WO2023114953A2 - Novel crispr enzymes, methods, systems and uses thereof - Google Patents
Novel crispr enzymes, methods, systems and uses thereof Download PDFInfo
- Publication number
- WO2023114953A2 WO2023114953A2 PCT/US2022/081728 US2022081728W WO2023114953A2 WO 2023114953 A2 WO2023114953 A2 WO 2023114953A2 US 2022081728 W US2022081728 W US 2022081728W WO 2023114953 A2 WO2023114953 A2 WO 2023114953A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- sequence
- cas9
- seq
- protein
- nucleic acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/102—Mutagenizing nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/78—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y305/00—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
- C12Y305/04—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in cyclic amidines (3.5.4)
- C12Y305/04004—Adenosine deaminase (3.5.4.4)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/111—General methods applicable to biologically active non-coding nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/22—Vectors comprising a coding region that has been codon optimised for expression in a respective host
Definitions
- CRISPR Clustered, Regularly Interspaced Short Palindromic Repeats
- CRISPR-Cas CRISPR-associated protein
- CRISPR-Cas9 can be used to localize effector molecules to specific sites on the genome, allowing genetic and epigenetic regulation and transcriptional modulation through a variety of mechanisms.
- diverse genomes and genomic targets require a variety of tools for effective genetic engineering, and there remains a need to expand the CRISPR toolbox through the discovery and engineering of novel Cas proteins that can recognize and target diverse sequences.
- CRISPR-Cas9 systems can be used to knock out a gene or modify the expression of a gene
- certain kind of gene editing requires precise modifications to the target gene, such as editing a single base within the gene.
- precise modifications remain a challenge and requires a diverse gene editing toolkit to effectuate precise genomic modifications in a wide variety of target genes.
- PAM protospacer adjacent motifs
- the present invention provides, among other things, engineered, non-naturally occurring novel Cas9 enzymes isolated from Streptococcus equinus ATCC 33317, Enterococcus hirae strain F1129E, Streptococcus equinus strain AG46, Staphylococcus simulans strain 19, Streptococcus intermedius B196 strain G1552, Streptococcus sanguinis SK330, Streptococcus sp. C150, Streptococcus oralis subsp.
- the present invention is based, in part, on the surprising discovery that novel Cas9 enzymes discovered from different bacteria, which recognize specific PAM sequences can be engineered for expression in eukaryotic cells (e.g., human, plant, etc.). Accordingly, the described Cas9 enzymes and their variants are functional in eukaryotes.
- Cas9 engineered from Streptococcus equinus ATCC 33317 recognizes the consensus PAM sequence 5’-NRGNR-3’
- Enterococcus hirae strain F1129E recognizes the consensus PAM sequence 5’-NRG-3’
- Streptococcus equinus strain AG46 recognizes the consensus PAM sequence 5’-NRG-3’
- Streptococcus equinus strain AG46 recognizes the consensus PAM sequence 5’-NNGR-3’
- Staphylococcus simulans strain 19 recognizes the consensus PAM sequence 5’- NNGRRT-3’
- Streptococcus intermedius B196 strain G1552 recognizes the consensus PAM sequence 5’-NNAAAA-3’
- Streptococcus sanguinis SK330 recognizes the consensus PAM sequence 5’-NGGNG-3’
- Streptococcus SK330 recognizes the consensus PAM sequence 5’-NGGNG-3’
- Streptococcus SK330 recognizes
- an engineered, non-naturally occurring Cas9 protein modified from Streptococcus equinus ATCC 33317 Cas9, Enterococcus hirae strain F1129E Cas9, Streptococcus equinus strain AG46 Cas9, Staphylococcus simulans strain 19 Cas9, Streptococcus intermedius B196 strain G1552, Streptococcus sanguinis SK330 Cas9, Streptococcus sp. C150 Cas9, Streptococcus oralis subsp.
- the Streptococcus equinus ATCC 33317 Cas9 protein has at least 80% sequence identity to MEKSYSIGLDIGTNSVGWSVITDDYKVPAKKMRVLGNTDKKYIKKNLLGALLFDSGETAEAT RLKRTARRRYTRRKNRLRYLQEIFAKEMAKVDESFFQRLDESFLTDDDKTFDSHPIFGNKAE EDAYHQKFPTIYHLRKHLADSQEKADLRLIYLALAHMIKFRGHFLYDNFNDDNFDWRNIDIQ KRYEEFIETYDSTLGESYLADISVDAASILEEKVSKTERLENLLKYYPTEKKTTFFGNLIKL ILGQQAKFKAIFNLEDEISLQFATPTYDEDLEELLGKIDNGDSYSELFVAAQNLYNTILLAS FLKTDNKSAKAPLSTSMIERYENHKKDLAKLKDFVKKNCPDQYHDIFRDKSKNGYAGYIDNG VSQNDFYTFIGKCLEES
- C150 Cas9 protein has at least 80% sequence identity to MSDLVLGLDIGIGSVGVGILNKVTGEIIHKNSRIFPAAQAENNLERRTNRQGRRLTRRKKHR RVRLNHLFEESGLITDFTKVSINLNPYQLRVKGLTAELSNEELFIALKNMVKHRGISYLDDA SDDGNSSVGDYAQIVKENSKQLETKTPGQIQLERYQKYGQLRGDFTVEEDGRKHRLINVFPT SAYHAEALRILQTQQEFNPQITDEFINSYLEILTGKRKYYHGPGNEKSRTDYGKYTTKKDAQ GQYITLNNIFGILIGKCTFYPEEYRAAKASYTAQEFNLLNDLNNLTVPTETKKLSEEQKYQI ITYVKNEKAMGPAKLFKYIAKLLSCDVADIKGYRIDKSDKAEIHTFEAYRKMKTLETLDVKK MAREELDKLAYVLTLNTEREGIQEALDHEFAD
- the Cas9 protein further comprises a nuclear localization sequence (NLS) and/or a FLAG, HIS or HA tag.
- the Streptococcus equinus ATCC 33317 Cas9 (Seq2Cas9) has an amino acid sequence at least 80% identical to MPKKKRKVGTMEKSYSIGLAIGTNSVGWSVITDDYKVPAKKMRVLGNTDKKYIKKNLLGALL FDSGETAEATRLKRTARRRYTRRKNRLRYLQEIFAKEMAKVDESFFQRLDESFLTDDDKTFD SHPIFGNKAEEDAYHQKFPTIYHLRKHLADSQEKADLRLIYLALAHMIKFRGHFLYDNFNDD NFDWRNIDIQKRYEEFIETYDSTLGESYLADISVDAASILEEKVSKTERLENLLKYYPTEKK TTFFGNLIKLILGQQAKFKAIFNLEDEISLQFATPTYDEDLEELLGKIDN
- C150 Cas9 has an amino acid sequence at least 80% identical to MPKKKRKVGTMSDLVLGLAIGIGSVGVGILNKVTGEIIHKNSRIFPAAQAENNLERRTNRQG RRLTRRKKHRRVRLNHLFEESGLITDFTKVSINLNPYQLRVKGLTAELSNEELFIALKNMVK HRGISYLDDASDDGNSSVGDYAQIVKENSKQLETKTPGQIQLERYQKYGQLRGDFTVEEDGR KHRLINVFPTSAYHAEALRILQTQQEFNPQITDEFINSYLEILTGKRKYYHGPGNEKSRTDY GKYTTKKDAQGQYITLNNIFGILIGKCTFYPEEYRAAKASYTAQEFNLLNDLNNLTVPTETK KLSEEQKYQIITYVKNEKAMGPAKLFKYIAKLLSCDVADIKGYRIDKSDKAEIHTFEAYRKM KTLETLDVKKMAREELDKLAYVLTL
- the mutation is an amino acid substitution.
- the Cas9 protein has nickase activity.
- the at least one mutation results in an inactive Cas9 (dCas9).
- the Cas9 protein comprises at least one amino acid mutation in PAM Interacting, HNH and/or RuvC domain.
- the Cas9 protein further comprises a nuclear localization sequence (NLS) and/or a FLAG, HIS or HA tag.
- an engineered, non-naturally occurring Cas9 fusion protein comprising a Cas9 protein having at least 80% identity to SEQ ID NOs: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 and wherein the Cas9 protein is fused to a histone demethylase, a transcriptional activator, or to a deaminase.
- the Cas9 protein is fused to a cytosine deaminase or to an adenosine deaminase.
