WO2023130001A1 - Compositions and methods for treating huntington's disease - Google Patents
Compositions and methods for treating huntington's disease Download PDFInfo
- Publication number
- WO2023130001A1 WO2023130001A1 PCT/US2022/082523 US2022082523W WO2023130001A1 WO 2023130001 A1 WO2023130001 A1 WO 2023130001A1 US 2022082523 W US2022082523 W US 2022082523W WO 2023130001 A1 WO2023130001 A1 WO 2023130001A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- seq
- clq
- level
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
- G01N33/6896—Neurological disorders, e.g. Alzheimer's disease
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/46—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
- G01N2333/47—Assays involving proteins of known structure or function as defined in the subgroups
- G01N2333/4701—Details
- G01N2333/4716—Complement proteins, e.g. anaphylatoxin, C3a, C5a
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/28—Neurological disorders
- G01N2800/2835—Movement disorders, e.g. Parkinson, Huntington, Tourette
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
Definitions
- Huntington’s Disease is an autosomal-dominant progressive neurodegenerative condition that is characterized by chorea and dystonia, cognitive decline and psychiatric disorder.
- the specific genetic mutation involves expansion of a trinucleotide (cytosine, adenine, and guanine [CAG]) repeat in the huntingtin gene (Htt) on chromosome 4p.
- the unstable CAG repeat is translated into a polyglutamine stretch in the huntingtin protein.
- the age of onset and severity of disease is found to be linked to the number of CAG repeats in the Htt gene with those individuals with the earliest onset having the largest repeat number.
- the normal function of the huntingtin protein is not known but current understanding supports the mutant protein with the expanded polyglutamine sequence as toxic to brain cells.
- HD In general HD symptoms worsen progressively and invariably lead to death. HD is often divided into three broad phases. In early stage HD patients experience minor symptoms but are largely functional and able to work and live independently. In middle stage HD, patients’ symptoms are more prominent including chorea and cognitive decline and they may not be able to work or care for themselves. In late stage HD, patients require assistance for all aspects of daily living, with dementia, mutism, dystonia, and bradykinesia predominating in advanced disease. Death typically occurs within 15-20 years of disease onset, and is usually related to complications of immobility, infection, especially pneumonia, and cardiac disease.
- UHDRS Unified Huntington’s Disease Rating scale
- HD is primarily characterized by neuronal loss in the striatum and cerebral cortex. Certain neuronal populations are more affected including those within the corpus striatum of the basal ganglia.
- the mechanism by which polyglutamine aggregation leads to neurodegeneration has been elusive, although insight has emerged from animal models regarding HD pathophysiology.
- Early synaptic dysfunction is a key characteristic and is manifested by dysregulated glutamate release in striatum followed by progressive disconnection between cortex and striatum.
- Some of the alterations in late HD could be compensatory mechanisms designed to cope with early synaptic and receptor dysfunctions.
- the present disclosure is generally directed to methods of treating Huntington’s disease in a subject in need thereof.
- the method comprises determining that the subject has an elevated level of C4a or an elevated C4a/C4 ratio; and administering to the subject an inhibitor of the classical complement pathway, e.g., if the subject has an elevated level of C4a or an elevated C4a/C4 ratio.
- a therapeutically effective amount of the inhibitor may be administered.
- the elevated level of C4a may be greater than a C4a level in normal or healthy subjects, such as subjects of a similar age.
- the elevated level of C4a may be greater than a reference C4a level.
- the reference C4a level is a value that is equal to or greater than the median of C4a levels in samples derived from Huntington’s disease subjects, such as subjects of a similar age.
- the reference C4a level is a value that is equal to or greater than the 75th percentile of C4a levels in samples derived from normal or healthy subjects (subjects that do not have Huntington’s disease.), such as subjects of a similar age.
- the elevated level of C4a is greater than the reference C4a level by at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 150%, 200%, 250%, 300%, 350%, 400%, 450%, or 500%.
- the elevated level of C4a is greater than the reference C4a level by at least 1%-10%, 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-100%, 100%-200%, 200%- 300%, 300%-400%, or 400%-500%.
- the elevated C4a/C4 ratio may be greater than a C4a/C4 ratio in normal or healthy subjects, such as subjects of a similar age. In some embodiments, the elevated C4a/C4 ratio is greater than a reference C4a/C4 ratio.
- the reference C4a/C4 ratio may be a value that is equal to or greater than the median of C4a/C4 ratio in samples derived from Huntington’s disease subjects, such as subjects of a similar age. In other embodiments, the reference C4a/C4 ratio is a value that is equal to or greater than the 75th percentile of C4a/C4 ratios in samples derived from normal or healthy subjects (subjects that do not have Huntington’s disease), such as subjects of a similar age.
- the elevated C4a/C4 ratio is greater than the reference C4a/C4 ratio by at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 150%, 200%, 250%, 300%, 350%, 400%, 450%, or 500%.
- the elevated C4a/C4 ratio is greater than the reference C4a/C4 ratio by at least 1%-10%, 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-100%, 100%-200%, 200%-300%, 300%-400%, or 400%-500%.
- the level of C4a or the C4a/C4 ratio is measured in cerebrospinal fluid (CSF) or plasma.
- the subject has an elevated level of Neurofilament light chain (NfL).
- the elevated level of NfL may be greater than a NfL level in normal or healthy subjects, such as subjects of a similar age. In some embodiments, the elevated level of NfL is greater than a reference NfL level.
- the reference NfL level may be about 100 pg/ml, 200 pg/ml, 300 pg/ml, 400 pg/ml, 500 pg/ml, 600 pg/ml, 700 pg/ml, 800 pg/ml, 900 pg/ml, 1000 pg/ml, 1100 pg/ml, 1200 pg/ml, 1300 pg/ml, 1400 pg/ml, 1500 pg/ml, 1600 pg/ml, 1700 pg/ml, 1800 pg/ml, 1900 pg/ml, or 2000 pg/ml.
- the elevated level of NfL is greater than the NfL level in normal or healthy subjects or the reference NfL level by at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 150%, 200%, 250%, 300%, 350%, 400%, 450%, 500%, 550%, 600%, 650%, 700%, 750%, 800%, 850%, 900%, 950%, 1000%, 1500%, 2000%, 2500%, 3000%, 3500%, 4000%, 4500%, or 5000%.
- the elevated level of NfL is greater than the NfL level in normal or healthy subjects or the reference NfL level by at least 1%-10%, 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-100%, 100%-200%, 200%-300%, 300%-400%, 400%-500%, 500%-600%, 600%- 700%, 700%-800%, 800%-900%, 900%- 1000%, 1000%-2000%, 2000%-3000%, 3000%- 4000%, or 4000-5000%.
- the level of NfL is measured in cerebrospinal fluid (CSF).
- the level of NfL is measured in plasma.
- the reference NfL level may be about 1 pg/ml, 2 pg/ml, 3 pg/ml, 4 pg/ml, 5 pg/ml, 6 pg/ml, 7 pg/ml, 8 pg/ml, 9 pg/ml, 10 pg/ml, 11 pg/ml, 12 pg/ml, 13 pg/ml, 14 pg/ml, 15 pg/ml, 16 pg/ml, 17 pg/ml, 18 pg/ml, 19 pg/ml, or 20 pg/ml.
- the elevated level of NfL is greater than the NfL level in normal or healthy subjects or the reference NfL level by at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 150%, 200%, 250%, 300%, 350%, 400%, 450%, 500%, 550%, 600%, 650%, 700%, 750%, 800%, 850%, 900%, 950%, 1000%, 1500%, 2000%, 2500%, 3000%, 3500%, 4000%, 4500%, or 5000%.
- the elevated level of NfL is greater than the NfL level in normal or healthy subjects or the reference NfL level by at least 1%- 10%, 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%- 60%, 60%-70%, 70%-80%, 80%-90%, 90%-100%, 100%-200%, 200%-300%, 300%-400%, 400%-500%, 500%-600%, 600%-700%, 700%-800%, 800%-900%, 900%-1000%, 1000%- 2000%, 2000%-3000%, 3000%-4000%, or 4000-5000%.
- the inhibitor of the classical complement pathway is a Clq inhibitor, such as a small molecule, an antibody, an aptamer, an antisense nucleic acid or a gene-editing agent.
- the antibody may be an anti-Clq antibody.
- the antibody may be administered at a dose of at least 5 mg/kg, at least 10 mg/kg, at least 15 mg/kg, at least 20 mg/kg, at least 25 mg/kg, at least 30 mg/kg, at least 35 mg/kg, at least 40 mg/kg, at least 45 mg/kg, at least 50 mg/kg, at least 55 mg/kg, at least 60 mg/kg, at least 65 mg/kg, at least 70 mg/kg, at least 75 mg/kg, at least 80 mg/kg, at least 85 mg/kg, at least 90 mg/kg, at least 95 mg/kg, or at least 100 mg/kg.
- the antibody is administered at a dose of 5 mg/kg, 6 mg/kg, 7 mg/kg, 8 mg/kg, 9 mg/kg, 10 mg/kg, 11 mg/kg, 12 mg/kg, 13 mg/kg, 14 mg/kg, 15 mg/kg, 16 mg/kg, 17 mg/kg, 18 mg/kg, 19 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 35 mg/kg, 40 mg/kg, 45 mg/kg, 50 mg/kg, 55 mg/kg, 60 mg/kg, 65 mg/kg, 70 mg/kg, 75 mg/kg, 80 mg/kg, 85 mg/kg, 90 mg/kg, 95 mg/kg, 100 mg/kg, 105 mg/kg, 110 mg/kg, 120 mg/kg, 130 mg/kg, 140 mg/kg, or 150 mg/kg. In some embodiments, the antibody is administered at a dose of 75 mg/kg on day 1 and on day 5 or day 6. In some embodiments, the antibody is further administered at a dose of 100 mg/kg every two
- the antibody is administered intravenously. In some embodiments, the antibody is administered once a week, once every other week, once a month, once every six weeks, or once every other month. In some embodiments, the antibody is administered for at least 3 months, at least 6 months, at least 7 months, at least 8 months, at least 9 months, at least 10 months, at least 11 months, or at least 12 months. In some embodiments, the antibody is administered for 3 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, or 12 months.
- the anti-Clq antibody inhibits the interaction between Clq and an autoantibody or between Clq and Clr, or between Clq and Cis, or the anti-Clq antibody promotes clearance of Clq from circulation or a tissue.
- the antibody is a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a humanized antibody, a chimeric antibody, a multispecific antibody, antibody fragments, or an antibody derivative thereof.
- the antibody fragment may be a Fab fragment, a Fab' fragment, a F(ab')2 fragment, a Fv fragment, a diabody, a single chain antibody molecule, or a single arm antibody molecule.
- the antibody comprises a light chain variable domain comprising an HVR-L1 having the amino acid sequence of SEQ ID NO: 5, an HVR-L2 having the amino acid of SEQ ID NO: 6, and an HVR-L3 having the amino acid of SEQ ID NO: 7, and/or a heavy chain variable domain comprising an HVR-H1 having the amino acid sequence of SEQ ID NO: 9, an HVR-H2 having the amino acid of SEQ ID NO: 10, and an HVR-H3 having the amino acid of SEQ ID NO: 11.
- the antibody comprises a light chain variable domain comprising an amino acid sequence with at least about 95% homology to the amino acid sequence selected from SEQ ID NO: 4 and 35-38 and wherein the light chain variable domain comprises an HVR-L1 having the amino acid sequence of SEQ ID NO: 5, an HVR-L2 having the amino acid of SEQ ID NO: 6, and an HVR-L3 having the amino acid of SEQ ID NO: 7, preferably the light chain variable domain comprising an amino acid sequence selected from SEQ ID NO: 4 and 35-38.
- the antibody comprises a heavy chain variable domain comprising an amino acid sequence with at least about 95% homology to the amino acid sequence selected from SEQ ID NO: 8 and 31-34 and wherein the heavy chain variable domain comprises an HVR- H1 having the amino acid sequence of SEQ ID NO: 9, an HVR-H2 having the amino acid of SEQ ID NO: 10, and an HVR-H3 having the amino acid of SEQ ID NO: 11, preferably the heavy chain variable domain comprising an amino acid sequence selected from SEQ ID NO: 8 and 31-34.
- the antibody fragment comprises heavy chain Fab fragment of SEQ ID NO: 39 and light chain Fab fragment of SEQ ID NO: 40.
- the inhibitor of the classical complement pathway is a Clr inhibitor, such as a small molecule, an antibody, an aptamer, an antisense nucleic acid or a gene editing agent, preferably an anti-Clr antibody.
- the anti-Clr antibody inhibits the interaction between Clr and Clq or between Clr and Cis, or wherein the anti-Clr antibody inhibits the catalytic activity of Clr or inhibits the processing of pro- Clr to an active protease.
- the inhibitor of the classical complement pathway is a Cis inhibitor, such as a small molecule, an antibody, an aptamer, an antisense nucleic acid or a gene editing agent, preferably an anti-Cls antibody.
- the anti-Cls antibody inhibits the interaction between Cis and Clq or between Cis and Clr or between Cis and C2 or C4, or wherein the anti-Cls antibody inhibits the catalytic activity of Cis or inhibits the processing of pro-Cls to an active protease or binds to an activated form of Cis.
- the antibody is sutimlimab.
- the inhibitor of the classical complement pathway is an anti- C1 complex antibody, optionally wherein the anti-Cl complex antibody inhibits Clr or Cis activation or blocks their ability to act on C2 or C4.
- the anti-Cl complex antibody binds to a combinatorial epitope within the Cl complex, wherein said combinatorial epitope comprises amino acids of both Clq and Cis; both Clq and Clr; both Clr and Cis; or each of Clq, Clr, and Cis.
