 동물모델에서의 종양성장억제능을 확인하였다. 구체적으로, FAP을 과발현 시킨 마우스 섬유아세포 세포주인 NIH-3T3 세포와 마우스 대장암 세포주인 MC38을 1:1 비율로 공동주입한 마우스 동물모델을 이용하였다.
구체적으로, 약효평가를 위하여 종양의 크기가 평균 90 내지 160 ㎣에 도달하였을 때, 무작위로 나누어 그룹화하여 대조군(Control)으로 PBS를 3일에 1번 복강 투여하였다. T1.03m 단독 투여군, 면역관문 억제제인 aPD-L1(clone 10F.9G2, BioXCell) 단독 투여군, T1.03m 및 aPD-L1 병용투여군을 실험군으로 하여 종양성장 억제능을 평가하였다. T1.03m은 2 ㎍ 용량으로 단회 정맥주사하였으며, 면역관문 억제제는 200 ㎍ 용량으로 3일에 1번 투여하여 종양성장 억제능을 관찰하였다.
그 결과, 도 34a 와 도 34b에 나타낸 것과 같이, 투여 후 16일이 경과한 시점에서 대조군 및 T1.03m 투여군에 대비하여 면역관문 억제제 병용 투여군에서 더 우수한 종양성장 억제능이 관찰되었다. 이러한 결과는, 항-FAP 과 IL-12 단량체(monomer) 융합단백질인 T1.03m이 면역관문 억제제와 병용 투여 시, 대장암 마우스 모델에서 시너지 효과가 현저함을 의미한다.
또한 T1.03m 단독 투여군, 면역관문 억제제인 aPD-L1(clone 10F.9G2, BioXCell) 단독 투여군, T1.03m 및 aPD-L1 병용투여군을 실험군으로 하여 종양성장 억제능을 추가 평가하기 위해, T1.03m은 10 ㎍ 용량으로 단회 정맥주사하였으며, 면역관문 억제제는 200 ㎍ 용량으로 3일에 1번 투여하여 종양성장 억제능을 관찰하였다.
그 결과, 도 35a 와 도 35b에 나타낸 것과 같이, 투여 후 11일이 경과한 시점에서 대조군 및 T1.03m 투여군에 대비하여 면역관문 억제제인 aPD-L1 병용 투여군에서 더 우수한 종양성장 억제능이 관찰되었다.
또한 T1.03m 단독 투여군, 면역관문 억제제인 aTIGIT(clone 1G9, BioXCell), aLAG-3(clone C9B7W, BioXCell), 또는 aTIM-3(Clone RMT3-23, BioXCell) 단독 투여군, T1.03m 및 aTIGIT 병용투여(도 36), T1.03m 및 aLAG-3 병용투여(도 37) 및 T1.03m 및 aTIM-3 병용투여군(도 38)을 실험군으로 하여 종양성장 억제능을 평가하였다. T1.03m은 10 ㎍ 용량으로 단회 정맥주사하였으며, 면역관문 억제제는 200 ㎍ 용량으로 3일에 1번 투여하여 종양성장 억제능을 관찰하였다.
그 결과, 도 36a 및 36b에 나타낸 것과 같이, 투여 후 10일이 경과한 시점에서 대조군 및 T1.03m 단독 투여군에 대비하여 T1.03m 및 aTIGIT 병용 투여군에서 더 우수한 종양성장 억제능이 관찰되었다.
또한, 도 37a 및 37b에 나타낸 것과 같이, 투여 후 10일이 경과한 시점에서 대조군 및 T1.03m 단독 투여군에 대비하여 T1.03m 및 aLAG-3 병용 투여군에서 더 우수한 종양성장 억제능이 관찰되었다.