- the Cas9 protein is fused to an adenosine deaminase and has an amino acid sequence at least 80% identical to (a) MPAAKRVKLDGSEVEFSHEYWMRHALTLAKRARDEREVPVGAVLVLNNRVIGEGWNRAIGLH DPTAHAEIMALRQGGLVMQNYRLYDATLYVTFEPCVMCAGAMIHSRIGRVVFGVRNAKTGAA GSLMDVLHHPGMNHRVEITEGILADECAALLCRFFRMPRRVFNAQKKAQSSTDGSSGSETPG TSESATPESSGPKKKRKVGTMEKSYSIGLAIGTNSVGWSVITDDYKVPAKKMRVLGNTDKKY IKKNLLGALLFDSGETAEATRLKRTARRRYTRRKNRLRYLQEIFAKEMAKVDESFFQRLDES FLTDDDKTFDSHPIFGNKAEEDAYHQKFPTIYHLRKHLADSQEKADLRLIYLALAHMIKFRG
- the Cas9 protein is fused to a cytosine deaminase.
- the Streptococcus equinus ATCC 33317 Cas9 protein recognizes a PAM consensus sequence comprising 5’-NRGNR-3’.
- the Enterococcus hirae strain F1129E recognizes a PAM consensus sequence comprising 5’-NRG-3’
- the Streptococcus equinus strain AG46 recognizes a PAM consensus sequence comprising 5’-NNGR-3’.
- the Staphylococcus warneri strain 691 recognizes a PAM consensus sequence comprising 5’-NNGR-3’.
- the Staphylococcus sciuri strain SNUC 2430 recognizes a PAM consensus sequence comprising 5’-NNGR-3’.
- the Staphylococcus simulans strain 19 recognizes a PAM consensus sequence comprising 5’-NNGRRT-3’.
- the Streptococcus intermedius B196 strain G1552 recognizes a consensus PAM sequence comprising 5’-NNAAAA-3’.
- the Streptococcus sanguinis SK330 recognizes a consensus PAM sequence comprising 5’-NGGNG-3’.
- the Streptococcus sp. C150 recognizes a consensus PAM sequence comprising 5’-NNGNRG-3’.
- the Streptococcus oralis subsp. oralis strain RH_1735_08 recognizes a consensus PAM sequence comprising 5’-NNAAAC-3’.
- the Streptococcus oralis SK313 recognizes a consensus PAM sequence comprising 5’-NNRAAG-3’.
- the Streptococcus gallolyticus strain AM24-4 recognizes a consensus PAM sequence comprising 5’-NNAYAA-3’.
- the Lactobacillus kullabergensis strain Biut2 recognizes a consensus PAM sequence comprising 5’-NNGAAA-3’.
- a nucleic acid encoding the Cas9 protein is provided.
- the nucleic acid is codon-optimized for expression in mammalian cells.
- the nucleic acid is codon-optimized for expression in human cells.
- a eukaryotic cell comprising the Cas9 protein is provided.
- the cell is a human cell.
- the cell is a plant cell.
- a method of cleaving a target nucleic acid in a eukaryotic cell comprising: contacting the cell with a Cas9 as described herein, and an RNA guide or a nucleic acid encoding the RNA guide, wherein the RNA guide comprises a direct repeat sequence and a spacer sequence capable of hybridizing to the target nucleic acid, and wherein the Cas9 protein is capable of binding to the RNA guide and of causing a break in the target nucleic acid sequence complementary to the RNA guide.
- a method of altering expression of a target nucleic acid in a eukaryotic cell comprising: contacting the cell with a Cas9 as described herein, and an RNA guide or a nucleic acid encoding the RNA guide, wherein the RNA guide comprises a direct repeat sequence and a spacer sequence capable of hybridizing to the target nucleic acid, and wherein the Cas9 protein is capable of binding to the RNA guide and of causing a break in the target nucleic acid sequence complementary to the RNA guide.
- a method of altering expression of a target nucleic acid in a eukaryotic cell comprising: contacting the cell with a Cas9 as described herein, and an RNA guide or a nucleic acid encoding the RNA guide, wherein the RNA guide comprises a direct repeat sequence and a spacer sequence capable of hybridizing to the target nucleic acid, and wherein the Cas9 protein is capable of binding to the RNA guide and editing the target nucleic acid sequence complementary to the RNA guide.
- a method of modifying a target nucleic acid in a eukaryotic cell comprising: contacting the cell with a Cas9 as described herein, and an RNA guide or a nucleic acid encoding the RNA guide, wherein the RNA guide comprises a direct repeat sequence and a spacer sequence capable of hybridizing to the target nucleic acid, and wherein the Cas9 protein is capable of binding to the RNA guide and editing the target nucleic acid sequence complementary to the RNA guide.
- the Cas9 protein is an inactive Cas9 (dCas9).
- the dCas9 is fused to a deaminase.
- the RNA guide comprises a crRNA and a tracrRNA. In some embodiments, the RNA guide comprises a sgRNA. In some embodiments, the sgRNA for use with Seq2Cas9 comprises a scaffold comprising a sequence having at least 80% identity to 5’- GUUUUAGUACUCUGUAAUUUUGAAAAAAAUUACAGAAUCUACUAAAACAAGGC AAAAUGCCGUGUUUAUCUCGUCAACUUGUUGACGAGAUUUUUUU-3’ (SEQ ID NO: 43).
- the sgRNA for use with EhiCas9 comprises a scaffold comprising a sequence having at least 80% identity to 5’- GUUUUAGAGCUAUGUUGGAAACAACAUAGCGAGUUAAAAUAAGGCAUUGUCCG UUAUCAGCUUUUAAAGCAAGCACUGUCUCGGUGCUUUUU-3’ (SEQ ID NO: 44).
- the sgRNA for use with SeqCas9 comprises a scaffold comprising a sequence having at least 80% identity to 5’- GUUUUUGUACUCUCAAGAUUUGAAAAAAUCUUGCAGAGCCUACAAAGAUAAGG CUUCAUGCCGAAUUCAAGCACCCCAUGUUUACAUGGGGUGCUUUU-3’ (SEQ ID NO: 45).
- the sgRNA for use with SsiCas9 comprises a scaffold comprising a sequence having at least 80% identity to 5’- GUUUUAGUACUCUGUAAUUUUGAAAAAAAUUACAGAAUCUACUAAAACAAGGC AAAAUGCCGUGUUUAUCUCGUCAACUUGUUUGGCGAGAUUUUUUU-3’ (SEQ ID NO: 46).
- the sgRNA for use with SinCas9 comprises a scaffold comprising a sequence having at least 80% identity to 5’- GUUUUUGUACUCUCAAGAUUUGAAAAAAUCUUGCAGAAGCUACAAAGAUAAGG CUUCAUGCCGAAAUCAACACCCUGUCUAUGACGGGGUGUUUU-3’ (SEQ ID NO: 47).
- the sgRNA for use with SsaCas9 comprises a scaffold comprising a sequence having at least 80% identity to 5’- GUUUUAGAGCUGUGUUGUGAAAACAACACAGCAAGUUAAAAUAAGGCUUUGUC CGUACACAACUUGAAAAAGUGCGCACCGAUUCGGUGCUUUUU-3’ (SEQ ID NO: 48).
- the sgRNA for use with Ssc2Cas9 comprises a scaffold comprising a sequence having at least 80% identity to 5’- GUUUUUGUACUCUCAAGAUUUGAAAAAAUCUUGCAGAAGCUACAAAGAUAAGG CUUCAUGCCGAAAUCAACACCCUGUCAUUUUAUGGCAGGGUGUUUU-3’ (SEQ ID NO: 49).
- the sgRNA for use with Sor2Cas9 comprises a scaffold comprising a sequence having at least 80% identity to 5’- GUUUUUGUACUCUCAAGAUUUGAAAAAAUCUUGCAGAAGCUACAAAGAUAAGG CUUCAUGCCGAAUUCAACACCCUGUCAUUUAUGGCGGGGUGUUUU-3’ (SEQ ID NO: 50).
- the sgRNA for use with SorCas9 comprises a scaffold comprising a sequence having at least 80% identity to 5’- GUUUUUGUACUCUCAAGAUUUGAAAAAAUCUUGUAGAAGCUACAAAGAUAAGG CUUCAUGCCGAAUUCAACACCCUGUCAUUUAUGGCGGGGUGUUUCGUUUU-3’ (SEQ ID NO: 51).