- the inhibitor of the classical complement pathway is a C2 inhibitor, such as a small molecule, an antibody, an aptamer, an antisense nucleic acid or a gene editing agent.
- the inhibitor of the classical complement pathway is a C3 inhibitor, such as a small molecule, an antibody, an aptamer, an antisense nucleic acid or a gene editing agent.
- the C3 inhibitor may be APL-9 (Apellis) or AMY-101 (Amyndas).
- the inhibitor of the classical complement pathway is a C4 inhibitor, such as a small molecule, an antibody, an aptamer, an antisense nucleic acid or a gene editing agent.
- a method of treating Huntington’s disease in a subject in need thereof comprises determining that the subject has an elevated level of C4a or an elevated C4a/C4 ratio.
- the method may further comprise administering to the subject an antibody having a light variable domain comprising an amino acid sequence of SEQ ID NO: 37 and a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 33.
- the antibody is administered intravenously at a dose of at least 75 mg/Kg on day 1 and day 5 or day 6.
- the antibody may be further administered intravenously at a dose of 100 mg/Kg every two weeks.
- the antibody comprises a heavy chain comprising an amino acid sequence of SEQ ID NO: 14 and a light chain comprising an amino acid sequence of SEQ ID NO: 40.
- Figures 1A-1B show that inhibition of Clq blocks classical complement activation and provides synapse protection in a preclinical animal model of HD.
- Figure 1A shows that inhibition of excess complement blocks deposition on synapses (Fold-Change in Complement Deposition on Synapses).
- Figure IB shows that inhibition of excess complement protects against synapse loss (Fold-Change Synapse Number).
- FIG. 2 depicts cerebrospinal fluid (“CSF”) C4a elevated and increasing with HD progression.
- CSF cerebrospinal fluid
- Figure 3 shows that C4a increases in the CSF of manifest HD patients.
- the data analyzed is from clinical study in Example 2.
- Figures 4A-4B show that neurofilament light (“NFL” or “Nfl”) levels are significantly elevated in CSF of manifest HD patients and CSF NFL correlates with CSF C4a (HDClarity study).
- Figure 4A shows elevated NFL in CSF of manifest HD patients.
- Figure 4B shows that CSF NFL correlates with CSF C4a.
- FIG. 5 shows that C4a can inform disease stage beyond predicted by age. Errors are residuals or mis-category made by the models. Each data point corresponds to 1 patient.
- Model LM1 HD disease stage predicted by age.
- Model LM2 HD disease stage predicted by age+C4a.
- LM2 which includes C4a in addition to age, predicts HD disease stage more accurately compared to LM1.
- the diagonal line represents equal accuracy between two models. Data below the diagonal line indicates that LM2 has lower error, hence higher accuracy, than LM1
- Figures 6A-6B show that model combining complement activation, NfL and Age more accurately predicts HD stage than NfL alone.
- Figure 6A shows model HD progression predicted by Nfl alone.
- Figure 6B shows model HD stage predicted by Nfl, age, and complement.
- Figures 7A-7B show approximately 50% of HD patients have elevated CSF levels of complement activation product C4a.
- Figure 7A shows elevated C4a in CSF of natural history patients.
- Figure 7B shows similar range of C4a in current study cohort.
- Figure 8 shows CSF C4a/C4 ratio: a sensitive measure of ongoing complement activation.
- C4 decreased (consumed) with Clq activation activity.
- C4a increased (produced) with Clq activation.
- C4a/C4 ratio corrects for genetic variability among subjects.
- Figure 9 shows analyzed HD phase 2 data using CSF C4a/C4 ratio as measure of ongoing complement activity. Patients divided into two groups based on C4a/C4 levels at baseline. Characteristics of two groups balanced at baseline.
- Figure 10 shows that high baseline complement patients showed consistent and significant improvement on cUHDRS over 24-week treatment period.
- Figure 11A-11D show high baseline C4a/C4 ratio patients consistently improved on cUHDRS sub-domains over 24-week treatment period.
- Figure HA shows Symbol Digit Modality Test (Cognition).
- Figure 11B shows total functional capacity (TFC, activities of daily living).
- Figure 11C shows stroop word reading test (SWR, Cognition).
- Figure HD shows total motor score (TMS).
- Figures 12A-12B show that 75% of patients with high baseline complement activity (C4a/C4) improved at week 24 in cUHDRS vs. 36% with low activation. Biomarker- differentiated responses unlikely to be placebo driven.
- Figure 12A shows that 13/23 (56%) of all patients improved at Week 24.
- Figure 12B shows that 9/12 (75%) patients improved with high baseline complement activation while 4/11 (36%) improved with low baseline complement activation.
- Figure 13 shows that plasma NfL levels are consistent with HD natural history at week 24.
- Figure 14 shows that CSF NfL levels are consistent with HD natural history at week 24.
- Figures 15A-15B show combined baseline C4a ratio, NfL and age identifies separate groups of differential cUHDRS at week 24.
- Figure 15A shows model prediction compared to observed cUHDRS.
- Figures 16A-16B show that full-length Clq antibody demonstrated rapid, robust and long-lasting complement engagement.
- Figure 16A shows full-length Clq antibody levels in CSF.
- full-length Clq antibody concentrations ⁇ LLOQ are shown as 0.1 pg/mL so they show up on log scale.
- Figure 16B shows full engagement of Clq in CSF.
- Clq concentrations ⁇ LLOQ are shown as 0.25 pg/mL so they show up on log scale. *Data from discontinued subjects were included until dosing was discontinued.
- Figures 17A-17B show that full-length Clq antibody demonstrated rapid, robust and long-lasting complement engagement.
- Figure 17A shows full-length Clq antibody levels in serum.
- Figure 17B shows full engagement of Clq in serum.
- Clq concentrations ⁇ LLOQ are shown as 0.25 pg/mL so they show up on log scale. *Data from discontinued subjects were included until dosing was discontinued.
- Figure 18 shows prolonged full-length Clq antibody effect throughout 3-month off- treatment period.
- C4a release is a pharmacodynamic marker of Clq target engagement.
- Figures 19A-19B show full-length Clq antibody treatment resulted in early and sustained improvement in patients with excess baseline complement activity (Comparing higher vs lower C4a/C4 groups at week 24).
- Figure 19A shows Unified Huntington’s Disease Rating Scale (cUHDRS).
- Figure 19B shows total functional capacity (TFC, activities of daily living). * MMRM; LS means +/- 95% CI. Interpolated natural history from Schobel 2017 (TRACK-HD).
- Figures 20A-20D show that benefit in patients with high complement activity was demonstrated across most cUHDRS constituent domains.
- Figure 20A shows total functional capacity (TFC, activities of daily living).
- Figure 20B shows Symbol Digit Modality Test (SDMT, Cognition).
- Figure 20C shows total motor score (TMS).
- Figure 21 shows that plasma NfL levels are consistent with HD natural history at week 36 with 4% change from screening.
- FIG. 22 shows that CSF NfL levels are consistent with HD natural history at week 36 with 16% change from screening. *Results are independent of baseline complement activity.
- Complement activation has been implicated in the aberrant removal of synapses during neurodegenerative disease, and in conjunction with its associated inflammation may contribute to ongoing neuronal loss.
- Complement expression and activation are elevated in many neurodegenerative diseases, including HD, Amyotrophic Lateral Sclerosis (ALS) and Alzheimer’s disease (AD) patients.
- Therapies targeting the complement pathway may inhibit the complement driven functional synapse loss and neuronal damage in HD and reduce disease progression.
- the present disclosure presents a model, evaluating complement activation, alone or in combination with NfL and age, more accurately predicts HD stage than NfL alone or in combination with age.
- Data from the HD clinical trial demonstrate that patients identified via the use of a model evaluating high C4a levels and/or high C4a/C4 ratios exhibit clinical improvement with anti-Clq antibody treatment.
- the clinical trial data also demonstrate treatment with full-length anti-Clq antibody leads to clinical benefits in HD patients identified by the use of a model evaluating complement activation alone or in combination with NfL and age.
- the clinical trial data also demonstrate that accounting for complement activation, NfL, and age, and the use of a full-length anti-Clq antibody reliably leads to clinical benefits in HD patients.
- the present disclosure is generally directed to methods of treating Huntington’s disease in a subject in need thereof.
- the method comprises determining that the subject has an elevated level of C4a and/or an elevated C4a/C4 ratio; and administering to the subject so identified an inhibitor of the classical complement pathway.
- a” or “an” may mean one or more.
- the words “a” or “an” when used in conjunction with the word “comprising”, the words “a” or “an” may mean one or more than one.
- reference to an “antibody” is a reference from one to many antibodies.
- another may mean at least a second or more.
- reference level relates to a predetermined criteria used as a reference for evaluating the values or data obtained from a sample obtained from an individual.
- the reference level can be an absolute value; a relative value; a value that has an upper or a lower limit; a range of values; an average value; a median value; a mean value; or a value as compared to a particular control or baseline value.
- a reference level can be based on an individual sample value, such as for example, a value obtained from a sample from the subject being tested, but at an earlier point in time.
- the reference level can be based on a large number of samples, such as from a population of subjects of similar chronological age, gender, disease state, or otherwise matched group, or based on a pool of samples including or excluding the sample to be tested.
- a reference level can also be determined from a representative number of samples (e.g., plasma or CSF) derived from different individuals afflicted with HD.
- a reference level can also be determined from biological samples from non-HD afflicted individuals (i.e., normal or healthy subjects of a similar age). These biological samples from a HD afflicted or non-HD afflicted individual may comprise for example, tissue biopsies, blood, plasma, serum, fecal samples, urine, cerebral spinal fluid, pap smears, or semen.
- a representative sample can include measurements from at least 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000 or more individuals.
- immunoglobulin (Ig) is used interchangeably with “antibody” herein.
- antibody herein is used in the broadest sense and specifically covers monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies) formed from at least two intact antibodies, antibody fragments so long as they exhibit the desired biological activity, and antibody derivatives.
- the basic 4-chain antibody unit is a heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains.
- the pairing of a VH and VL together forms a single antigen-binding site.
- L chain from any vertebrate species can be assigned to one of two clearly distinct types, called kappa (“K”) and lambda (“X”), based on the amino acid sequences of their constant domains.
- immunoglobulins can be assigned to different classes or isotypes.
- the y and a classes are further divided into subclasses (isotypes) on the basis of relatively minor differences in the CH sequence and function, e.g., humans express the following subclasses: IgGl, IgG2, IgG3, IgG4, IgAl, and IgA2.
- agent as used herein describes any molecule, e.g. protein or pharmaceutical, with the capability of modulating synapse loss, particularly through the complement pathway.
- Candidate agents also include genetic elements, e.g., anti-sense and RNAi molecules to inhibit Clq expression, and constructs encoding complement inhibitors, e.g., CD 59, and the like.
- Candidate agents encompass numerous chemical classes, though typically they are organic molecules, including small organic compounds having a molecular weight of more than 50 and less than about 2,500 daltons.
- Candidate agents comprise functional groups necessary for structural interaction with proteins, particularly hydrogen bonding, and typically include at least an amine, carbonyl, hydroxyl or carboxyl group, preferably at least two of the functional chemical groups.
- the candidate agents often comprise cyclical carbon or heterocyclic structures and/or aromatic or polyaromatic structures substituted with one or more of the above functional groups.
- Candidate agents are also found among biomolecules including peptides, saccharides, fatty acids, steroids, purines, pyrimidines, derivatives, structural analogs or combinations thereof.
- a plurality of assay mixtures are run in parallel with different agent concentrations to obtain a differential response to the various concentrations. Typically one of these concentrations serves as a negative control, i.e., at zero concentration or below the level of detection.
- variable region refers to the aminoterminal domains of the heavy or light chain of the antibody.
- variable domains of the heavy chain and light chain may be referred to as “VH” and “VL”, respectively. These domains are generally the most variable parts of the antibody (relative to other antibodies of the same class) and contain the antigen binding sites.
- variable refers to the fact that certain segments of the variable domains differ extensively in sequence among antibodies.
- the V domain mediates antigen binding and defines the specificity of a particular antibody for its particular antigen.
- variability is not evenly distributed across the entire span of the variable domains. Instead, it is concentrated in three segments called hypervariable regions (HVRs) both in the light-chain and the heavy chain variable domains.
- HVRs hypervariable regions
- the more highly conserved portions of variable domains are called the framework regions (FR).
- the variable domains of native heavy and light chains each comprise four FR regions, largely adopting a beta-sheet configuration, connected by three HVRs, which form loops connecting, and in some cases forming part of, the beta-sheet structure.
- the HVRs in each chain are held together in close proximity by the FR regions and, with the HVRs from the other chain, contribute to the formation of the antigen binding site of antibodies (see Kabat et al., Sequences of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, MD (1991)).
- the constant domains are not involved directly in the binding of antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent-cellular toxicity.
- CDR complementarity determining region
- CDRs have been described by Kabat et al., J. Biol. Chem. 252:6609-6616 (1977); Kabat et al., U.S. Dept, of Health and Human Services, “Sequences of proteins of immunological interest” (1991) (also referred to herein as Kabat 1991); by Chothia et al., J. Mol. Biol. 196:901-917 (1987) (also referred to herein as Chothia 1987); and MacCallum et al., J. Mol. Biol.
- CDR-L1”, CDR-L2”, and CDR-L3 refer, respectively, to the first, second, and third CDRs in a light chain variable region.
- CDR-H1”, CDR-H2”, and CDR-H3 refer, respectively, to the first, second, and third CDRs in a heavy chain variable region.
- CDR-1”, “CDR-2”, and “CDR-3” refer, respectively, to the first, second and third CDRs of either chain's variable region.
- monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, z.e., the individual antibodies of the population are identical except for possible naturally occurring mutations and/or posttranslation modifications (e.g., isomerizations, amidations) that may be present in minor amounts.