더불어, 도 38a 및 38b에 나타낸 것과 같이, 투여 후 10일이 경과한 시점에서 대조군 및 T1.03m 단독 투여군에 대비하여 T1.03m 및 aTIM-3 병용 투여군에서 더 우수한 종양성장 억제능이 관찰되었다.
이러한 결과는, 항-FAP 과 IL-12 단량체(monomer) 융합단백질인 T1.03m이 면역관문 억제제와 병용 투여 시, 대장암 마우스 모델에서 시너지 효과가 현저함을 의미한다.
실시예 7.3. 대장암 마우스 모델에서 화학항함제 병용 투여에 의한 항암 효과 확인
항-FAP 서열 구조와 IL-12 서열 구조가 Knob-in-Hole 구조를 이루는 이중 항체 형태 융합단백질과 화학항암제 병용 투여시의 항암 효능 비교를 위해, 마우스 동물모델에서의 종양성장억제능을 확인하였다. 구체적으로, FAP을 과발현 시킨 마우스 섬유아세포 세포주인 NIH-3T3 세포와 마우스 대장암 세포주인 MC38을 1:1 비율로 공동주입한 마우스 동물모델을 이용하였다.
구체적으로, 약효평가를 위하여 종양의 크기가 평균 110 내지 120 ㎣에 도달하였을 때, 무작위로 나누어 그룹화하여 대조군(Control)으로 PBS를 4일에 1번 복강 투여하였다. T1.03m 단독 투여군; 화학항암제인 Cyclophosphamide(엔독산주, 부광약품), Fluorouracil(5-에프유주, 중외제약), Paclitaxel(네오탁주, 중외제약) 또는 Camptosar(이리노테칸주, 화이자) 단독 투여군; T1.03m 및 Cyclophosphamide 병용투여군(도 39), T1.03m 및 Fluorouracil 병용투여군(도 40), T1.03m 및 Pacliatxel 병용투여군(도 41) 및 T1.03m 및 Camptosar 병용투여군(도 42)을 실험군으로 하여 종양성장 억제능을 평가하였다.
그 결과, 도 39a 및 39b에 나타낸 것과 같이, 투여 후 11일이 경과한 시점에서 대조군 및 T1.03m 단독 투여군에 대비하여 T1.03m 및 Cyclophosphamide 병용 투여군에서 더 우수한 종양성장 억제능이 관찰되었다.
또한, 도 40a 및 40b에 나타낸 것과 같이, 투여 후 11일이 경과한 시점에서 대조군 및 T1.03m 단독 투여군에 대비하여 T1.03m 및 Fluorouracil 병용 투여군에서 더 우수한 종양성장 억제능이 관찰되었다.
더불어, 도 41a 및 41b에 나타낸 것과 같이, 투여 후 11일이 경과한 시점에서 대조군 및 T1.03m 단독 투여군에 대비하여 T1.03m 및 Pacliatxel 병용 투여군에서 더 우수한 종양성장 억제능이 관찰되었다.
또한, 도 42a 및 42b에 나타낸 것과 같이, 투여 후 11일이 경과한 시점에서 대조군 및 T1.03m 투여군에 대비하여 T1.03m 및 Camptosar 병용 투여군에서 더 우수한 종양성장 억제능이 관찰되었다.
이러한 결과는, 항-FAP 과 IL-12 단량체(monomer) 융합단백질인 T1.03m이 화학항암제와 병용 투여 시, 대장암 마우스 모델에서 시너지 효과가 현저함을 의미한다.