- the sgRNA for use with SwaCas9 comprises a scaffold comprising a sequence having at least 80% identity to 5’- GUUUUAGUACUCUGUAAUUUUGAAAAAAAUUACAGAAUCUACUGAAACAAGAC UAUAUGUCGUGUUUAUCCCACUAAUUUAUUAGUGGGAUUUUU-3’ (SEQ ID NO: 52).
- the sgRNA for use with SscCas9 comprises a scaffold comprising a sequence having at least 80% identity to 5’- GUUUUAGUACUCUGUAAUUUUGAAAAAAAUUACAGAAUCUACUAAAACAAGGC AAAAUGCCGUGUUUAUCUCGUCAACUUGUUGACGAGAUUUUUU-3’ (SEQ ID NO: 53).
- the sgRNA for use with SgaCas9 comprises a scaffold comprising a sequence having at least 80% identity to 5’- 5’- GUUUUUGUACUCUCAAGAUUUGAAAAAAUCUUGCUGAGCCUACAAAGAUAAGG CUUUAUGCCGAAUUCAAGCACCCCAUGUUUUGACAUGGGGUGCUUUU-3’ (SEQ ID NO: 54).
- the sgRNA for use with LkuCas9 comprises a scaffold comprising a sequence having at least 80% identity to 5’- 5’- GUUUUAGAUGAUUGUUAGAUCGAAAGAUCUAACAACCAGAUUUUAAAAUCAAA CAAUGUAUCUUUGAUACUAAGUUUCAACGCGGUAUUAUUACCGUCCUGCCUCA GCUCUAUAGCGGAGGUUUUU-3’ (SEQ ID NO: 55).
- the sgRNA for use with SsuCas9 comprises a scaffold comprising a sequence having at least 80% identity to 5’- 5’- GUUUUUGUACUCUCAAGAUUUGAAAAAAUCUUGCAGAGCCUACAAAGAUAAGG CUUUAUGCCGAAAUCAAGCACCCCGUUUCGUACGGGGUGCUUUU -3’ (SEQ ID NO: 56).
- SEQ ID NOs 43 - 56 Direct repeat (italics and underlined), tetraloop (italics), tracrRNA (underlined)
- the crRNA comprises a guide sequence of between about 16 and 26 nucleotides long.
- the crRNA comprises a guide sequence between 18 and 24 nucleotides long.
- the break in the target nucleic acid is a single-stranded or double-stranded break.
- the break in the target nucleic acid is a single-stranded break.
- the Cas9 protein is a nuclease that cleaves both strands of the target nucleic acid sequence.
- the Cas9 is a nickase that cleaves one strand of the target nucleic acid sequence.
- the target nucleic acid is 5’ to a protospacer adjacent motif (PAM) sequence.
- PAM protospacer adjacent motif
- the Cas9 is operably linked to a promoter sequence for expression in a eukaryotic cell, and wherein the guide RNA is operably linked to a promoter sequence for expression in a eukaryotic cell.
- the eukaryotic cell is a human cell.
- the promoter sequence is a eukaryotic or viral promoter.
- an engineered, non-naturally occurring CRISPR-Cas system comprising: an RNA guide or a nucleic acid encoding the RNA guide, wherein the RNA guide comprises a direct repeat sequence and a spacer sequence capable of hybridizing to a target nucleic acid; and a codon-optimized CRISPR-associated (Cas) protein having at least 80% sequence identity to SEQ ID NOs: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14, and wherein the Cas protein is capable of binding to the RNA guide and of causing a break in the target nucleic acid sequence complementary to the RNA guide.
- a codon-optimized CRISPR-associated (Cas) protein having at least 80% sequence identity to SEQ ID NOs: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14, and wherein the Cas protein is capable of binding to the RNA guide and of causing a break in the target nucleic acid sequence complementary to the RNA guide.
- an engineered, non-naturally occurring CRISPR-Cas system comprising: an RNA guide or a nucleic acid encoding the RNA guide, wherein the RNA guide comprises a direct repeat sequence and a spacer sequence capable of hybridizing to a target nucleic acid; and a codon-optimized CRISPR-associated (Cas) protein having at least 80% sequence identity to SEQ ID NOs: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14; wherein the Cas protein is fused to a deaminase, and wherein the Cas protein fusion is capable of binding to the RNA guide and of editing the target nucleic acid sequence complementary to the RNA guide.
- a codon-optimized CRISPR-associated (Cas) protein having at least 80% sequence identity to SEQ ID NOs: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14; wherein the Cas protein is fused to a deaminase, and wherein the Cas protein fusion is
- the Cas9 protein is an inactive Cas9 (dCas9).
- the RNA guide comprises a crRNA and a tracrRNA.
- the RNA guide comprises an sgRNA.
- the Cas protein is operably linked to a promoter sequence for expression in a eukaryotic cell, and wherein the guide RNA is operably linked to a promoter sequence for expression in a eukaryotic cell.
- the eukaryotic cell is a human cell.
- the promoter sequence is a eukaryotic promoter sequence.
- a nucleic acid encoding the system described herein is provided.
- a vector comprising the system described herein.
- the vector is a plasmid vector or a viral vector.
- the viral vector is an adeno associated virus (AAV) vector or a lentiviral vector.
- the viral vector is an AAV vector. In one embodiment, more than one AAV vector is used for packaging the system.
- AAV adeno associated virus
- a method of treating a disorder or a disease in a subject in need thereof comprises administering to the subject the system described herein, wherein the guide RNA is complementary to at least 10 nucleotides of a target nucleic acid associated with the condition or disease; wherein the Cas protein associates with the guide RNA; wherein the guide RNA binds to the target nucleic acid; wherein the Cas protein causes a break in the target nucleic acid, optionally wherein the Cas9 is an inactive Cas9 (dCas9) fused to a deaminase and results in one or more base edits in the target nucleic acid, thereby treating the disorder or disease.
- the guide RNA is complementary to at least 10 nucleotides of a target nucleic acid associated with the condition or disease
- the Cas protein associates with the guide RNA
- the guide RNA binds to the target nucleic acid
- the Cas protein causes a break in the target nucleic acid
- the Cas9 is an
- the guide RNA is complementary to about 18-24 nucleotides. In some embodiments, the guide RNA is complementary to 20 nucleotides.
- the base editor comprises a fusion protein. In some embodiments, the base editor comprises an adenosine deaminase domain or a cytidine deaminase domain.
- a method of editing a nucleobase of a polynucleotide comprising contacting the polynucleotide with a base in complex with one or more guide RNAs, wherein the base editor comprises an adenosine deaminase domain, and wherein the one or more guide RNAs target the base editor to effect an A•T to G•C alteration in the polynucleotide.
- a method of editing a nucleobase of a polynucleotide comprising contacting the polynucleotide with a base editor in complex with one or more guide RNAs, wherein the base editor comprises a cytidine deaminase domain, and wherein the one or more guide RNAs target the base editor to effect a C•G to T•A alteration in the polynucleotide.
- the editing results in less than 50 % indel formation in the target polynucleotide sequence.
- the editing generates a point mutation.
- a or An The articles “a” and “an” are used herein to refer to one or to more than one (i.e., to at least one) of the grammatical object of the article.
- an element means one element or more than one element.
- Approximately or about As used herein, the term “approximately” or “about,” as applied to one or more values of interest, refers to a value that is similar to a stated reference value.
- the term “approximately” or “about” refers to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
- Two events or entities are “associated” with one another, as that term is used herein, if the presence, level and/or form of one is correlated with that of the other.
- a particular entity e.g., polypeptide
- a particular disease, disorder, or condition if its presence, level and/or form correlates with incidence of and/or susceptibility to the disease, disorder, or condition (e.g., across a relevant population).
- two or more entities are physically “associated” with one another if they interact, directly or indirectly, so that they are and remain in physical proximity with one another.
- two or more entities that are physically associated with one another are covalently linked to one another; in some embodiments, two or more entities that are physically associated with one another are not covalently linked to one another but are non-covalently associated, for example by means of hydrogen bonds, van der Waals interaction, hydrophobic interactions, magnetism, and combinations thereof.
- Base Editor By “base editor (BE),” or “nucleobase editor (NBE)” is meant an agent that binds a polynucleotide and has nucleobase modifying activity.
- the base editor comprises a nucleobase modifying polypeptide (e.g., a deaminase) and a polynucleotide programmable nucleotide binding domain in conjunction with a guide polynucleotide (e.g., guide RNA).