- Monoclonal antibodies are highly specific, being directed against a single antigenic site. In contrast to polyclonal antibody preparations which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
- monoclonal antibodies are advantageous since they are typically synthesized by hybridoma culture, uncontaminated by other immunoglobulins.
- the modifier “monoclonal” indicates the character of the antibody as being obtained as a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present disclosure may be made by a variety of techniques, including, for example, the hybridoma method (e.g., Kohler and Milstein., Nature, 256:495-97 (1975); Hongo et al., Hybridoma, 14 (3):253-260 (1995), Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2d ed.
- “Full-length antibodies’” are usually heterotetrameric glycoproteins of about 150,000 daltons, comprising two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies among the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain (VH) followed by a number of constant domains.
- VH variable domain
- Each light chain has a variable domain at one end (VL) and a constant domain at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain. Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
- full-length antibody or “intact antibody”” and “whole antibody” are used interchangeably to refer to an antibody in its substantially intact form, as opposed to an antibody fragment or antibody derivative.
- whole antibodies include those with heavy and light chains including an Fc region.
- the constant domains may be native sequence constant domains (e.g., human native sequence constant domains) or amino acid sequence variants thereof.
- the intact antibody may have one or more effector functions.
- antibody fragments include Fab, Fab', F(ab')2 and Fv fragments; diabodies; and linear antibodies (see U.S. Patent 5,641,870, Example 2; Zapata et al., Protein Eng. 8(10): 1057-1062 (1995)).
- antibody fragments include antibody derivatives such as single-chain antibody molecules, single-arm antibodies, antibodies with a single antigen-binding arm, monovalent antibodies and multispecific antibodies formed from antibody fragments
- the term “single-arm antibody” herein is used to cover an antibody that comprises a single antigen-binding arm.
- the single-arm antibody may comprise an antigen-binding arm and an Fc region, wherein the single antigen-binding arm comprises a light chain variable domain and a heavy chain variable domain; and the Fc region comprises a complex of a first and a second Fc polypeptide.
- one but not both of the Fc polypeptides is an N-terminally truncated heavy chain.
- the antibody may be a bivalent antibody - where one arm binds Clq and the other binds a different antigen. Depending on the other antigen, such an antibody would not crosslink and activate Clq.
- an antibody with a single antigen-binding arm means an antibody comprising a single antigen-binding arm and an Fc region, wherein the antigen-binding arm comprises a light chain variable domain and a heavy chain variable domain.
- the antibody further comprises an inactive antigen-binding arm, which is incapable of binding to the antigen, or comprises an arm that binds to a different antigen.
- the Fc region comprises a complex of a first and a second Fc polypeptide.
- antibody derivative is any construct that comprises the antigen binding region of an antibody.
- antibody derivatives include single-chain antibody molecules, single arm antibodies, antibodies with a single antigen-binding arm, monovalent antibodies and multispecific antibodies formed from antibody fragments.
- Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, and a residual “Fc” fragment, a designation reflecting the ability to crystallize readily.
- the Fab fragment consists of an entire L chain along with the variable region domain of the H chain (VH), and the first constant domain of one heavy chain (CHI).
- VH variable region domain of the H chain
- CHI first constant domain of one heavy chain
- Each Fab fragment is monovalent with respect to antigen binding, z.e., it has a single antigenbinding site.
- Pepsin treatment of an antibody yields a single large F(ab')2 fragment which roughly corresponds to two disulfide linked Fab fragments having different antigen-binding activity and is still capable of cross-linking antigen.
- Fab' fragments differ from Fab fragments by having a few additional residues at the carboxy terminus of the CHI domain including one or more cysteines from the antibody hinge region.
- Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
- F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments with hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
- the Fc fragment comprises the carboxy-terminal portions of both H chains held together by disulfides.
- the effector functions of antibodies are determined by sequences in the Fc region, the region which is also recognized by Fc receptors (FcR) found on certain types of cells.
- Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native-sequence Fc regions and variant Fc regions.
- the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy-chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof.
- the C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody.
- composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue.
- Suitable native-sequence Fc regions for use in the antibodies of the disclosure include human IgGl, IgG2, IgG3 and IgG4.
- a “ native sequence Fc region” comprises an amino acid sequence identical to the amino acid sequence of an Fc region found in nature.
- Native sequence human Fc regions include a native sequence human IgGl Fc region (non-A and A allotypes); native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally occurring variants thereof.
- a “variant Fc region” comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification, preferably one or more amino acid substitution(s).
- the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, e.g., from about one to about ten amino acid substitutions, and preferably from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of the parent polypeptide.
- the variant Fc region herein will preferably possess at least about 80% homology with a native sequence Fc region and/or with an Fc region of a parent polypeptide, and most preferably at least about 90% homology therewith, more preferably at least about 95% homology therewith.
- Fc receptor or “FcR” describes a receptor that binds to the Fc region of an antibody.
- the preferred FcR is a native sequence human FcR.
- a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors, FcyRII receptors include FcyRIIA (an “activating receptor”) and FcyRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
- Activating receptor FcyRIIA contains an immunoreceptor tyrosine-based activation motif (“ITAM”) in its cytoplasmic domain.
- Inhibiting receptor FcyRIIB contains an immunoreceptor tyrosine-based inhibition motif (“ITIM”) in its cytoplasmic domain.
- ITAM immunoreceptor tyrosine-based activation motif
- ITIM immunoreceptor tyrosine-based inhibition motif
- Binding to FcRn in vivo and serum half-life of human FcRn high-affinity binding polypeptides can be assayed, e.g., in transgenic mice or transfected human cell lines expressing human FcRn, or in primates to which the polypeptides having a variant Fc region are administered.
- WO 2004/42072 (Presta) describes antibody variants with improved or diminished binding to FcRs. See also, e.g., Shields et al., J. Biol. Chem. 9(2):6591-6604 (2001).
- “Fv” is the minimum antibody fragment, which contains a complete antigenrecognition and -binding site. This fragment consists of a dimer of one heavy- and one lightchain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three HVRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
- Single-chain Fv also abbreviated as “sFv” or “scFv” are antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain.
- the sFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the sFv to form the desired structure for antigen binding.
- Pliickthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994).
- diabodies refers to small antibody fragments prepared by constructing sFv fragments (see preceding paragraph) with short linkers (about 5-10) residues) between the VH and VL domains such that inter-chain but not intra-chain pairing of the V domains is achieved, thereby resulting in a bivalent fragment, i.e., a fragment having two antigenbinding sites.
- Bispecific diabodies are heterodimers of two “crossover” sFv fragments in which the VH and VL domains of the two antibodies are present on different polypeptide chains.
- Diabodies are described in greater detail in, for example, EP 404,097; WO 1993/011161; WO/2009/121948; WO/2014/191493; Hollinger et al., Proc. Nat’l Acad. Sci. USA 90:6444-48 (1993).
- a “chimeric antibody” refers to an antibody (immunoglobulin) in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is(are) identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Patent No. 4,816,567; Morrison et al., Proc. Nat’l Acad. Sci. USA, 81 :6851-55 (1984)).
- Chimeric antibodies of interest herein include PRIMATIZED® antibodies wherein the antigen-binding region of the antibody is derived from an antibody produced by, e.g., immunizing macaque monkeys with an antigen of interest.
- “humanized antibody” is a subset of “chimeric antibodies.”
- “Humanized' forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin.
- a humanized antibody is a human immunoglobulin (recipient antibody) in which residues from an HVR of the recipient are replaced by residues from an HVR of a non- human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired specificity, affinity, and/or capacity.
- donor antibody such as mouse, rat, rabbit or non-human primate having the desired specificity, affinity, and/or capacity.
- FR residues of the human immunoglobulin are replaced by corresponding non-human residues.
- humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications may be made to further refine antibody performance, such as binding affinity.
- a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin sequence, and all or substantially all of the FR regions are those of a human immunoglobulin sequence, although the FR regions may include one or more individual FR residue substitutions that improve antibody performance, such as binding affinity, isomerization, immunogenicity, and the like.
- the number of these amino acid substitutions in the FR is typically no more than 6 in the H chain, and in the L chain, no more than 3.
- the humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- a “human antibody” is one that possesses an amino-acid sequence corresponding to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
- Human antibodies can be produced using various techniques known in the art, including phage-display libraries. Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991). Also available for the preparation of human monoclonal antibodies are methods described in Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p.
- Human antibodies can be prepared by administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e.g., immunized xenomice (see, e.g., U.S. Patent Nos. 6,075,181 and 6,150,584 regarding XENOMOUSETM technology). See also, for example, Li et al., Proc. Nat’l Acad. Sci. USA, 103:3557-3562 (2006) regarding human antibodies generated via a human B-cell hybridoma technology.
- antibodies comprise six HVRs; three in the VH (Hl, H2, H3), and three in the VL (LI, L2, L3).
- H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies.
- HVR delineations are in use and are encompassed herein.
- the HVRs that are Kabat complementarity-determining regions (CDRs) are based on sequence variability and are the most commonly used (Kabat et al., supra). Chothia refers instead to the location of the structural loops (Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)).
- the AbM HVRs represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody-modeling software.
- the “contact” HVRs are based on an analysis of the available complex crystal structures. The residues from each of these HVRs are noted below.
- H3 H95-H102 H95-H102 H96-H101 H93-H101 HVRs may comprise “extended HVRs” as follows: 24-36 or 24-34 (LI), 46-56 or SO- 56 (L2), and 89-97 or 89-96 (L3) in the VL, and 26-35 (Hl), 50-65 or 49-65 (a preferred embodiment) (H2), and 93-102, 94-102, or 95-102 (H3) in the VH.
- the variable-domain residues are numbered according to Kabat et al., supra, for each of these extended-HVR definitions.
- I-f mework or “FB” residues are those variable-domain residues other than the HVR residues as herein defined.
- variable-domain residue-numbering as in Kabat or “amino-acid- position numbering as in Kabat, ” and variations thereof, refers to the numbering system used for heavy-chain variable domains or light-chain variable domains of the compilation of antibodies in Kabat et al., supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or HVR of the variable domain.
- a heavy-chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g., residues 82a, 82b, and 82c, etc. according to Kabat) after heavy-chain FR residue 82.
- the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence.
- the Kabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) (e.g., Kabat et al., Sequences of Immunological Interest. 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
- the “EU numbering system” or “EU index” is generally used when referring to a residue in an immunoglobulin heavy chain constant region (e.g., the EU index reported in Kabat et al., supra).
- the “EU index as in Kabat” refers to the residue numbering of the human IgGl EU antibody.
- references to residue numbers in the variable domain of antibodies means residue numbering by the Kabat numbering system. Unless stated otherwise herein, references to residue numbers in the constant domain of antibodies means residue numbering by the EU numbering system (e.g., see United States Patent Publication No. 2010-280227).
- An “acceptor human framework” as used herein is a framework comprising the amino acid sequence of a VL or VH framework derived from a human immunoglobulin framework or a human consensus framework.
- An acceptor human framework “derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain pre-existing amino acid sequence changes.
- the number of pre-existing amino acid changes are 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, or 2 or fewer.
- preexisting amino acid changes are present in a VH, preferable those changes occur at only three, two, or one of positions 71H, 73H and 78H; for instance, the amino acid residues at those positions may by 71 A, 73T and/or 78A.
- the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
- a “human consensus framework” is a framework that represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
- the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
- the subgroup of sequences is a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (1991). Examples include for the VL, the subgroup may be subgroup kappa I, kappa II, kappa III or kappa IV as in Kabat et al., supra. Additionally, for the VH, the subgroup may be subgroup I, subgroup II, or subgroup III as in Kabat et al., supra.
- amino-acid modification at a specified position refers to the substitution or deletion of the specified residue, or the insertion of at least one amino acid residue adjacent the specified residue. Insertion “adjacent” to a specified residue means insertion within one to two residues thereof. The insertion may be N-terminal or C-terminal to the specified residue.
- the preferred amino acid modification herein is a substitution.
- an “affinity-matured” antibody is one with one or more alterations in one or more HVRs thereof that result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody that does not possess those alteration(s).
- an affinity-matured antibody has nanomolar or even picomolar affinities for the target antigen.
- Affinity-matured antibodies are produced by procedures known in the art. For example, Marks et al., Bio/Technology 10:779-783 (1992) describes affinity maturation by VH- and VL-domain shuffling. Random mutagenesis of HVR and/or framework residues is described by, for example: Barbas et al. Proc Nat. Acad. Sci.
- the term “specifically recognizes” or “specifically binds’” refers to measurable and reproducible interactions such as attraction or binding between a target and an antibody that is determinative of the presence of the target in the presence of a heterogeneous population of molecules including biological molecules.
- an antibody that specifically or preferentially binds to a target or an epitope is an antibody that binds this target or epitope with greater affinity, avidity, more readily, and/or with greater duration than it binds to other targets or other epitopes of the target. It is also understood that, for example, an antibody (or a moiety) that specifically or preferentially binds to a first target may or may not specifically or preferentially bind to a second target.
- “specific binding” or “preferential binding” does not necessarily require (although it can include) exclusive binding.
- An antibody that specifically binds to a target may have an association constant of at least about 10 3 M' 1 or 10 4 M' 1 , sometimes about 10 5 M' 1 or 10 6 M' 1 , in other instances about 10 6 M -1 or 10 7 M -1 , about 10 x M' 1 to 10 9 M -1 , or about 10 10 M' 1 to 10 11 M' 1 or higher.
- a variety of immunoassay formats can be used to select antibodies specifically immunoreactive with a particular protein.