Claims (13)

  1. IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및
    FAP(Fibroblast activation protein alpha)에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질; 및 항암제를 포함하는 암 예방 또는 치료용 약학 조성물.
  2. 제1항에 있어서,
    IL-12 또는 이의 변이체는 IL-12A(p35) 또는 이의 변이체; 및 IL-12B(p40) 또는 이의 변이체를 포함하는 것인, 암 예방 또는 치료용 약학 조성물.
  3. 제2항에 있어서,
    상기 IL-12B(p40)의 변이체는 서열번호 74의 아미노산 서열에서 K258A, K260A, K263A 및 K264A로 이루어지는 군으로부터 선택되는 하나 이상의 치환이 일어난 아미노산 서열을 포함하는 것인, 암 예방 또는 치료용 약학 조성물.
  4. 제1항에 있어서,
    상기 제1 단량체 및 제2 단량체는 놉-인투-홀 구조를 형성하는 것인, 암 예방 또는 치료용 약학 조성물.
  5. 제1항에 있어서,
    상기 항암제는 화학항암제, 항암 바이러스 및 면역관문 억제제로 이루어진 군에서 선택되는 어느 하나인 것인, 암 예방 또는 치료용 약학 조성물.
  6. 제5항에 있어서,
    상기 화학항암제는 Alkylating Agent, Microtubule Inhibitor, Anti metabolite 및 Topoisomerase Inhibitor로 이루어진 군에서 선택되는 어느 하나인 것인, 암 예방 또는 치료용 약학 조성물.
  7. 제5항에 있어서,
    상기 화학항암제는 Cyclophosphamide, Cisplatin, Fluorouracil, Gemcitabine, Camptosar, Paclitaxel 및 Adriamycin으로 이루어진 군에서 선택되는 어느 하나인 것인, 암 예방 또는 치료용 약학 조성물.
  8. 제5항에 있어서,
    상기 항암 바이러스는 Talimogene Laherparepvec(T-VEC)인 것인, 암 예방 또는 치료용 약학 조성물.
  9. 제5항에 있어서,
    상기 면역관문 억제제는 항-CTLA-4 항체, 항-PD-1 항체, 항-PD-L1 항체, 항-TIM3 항체, 항-TIGIT 항체 및 항-LAG3 항체로 이루어진 군으로부터 선택되는 어느 하나인 것인, 암 예방 또는 치료용 약학 조성물.
  10. 제5항에 있어서,
    상기 면역관문 억제제는 Ipilimumab, Pembrolizumab, Nivolumab, Cemiplimab, Atezolizumab, Avelumab 및 Durvalumab로 이루어진 군에서 선택되는 어느 하나인 것인, 암 예방 또는 치료용 약학 조성물.
  11. 제1항에 있어서,
    상기 암은 위암, 간암, 폐암, 대장암, 유방암, 전립선암, 난소암, 췌장암, 자궁경부암, 갑상선암, 후두암, 급성 골수성 백혈병, 뇌종양, 신경모세포종, 망막모세포종, 두경부암, 침샘암, 흑색종, 방광암, 식도암, 두경부암, 피부암, 결장직장암 및 림프종으로 구성된 군에서 선택되는 어느 하나인, 암 예방 또는 치료용 약학 조성물.
  12. IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및
    FAP에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질; 및 항암제를 유효성분으로 포함하는 암 예방 또는 치료용 키트.
  13. IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및
    FAP에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질 또는 이의 이량체; 및 항암제를 개체에 투여하는 단계를 포함하는 암을 치료 또는 예방하는 방법.
PCT/KR2023/002030 2022-02-11 2023-02-10 Il-12 및 항-fap 항체를 포함하는 융합단백질 및 항암제를 포함하는 암 치료용 약학 조성물 WO2023153880A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR20220018247 2022-02-11
KR10-2022-0018247 2022-02-11

Publications (1)

Publication Number Publication Date
WO2023153880A1 true WO2023153880A1 (ko) 2023-08-17

Family

ID=87564833

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2023/002030 WO2023153880A1 (ko) 2022-02-11 2023-02-10 Il-12 및 항-fap 항체를 포함하는 융합단백질 및 항암제를 포함하는 암 치료용 약학 조성물

Country Status (2)

Country Link
KR (1) KR20230121685A (ko)
WO (1) WO2023153880A1 (ko)

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20130133300A (ko) * 2011-04-29 2013-12-06 로슈 글리카트 아게 면역접합체
KR20210117220A (ko) * 2020-03-18 2021-09-28 (주)지아이이노베이션 Il-2 단백질 및 cd80 단백질을 포함하는 융합단백질 및 항암제를 포함하는 암 치료용 약학 조성물

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20130133300A (ko) * 2011-04-29 2013-12-06 로슈 글리카트 아게 면역접합체
KR20210117220A (ko) * 2020-03-18 2021-09-28 (주)지아이이노베이션 Il-2 단백질 및 cd80 단백질을 포함하는 융합단백질 및 항암제를 포함하는 암 치료용 약학 조성물

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
KIM DONGGEON, LEE DAHEA, RYU SOOMIN, BYEON YEONGSEON, PYO KYOUNG-HO, KIM JAE-HWAN, LEE SEUL, KIM DONG KWON, LEE EUN JI, OH SEUNG Y: "572 Fibroblast activating protein (FAP)-targeting IL-12 (anti-FAP/IL-12) TMEkine™ potentiates anti-cancer effects in preclinical cancer models", JOURNAL FOR IMMUNOTHERAPY OF CANCER, vol. 8, no. S3, 1 November 2020 (2020-11-01), pages A344 - A344, XP055901456, DOI: 10.1136/jitc-2020-SITC2020.0572 *
LURIA-PÉREZ ROSENDO, CANDELARIA PIERRE V., DANIELS-WELLS TRACY R., RODRÍGUEZ JOSÉ A., HELGUERA GUSTAVO, PENICHET MANUEL L.: "Amino acid residues involved in the heparin-binding activity of murine IL-12 in the context of an antibody-cytokine fusion protein", CYTOKINE, ACADEMIC PRESS LTD, PHILADELPHIA, PA, US, vol. 120, 1 August 2019 (2019-08-01), US , pages 220 - 226, XP055900916, ISSN: 1043-4666, DOI: 10.1016/j.cyto.2019.04.004 *
MURER PATRIZIA, NERI DARIO: "Antibody-cytokine fusion proteins: A novel class of biopharmaceuticals for the therapy of cancer and of chronic inflammation", NEW BIOTECHNOLOGY, ELSEVIER BV, NL, vol. 52, 1 September 2019 (2019-09-01), NL , pages 42 - 53, XP093007294, ISSN: 1871-6784, DOI: 10.1016/j.nbt.2019.04.002 *