- the agent is a biomolecular complex comprising a protein domain having base editing activity, i.e., a domain capable of modifying a base (e.g., A, T, C, G, or U) within a nucleic acid molecule (e.g., DNA).
- the polynucleotide programmable DNA binding domain is fused or linked to a deaminase domain.
- the agent is a fusion protein comprising one or more domains having base editing activity.
- the protein domains having base editing activity are linked to the guide RNA (e.g., via an RNA binding motif on the guide RNA and an RNA binding domain fused to the deaminase).
- the domains having base editing activity are capable of deaminating a base within a nucleic acid molecule.
- the base editor is capable of deaminating one or more bases within a DNA molecule.
- the base editor is capable of deaminating a cytosine (C) or an adenosine (A) within DNA.
- the base editor is capable of deaminating a cytosine (C) and an adenosine (A) within DNA.
- the base editor is a cytidine base editor (CBE).
- the base editor is an adenosine base editor (ABE).
- the base editor is an adenosine base editor (ABE) and a cytidine base editor (CBE).
- the base editor is a nuclease-inactive Cas9 (dCas9) fused to an adenosine deaminase.
- the base editor is fused to an inhibitor of base excision repair, for example, a UGI domain, or a dISN domain.
- the fusion protein comprises a Cas9 nickase fused to a deaminase and an inhibitor of base excision repair, such as a UGI or dISN domain.
- the base editor is an abasic base editor. Details of base editors are described in International PCT Application Nos. PCT/2017/045381 (WO2018/027078) and PCT/US2016/058344 (WO2017/070632), each of which is incorporated herein by reference for its entirety.
- Base editing activity is meant acting to chemically alter a base within a polynucleotide.
- a first base is converted to a second base.
- the base editing activity is cytidine deaminase activity, e.g., converting target C•G to T•A.
- the base editing activity is adenosine or adenine deaminase activity, e.g., converting A•T to G•C.
- the base editing activity is cytosine or cytidine deaminase activity, e.g., converting target C•G to T•A and adenosine or adenine deaminase activity, e.g., converting A•T to G•C.
- Base Editor System refers to a system for editing a nucleobase of a target nucleotide sequence.
- the base editor (BE) system comprises (1) a polynucleotide programmable nucleotide binding domain (e.g., Cas9), a deaminase domain and a cytidine deaminase domain for deaminating nucleobases in the target nucleotide sequence; and (2) one or more guide polynucleotides (e.g., guide RNA) in conjunction with the polynucleotide programmable nucleotide binding domain.
- a polynucleotide programmable nucleotide binding domain e.g., Cas9
- a deaminase domain e.g., Cas9
- a cytidine deaminase domain for deaminating nucleobases in the target nucleotide sequence
- guide polynucleotides e.g., guide RNA
- the base editor (BE) system comprises a nucleobase editor domains selected from an adenosine deaminase or a cytidine deaminase, and a domain having nucleic acid sequence specific binding activity.
- the base editor system comprises (1) a base editor (BE) comprising a polynucleotide programmable DNA binding domain and a deaminase domain for deaminating one or more nucleobases in a target nucleotide sequence; and (2) one or more guide RNAs in conjunction with the polynucleotide programmable DNA binding domain.
- the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable DNA binding domain.
- the base editor is a cytidine base editor (CBE). In some embodiments, the base editor is an adenine or adenosine base editor (ABE). In some embodiments, the base editor is an adenine or adenosine base editor (ABE) or a cytidine base editor (CBE).
- a polynucleotide programmable nucleotide binding domain can target a deaminase domain to a target nucleotide sequence by non-covalently interacting with or associating with the deaminase domain.
- the nucleobase editing component e.g., the deaminase component can comprise an additional heterologous portion or domain that is capable of interacting with, associating with, or capable of forming a complex with an additional heterologous portion or domain that is part of a polynucleotide programmable nucleotide binding domain.
- the additional heterologous portion may be capable of binding to, interacting with, associating with, or forming a complex with a polypeptide. In some embodiments, the additional heterologous portion may be capable of binding to, interacting with, associating with, or forming a complex with a polynucleotide. In some embodiments, the additional heterologous portion may be capable of binding to a guide polynucleotide. In some embodiments, the additional heterologous portion may be capable of binding to a polypeptide linker. In some embodiments, the additional heterologous portion may be capable of binding to a polynucleotide linker. The additional heterologous portion may be a protein domain.
- the additional heterologous portion may be a K Homology (KH) domain, a MS2 coat protein domain, a PP7 coat protein domain, a SfMu Com coat protein domain, a steril alpha motif, a telomerase Ku binding motif and Ku protein, a telomerase Sm7 binding motif and Sm7 protein, or an RNA recognition motif.
- Biologically active refers to a characteristic of any agent that has activity in a biological system, and particularly in an organism. For instance, an agent that, when administered to an organism, has a biological effect on that organism, is considered to be biologically active.
- cleavage refers to a break in a target nucleic acid created by a nuclease of a CRISPR system described herein.
- the cleavage event is a double-stranded DNA break.
- the cleavage event is a single- stranded DNA break.
- the cleavage event is a single-stranded RNA break.
- the cleavage event is a double-stranded RNA break.
- CRISPR-Cas9 Clustered Interspaced Short Palindromic Repeat (CRISPR)-associated (Cas) system: As used herein, CRISPR-Cas9 system refers to nucleic acids and/or proteins involved in the expression of, or directing the activity of, CRISPR-effectors, including sequences encoding CRISPR effectors, RNA guides, and other sequences and transcripts from a CRISPR locus.
- the CRISPR system is an engineered, non-naturally occurring CRISPR system.
- the components of a CRISPR system may include a nucleic acid(s) (e.g., a vector) encoding one or more components of the system, a component(s) in protein form, or a combination thereof.
- CRISPR Array refers to the nucleic acid (e.g., DNA) segment that includes CRISPR repeats and spacers, starting with the first nucleotide of the first CRISPR repeat and ending with the last nucleotide of the last (terminal) CRISPR repeat.
- CRISPR repeat or CRISPR direct repeat,” or “direct repeat,” as used herein, refer to multiple short direct repeating sequences, which show very little or no sequence variation within a CRISPR array.
- CRISPR-associated protein CRISPR-associated protein (Cas): The term “CRISPR-associated protein,” “CRISPR effector,” “effector,” or “CRISPR enzyme” as used herein refers to a protein that carries out an enzymatic activity or that binds to a target site on a nucleic acid specified by a RNA guide.
- a CRISPR effector has endonuclease activity, nickase activity, exonuclease activity, transposase activity, and/or excision activity. It should be appreciated that any of the Cas9 proteins provided herein include naturally occurring Cas9 proteins and non-naturally occurring variants thereof.
- crRNA The term "CRISPR RNA" or "crRNA,” as used herein, refers to a RNA molecule including a guide sequence used by a CRISPR effector to target a specific nucleic acid sequence. Typically, crRNAs contains a sequence that mediates target recognition and a sequence that forms a duplex with a tracrRNA.
- the crRNA: tracrRNA duplex binds to a CRISPR effector.
- ex vivo refers to events that occur in cells or tissues, grown outside rather than within a multi-cellular organism.
- Functional equivalent or analog As used herein, the term “functional equivalent” or “functional analog” denotes, in the context of a functional derivative of an amino acid sequence, a molecule that retains a biological activity (either function or structural) that is substantially similar to that of the original sequence.
- a functional derivative or equivalent may be a natural derivative or is prepared synthetically.
- Exemplary functional derivatives include amino acid sequences having substitutions, deletions, or additions of one or more amino acids, provided that the biological activity of the protein is conserved.
- the substituting amino acid desirably has chemico-physical properties which are similar to that of the substituted amino acid. Desirable similar chemico-physical properties include, similarities in charge, bulkiness, hydrophobicity, hydrophilicity, and the like.
- Half-Life As used herein, the term “half-life” is the time required for a quantity such as protein concentration or activity to fall to half of its value as measured at the beginning of a time period.
- the terms “improve,” “increase” or “reduce,” or grammatical equivalents, indicate values that are relative to a baseline measurement, such as a measurement in the same individual prior to initiation of the treatment described herein, or a measurement in a control subject (or multiple control subject) in the absence of the treatment described herein.
- a “control subject” is a subject afflicted with the same form of disease as the subject being treated, who is about the same age as the subject being treated.
- Inhibition As used herein, the terms “inhibition,” “inhibit” and “inhibiting” refer to processes or methods of decreasing or reducing activity and/or expression of a protein or a gene of interest.