- solid-phase ELISA immunoassays are routinely used to select monoclonal antibodies specifically immunoreactive with a protein. See, e.g., Harlow and Lane (1988) Antibodies, A Laboratory Manual, Cold Spring Harbor Publications, New York, for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity.
- Identity indicates that at any particular position in the aligned sequences, the amino acid residue is identical between the sequences.
- similarity indicates that, at any particular position in the aligned sequences, the amino acid residue is of a similar type between the sequences.
- leucine may be substituted for isoleucine or valine.
- Other amino acids which can often be substituted for one another include but are not limited to: - phenylalanine, tyrosine and tryptophan (amino acids having aromatic side chains);
- an "interaction" between a complement protein and a second protein encompasses, without limitation, protein-protein interaction, a physical interaction, a chemical interaction, binding, covalent binding, and ionic binding.
- an antibody “inhibits interaction” between two proteins when the antibody disrupts, reduces, or completely eliminates an interaction between the two proteins.
- blocking antibody an “antagonist” antibody, an “inhibitory” antibody, or a “neutralizing antibody is an antibody that inhibits or reduces one or more biological activities of the antigen it binds, such as interactions with one or more proteins.
- blocking antibodies, antagonist antibodies, inhibitory antibodies, or “neutralizing antibodies substantially or completely inhibit one or more biological activities or interactions of the antigen.
- inhibitor refers to a compound having the ability to inhibit a biological function of a target biomolecule, for example, an mRNA or a protein, whether by decreasing the activity or expression of the target biomolecule.
- An inhibitor may be an antibody, a small molecule, or a nucleic acid molecule.
- antagonist refers to a compound that binds to a receptor, and blocks or dampens the receptor’s biological response.
- inhibitor may also refer to an “antagonist.”
- Antibody effector functions refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype.
- affinity refers to the equilibrium constant for the reversible binding of two agents (e.g., an antibody and an antigen) and is expressed as a dissociation constant (KD).
- KD dissociation constant
- Affinity can be at least 1-fold greater, at least 2-fold greater, at least 3 -fold greater, at least 4-fold greater, at least 5-fold greater, at least 6-fold greater, at least 7-fold greater, at least 8-fold greater, at least 9-fold greater, at least 10-fold greater, at least 20-fold greater, at least 30-fold greater, at least 40-fold greater, at least 50-fold greater, at least 60- fold greater, at least 70-fold greater, at least 80-fold greater, at least 90-fold greater, at least 100-fold greater, or at least 1,000-fold greater, or more, than the affinity of an antibody for unrelated amino acid sequences.
- Affinity of an antibody to a target protein can be, for example, from about 100 nanomolar (nM) to about 0.1 nM, from about 100 nM to about 1 picomolar (pM), or from about 100 nM to about 1 femtomolar (fM) or more.
- nM nanomolar
- pM picomolar
- fM femtomolar
- the term “avidity” refers to the resistance of a complex of two or more agents to dissociation after dilution.
- the terms “immunoreactive” and “preferentially binds” are used interchangeably herein with respect to antibodies and/or antigen-binding fragments.
- binding refers to a direct association between two molecules, due to, for example, covalent, electrostatic, hydrophobic, and ionic and/or hydrogen-bond interactions, including interactions such as salt bridges and water bridges.
- a subject anti-Cls antibody binds specifically to an epitope within a complement Cis protein.
- Specific binding refers to binding with an affinity of at least about IO -7 M or greater, e.g., 5* IO -7 M, 10 -8 M, 5x l0 -8 M, and greater.
- Non-specific binding refers to binding with an affinity of less than about 10 -7 M, e.g., binding with an affinity of 10 -6 M, 10 -5 M, 10 -4 M, etc.
- k O n is intended to refer to the rate constant for association of an antibody to an antigen.
- k O ff is intended to refer to the rate constant for dissociation of an antibody from the antibody/antigen complex.
- KD is intended to refer to the equilibrium dissociation constant of an antibody-antigen interaction.
- percent (%) amino acid sequence identity and “homology” with respect to a peptide, polypeptide or antibody sequence refers to the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific peptide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or MEGALIGNTM (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms known in the art needed to achieve maximal alignment over the full length of the sequences being compared.
- a “biological sample” encompasses a variety of sample types obtained from an individual and can be used in a diagnostic or monitoring assay.
- the definition encompasses blood and other liquid samples of biological origin, solid tissue samples such as a biopsy specimen or tissue cultures or cells derived therefrom and the progeny thereof.
- the definition also includes samples that have been manipulated in any way after their procurement, such as by treatment with reagents, solubilization, or enrichment for certain components, such as polynucleotides.
- the term “biological sample” encompasses a clinical sample, and also includes cells in culture, cell supernatants, cell lysates, serum, plasma, biological fluid, and tissue samples.
- biological sample includes urine, saliva, cerebrospinal fluid, interstitial fluid, ocular fluid, synovial fluid, blood fractions such as plasma and serum, and the like.
- biological sample also includes solid tissue samples, tissue culture samples, and cellular samples.
- a “host cell” includes an individual cell or cell culture that can be or has been a recipient for vector(s) for incorporation of polynucleotide inserts.
- Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in genomic DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation.
- a host cell includes cells transfected in vivo with a polynucleotide(s) of this disclosure.
- Carriers as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution.
- physiologically acceptable carriers include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEENTM, polyethylene glycol (PEG), and PLURONICSTM.
- buffers such as phosphate, citrate, and other organic acids
- antioxidants including ascorbic acid
- proteins such as serum albumin,
- subjecC refers to a living mammal and may be interchangeably used with the term “patient”.
- mammals include, but are not limited to, any member of the mammalian class: humans, non-human primates such as chimpanzees, and other apes and monkey species; farm animals such as cattle, horses, sheep, goats, swine; domestic animals such as rabbits, dogs, and cats; laboratory animals including rodents, such as rats, mice and guinea pigs, and the like.
- the term does not denote a particular age or gender.
- treating includes reducing, arresting, or reversing the symptoms, clinical signs, or underlying pathology of a condition to stabilize or improve a subject's condition or to reduce the likelihood that the subject’s condition will worsen as much as if the subject did not receive the treatment.
- terapéuticaally effective amount of a compound with respect to the subject method of treatment refers to an amount of the compound(s) in a preparation which, when administered as part of a desired dosage regimen (to a mammal, preferably a human) alleviates a symptom, ameliorates a condition, or slows the onset of disease conditions according to clinically acceptable standards for the disorder or condition to be treated or the cosmetic purpose, e.g., at a reasonable benefit/risk ratio applicable to any medical treatment.
- a therapeutically effective amount herein may vary according to factors such as the disease state, age, sex, and weight of the patient, and the ability of the antibody to elicit a desired response in the individual.
- an individual “at risk” of developing a particular disease, disorder, or condition may or may not have detectable disease or symptoms of disease, and may or may not have displayed detectable disease or symptoms of disease prior to the treatment methods described herein.
- “At risk” denotes that an individual has one or more risk factors, which are measurable parameters that correlate with development of a particular disease, disorder, or condition, as known in the art. An individual having one or more of these risk factors has a higher probability of developing a particular disease, disorder, or condition than an individual without one or more of these risk factors.
- Chronic administration refers to administration of the medicament(s) in a continuous as opposed to acute mode, so as to maintain the initial therapeutic effect (activity) for an extended period of time.
- Intermittent administration refers to treatment that is not administered consecutively without interruption, but rather is cyclic/periodic in nature.
- the inhibitor of the classical complement pathway may be a Clq inhibitor, such as a small molecule, an antibody, an aptamer, an antisense nucleic acid or a gene editing agent.
- anti-Clq antibodies disclosed herein are potent inhibitors of Clq.
- Clq is a large multimeric protein of 460 kDa consisting of 18 polypeptide chains (6 Clq A chains, 6 Clq B chains, and 6 Clq C chains).
- Clr and Cis complement proteins bind to the Clq tail region to form the Cl complex (Clqr 2 s 2 ).
- Suitable inhibitors include an antibody that binds complement factor Clq and/or Clq in the Cl complex of the classical complement activation pathway.
- the bound complement factor may be derived, without limitation, from any organism having a complement system, including any mammalian organism such as human, mouse, rat, rabbit, monkey, dog, cat, cow, horse, camel, sheep, goat, or pig.
- Cl complex refers to a protein complex that may include, without limitation, one Clq protein, two Clr proteins, and two Cis proteins (e.g., C l qrs 2 ).
- complement factor Clq refers to both wild type sequences and naturally occurring variant sequences.
- a non-limiting example of a complement factor Clq recognized by antibodies of this disclosure is human Clq, including the three polypeptide chains A, B, and C:
- an anti-Clq antibody of the present disclosure may bind to polypeptide chain A, polypeptide chain B, and/or polypeptide chain C of a Clq protein.
- an anti-Clq antibody of the present disclosure binds to polypeptide chain A, polypeptide chain B, and/or polypeptide chain C of human Clq or a homolog thereof, such as mouse, rat, rabbit, monkey, dog, cat, cow, horse, camel, sheep, goat, or pig Clq.
- the anti-Clq antibody is a human antibody, a humanized antibody, or a chimeric antibody.
- anti-Clq antibodies suitable for binding to Clq protein are well-known in the art and include, for example, antibodies Cat #: AF2379, AF1696, MAB1696, and MAB23791 (R&D System), NBP1-87492, NB100-64420, H00000712-B01P, H00000712-D01P, and H00000712-D01 (Novus Biologicals), MAI-83963, MAI-40311, PA5-14208, PA5-29586, and PAI-36177 (ThermoFisher Scientific), ab71940, abl l861, ab4223, ab72355, abl82451, ab46191, ab227072, ab 182940, ab216979, and ab235454 (abeam), etc.
- siRNA, shRNA, CRISPR constructs for reducing Clq expression can be found in the commercial product lists of the above-referenced companies, such as SiRNA product # sc- 43651, sc-44962, sc-105153, sc-141842, ShRNA product # sc-43651-SH, sc-43651-V, sc- 44962-SH, sc-44962-V, sc-105153-SH, sc-105153-V, sc-141842-SH, sc-141842-V, CRISPR product # sc-419385, sc-419385 -HDR, sc-419385 -NIC, sc-419385-NIC-2, sc-402156, sc- 402156-KO-2, sc-404309, sc-404309-HDR, sc-404309-NIC, sc-404309-NIC-2, sc-419386,
- the amino acid sequence of the light chain variable domain of antibody Ml is: DVOITOSPSYLAASPGETITINCRASKSINKYLAWYOEKPGKTNKLLIYSGSTLQSGIP SRFSGSGSGTDFTLTISSLEPEDFAMYYCOQHNEYPLTFGAGTKLELK (SEQ ID NO:4).
- the hyper variable regions (HVRs) of the light chain variable domain are depicted in bolded and underlined text.
- the HVR-L1 of the Ml light chain variable domain has the sequence RASKSINKYLA (SEQ ID NO:5)
- the HVR-L2 of the Ml light chain variable domain has the sequence SGSTLQS (SEQ ID NO:6)
- the HVR-L3 of the Ml light chain variable domain has the sequence QQHNEYPLT (SEQ ID NO:7).
- the amino acid sequence of the heavy chain variable domain of antibody Ml is: OVOLOOPGAELVKPGASVKLSCKSSGYHFTSYWMHWVKQRPGOGLEWIGVIHPNS GSINYNEKFESKATLTVDKSSSTAYMQLSSLTSEDSAVYYCAGERDSTEVLPMDYW GQGTSVTVSS (SEQ ID NO:8).
- the hyper variable regions (HVRs) of the heavy chain variable domain are depicted in bolded and underlined text.
- the HVR-H1 of the Ml heavy chain variable domain has the sequence GYHFTSYWMH (SEQ ID NOV)
- the HVR-H2 of the Ml heavy chain variable domain has the sequence VH4PNSGSINYNEKFES (SEQ ID NO: 10)
- the HVR-H3 of the Ml heavy chain variable domain has the sequence ERDSTEVLPMDY (SEQ ID NO: 11).
- the nucleic acid sequence encoding the light chain variable domain was determined to be: GATGTCCAGATAACCCAGTCTCCATCTTATCTTGCTGCATCTCCTGGAGAAACCA TTACTATTAATTGCAGGGCAAGTAAGAGCATTAACAAATATTTAGCCTGGTATCA AGAGAAACCTGGGAAAACTAATAAGCTTCTTATCTACTCTGGATCCACTTTGCAA TCTGGAATTCCATCAAGGTTCAGTGGCAGTGGATCTGGTACAGATTTCACTCTCA CCATCAGTAGCCTGGAGCCTGAAGATTTTGCAATGTATTACTGTCAACAACATAA TGAATACCCGCTCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAAA (SEQ ID NO: 12).
- the nucleic acid sequence encoding the heavy chain variable domain was determined to be: CAGGTCCAACTGCAGCAGCCTGGGGCTGAGCTGGTAAAGCCTGGGGCTTCAGTG AAGTTGTCCTGCAAGTCTTCTGGCTACCATTTCACCAGCTACTGGATGCACTGGG TGAAGCAGAGGCCTGGACAAGGCCTTGAGTGGATTGGAGTGATTCATCCTAATA GTGGTAGTATTAACTACAATGAGAAGTTCGAGAGCAAGGCCACACTGACTGTAG ACAAATCCTCCAGCACAGCCTACATGCAACTCAGCAGCCTGACATCTGAGGACTC GGCGGTCTATTATTGTGCAGGAGAGAGATTCTACGGAGGTTCTCCCTATGGAC
- the hybridoma cell line producing the Ml antibody (mouse hybridoma ClqMl 7788- 1(M) 051613) has been deposited with ATCC under conditions that assure that access to the culture will be available during pendency of the patent application and for a period of 30 years, or 5 years after the most recent request, or for the effective life of the patent, whichever is longer. A deposit will be replaced if the deposit becomes nonviable during that period. The deposit is available as required by foreign patent laws in countries wherein counterparts of the subject application, or its progeny are filed. However, it should be understood that the availability of the deposit does not constitute a license to practice the subject invention in derogation of patent rights granted by governmental action.