Also Published As

Publication number Publication date
KR20230121685A (ko) 2023-08-21

Similar Documents

Publication Publication Date Title
WO2018194381A1 (ko) Lrig-1 단백질에 특이적인 결합 분자 및 이의 용도
WO2015058573A1 (zh) 拮抗抑制程序性死亡受体pd-1与其配体结合的单克隆抗体及其编码序列与用途
WO2014090053A1 (zh) 拮抗抑制血管内皮细胞生长因子与其受体结合的单克隆抗体及其编码序列与用途
WO2020050667A1 (ko) 고형암을 위한 키메라 항원 수용체 및 키메라 항원 수용체가 발현된 t 세포
WO2018026248A1 (ko) 프로그램화된 세포 사멸 단백질(pd-1)에 대한 신규 항체 및 이의 용도
WO2018030806A1 (ko) 항체 중쇄불변부위 이종이중체에 융합된 사이토카인 및 이를 포함하는 약제학적 조성물
WO2016137108A1 (en) Novel antibody binding to tfpi and composition comprising the same
WO2022039490A1 (en) Anti-b7-h4/anti-4-1bb bispecific antibodies and use thereof
WO2021107689A1 (ko) Il-2 단백질 및 cd80 단백질을 포함하는 융합단백질 및 면역관문 억제제를 포함하는 암 치료용 약학 조성물
WO2021020846A1 (en) Anti-her2/anti-4-1bb bispecific antibody and use thereof
WO2020080854A1 (ko) Lrig-1 단백질에 특이적인 결합 분자 및 이의 용도
WO2021187922A1 (ko) Il-2 단백질 및 cd80 단백질을 포함하는 융합단백질 및 항암제를 포함하는 암 치료용 약학 조성물
WO2022035201A1 (ko) Il-12 및 항-fap 항체를 포함하는 융합단백질 및 이의 용도
WO2021101346A1 (en) Anti-ror1/anti-4-1bb bispecific antibodies and uses thereof
WO2021020845A1 (en) Anti-egfr/anti-4-1bb bispecific antibody and use thereof
WO2016199964A1 (ko) 분리된 비멘틴 유래 펩타이드에 특이적으로 결합하는 항체 또는 상기 펩타이드의 결합 단편
WO2023153880A1 (ko) Il-12 및 항-fap 항체를 포함하는 융합단백질 및 항암제를 포함하는 암 치료용 약학 조성물
WO2021071319A1 (ko) 다중 특이적 융합 단백질 및 이의 용도
WO2018026249A1 (ko) 프로그램화된 세포 사멸 단백질 리간드-1 (pd-l1)에 대한 항체 및 이의 용도
WO2021101349A1 (ko) Ror1 및 b7-h3에 결합하는 항체, 이를 포함하는 항체-약물 접합체 및 그 용도
WO2023224429A1 (ko) Light 단백질 및 항-fap 항체를 포함하는 융합단백질 및 이의 용도
WO2020138868A1 (ko) 타입 1 인터페론 중화 fc-융합 단백질 및 이의 용도
WO2023048516A1 (ko) Pd-1 및 il-21을 포함하는 융합단백질 이량체 및 이의 용도
WO2023048518A1 (ko) Pd-1 및 il-15를 포함하는 융합단백질 이량체 및 이의 용도
WO2016200220A1 (ko) 분리된 비멘틴 유래 펩타이드에 특이적으로 결합하는 항체 또는 상기 펩타이드의 결합 단편

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23753226

Country of ref document: EP

Kind code of ref document: A1