- inhibiting a protein or a gene refers to reducing expression or a relevant activity of the protein or gene by at least 10% or more, for example, 20%, 30%, 40%, or 50%, 60%, 70%, 80%, 90% or more, or a decrease in expression or the relevant activity of greater than 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 50-fold, 100-fold or more as measured by one or more methods described herein or recognized in the art.
- Hybridization refers to a reaction in which two or more nucleic acids bind with each other via hydrogen bonding by Watson-Crick pairing, Hoogstein binding or other sequence-specific binding between the bases of the two nucleic acids.
- Indel refers to insertion or deletion of bases in a nucleic acid sequence. It commonly results in mutations and is a common form of genetic variation.
- in vitro refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, etc., rather than within a multi-cellular organism.
- in vivo refers to events that occur within a multi- cellular organism, such as a human and a non-human animal.
- Linker refers to any means, entity or moiety used to join two or more entities.
- the linker is a covalent linker.
- the linker is a non-covalent linker.
- covalent linkers include covalent bonds or a linker moiety covalently attached to one or more of the proteins or domains to be linked.
- the linker is a non-covalent bond, e.g., an organometallic bond through a metal center such as platinum atom. The joining can be permanent or reversible.
- amide groups including carbonic acid derivatives, ethers, esters, including organic and inorganic esters, amino, urethane, urea and the like.
- the domains can be modified by oxidation, hydroxylation, substitution, reduction etc. to provide a site for coupling. Methods for conjugation are well known by persons skilled in the art and are encompassed for use in the present invention.
- Linker moieties include, but are not limited to, chemical linker moieties, or for example a peptide linker moiety (a linker sequence). It will be appreciated that modification which do not significantly decrease the function of the RNA-binding domain and effector domain are preferred.
- oligonucleotide As used herein, the term “mutation” has the ordinary meaning in the art, and includes, for example, point mutations, substitutions, insertions, deletions, inversions, and deletions. Oligonucleotide: As used herein, the term “oligonucleotide” generally refers to polynucleotides of between about 5 and about 100 nucleotides of single- or double-stranded DNA. Oligonucleotides are also known as “oligomers” or “oligos” and may be isolated from genes, or chemically synthesized.
- PAM The term “PAM” or “Protospacer Adjacent Motif” refers to a short nucleic acid sequence (usually 2-6 base pairs in length) that follows the nucleic acid region targeted for cleavage by the CRISPR system, such as CRISPR-Cas9. The PAM is required for a Cas nuclease to cut and is generally found 3-4 nucleotides downstream from the cut site.
- Polypeptide The term “polypeptide” as used herein refers to a sequential chain of amino acids linked together via peptide bonds.
- polypeptides may be processed and/or modified.
- the terms “polypeptide” and “peptide” are used inter-changeably.
- Prevent As used herein, the term “prevent” or “prevention”, when used in connection with the occurrence of a disease, disorder, and/or condition, refers to reducing the risk of developing the disease, disorder and/or condition.
- Protein The term “protein” as used herein refers to one or more polypeptides that function as a discrete unit.
- polypeptide and “protein” may be used interchangeably. If the discrete functional unit is comprised of more than one polypeptide that physically associate with one another, the term “protein” refers to the multiple polypeptides that are physically coupled and function together as the discrete unit.
- a “reference” entity, system, amount, set of conditions, etc. is one against which a test entity, system, amount, set of conditions, etc. is compared as described herein.
- a “reference” antibody is a control antibody that is not engineered as described herein.
- RNA guide refers to an RNA molecule that facilitates the targeting of a protein described herein to a target nucleic acid.
- exemplary "RNA guides” or “guide RNAs” include, but are not limited to, crRNAs or crRNAs in combination with cognate tracrRNAs. The latter may be independent RNAs or fused as a single RNA using a linker (sgRNAs).
- the RNA guide is engineered to include a chemical or biochemical modification, in some embodiments, an RNA guide may include one or more nucleotides.
- Subject The term “subject”, as used herein, means any subject for whom diagnosis, prognosis, or therapy is desired.
- a subject can be a mammal, e.g., a human or non-human primate (such as an ape, monkey, orangutan, or chimpanzee), a dog, cat, guinea pig, rabbit, rat, mouse, horse, cattle, or cow.
- sgRNA The term “sgRNA” or “single guide RNA” refers to a single guide RNA containing (i) a guide sequence (crRNA sequence) and (ii) a Cas9 nuclease-recruiting sequence (tracrRNA).
- Substantial identity The phrase “substantial identity” is used herein to refer to a comparison between amino acid or nucleic acid sequences.
- amino acid or nucleic acid sequences may be compared using any of a variety of algorithms, including those available in commercial computer programs such as BLASTN for nucleotide sequences and BLASTP, gapped BLAST, and PSI-BLAST for amino acid sequences. Exemplary such programs are described in Altschul, et al., Basic local alignment search tool, J. Mol.
- two sequences are considered to be substantially identical if at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more of their corresponding residues are identical over a relevant stretch of residues.
- the relevant stretch is a complete sequence.
- the relevant stretch is at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500 or more residues.
- Target nucleic acid refers to nucleotides of any length (oligonucleotides or polynucleotides) to which the CRISPR-Cas9 system binds, either deoxyribonucleotides, ribonucleotides, or analogs thereof.
- Target nucleic acids may have three-dimensional structure, may including coding or non-coding regions, may include exons, introns, mRNA, tRNA, rRNA, siRNA, shRNA, miRNA, ribozymes, cDNA, plasmids, vectors, exogenous sequences, endogenous sequences.
- a target nucleic acid can comprise modified nucleotides, include methylated nucleotides, or nucleotide analogs.
- a target nucleic acid may be interspersed with non-nucleic acid components.
- a target nucleic acid is not limited to, single-, double-, or multi-stranded DNA or RNA, genomic DNA, cDNA, DNA-RNA hybrids, or a polymer comprising purine and pyrimidine bases or other natural, chemically or biochemically modified, non-natural, or derivatized nucleotide bases.
- therapeutically effective amount refers to an amount of a therapeutic molecule (e.g., an engineered antibody described herein) which confers a therapeutic effect on a treated subject, at a reasonable benefit/risk ratio applicable to any medical treatment.
- the therapeutic effect may be objective (i.e., measurable by some test or marker) or subjective (i.e., subject gives an indication of or feels an effect).
- the “therapeutically effective amount” refers to an amount of a therapeutic molecule or composition effective to treat, ameliorate, or prevent a particular disease or condition, or to exhibit a detectable therapeutic or preventative effect, such as by ameliorating symptoms associated with the disease, preventing or delaying the onset of the disease, and/or also lessening the severity or frequency of symptoms of the disease.
- a therapeutically effective amount can be administered in a dosing regimen that may comprise multiple unit doses.
- a therapeutically effective amount and/or an appropriate unit dose within an effective dosing regimen) may vary, for example, depending on route of administration, on combination with other pharmaceutical agents.
- tracrRNA The term "tracrRNA” or “trans-activating crRNA” as used herein refers to an RNA including a sequence that forms a structure required for a CRlSPR-associated protein to bind to a specified target nucleic acid.
- treatment refers to any administration of a therapeutic molecule (e.g., a CRISPR-Cas therapeutic protein or system described herein) that partially or completely alleviates, ameliorates, relieves, inhibits, delays onset of, reduces severity of and/or reduces incidence of one or more symptoms or features of a particular disease, disorder, and/or condition.
- a therapeutic molecule e.g., a CRISPR-Cas therapeutic protein or system described herein
- Such treatment may be of a subject who does not exhibit signs of the relevant disease, disorder and/or condition and/or of a subject who exhibits only early signs of the disease, disorder, and/or condition.
- such treatment may be of a subject who exhibits one or more established signs of the relevant disease, disorder and/or condition.
- FIG.1A is a graph that shows a consensus PAM motif recognized by human codon- optimized Streptococcus equinus ATCC 33317 Cas9.
- FIG.1B is a graph that shows a consensus PAM motif recognized by human codon-optimized Enterococcus hirae strain F1129E Cas9.
- FIG.1C is a graph that shows a consensus PAM motif recognized by human codon-optimized Streptococcus equinus strain AG46 Cas9.
- FIG.1D is a graph that shows a consensus PAM motif recognized by human codon-optimized Staphylococcus simulans strain 19.
- FIG.1E is a graph that shows a consensus PAM motif recognized by human codon-optimized Streptococcus intermedius B196 strain G1552.