- the antibody may bind to at least human Clq, mouse Clq, or rat Clq.
- the antibody may be a humanized antibody, a chimeric antibody, or a human antibody.
- the antibody may be a monoclonal antibody, an antibody fragment thereof, and/or an antibody derivative thereof.
- the light chain variable domain comprises the HVR-L1, HVR-L2, and HVR-L3 of the monoclonal antibody Ml produced by a hybridoma cell line deposited with Accession Number PTA-120399.
- the heavy chain variable domain comprises the HVR-H1, HVR-H2, and HVR-H3 of the monoclonal antibody Ml produced by a hybridoma cell line deposited with ATCC Accession Number PTA-120399.
- the amino acid sequence of the light chain variable domain and heavy chain variable domain comprise one or more of SEQ ID NO:5 of HVR-L1, SEQ ID NO:6 of HVR-L2, SEQ ID NO:7 of HVR-L3, SEQ ID NO:9 of HVR-H1, SEQ ID NO: 10 of HVR-H2, and SEQ ID NO: 11 of HVR-H3.
- the antibody may comprise a light chain variable domain amino acid sequence that is at least 85%, 90%, or 95% identical to SEQ ID NO:4, preferably while retaining the HVR-L1 RASKSINKYLA (SEQ ID NO:5), the HVR-L2 SGSTLQS (SEQ ID NO:6), and the HVR-L3 QQHNEYPLT (SEQ ID NO:7).
- the antibody may comprise a heavy chain variable domain amino acid sequence that is at least 85%, 90%, or 95% identical to SEQ ID NO:8, preferably while retaining the HVR-H1 GYHFTSYWMH (SEQ ID NO:9), the HVR-H2 VIHPNSGSINYNEKFES (SEQ ID NOTO), and the HVR-H3 ERDSTEVLPMDY (SEQ ID NO: 11).
- an anti-Clq antibody which inhibits the interaction between Clq and an autoantibody.
- the anti-Clq antibody causes clearance of Clq from the circulation or tissue.
- the anti-Clq antibody of this disclosure inhibits the interaction between Clq and Cis. In some embodiments, the anti-Clq antibody inhibits the interaction between Clq and Clr. In some embodiments, the anti-Clq antibody inhibits the interaction between Clq and Cis and between Clq and Clr. In some embodiments, the anti-Clq antibody inhibits the interaction between Clq and another antibody, such as an autoantibody. In preferred embodiments, the anti-Clq antibody causes clearance of Clq from the circulation or tissue. In some embodiments, the anti-Clq antibody inhibits the respective interactions, at a stoichiometry of less than 2.5: 1; 2.0: 1; 1.5: 1; or 1.0: 1.
- the Clq antibody inhibits an interaction, such as the Clq-Cls interaction, at approximately equimolar concentrations of Clq and the anti-Clq antibody.
- the anti-Clq antibody binds to Clq with a stoichiometry of less than 20: 1; less than 19.5: 1; less thanl9: l; less than 18.5: 1; less than 18: 1; less than 17.5: 1; less than 17: 1; less than 16.5: 1; less than 16: 1; less than 15.5: 1; less than 15:1; less than 14.5: 1; less than 14: 1; less than 13.5: 1; less than 13: 1; less than 12.5: 1; less than 12: 1; less than 11.5: 1; less than 11 : 1; less than 10.5: 1; less than 10: 1; less than 9.5: 1; less than 9: 1; less than 8.5: 1; less than 8: 1; less than 7.5: 1; less than 7: 1; less than
- the anti-Clq antibody binds Clq with a binding stoichiometry that ranges from 20: 1 to 1.0: 1 or less thanl .0: 1. In certain embodiments, the anti-Clq antibody binds Clq with a binding stoichiometry that ranges from 6: 1 to 1.0:1 or less thanl.0: l. In certain embodiments, the anti-Clq antibody binds Clq with a binding stoichiometry that ranges from 2.5: 1 to 1.0: 1 or less thanl.0:1. In some embodiments, the anti-Clq antibody inhibits the interaction between Clq and Clr, or between Clq and Cis, or between Clq and both Clr and Cis.
- the anti-Clq antibody inhibits the interaction between Clq and Clr, between Clq and Cis, and/or between Clq and both Clr and Cis. In some embodiments, the anti-Clq antibody binds to the Clq A-chain. In other embodiments, the anti-Clq antibody binds to the Clq B- chain. In other embodiments, the anti-Clq antibody binds to the Clq C-chain. In some embodiments, the anti-Clq antibody binds to the Clq A-chain, the Clq B-chain and/or the Clq C-chain. In some embodiments, the anti-Clq antibody binds to the globular domain of the Clq A-chain, B-chain, and/or C-chain. In other embodiments, the anti-Clq antibody binds to the collagen-like domain of the Clq A-chain, the Clq B-chain, and/or the Clq C- chain.
- the interaction occurring in the presence of the antibody may be reduced by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% relative to a control wherein the antibodies of this disclosure are absent.
- the interaction occurring in the presence of the antibody is reduced by an amount that ranges from at least 30% to at least 99% relative to a control wherein the antibodies of this disclosure are absent.
- the antibodies of this disclosure inhibit C2 or C4-cleavage by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99%, or by an amount that ranges from at least 30% to at least 99%, relative to a control wherein the antibodies of this disclosure are absent.
- Methods for measuring C2 or C4-cleavage are well known in the art.
- the ECso values for antibodies of this disclosure with respect C2 or C4-cleavage may be less than 3 pg/ml; 2.5 pg/ml; 2.0 pg/ml; 1.5 pg/ml; 1.0 pg/ml; 0.5 pg/ml; 0.25 pg/ml; 0.1 pg/ml; 0.05 pg/ml.
- the antibodies of this disclosure inhibit C2 or C4-cleavage at approximately equimolar concentrations of Clq and the respective anti-Clq antibody.
- the antibodies of this disclosure inhibit autoantibodydependent and complement-dependent cytotoxicity (CDC) by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99%, or by an amount that ranges from at least 30% to at least 99%, relative to a control wherein the antibodies of this disclosure are absent.
- CDC autoantibodydependent and complement-dependent cytotoxicity
- the ECso values for antibodies of this disclosure with respect to inhibition of autoantibody-dependent and complementdependent cytotoxicity may be less than 3 pg/ml; 2.5 pg/ml; 2.0 pg/ml; 1.5 pg/ml; 1.0 pg/ml; 0.5 pg/ml; 0.25 pg/ml; 0.1 pg/ml; 0.05 pg/ml.
- the antibodies of this disclosure inhibit complement-dependent cell-mediated cytotoxicity (CDCC) by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99%, or by an amount that ranges from at least 30% to at least 99%, relative to a control wherein the antibodies of this disclosure are absent.
- CDCC complement-dependent cell-mediated cytotoxicity
- the ECso values for antibodies of this disclosure with respect CDCC inhibition may be 1 less than 3 pg/ml; 2.5 pg/ml; 2.0 pg/ml; 1.5 pg/ml; 1.0 pg/ml; 0.5 pg/ml; 0.25 pg/ml; 0.1 pg/ml; 0.05 pg/ml.
- the antibodies of this disclosure inhibit CDCC but not antibody-dependent cellular cytotoxicity (ADCC).
- Humanized antibodies of the present disclosure specifically bind to a complement factor Clq and/or Clq protein in the Cl complex of the classical complement pathway.
- the humanized anti-Clq antibody may specifically bind to human Clq, human and mouse Clq, to rat Clq, or human Clq, mouse Clq, and rat Clq.
- the human heavy chain constant region is a human IgG4 heavy chain constant region comprising the amino acid sequence of SEQ ID NO:47, or with at least 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90% homology to SEQ ID NO: 47.
- the human IgG4 heavy chain constant region may comprise an Fc region with one or more modifications and/or amino acid substitutions according to Kabat numbering.
- the Fc region comprises a leucine to glutamate amino acid substitution at position 248 (corresponding to LI 15E mutation in IgG4), wherein such a substitution inhibits the Fc region from interacting with an Fc receptor.
- the Fc region comprises a serine to proline amino acid substitution at position 241 (corresponding to S108P in IgG4), wherein such a substitution prevents arm switching in the antibody.
- the amino acid sequence of human IgG4 (S241P L248E; that is corresponding to S108P and LI 15E in SEQ ID NO: 47) heavy chain constant domain is: ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFEG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPRE EQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYT LPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS RLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLGK (SEQ ID NO: 47).
- the antibody may comprise a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain comprises an amino acid sequence selected from any one of SEQ ID NOs: 31-34, or an amino acid sequence with at least about 90% homology to the amino acid sequence selected from any one of SEQ ID NOs: 31-34.
- the light chain variable domain comprises an amino acid sequence selected from any one of SEQ ID NOs: 35-38, or an amino acid sequence with at least about 90% homology to the amino acid sequence selected from any one of SEQ ID NOs: 35-38.
- VH1 heavy chain variable domain variant 1
- SEQ ID NO: 31 The amino acid sequence of heavy chain variable domain variant 1 (VH1) is: OVOLVOSGAELKKPGASVKVSCKSSGYHFTSYWMHWVKOAPGOGLEWIGVIHPN SGSINYNEKFESKATITVDKSTSTAYMQLSSLTSEDSAVYYCAGERDSTEVLPMDY WGQGTSVTVSS (SEQ ID NO: 31).
- the hyper variable regions (HVRs) of VH1 are depicted in bolded and underlined text.
- VH2 heavy chain variable domain variant 2
- the amino acid sequence of heavy chain variable domain variant 2 is: OVOLVOSGAELKKPGASVKVSCKSSGYHFTSYWMHWVKOAPGOGLEWIGVIHPN SGSINYNEKFESRATITVDKSTSTAYMELSSLRSEDTAVYYCAGERDSTEVLPMDY WGQGTTVTVSS (SEQ ID NO: 32).
- the hyper variable regions (HVRs) of VH2 are depicted in bolded and underlined text.
- VH3 heavy chain variable domain variant 3
- the amino acid sequence of heavy chain variable domain variant 3 is: OVOLVOSGAELKKPGASVKVSCKSSGYHFTSYWMHWVKQAPGOGLEWIGVIHPN SGSINYNEKFESRVTITVDKSTSTAYMELSSLRSEDTAVYYCAGERDSTEVLPMDY WGQGTTVTVSS (SEQ ID NO: 33).
- the hyper variable regions (HVRs) of VH3 are depicted in bolded and underlined text.
- VH4 heavy chain variable domain variant 4
- the amino acid sequence of heavy chain variable domain variant 4 is: OVOLVOSGAELKKPGASVKVSCKSSGYHFTSYWMHWVROAPGOGLEWIGVIHPN SGSINYNEKFESRVTITVDKSTSTAYMELSSLRSEDTAVYYCAGERDSTEVLPMDY WGQGTTVTVSS (SEQ ID NO: 34).
- the hyper variable regions (HVRs) of VH4 are depicted in bolded and underlined text.
- VKI The amino acid sequence of kappa light chain variable domain variant 1 (VKI) is: DVOITOSPSYLAASLGERATINCRASKSINKYLAWYOOKPGKTNKLLIYSGSTLQSGI PARFSGSGSGTDFTLTISSLEPEDFAMYYCOQHNEYPLTFGOGTKLEIK (SEQ ID NO:
- hyper variable regions (HVRs) of VKI are depicted in bolded and underlined text.
- VK2 The amino acid sequence of kappa light chain variable domain variant 2 (VK2) is: DVOITOSPSSLSASLGERATINCRASKSINKYLAWYOOKPGKANKLLIYSGSTLQSGI PARFSGSGSGTDFTLTISSLEPEDFAMYYCOQHNEYPLTFGOGTKLEIK (SEQ ID NO:
- hyper variable regions (HVRs) of VK2 are depicted in bolded and underlined text.
- VK3 The amino acid sequence of kappa light chain variable domain variant 3 (VK3) is: DVOITOSPSSLSASLGERATINCRASKSINKYLAWYOOKPGKAPKLLIYSGSTLQSGI PARFSGSGSGTDFTLTISSLEPEDFAMYYCOQHNEYPLTFGOGTKLEIK (SEQ ID NO:
- hyper variable regions (HVRs) of VK3 are depicted in bolded and underlined text.
- VK4 The amino acid sequence of kappa light chain variable domain variant 4 (VK4) is: DIOLTOSPSSLSASLGERATINCRASKSINKYLAWYOOKPGKAPKLLIYSGSTLQSGIP ARFSGSGSGTDFTLTISSLEPEDFAMYYCOQHNEYPLTFGOGTKLEIK (SEQ ID NO:
- the hyper variable regions (HVRs) of VK4 are depicted in bolded and underlined text.
- the antibody may comprise a light chain variable domain amino acid sequence that is at least 85%, 90%, or 95% identical to SEQ ID NO:35-38 while retaining the HVR-L1 RASKSINKYLA (SEQ ID NO:5), the HVR-L2 SGSTLQS (SEQ ID NO:6), and the HVR-L3 QQHNEYPLT (SEQ ID NO:7).
- the antibody may comprise a heavy chain variable domain amino acid sequence that is at least 85%, 90%, or 95% identical to SEQ ID NO:31-34 while retaining the HVR-H1 GYHFTSYWMH (SEQ ID NO:9), the HVR-H2 VIHPNSGSINYNEKFES (SEQ ID NOTO), and the HVR-H3 ERDSTEVLPMDY (SEQ ID NO: 11).
- the antibody may comprise a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 14; and the light chain comprises the amino acid sequence of SEQ ID NO: 40.
- the amino acid sequence of the heavy chain is: OVOLVOSGAELKKPGASVKVSCKSSGYHFTSYWMHWVKOAPGOGLEWIGVIHPN SGSINYNEKFESRVTITVDKSTSTAYMELSSLRSEDTAVYYCAGERDSTEVLPMDY WGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGAL TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYG PPCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDG VEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISK AKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSRL
- amino acid sequence of the light chain is:
- CDRs complementarity determining regions
- humanized anti-Clq antibodies of the present disclosure include a heavy chain variable region that contains a Fab region and a heavy chain constant regions that contains an Fc region, where the Fab region specifically binds to a Clq protein of the present disclosure, but the Fc region is incapable of binding the Clq protein.
- the Fc region is from a human IgGl, IgG2, IgG3, or IgG4 isotype.
- the Fc region is incapable of inducing complement activity and/or incapable of inducing antibody-dependent cellular cytotoxicity (ADCC).
- the Fc region comprises one or more modifications, including, without limitation, amino acid substitutions.
- the Fc region of humanized anti-Clq antibodies of the present disclosure comprise an amino acid substitution at position 248 according to Kabat numbering convention or a position corresponding to position 248 according to Kabat numbering convention, and/or at position 241 according to Kabat numbering convention or a position corresponding to position 241 according to Kabat numbering convention.
- the amino acid substitution at position 248 or a positions corresponding to position 248 inhibits the Fc region from interacting with an Fc receptor.
- the amino acid substitution at position 248 or a positions corresponding to position 248 is a leucine to glutamate amino acid substitution.
- the amino acid substitution at position 241 or a positions corresponding to position 241 prevents arm switching in the antibody. In some embodiments, the amino acid substitution at position 241 or a positions corresponding to position 241 is a serine to proline amino acid substitution.
- the Fc region of humanized anti-Clq antibodies of the present disclosure comprises the amino acid sequence of SEQ ID NO: 47, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 47.
- the present disclosure provides an anti-Clq antibody Fab fragment that binds to a Clq protein comprising a heavy (VH/CHI) and light chain (VL/CL), wherein the anti-Clq antibody Fab fragment has six complementarity determining regions (CDRs), three each from VL and VH (HCDR1, HCDR2, HCDR3, and LCDR1, LCDR2, LCDR3).
- CDRs complementarity determining regions
- the heavy chain of the antibody Fab fragment is truncated after the first heavy chain domain of IgGl (SEQ ID NO: 39), and comprises the following amino acid sequence: OVOLVOSGAELKKPGASVKVSCKSSGYHFTSYWMHWVKQAPGOGLEWIGVIH PNSGSINYNEKFESRVTITVDKSTSTAYMELSSLRSEDTAVYYCAGERDSTEVLP MDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVD KKVEPKSCDKTHT (SEQ ID NO: 39)
- CDRs complementarity determining regions
- the light chain domain of the antibody Fab fragment comprises the following amino acid sequence (SEQ ID NO: 40):
- CDRs complementarity determining regions
- the present disclosure provides an antibody that binds to a protein in the complement cascade, such as a Clq protein.
- the antibody that binds to Clq comprises a single Clq antigen-binding arm and an Fc region.
- the single Clq antigen-binding arm may comprise a light chain variable domain and a heavy chain variable domain.
- the Fc region may comprise a complex of a first and a second Fc polypeptide.
- the Fc region may comprise a Fey receptor binding site mutation.
- the antibody may be of the IgG4 class.
- one but not both of the Fc polypeptide is an N-terminally truncated heavy chain.
- the Fey receptor is FcyRI , FcyRII, or FcyRIII, preferably FcyRI.
- the Fey receptor binding site mutation may comprise a IgG4 LI 15E mutation.
- the HVR-L1 of the light chain variable domain has the sequence RASKSINKYLA (SEQ ID NO:5)
- the HVR-L2 of the light chain variable domain has the sequence SGSTLQS (SEQ ID NO:6)
- the HVR-L3 of the light chain variable domain has the sequence QQHNEYPLT (SEQ ID NO: 7).
- One heavy chain of the single-arm antibody (the heavy chain 1 domain) of the singlearm antibody may comprise the following amino acid sequence (SEQ ID NO:2):
- CDRs complementarity determining regions
- the HVR-H1 of the heavy chain variable domain has the sequence GYHFTSYWMH (SEQ ID NO: 9)
- the HVR-H2 of the heavy chain variable domain has the sequence VIHPNSGSINYNEKFES (SEQ ID NO: 10)
- the HVR-H3 of the heavy chain variable domain has the sequence ERDSTEVLPMDY (SEQ ID NO: 11).
- a second heavy chain of the single-arm antibody (the heavy chain 2 domain) of the single-arm antibody, which is N-terminally truncated, may comprise the following amino acid sequence (SEQ ID NO: 3):
- the knob in hole T366S/L368A/Y407V mutations in SEQ ID NO: 3 are depicted in underlined text.
- the S241P and L248E mutations are depicted in bolded text.
- the antibody that binds to Clq comprising: a light chain domain comprising the amino acid sequence of SEQ ID NO: 40; a first heavy chain domain comprising the amino acid sequence of SEQ ID NO: 2; and a second heavy chain domain comprising the amino acid sequence of SEQ ID NO: 3; the second heavy chain domain is an N-terminally truncated heavy chain.
- the inhibitor of the classical complement pathway may be a Cis inhibitor, such as a small molecule, an antibody, an aptamer, an antisense nucleic acid or a gene editing agent.
- Cis small molecule inhibitors are described in United States patent application 17/379,334, the contents of which are incorporated herein by reference.
- Suitable inhibitors include an antibody that binds complement Cis protein (i.e., an anti-complement Cis antibody, also referred to herein as an anti-Cls antibody and a Cis antibody) and a nucleic acid molecule that encodes such an antibody.
- complement Cis protein i.e., an anti-complement Cis antibody, also referred to herein as an anti-Cls antibody and a Cis antibody
- nucleic acid molecule that encodes such an antibody.
- Complement Cis is an attractive target as it is upstream in the complement cascade and has a narrow range of substrate specificity.
- antibodies for example, but not limited to, monoclonal antibodies
- the antibody may be a murine, humanized, or chimeric antibody.
- the light chain variable domain comprises HVR-L1, HVR-L2, and HVR-L3
- the heavy chain comprises HVR-H1, HVR-H2, and HVR-H3 of a murine anti-human Cis monoclonal antibody 5 Al produced by a hybridoma cell line deposited with ATCC on 5/15/2013 or progeny thereof (ATCC Accession No. PTA-120351).
- the light chain variable domain comprises the HVR-L1, HVR-L2, and HVR-L3 and the heavy chain variable domain comprises the HVR-H1, HVR-H2, and HVR-H3 of a murine anti-human Cis monoclonal antibody 5C12 produced by a hybridoma cell line deposited with ATCC on 5/15/2013, or progeny thereof (ATCC Accession No. PTA-120352).
- antibodies specifically bind to and inhibit a biological activity of C 1 s or the C 1 s proenzyme, such as C 1 s binding to C 1 q, C 1 s binding to C 1 r, or C 1 s binding to C2 or C4.
- the biological activity may be a proteolytic enzyme activity of Cis, the conversion of the Cis proenzyme to an active protease, or proteolytic cleavage of C2 or C4.
- the biological activity is activation of the classical complement activation pathway, activation of antibody and complement dependent cytotoxicity, or C1F hemolysis.
- an anti-Cls antibody of the present disclosure (e.g., a subject antibody that specifically binds an epitope in a complement Cis protein) comprises: a) a light chain region comprising CDRs selected from SEQ ID NO: 15, SEQ ID NO: 16, and SEQ ID NO: 17; and b) a heavy chain region comprising CDRs selected from SEQ ID NO: 18, SEQ ID NO: 19, and SEQ ID NO:20.
- the anti-Cls antibody includes a humanized VH and/or VL framework region.
- SEQ ID NO: 15 SSVSSSYLHWYQ
- SEQ ID NO: 16 STSNLASGVP;
- SEQ ID NO: 18 GFTFSNYAMSWV;
- SEQ ID NO: 20 ARLFTGYAMDY.
- an anti-Cls antibody of the present disclosure comprises a light chain variable region comprising amino acid sequence SEQ ID NO:21.
- an anti-Cls antibody of the present disclosure comprises a heavy chain variable region comprising amino acid sequence SEQ ID NO:22.
- an anti-Cls antibody of the present disclosure comprises a light chain variable region comprising amino acid sequence SEQ ID NO:23.
- an anti-Cls antibody of the present disclosure comprises a heavy chain variable region comprising amino acid sequence SEQ ID NO:24.
- an anti-Cls antibody of the present disclosure comprises a light chain comprising amino acid sequence SEQ ID NO:25.
- an anti-Cls antibody of the present disclosure comprises a heavy chain comprising amino acid sequence SEQ ID NO:26.
- Sutimlimab antibody comprises a light chain comprising amino acid sequence SEQ ID NO:25 and a heavy chain comprising amino acid sequence SEQ ID NO:26.
- an anti-Cls antibody of the present disclosure comprises: a) a light chain region comprising CDRs selected from SEQ ID NO:27, SEQ ID NO:28, and SEQ ID NO:17; and b) a heavy chain region comprising CDRs selected from SEQ ID NO:29, SEQ ID NO: 30, and SEQ ID NO:31.
- the anti-Cls antibody includes a humanized VH and/or VL framework region.
- SEQ ID NO: 27 TASSSVSSSYLH;
- SEQ ID NO: 28 STSNLAS
- SEQ ID NO: 30 TISSGGSHTYYLDSVKG
- an anti-Cls antibody of the present disclosure comprises a light chain variable region comprising amino acid sequence SEQ ID NO:44.
- an anti-Cls antibody of the present disclosure comprises a heavy chain variable region comprising amino acid sequence SEQ ID NO:45.
- the anti-Cls antibody may be selected from an antigen binding fragment, Ig monomer, a Fab fragment, a F(ab')2 fragment, a Fd fragment, a scFv, a scAb, a dAb, a Fv, a single domain heavy chain antibody, a single domain light chain antibody, a mono-specific antibody, a bi-specific antibody, or a multi-specific antibody.
- an antibody that competes for binding the epitope bound by antibody IPN003 (also referred to herein as “IPN-M34” or “M34” or “TNT003”), e.g., an antibody comprising a variable domain of antibody IPN003, such as antibody IPN003.
- the inhibitor of the classical complement pathway may be a Clr inhibitor, such as a small molecule, an antibody, an aptamer, an antisense nucleic acid or a gene editing agent.
- anti-Clr antibodies disclosed herein are potent inhibitors of Clr.
- anti-Clr antibodies disclosed herein inhibit the interaction between Clr and Clq or between Clr and Cis, or wherein the anti-Clr antibody inhibits the catalytic activity of Clr or inhibits the processing of pro-Clr to an active protease.
- the inhibitor of the classical complement pathway may be a Cl complex inhibitor, such as a small molecule, an antibody, an aptamer, an antisense nucleic acid or a gene editing agent.
- anti-Cl complex antibodies disclosed herein are potent inhibitors of Cl complex.
- the anti-Cl complex antibodies disclosed herein inhibit Clr or Cis activation or blocks their ability to act on C2 or C4.
- the anti-Cl complex antibodies disclosed herein bind to a combinatorial epitope within the Cl complex, wherein said combinatorial epitope comprises amino acids of both Clq and Cis; both Clq and Clr; both Clr and Cis; or each of Clq, Clr, and Cis.
- the inhibitor of the classical complement pathway may be a C2 inhibitor, such as a small molecule, an antibody, an aptamer, an antisense nucleic acid or a gene editing agent.
- anti-C2 inhibitors disclosed herein are potent inhibitors of C2.
- the inhibitor of the classical complement pathway may be a C3 inhibitor, such as a small molecule, an antibody, an aptamer, an antisense nucleic acid or a gene editing agent.
- the anti-C3 inhibitors disclosed herein are potent inhibitors of C3.
- the C3 inhibitor is APL-9 (Apellis) and/or AMY-101 (Amyndas) and/or IVT CB 2782-PEG (Catalyst Biosciences and Biogen).
- the inhibitor of the classical complement pathway may be a C4 inhibitor, such as a small molecule, an antibody, an aptamer, an antisense nucleic acid or a gene editing agent.
- anti-C4 inhibitors disclosed herein are potent inhibitors of C4.
- a number of molecules are known that inhibit the activity of complement.
- suitable inhibitors can be screened by methods described herein.
- normal cells can produce proteins that block complement activity, e.g., CD59, Cl inhibitor, etc.
- complement is inhibited by upregulating expression of genes encoding such polypeptides.
- Modifications of molecules that block complement activation are also known in the art.
- such molecules include, without limitation, modified complement receptors, such as soluble CR1.
- modified complement receptors such as soluble CR1.
- the mature protein of the most common allotype of CR1 contains 1998 amino acid residues: an extracellular domain of 1930 residues, a transmembrane region of 25 residues, and a cytoplasmic domain of 43 residues.
- the entire extracellular domain is composed of 30 repeating units referred to as short consensus repeats (SCRs) or complement control protein repeats (CCPRs), each consisting of 60 to 70 amino acid residues.
- SCRs short consensus repeats
- CCPRs complement control protein repeats
- Clq binds specifically to human CR1.
- CR1 recognizes all three complement opsonins, namely C3b, C4b, and Clq.
- sCRl human CR1
- cClqR human Clq receptors
- Decay accelerating factor (CD55) is composed of four SCRs plus a serine/threonine-enriched domain that is capable of extensive O-linked glycosylation.
- DAF is attached to cell membranes by a glycosyl phosphatidyl inositol (GPI) anchor and, through its ability to bind C4b and C3b, it acts by dissociating the C3 and C5 convertases.