- FIG.1F is a graph that shows a consensus PAM motif recognized by human codon-optimized Streptococcus sanguinis SK330.
- FIG.1G is a graph that shows a consensus PAM motif recognized by human codon-optimized Streptococcus sp. C150.
- FIG.1H is a graph that shows a consensus PAM motif recognized by human codon-optimized Streptococcus oralis subsp. oralis strain RH_1735_08.
- FIG.1I is a graph that shows a consensus PAM motif recognized by Streptococcus oralis SK313.
- FIG.1J is a graph that shows a consensus PAM motif recognized by Staphylococcus warneri strain 691.
- FIG.1K is a graph that shows a consensus PAM motif recognized by Staphylococcus sciuri strain SNUC 2430.
- FIG.1L is a graph that shows a consensus PAM motif recognized by Streptococcus gallolyticus strain AM24-4.
- FIG. 1M is a graph that shows a consensus PAM motif recognized by Lactobacillus kullabergensis strain Biut2.
- FIG.2A is a schematic that shows predicted RNA folding structure of sgRNA for human codon-optimized Streptococcus equinus ATCC 33317 (Seq2Cas9) using Geneious software.
- FIG.2A depicts sgRNA comprising SEQ ID NO:198.
- FIG.2B is a schematic that shows predicted RNA folding structure of sgRNA for human codon-optimized Enterococcus hirae strain F1129E Cas9 (EhiCas9) using Geneious software.
- FIG.2B depicts sgRNA comprising SEQ ID NO: 44.
- FIG.2C is a schematic that shows predicted RNA folding structure of sgRNA for human codon-optimized Streptococcus equinus strain AG46 Cas9 (SeqCas9) using Geneious software.
- FIG.2C depicts sgRNA comprising SEQ ID NO: 46.
- FIG.2D is a schematic that shows predicted RNA folding structure of sgRNA for human codon-optimized Staphylococcus simulans strain 19 (SsiCas9) using Geneious software.
- FIG. 2D depicts sgRNA comprising SEQ ID NO: 45.
- FIG.2E is a schematic that shows predicted RNA folding structure of sgRNA for human codon-optimized Streptococcus intermedius B196 strain G1552 (SinCas9) using Geneious software.
- FIG.2E depicts sgRNA comprising SEQ ID NO: 47.
- FIG.2F is a schematic that shows predicted RNA folding structure of sgRNA for human codon-optimized Streptococcus sanguinis SK330 (SsaCas9) using Geneious software.
- FIG.2F depicts sgRNA comprising SEQ ID NO: 48.
- FIG.2G is a schematic that shows predicted RNA folding structure of sgRNA for human codon-optimized Streptococcus sp.
- FIG.2G depicts sgRNA comprising SEQ ID NO: 49.
- FIG.2H is a schematic that shows predicted RNA folding structure of sgRNA for human codon-optimized Streptococcus oralis subsp. oralis strain RH_1735_08 (Sor2Cas9) using Geneious software.
- FIG.2H depicts sgRNA comprising SEQ ID NO: 50.
- FIG.2I is a schematic that shows predicted RNA folding structure of sgRNA for human codon-optimized Streptococcus oralis SK313 (SorCas9) using Geneious software.
- FIG.2I depicts sgRNA comprising SEQ ID NO: 51.
- FIG.2J is a schematic that shows predicted RNA folding structure of sgRNA for human codon-optimized Staphylococcus warneri strain 691 (SwaCas9) using Geneious software.
- FIG.2J depicts sgRNA comprising SEQ ID NO: 52.
- FIG.2K is a schematic that shows predicted RNA folding structure of sgRNA for human codon-optimized Staphylococcus sciuri strain SNUC 2430 using Geneious software.
- FIG.2K depicts sgRNA comprising SEQ ID NO: 53.
- FIG.2L is a schematic that shows predicted RNA folding structure of sgRNA for human codon-optimized Streptococcus gallolyticus strain AM24-4 (SgaCas9) using Geneious software.
- FIG.2L depicts sgRNA comprising SEQ ID NO: 54.
- FIG.2M is a schematic that shows predicted RNA folding structure of sgRNA for human codon-optimized Lactobacillus kullabergensis strain Biut2 (LkuCas9) using Geneious software.
- FIG.2M depicts sgRNA comprising SEQ ID NO: 55.
- FIG.2N is a schematic that shows predicted RNA folding structure of sgRNA for human codon-optimized Streptococcus suis strain LSS83 using Geneious software.
- FIG.2N depicts sgRNA comprising SEQ ID NO: 56.
- FIG.3A is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a Seq2Cas9 D10A mutant.
- the A-to-G conversion percentage (y-axis) is plotted for various guide RNAs targeting A-rich genomic test sites (x-axis; Table 8) adjacent to a sequence corresponding to the PAM consensus motif (see FIG.1A).
- FIG.3B is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a EhiCas9 D10A mutant.
- the A-to-G conversion percentage (y-axis) is plotted for various guide RNAs targeting A-rich genomic test sites (x-axis; Table 9) adjacent to a sequence corresponding to the PAM consensus motif (see FIG.1B).
- FIG.3C is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SeqCas9 D10A mutant.
- the A-to-G conversion percentage (y-axis) is plotted for various guide RNAs targeting A-rich genomic test sites (x-axis; Table 10) adjacent to a sequence corresponding to the PAM consensus motif (see FIG.1C).
- FIG.3D is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SsiCas9 D10A mutant.
- the A-to-G conversion percentage (y-axis) is plotted for various guide RNAs targeting A-rich genomic test sites (x-axis; Table 11) adjacent to a sequence corresponding to the PAM consensus motif (see FIG.1D).
- FIG.3E is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SinCas9 D9A mutant.
- the A-to-G conversion percentage (y-axis) is plotted for various guide RNAs targeting A-rich genomic test sites (x-axis; Table 12) adjacent to a sequence corresponding to the PAM consensus motif (see FIG.1E).
- FIG.3F is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SsaCas9 D11A mutant.
- the A-to-G conversion percentage (y-axis) is plotted for various guide RNAs targeting A-rich genomic test sites (x-axis; Table 13) adjacent to a sequence corresponding to the PAM consensus motif (see FIG.1F).
- FIG.3G is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a Ssc2Cas9 D9A mutant.
- the A-to-G conversion percentage (y-axis) is plotted for various guide RNAs targeting A-rich genomic test sites (x-axis; Table 14) adjacent to a sequence corresponding to the PAM consensus motif (see FIG.1G).
- FIG.3H is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a Sor2Cas9 D9A mutant.
- the A-to-G conversion percentage (y-axis) is plotted for various guide RNAs targeting A-rich genomic test sites (x-axis; Table 15) adjacent to a sequence corresponding to the PAM consensus motif (see FIG.1H).
- FIG.3I is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SorCas9 D9A mutant.
- the A-to-G conversion percentage (y-axis) is plotted for various guide RNAs targeting A-rich genomic test sites (x-axis; Table 16) adjacent to a sequence corresponding to the PAM consensus motif (see FIG.1I).
- FIG.3J is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SwaCas9 mutant.
- the A-to-G conversion percentage (y-axis) is plotted for various guide RNAs targeting A-rich genomic test sites (x-axis; Table 17) adjacent to a sequence corresponding to the PAM consensus motif (see FIG.1J).
- FIG.3K is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SscCas9 mutant.
- the A-to-G conversion percentage (y-axis) is plotted for various guide RNAs targeting A-rich genomic test sites (x-axis; Table 18) adjacent to a sequence corresponding to the PAM consensus motif (see FIG.1K).
- FIG.3L is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SgaCas9 mutant.
- the A-to-G conversion percentage (y-axis) is plotted for various guide RNAs targeting A-rich genomic test sites (x-axis; Table 19) adjacent to a sequence corresponding to the PAM consensus motif (see FIG.1L).
- FIG.3M is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a LkuCas9 mutant.
- the A-to-G conversion percentage (y-axis) is plotted for various guide RNAs targeting A-rich genomic test sites (x-axis; Table 20) adjacent to a sequence corresponding to the PAM consensus motif (see FIG.1M).
- FIG.3N is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SsuCas9 mutant.
- the A-to-G conversion percentage (y-axis) is plotted for various guide RNAs targeting A-rich genomic test sites (x-axis; Table 21) adjacent to a sequence corresponding to the PAM consensus motif (see FIG.1N).
- CRISPR Clustered regularly interspaced short palindromic repeats
- CRISPR-Cas systems comprise three main types (I, II, and III) based on their Cas gene organization, and the sequence and structure of component proteins.
- Each of the three CRISPR systems is characterized by a unique Cas gene: Cas3, a target-degrading nuclease/helicase in Type I; Cas9, an RNA-binding and target-degrading nuclease in type II; Cas10, a large protein for multiple functions in type III.
- the three CRISPR types also differ in their associated effector complexes.
- Type I Cas systems associate with Cascade effector complexes, type II effector complexes consist of a single Cas9 and one or more RNA molecules, and type III interference complexes are further divided into type III-A (Csm complex targeting DNA) and type III-B (Cmr complex targeting RNA). Cas proteins are important components of effector complexes in all CRISPR-Cas systems.
- CRISPR–Cas systems which contain single-protein effector nucleases for DNA cleavage, specifically, Cas9, a dual- RNA-guided nuclease which requires both CRISPR RNA (crRNA) and tracrRNA and contains both HNH and RuvC nuclease domains, and Cas12a, a single-RNA-guided nuclease which only requires crRNA and contains a single RuvC domain.
- Cas9 a dual- RNA-guided nuclease which requires both CRISPR RNA (crRNA) and tracrRNA and contains both HNH and RuvC nuclease domains
- Cas12a a single-RNA-guided nuclease which only requires crRNA and contains a single RuvC domain.
- Non-Naturally Occuring Cas9 Protein Described herein are engineered, non-naturally occurring Cas9 proteins modified from WT Cas9 obtained from Streptococcus equinus ATCC 33317 (Seq2Cas9), Enterococcus hirae strain F1129E (EhiCas9), Streptococcus equinus strain AG46 (SeqCas9), Staphylococcus simulans strain 19 (SsiCas9), Streptococcus intermedius B196 strain G1552 (SinCas9), Streptococcus sanguinis SK330 (SsaCas9), Streptococcus sp.
- WT Cas9 obtained from Streptococcus equinus ATCC 33317 (Seq2Cas9), Enterococcus hirae strain F1129E (EhiCas9), Streptococcus equinus strain
- the engineered non-naturally occurring Cas9 protein described herein comprises an amino acid sequence at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) identical to SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14.
- the Cas9 protein has is 80% identical to SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14.
- the amino acid sequence of the Cas9 protein is identical to SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14.
- Exemplary Cas9 amino acid sequences are provided in Table 1 below. Table 1: Exemplary Cas9 Amino Acid Sequences
- the Cas9 protein comprises one or more mutations in reference to SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14.
- the amino acid sequence of the Cas9 protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least 10 mutations in SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14.
- Various mutations are known in the art, and include for example, amino acid substitutions.
- two or more catalytic domains of Cas9 are mutated to produce an inactive, or “dead” Cas9 (dCas9) that lacks nucleic acid cleavage activity.
- the one or more mutations are in the PAM Interacting, HNH, and or the RuvC domains.
- Cas9 is mutated to reduce DNA cleavage activity to less than about 25%, 15%, 10%, 5%, 1%, 0.1%, 0.01% or lower with respect to its non-mutated form.
- a nickase-mutant version of Cas9 is provided.
- the nickase mutant has one or more amino acid substitutions in the RuvC and/or the HNH domains.
- Various nickase mutations are known with respect to SpCas9 (Streptococcus pyogenes) and include for example mutations at one or more of amino acid positions 10, 12, 17, 762, 840, 854, 863, 982, 983, 984, 986, 987 of wild type SpCas9.
- an aspartic acid-to-alanine substitution that corresponds to D10A in SpCas9 results in the creation of a nickase.
- the Cas9 described herein has one or more mutations that result in the creation of a nickase.
- the Cas9 described herein has one or more mutations at an amino acid position that corresponds to one or more of amino acids 10, 12, 17, 762, 840, 854, 863, 982, 983, 984, 986, 987 of SpCas9.
- the mutation is an aspartic acid-to-alanine substitution (D10A) in the RuvC domain of Seq2Cas9.
- the mutation is an aspartic acid-to-alanine substitution (D10A) in the RuvC domain of EhiCas9.
- the mutation is an aspartic acid-to-alanine substitution (D10A) in the RuvC domain of SeqCas9 (e.g., corresponding to D10A in SpCas9).
- the mutation is an aspartic acid-to-alanine substitution (D10A) in the RuvC domain of SsiCas9.
- the mutation is an aspartic acid-to-alanine substitution (D9A) in the RuvC domain of SinCas9.
- the mutation is an aspartic acid-to-alanine substitution (D11A) in the RuvC domain of SsaCas9.
- the mutation is an aspartic acid-to-alanine substitution (D9A) in the RuvC domain of Ssc2Cas9. In some embodiments, the mutation is an aspartic acid-to-alanine substitution (D9A) in the RuvC domain of Sor2Cas9. In some embodiments, the mutation is an aspartic acid-to-alanine substitution (D9A) in the RuvC domain of SorCas9. In some embodiments, the mutation is an aspartic acid-to-alanine substitution (D10A) in the RuvC domain of SwaCas9.
- the mutation is an aspartic acid-to-alanine substitution (D10A) in the RuvC domain of SscCas9. In some embodiments, the mutation is an aspartic acid-to-alanine substitution (D10A) in the RuvC domain of SgaCas9. In some embodiments, the mutation is an aspartic acid-to-alanine substitution (D13A) in the RuvC domain of LkuCas9. In some embodiments, the mutation is an aspartic acid-to-alanine substitution (D10A) in the RuvC domain of SsuCas9.
- the mutation is an aspartic acid-to-glycine substitution (D10G) in the RuvC domain of Seq2Cas9. In some embodiments, the mutation is an aspartic acid-to glycine substitution (D10G) in the RuvC domain of EhiCas9. In some embodiments, the mutation is an aspartic acid-to-glycine substitution (D10G) in the RuvC domain of SeqCas9 (e.g., corresponding to D10G in SpCas9). In some embodiments, the mutation is an aspartic acid-to-glycine substitution (D10G) in the RuvC domain of SsiCas9.
- the mutation is an aspartic acid-to-glycine substitution (D9G) in the RuvC domain of SinCas9. In some embodiments, the mutation is an aspartic acid-to-glycine substitution (D11G) in the RuvC domain of SsaCas9. In some embodiments, the mutation is an aspartic acid-to-glycine substitution (D9G) in the RuvC domain of Ssc2Cas9. In some embodiments, the mutation is an aspartic acid-to-glycine substitution (D9G) in the RuvC domain of Sor2Cas9.
- the mutation is an aspartic acid-to-glycine substitution (D9G) in the RuvC domain of SorCas9. In some embodiments, the mutation is an aspartic acid-to-glycine substitution (D10G) in the RuvC domain of SwaCas9. In some embodiments, the mutation is an aspartic acid-to-glycine substitution (D10G) in the RuvC domain of SscCas9. In some embodiments, the mutation is an aspartic acid-to-glycine substitution (D10G) in the RuvC domain of SgaCas9. In some embodiments, the mutation is an aspartic acid-to-glycine substitution (D13G) in the RuvC domain of LkuCas9.
- the mutation is an aspartic acid-to-glycine substitution (D10G) in the RuvC domain of SsuCas9.
- D10G aspartic acid-to-glycine substitution
- such one or more mutations described herein converts Cas9 to an inactive, or “dead” version of Cas9 (dCas9).
- the Cas9 protein comprises one or more mutations that inhibits the ability of Cas9 to cleave both strands of a DNA duplex.
- dead Cas9 when coexpressed with a guide RNA, dead Cas9 generates a DNA recognition complex that can specifically interfere with transcriptional elongation, RNA polymerase binding, or transcription factor binding.
- dead Cas9 is used to specifically target effector proteins of various functions to specific nucleic acid target sites.
- the engineered non-naturally occurring Cas9 is codon- optimized for human cells.
- the engineered, non-naturally occurring Cas9 is at least 80% (e.g., 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) identical to SEQ ID NO.1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14.
- Exemplary Cas9 amino acid sequences with Nuclear Localization Signal (NLS) and a linker is provided in Table 2 below. Table 2: Exemplary Cas9 Sequence with NLS and Linker
- recombinant engineered non-naturally occurring human codon-optimized Cas9 comprises a sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99% sequence identity to SEQ ID NO: 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27 or 28.