- GPI glycosyl phosphatidyl inositol
- Soluble versions of DAF (sDAF) have been shown to inhibit complement activation.
- Cl inhibitor a member of the “serpin” family of serine protease inhibitors, is a heavily glycosylated plasma protein that prevents fluid-phase Cl activation.
- Cl inhibitor regulates the classical pathway of complement activation by blocking the active site of Clr and Cis and dissociating them from Clq.
- Peptide inhibitors of complement activation include C5a and other inhibitory molecules include Fucan.
- the present disclosure presents a model evaluating complement activation, alone or in combination with NfL and age, that more accurately predicts HD stage than NfL alone or in combination with age.
- Data from HD clinical trials demonstrate that patients identified via the use of a model evaluating high C4a levels and/or high C4a/C4 ratios exhibit clinical improvement with anti-Clq antibody treatment.
- the clinical trial data also demonstrates treatment with full-length anti-Clq antibody leads to clinical benefits in HD patients identified by the use of a model evaluating complement activation alone or in combination with NfL and age.
- the clinical trial data also demonstrate that accounting for complement activation, NfL, and age, and the use of a full-length anti-Clq antibody reliably leads to clinical benefits in HD patients.
- Clinical benefits were measured by composite Unified Huntington’s Disease Rating Scale (cUHDRS), or any of the following domains: cognitive (SDMT, SWR), total functional capacity (TFC), and total motor skills (TMS).
- the present disclosure is generally directed to methods of treating Huntington’s disease in a subject in need thereof.
- the method comprises determining that the subject has an elevated level of C4a or an elevated C4a/C4 ratio; and administering to the subject an inhibitor of the classical complement pathway, e.g., if the subject has an elevated level of C4a or an elevated C4a/C4 ratio.
- a therapeutically effective amount of the inhibitor may be administered.
- the elevated level of C4a may be greater than a C4a level in normal or healthy subjects, such as subjects of a similar age.
- Patients treated with inhibitor of the classical complement pathway e.g., full-length Clq antibody
- results from baseline in cUHDRS and/orcomponents of cUHDRS over 6 months of treatment showed improvement from baseline in cUHDRS and/orcomponents of cUHDRS over 6 months of treatment.
- This improvement was enriched in patients with excess complement activity at baseline, whereby 75% of patients with elevated CSF C4a levels at baseline demonstrated improvement in cUHDRS over 6 months of treatment, suggesting rapid response to anti-Clq therapy potentially via enhanced synapse function.
- C4a is an objective measurement that can indicate excess classical complement activity in CSF that correlates with disease stage and multiple clinical end-points in HD.
- the elevated level of C4a may be greater than a reference C4a level.
- the reference C4a level is a value that is equal to or greater than the median of C4a levels in samples derived from Huntington’s disease subjects, such as subjects of a similar age.
- the reference C4a level is a value that is equal to or greater than the 75th percentile of C4a levels in samples derived from normal or healthy subjects (subjects that do not have Huntington’s disease.), such as subjects of a similar age.
- Approximately 50% of HD patients have elevated CSF levels of complement activation product C4a in natural history cohorts ( Figures 7A-7B).
- the median of the C4a levels in samples derived from Huntington’s disease subjects is similar to the 75th percentile of C4a levels in samples derived from normal or healthy subjects ( Figure 7A).
- the elevated level of C4a is greater than the reference C4a level by at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 150%, 200%, 250%, 300%, 350%, 400%, 450%, or 500%.
- the elevated level of C4a is greater than the reference C4a level by at least 1%-10%, 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-100%, 100%-200%, 200%- 300%, 300%-400%, or 400%-500%.
- the elevated C4a/C4 ratio may be greater than a C4a/C4 ratio in normal or healthy subjects, such as subjects of a similar age.
- the elevated C4a/C4 ratio is greater than a reference C4a/C4 ratio.
- the reference C4a/C4 ratio may be a value that is equal to or greater than the median of C4a/C4 ratio in samples derived from Huntington’s disease subjects, such as subjects of a similar age.
- the reference C4a/C4 ratio is a value that is equal to or greater than the 75th percentile of C4a/C4 ratios in samples derived from normal or healthy subjects (subjects that do not have Huntington’s disease), such as subjects of a similar age.
- the elevated C4a/C4 ratio is greater than the reference C4a/C4 ratio by at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 150%, 200%, 250%, 300%, 350%, 400%, 450%, or 500%.
- the elevated C4a/C4 ratio is greater than the reference C4a/C4 ratio by at least 1%-10%, 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-100%, 100%-200%, 200%-300%, 300%-400%, or 400%-500%.
- the level of C4a or the C4a/C4 ratio is measured in cerebrospinal fluid (CSF) or plasma. Any methods of measuring complement C4a and C4 levels can be used, and are well known to those of ordinary skill in the art, including but not limited to commercially available ELISA kits such as those from Quidel and SVAR.
- Neurofilament light is a strong monitoring and prognostic biomarker for HD.
- NfL Neurofilament light
- Figures 6A-6B a model combining complement activation, NfL and age more accurately predicts HD stage than NfL alone
- the subject has an elevated level of Neurofilament light chain (NfL).
- the elevated level of NfL may be greater than a NfL level in normal or healthy subjects, such as subjects of a similar age. In some embodiments, the elevated level of NfL is greater than a reference NfL level.
- the reference NfL level may be about 100 pg/ml, 200 pg/ml, 300 pg/ml, 400 pg/ml, 500 pg/ml, 600 pg/ml, 700 pg/ml, 800 pg/ml, 900 pg/ml, 1000 pg/ml, 1100 pg/ml, 1200 pg/ml, 1300 pg/ml, 1400 pg/ml, 1500 pg/ml, 1600 pg/ml, 1700 pg/ml, 1800 pg/ml, 1900 pg/ml, or 2000 pg/ml.
- the elevated level of NfL is greater than the NfL level in normal or healthy subjects or the reference NfL level by at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 150%, 200%, 250%, 300%, 350%, 400%, 450%, 500%, 550%, 600%, 650%, 700%, 750%, 800%, 850%, 900%, 950%, 1000%, 1500%, 2000%, 2500%, 3000%, 3500%, 4000%, 4500%, or 5000%.
- the elevated level of NfL is greater than the NfL level in normal or healthy subjects or the reference NfL level by at least 1%-10%, 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-100%, 100%-200%, 200%- 300%, 300%-400%, 400%-500%, 500%-600%, 600%-700%, 700%-800%, 800%-900%, 900%-1000%, 1000%-2000%, 2000%-3000%, 3000%-4000%, or 4000-5000%.
- the level of NfL is measured in cerebrospinal fluid (CSF).
- the level of NfL is measured in plasma.
- the reference NfL level may be about 1 pg/ml, 2 pg/ml, 3 pg/ml, 4 pg/ml, 5 pg/ml, 6 pg/ml, 7 pg/ml, 8 pg/ml, 9 pg/ml, 10 pg/ml, 11 pg/ml, 12 pg/ml, 13 pg/ml, 14 pg/ml, 15 pg/ml, 16 pg/ml, 17 pg/ml, 18 pg/ml, 19 pg/ml, or 20 pg/ml.
- the elevated level of NfL is greater than the NfL level in normal or healthy subjects or the reference NfL level by at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 150%, 200%, 250%, 300%, 350%, 400%, 450%, 500%, 550%, 600%, 650%, 700%, 750%, 800%, 850%, 900%, 950%, 1000%, 1500%, 2000%, 2500%, 3000%, 3500%, 4000%, 4500%, or 5000%.
- the elevated level of NfL is greater than the NfL level in normal or healthy subjects or the reference NfL level by at least 1%- 10%, 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%- 60%, 60%-70%, 70%-80%, 80%-90%, 90%-100%, 100%-200%, 200%-300%, 300%-400%, 400%-500%, 500%-600%, 600%-700%, 700%-800%, 800%-900%, 900%-1000%, 1000%- 2000%, 2000%-3000%, 3000%-4000%, or 4000-5000%.
- the inhibitor of the classical complement pathway is a Clq inhibitor, such as a small molecule, an antibody, an aptamer, an antisense nucleic acid or a gene-editing agent.
- the antibody may be a Clq antibody described herein.
- the antibody may comprise a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 14; and the light chain comprises the amino acid sequence of SEQ ID NO: 40. Any suitable dosing may be used in the methods described herein.
- the antibody may be administered at a dose of at least 5 mg/kg, at least 10 mg/kg, at least 15 mg/kg, at least 20 mg/kg, at least 25 mg/kg, at least 30 mg/kg, at least
- the antibody is administered at a dose of 5 mg/kg, 6 mg/kg, 7 mg/kg, 8 mg/kg, 9 mg/kg, 10 mg/kg, 11 mg/kg, 12 mg/kg, 13 mg/kg, 14 mg/kg, 15 mg/kg, 16 mg/kg, 17 mg/kg, 18 mg/kg, 19 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 35 mg/kg, 40 mg/kg, 45 mg/kg, 50 mg/kg, 55 mg/kg, 60 mg/kg, 65 mg/kg, 70 mg/kg, 75 mg/kg, 80 mg/kg, 85 mg/kg, 90 mg/kg, 95 mg/kg, 100 mg/kg, 105 mg/kg, 110 mg/kg, 120 mg/kg, 130 mg/kg, 140 mg/kg, or 150 mg/kg. In some embodiments, the antibody is administered at a dose of 75 mg/kg on day 1 and
- the antibody is administered intravenously. In some embodiments, the antibody is administered once a week, once every other week, once a month, once every six weeks, or once every other month. In some embodiments, the antibody is administered for at least 3 months, at least 6 months, at least 7 months, at least 8 months, at least 9 months, at least 10 months, at least 11 months, or at least 12 months. In some embodiments, the antibody is administered for 3 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, or 12 months.
- the antibody comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 14; and the light chain comprises the amino acid sequence of SEQ ID NO: 40.
- the antibody may be administered at a dose of 75 mg/kg on day 1 and on day 5 or day 6. In some embodiments, the antibody is further administered at a dose of 100 mg/kg every two weeks.
- C4 was measured by sandwich ELISA. Plates were coated with 3 ug/ml polyclonal raised to C4 (Goat anti-Human C4, Complement Tech, A205 ). CSF was diluted 1 :5000 in dPBS (Delbecco’s PBS) buffer containing lOmM EDTA and incubated overnight at 4-degree C. Plates were washed and incubated with antibody anti-C4 antibody (Abeam ab47788) conjugated to Alkaline phosphatase (1 :2000 dilution). Plates were washed thrice with wash buffer and developed using 75 uL of alkaline phosphatase substrate (Life Technologies, T2214). After 20 minutes at room temperature, plates were read using a luminometer. Standards were fit using a 4PL logistic fit and concentration of unknowns determined. Analyte levels were corrected for dilution and then plotted using GraphPad Prism.
- C4a was measured in a competition-based ELISA. Plates were coated with lOug/ml CT-C4a (Rabbit anti human C4a, Complement Tech A206), a polyclonal antisera raised to C4a. CSF was diluted 1 : 10 in buffer dPBS containing lOmM EDTA and lOng/ml biotinylated-C4a and incubated overnight at 4 degree C. Plates were washed 3 times and incubated with Avidin-AP (1 : 1000 dilution). Alkaline phosphates activity was detected as above.
- cUHDRS Composite UHDRS
- cUHDRS Composite UHDRS
- CSF C4a Excess classical complement activity in CSF (C4a) of HD patients is associated with functional decline and disease severity ( Figure 2). Further, CSF C4a is correlated with individual domains of the cUHDRS (Table 1).
- C4a increases in the CSF of manifest HD patients ( Figure 3).
- NFL is significantly elevated in CSF of manifest HD patients and CSF NFL correlates with CSF C4a ( Figures 4A- 4B).
- C4a can inform disease stage beyond predicted by age (Figure 5).
- Figure 5 To determine if C4a offers additional information about disease stage beyond age alone, we assessed the statistical significance of C4a coefficient towards predicting HD disease stage.
- Two linear regression models were used to compare correlation between age and age+C4a with HD category.
- LM2 which includes C4a in addition to age, predicts HD disease stage more accurately compared to LM1.
- the diagonal line represents equal accuracy between two models. Data below the diagonal line indicates that LM2 has lower error, hence higher accuracy, than LM1 ( Figure 5).
- CSF C4a/C4 ratio a sensitive measure of ongoing complement activation. C4 decreased (consumed) with Clq activation activity. C4a increased (produced) with Clq activation. C4a/C4 ratio corrects for genetic variability among subjects Figure 8).
- Example 2 A Phase 2a Open Label Study to Assess the Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of Intravenous full-length Clq antibody in Subjects with, or at Risk for, Manifest Huntington’s Disease
- Subjects received induction dosing of full-length Clq antibody (the antibody comprises the heavy chain comprising the amino acid sequence of SEQ ID NO: 14; and the light chain comprising the amino acid sequence of SEQ ID NO: 40) at 75 mg/kg administered by intravenous (IV) infusion on Days 1 and 5 or 6, followed by maintenance dosing at 100 mg/kg every 2 weeks (Weeks 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, and 22) with follow up visits on Weeks 24, 28, and 36. All full-length Clq antibody infusions were administered at in clinic visits.
- IV intravenous
- Plasma samples for PK/PD assessments were collected for serial sampling following the first and last dose. Pre-dose samples were collected at all dosing visits (Days 1 and 5/6 and Weeks 2 through 22) prior to beginning the full-length Clq antibody infusion. Blood samples were collected after completing the infusion on Day 5/6, and Weeks 2, 6, 10, 14, and 18. PK/PD samples were also collected at the Week 24, 28, and 36 visits.
- Cerebrospinal fluid (CSF) sampling for PK and PD assessments were conducted at Screening, pre-dose at Week 6 and Week 12, and at Weeks 24 and 36.
- EEGs were conducted during Screening and pre-dose on Day 1, Week 6, Week 12, and Week 18, as well as at Weeks 24 and 36.
- Initial target engagement data included pharmacokinetics (PK) and pharmacodynamics (PD) in 17 patients who completed the 24-week treatment period.
- Initial efficacy and biomarker data included clinical outcomes, as measured by the Unified Huntington's Disease Rating Scale (UHDRS) in all 23 patients who completed the 24-week treatment period, as well as neurofilament light chain (NfL) levels in 16 patients who completed the 24-week treatment period.
- UHDRS Unified Huntington's Disease Rating Scale
- NfL neurofilament light chain
- C4a, C4, and Nfl levels were measured as described in Example 1.
- Initial findings show that treatment with full-length Clq antibody was generally well-tolerated, with robust target engagement of Clq in both serum and cerebrospinal fluid (CSF) through the dosing period. Notably, meaningful improvements in UHDRS were observed, while NfL levels in both plasma and CSF remained generally unchanged and consistent with HD natural history.
- the phase 2a data was analyzed using CSF C4a/C4 ratio as measure of ongoing complement activity (Figure 9).
- Patients were divided into two groups based on C4a/C4 levels at baseline.
- High baseline complement patients showed consistent and significant improvement on cUHDRS over 24-week treatment period ( Figure 10).
- Biomarker- differentiated responses are unlikely to be placebo driven.
- the high baseline C4a/C4 ratio patients also improved from baseline on cUHDRS over 24-week treatment period vs. natural history.
- the decline of low complement activity cohort is consistent with natural history.
- high baseline C4a/C4 ratio patients consistently improved on cUHDRS sub-domains over 24-week treatment period ( Figures 11 A-l ID). 75% of patients with high baseline complement activity (C4a/C4) improved at week 24 in cUHDRS vs. 36% with low activation ( Figures 12A-12B).
- Plasma NfL levels are consistent with HD natural history at week 24 ( Figure 13).
- CSF NfL levels are also consistent with HD natural history at week 24 ( Figure 14).
- the HD natural history data are for manifest cohort (Rodriguez, et al., Sci Transl Med. 2020 12 16; 12(574)) and (Tabrizi, NEJM 2019, 38:2307). Synapse loss impacts neuronal function and precedes neuronal loss and NfL release (Ravalia, 2021; Milnerwood and Raymond, 2010; Milnerwood et al., 2010; Parsons and Raymond, 2014; Ravalia et al., 2021; Alirezaeil et al., 2020 Mol Neurobiol. 57: 469-491).
- Example 3 A Phase 2a Open Label Study to Assess the effect of Intravenous full-length Clq antibody in Subjects with, or at Risk for, Manifest Huntington’s Disease
- Subjects received induction dosing of full-length Clq antibody (the antibody comprises the heavy chain comprising the amino acid sequence of SEQ ID NO: 14; and the light chain comprising the amino acid sequence of SEQ ID NO: 40) at 75 mg/kg administered by intravenous (IV) infusion on Days 1 and 5 or 6, followed by maintenance dosing at 100 mg/kg every 2 weeks (Weeks 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, and 22) with follow up visits on Weeks 24, 28, and 36. All full-length Clq antibody infusions were administered at in clinic visits.
- IV intravenous
- Plasma samples for PK/PD assessments were collected for serial sampling following the first and last dose. Pre-dose samples were collected at all dosing visits (Days 1 and 5/6 and Weeks 2 through 22) prior to beginning the full-length Clq antibody infusion. Blood samples were collected after completing the infusion on Day 5/6, and Weeks 2, 6, 10, 14, and 18. PK/PD samples were also collected at the Week 24, 28, and 36 visits.
- Cerebrospinal fluid (CSF) sampling for PK and PD assessments were conducted at Screening, pre-dose at Week 6 and Week 12, and at Weeks 24 and 36.
- EEGs were conducted during Screening and pre-dose on Day 1, Week 6, Week 12, and Week 18, as well as at Weeks 24 and 36.
- the data also shows extended target engagement and downstream complement inhibition within the CNS 14 weeks post last dose.
- Figure 18 shows prolonged full-length Clq antibody effect throughout 3-month off-treatment period.
- C4a release is a pharmacodynamic marker of Clq target engagement. All patients have evidence of continued target engagement 3 months post last dose. This is consistent with preclinical data showing full-length Clq antibody accumulation at sites of high Clq expression in CNS.
- Figures 19A-19B show significant improvement during treatment period for subjects with excess versus lower baseline complement activity.
- Figures 20A-20D show that benefit in patients with high complement activity was demonstrated across most cUHDRS constituent domains.
- Figure 20A shows total functional capacity (TFC, activities of daily living).
- Figure 20B shows Symbol Digit Modality Test (SDMT, Cognition).
- Figure 20C shows total motor score (TMS).
- Figure 20D shows stroop word reading test (SWR, Cognition).
- Plasma NfL levels were stabilized throughout study.
- Figure 21 shows that plasma NfL levels are consistent with HD natural history at week 36 with 4% change from screening (Rodriguez, et al., Sci Transl Med. 2020 12 16; 12(574)) and (Tabrizi, NEJM 2019, 38:2307).
- Figure 14 shows that CSF NfL levels are consistent with HD natural history at week 36 with 16% change from screening. *Results are independent of baseline complement activity.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Biomedical Technology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Neurology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Neurosurgery (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biophysics (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Genetics & Genomics (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Pathology (AREA)
- Physical Education & Sports Medicine (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Cell Biology (AREA)
- Hospice & Palliative Care (AREA)
- Psychiatry (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020247023399A KR20240126863A (ko) | 2021-12-30 | 2022-12-29 | 헌팅턴병 치료용 조성물 및 방법 |
| IL313901A IL313901A (en) | 2021-12-30 | 2022-12-29 | Compositions and methods for treating huntington's disease |
| US18/725,580 US20250074973A1 (en) | 2021-12-30 | 2022-12-29 | Compositions and methods for treating huntington’s disease |
| AU2022425559A AU2022425559A1 (en) | 2021-12-30 | 2022-12-29 | Compositions and methods for treating huntington's disease |
| CN202280086909.6A CN118525031A (zh) | 2021-12-30 | 2022-12-29 | 用于治疗亨廷顿氏病的组合物和方法 |
| MX2024008273A MX2024008273A (es) | 2021-12-30 | 2022-12-29 | Composiciones y metodos para el tratamiento de la enfermedad de huntington. |
| EP22917557.5A EP4457244A4 (en) | 2021-12-30 | 2022-12-29 | COMPOSITIONS AND METHODS OF TREATMENT FOR HUNTINGTON'S DISEASE |
| JP2024539560A JP2025503545A (ja) | 2021-12-30 | 2022-12-29 | ハンチントン病を治療するための組成物及び方法 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163295213P | 2021-12-30 | 2021-12-30 | |
| US63/295,213 | 2021-12-30 | ||
| US202263349305P | 2022-06-06 | 2022-06-06 | |
| US63/349,305 | 2022-06-06 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023130001A1 true WO2023130001A1 (en) | 2023-07-06 |
Family
ID=87000332
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/082523 Ceased WO2023130001A1 (en) | 2021-12-30 | 2022-12-29 | Compositions and methods for treating huntington's disease |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US20250074973A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4457244A4 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2025503545A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20240126863A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2022425559A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL313901A (cg-RX-API-DMAC7.html) |
| MX (1) | MX2024008273A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2023130001A1 (cg-RX-API-DMAC7.html) |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20160159890A1 (en) * | 2013-07-09 | 2016-06-09 | Annexon, Inc. | Methods of treatment for alzheimer's disease and huntington's disease |
| US20200317765A1 (en) * | 2015-11-24 | 2020-10-08 | Annexon, Inc. | Anti-complement factor c1q fab fragments and uses thereof |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB2584105B (en) * | 2019-05-21 | 2023-08-02 | Argenx Bvba | Methods of treating neuropathy |
-
2022
- 2022-12-29 US US18/725,580 patent/US20250074973A1/en active Pending
- 2022-12-29 JP JP2024539560A patent/JP2025503545A/ja active Pending
- 2022-12-29 AU AU2022425559A patent/AU2022425559A1/en active Pending
- 2022-12-29 EP EP22917557.5A patent/EP4457244A4/en active Pending
- 2022-12-29 IL IL313901A patent/IL313901A/en unknown
- 2022-12-29 KR KR1020247023399A patent/KR20240126863A/ko active Pending
- 2022-12-29 MX MX2024008273A patent/MX2024008273A/es unknown
- 2022-12-29 WO PCT/US2022/082523 patent/WO2023130001A1/en not_active Ceased
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20160159890A1 (en) * | 2013-07-09 | 2016-06-09 | Annexon, Inc. | Methods of treatment for alzheimer's disease and huntington's disease |
| US20200317765A1 (en) * | 2015-11-24 | 2020-10-08 | Annexon, Inc. | Anti-complement factor c1q fab fragments and uses thereof |
Non-Patent Citations (5)
| Title |
|---|
| HUGHES-JONES, NEVIN C.: ""The classical pathway." Immunobiology of the complement system", 31 December 1986 (1986-12-31), pages 21 - 44, Retrieved from the Internet <URL:https://www.reprintsdesk.com/userv3/fulltextreader.aspx> [retrieved on 20230417] * |
| JOHAN BEEK; KRISTINA ELWARD; PHILIPPE GASQUE: "Activation of Complement in the Central Nervous System", ANNALS OF THE NEW YORK ACADEMY OF SCIENCES, NEW YORK ACADEMY OF SCIENCES., US, vol. 992, no. 1, 24 January 2006 (2006-01-24), US , pages 56 - 71, XP071397013, ISSN: 0077-8923, DOI: 10.1111/j.1749-6632.2003.tb03138.x * |
| OMORI, TOMOKO, ET AL.: "Evidence for activation of lectin and classical pathway complement components in aqueous humor of neovascular age-related macular degeneration", OPHTHALMIC RESEARCH, vol. 63, no. 3, 2020, pages 252 - 258, XP009547270 * |
| See also references of EP4457244A4 * |
| TATOMIR ALEXANDRU; TALPOS-CAIA ANAMARIA; ANSELMO FREIDRICH; KRUSZEWSKI ADAM M.; BOODHOO DALLAS; RUS VIOLETA; RUS HOREA: "The complement system as a biomarker of disease activity and response to treatment in multiple sclerosis", IMMUNOLOGY RESEARCH, HUMANA PRESS, INC, US, vol. 65, no. 6, 8 November 2017 (2017-11-08), US , pages 1103 - 1109, XP036376584, ISSN: 0257-277X, DOI: 10.1007/s12026-017-8961-8 * |
Also Published As
| Publication number | Publication date |
|---|---|
| EP4457244A4 (en) | 2026-01-07 |
| EP4457244A1 (en) | 2024-11-06 |
| US20250074973A1 (en) | 2025-03-06 |
| JP2025503545A (ja) | 2025-02-04 |
| AU2022425559A1 (en) | 2024-07-04 |
| IL313901A (en) | 2024-08-01 |
| MX2024008273A (es) | 2024-07-19 |
| KR20240126863A (ko) | 2024-08-21 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7275223B2 (ja) | ヒト化抗補体因子C1q抗体及びその使用 | |
| JP7106386B2 (ja) | コロニー刺激因子1受容体(csf1r)を結合する抗体によって状態を治療する方法 | |
| JP6646100B2 (ja) | 抗cxcr3抗体 | |
| US20180303936A1 (en) | Combination therapy comprising ox40 binding agonists and pd-1 axis binding antagonists | |
| TWI564305B (zh) | 治療性抗體 | |
| JP7617848B2 (ja) | ピログルタメートアミロイド-βに対する抗体及びその使用 | |
| US20170290913A1 (en) | Combination therapy comprising ox40 binding agonists and pd-1 axis binding antagonists | |
| ES2738305T3 (es) | Procedimientos para diagnosticar y tratar enfermedades inflamatorias intestinales | |
| JP2021514969A (ja) | 抗tigit及び抗pd−l1アンタゴニスト抗体による治療のための投薬 | |
| AU2019370485B2 (en) | Compositions and methods for treating brain injury | |
| IL296130A (en) | Anti-complement factor c1q fab fragments and their uses | |
| IL293386A (en) | Methods of use of anti-trem2 antibodies | |
| US20250230225A1 (en) | Compositions and methods for treating muscular dystrophy | |
| KR20230024368A (ko) | 항-tigit 항체 및 pd-1 축 결합 길항제를 사용한 치료 | |
| US20240034775A1 (en) | Compositions and methods for treating epilepsy | |
| EP4200331A1 (en) | Methods for reducing maternal autoantibodies | |
| EP4228696A1 (en) | Compositions and methods for treating blood disorders | |
| US20250074973A1 (en) | Compositions and methods for treating huntington’s disease | |
| US20250313615A1 (en) | Compositions and methods for treating lupus nephritis | |
| CN118525031A (zh) | 用于治疗亨廷顿氏病的组合物和方法 | |
| HK40114489A (zh) | 用於治疗亨廷顿氏病的组合物和方法 | |
| TW201400501A (zh) | 新穎抗體及其用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22917557 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022425559 Country of ref document: AU Ref document number: 812095 Country of ref document: NZ Ref document number: AU2022425559 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 313901 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024539560 Country of ref document: JP Ref document number: 202280086909.6 Country of ref document: CN Ref document number: MX/A/2024/008273 Country of ref document: MX Ref document number: 3242780 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 20247023399 Country of ref document: KR Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022917557 Country of ref document: EP Effective date: 20240730 |
|
| WWP | Wipo information: published in national office |
Ref document number: 18725580 Country of ref document: US |