- recombinant engineered non-naturally occurring human codon-optimized Cas9 comprises a sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99% sequence identity to SEQ ID NO: 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27 or 28. In some embodiments, recombinant engineered non-naturally occurring human codon-optimized Cas9 comprises a sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99% sequence identity to SEQ ID NO: 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27 or 28.
- recombinant engineered non- naturally occurring human codon-optimized Cas9 comprises a sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99% sequence identity to SEQ ID NO: 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27 or 28.
- Various species exhibit codon bias (i.e. differences in codon usage by organisms) which correlates with the efficiency of translation of messenger RNA (mRNA) by utilizing codons in mRNA that correspond with the abundance of tRNA species for that codon in a particular organism.
- mRNA messenger RNA
- Various methods in the art can be used for computer optimization, including for example through use of software.
- codon optimization refers to modification of nucleic acid sequences for enhanced expression in the host cells of interest by replacing at least one codon (e.g.1, 2, 3, 4, 5, 10, 15, 20, 25, 50 or more codons) of the native sequence with codons that are more frequently used or most frequently used in the genes of the host cell while maintaining the native amino acid sequence.
- the Cas9 protein described herein is codon optimized. This type of optimization is known in the art and entails the mutation of foreign-derived DNA to mimic the codon preferences of the intended host organism or cell while encoding the same protein. Thus, the codons are changed, but the encoded protein remains unchanged. Codon optimization improves soluble protein levels and increases activity and editing efficiency in a given species.
- the Cas9 protein is codon optimized for expression in eukaryotic cells. In some embodiments, the Cas9 protein is codon optimized for expression in human cells.
- Protospacer Adjacent Motif PAM
- PAM protospacer adjacent motif
- Cas9 engineered from Streptococcus equinus ATCC 33317 cuts upstream of the consensus PAM sequence 5’-NRGNR-3’ (where “N” can be any nucleotide base and R is A or G), Enterococcus hirae strain F1129E recognizes the consensus PAM sequence 5’-NRG-3’, Streptococcus equinus strain AG46, Staphylococcus warneri strain 691, and Staphylococcus sciuri strain SNUC 2430 recognize the consensus PAM sequence 5’-NNGR-3’, Staphylococcus simulans strain 19 recognizes the consensus PAM sequence 5’-NNGRRT-3’, Streptococcus intermedius B196 strain G1552 recognizes the consensus PAM sequence 5’-NNAAAA-3’, Streptococcus sanguinis SK330 recognizes the consensus PAM sequence 5’-NGGNG-3’, Streptococcus sp.
- N can be any nucleotide base and R
- RNA guide comprises a polynucleotide sequence with complementarity to a target sequence. The RNA guide hybridizes with the target nucleic acid sequence and directs sequence-specific binding of a CRISPR complex to the target nucleic acid.
- an RNA guide has 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% complementarity to a target nucleic acid sequence.
- the RNA guides are about 5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 75 or more nucleotides in length.
- the RNA guides are about 18-24 nucleotides in length.
- the RNA guide is complementary to about 18-24 nucleotides in the target nucleic acid sequence.
- the RNA guide is complementary to about 18, 19, 20, 21, 22, 23, or 24 nucleotides in the target nucleic acid sequence.
- the RNA guide is complementary to about 18-22 nucleotides. In some embodiments, the RNA guide is complementary to about 18-21 nucleotides. In some embodiments, the RNA guide is complementary to about 18-20 nucleotides. In some embodiments, the RNA guide is complementary to 20 nucleotides in the target nucleic acid sequence.
- An RNA guide can be designed to target any target sequence. Optimal alignment is determined using any algorithm for aligning sequences, including the Needleman-Wunsch algorithm, Smith-Waterman algorithm, Burrows-Wheeler algorithm, ClustlW, ClustlX, BLAST, Novoalign, SOAP, Maq, and ELAND.
- an RNA guide is targeted to a unique target sequence within the genome of a cell.
- an RNA guide is designed to lack a PAM sequence.
- an RNA guide sequence is designed to have optimal secondary structure using a folding algorithm including mFold or Geneious.
- expression of RNA guides may be under an inducible promoter, e.g. hormone inducible, tetracycline or doxycycline inducible, arabinose inducible, or light inducible.
- the CRISPR system includes one or more RNA guides e.g. crRNA, tracrRNA, and/or sgRNA. Accordingly, in some embodiments the RNA guide comprises a crRNA.
- the RNA guide comprises a tracrRNA. In some embodiments, the RNA guide comprises a sgRNA. In some embodiments, the CRISPR system includes multiple RNA guides, comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15 or more RNA guides. In some embodiments, the RNA guide includes a crRNA. In some embodiments, the CRISPR system includes multiple crRNAs comprising 2-15 crRNAs. In some embodiments, the crRNA is a precursor crRNA (pre-crRNA), which includes a direct repeat sequence, a spacer sequence and a direct repeat sequence. In some embodiments, the crRNA is a processed or mature crRNA which includes a truncated direct repeat sequence.
- pre-crRNA precursor crRNA
- the crRNA is a processed or mature crRNA which includes a truncated direct repeat sequence.
- a CRISPR associated protein cleaves the pre-crRNA to form processed or mature crRNA.
- a CRISPR associated protein forms a complex with the mature crRNA and the spacer sequence targets the complex to a complementary sequence in the target nucleic acid.
- an RNA guide comprises a direct repeat sequence and a spacer sequence capable of hybridizing under appropriate conditions to a target nucleic acid.
- the spacer length of crRNAs can range from about 15 to 50 nucleotides.
- the spacer length of an RNA guide is at least 16 nucleotides, at least 17 nucleotides, at least 18 nucleotides, at least 19 nucleotides, at least 20 nucleotides, at least 21 nucleotides, or at least 22 nucleotides.
- the spacer length is from 15 to 17 nucleotides (e.g., 15, 16, or 17 nucleotides), from 17 to 20 nucleotides (e.g., 17, 18, 19, or 20 nucleotides), from 20 to 24 nucleotides (e.g., 20, 21, 22, 23, or 24 nucleotides), from 23 to 25 nucleotides (e.g., 23, 24, or 25 nucleotides), from 24 to 27 nucleotides, from 27 to 30 nucleotides, from 30 to 45 nucleotides (e.g., 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, or 45 nucleotides), from 30 or 35 to 40 nucleotides, from 41 to 45 nucleotides, from 45 to 50 nucleotides (e.g., 45, 46, 47, 48, 49, or 50 nucleotides), or longer.
- 15 to 17 nucleotides e.g., 15,
- the RNA guide comprises a direct repeat (DR) sequence of between about 16 and 26 nucleotides long.
- the DR is about 16 nucleotides long.
- the DR is about 17 nucleotides long.
- the DR is about 18 nucleotides long.
- the DR is about 19 nucleotides long.
- the DR is about 20 nucleotides long.
- the DR is about 21 nucleotides long.
- the DR is about 22 nucleotides long.
- the DR is about 23 nucleotides long.
- the DR is about 24 nucleotides long. In some embodiments, the DR is about 25 nucleotides long. In some embodiments, the DR is about 26 nucleotides long.
- the crRNA comprises a nucleotide guide sequence and a DR sequence.
- the nucleotide guide sequence can be between about 18 and 24 nucleotides long. Accordingly, in some embodiments, the nucleotide guide sequence is about 18 nucleotides long. In some embodiments, the nucleotide guide sequence is about 19 nucleotides long. In some embodiments, the nucleotide guide sequence is about 20 nucleotides long.
- the nucleotide guide sequence is about 21 nucleotides long. In some embodiments, the nucleotide guide sequence is about 22 nucleotides long. In some embodiments, the crRNA comprises a nucleotide guide sequence of about 22 nucleotides long and a direct repeat of about 22 nucleotides long. In some embodiments, the crRNA sequences can be modified to "dead crRNAs," “dead guides,” or “dead guide sequences" that can form a complex with a CRISPR-associated protein and bind specific targets without any substantial nuclease activity. In some embodiments, the crRNA may be chemically modified in the sugar phosphate backbone or base.
- the crRNA maybe modified using 2’O-methyl, 2’-F or locked nucleic acids to improve nuclease resistance or base pairing.
- the crRNA may contain modified bases such as 2-thiouridiene or N6-methyladenosine.
- the crRNA is conjugated with other oligonucleotides, peptides, proteins, tags, dyes, or polyethylene glycol.
- the crRNA may include aptamer or riboswitch sequences that can bind specific target molecules due to their three-dimensional structure.
- a trans-activating RNA is associated with crRNA to facilitate formation of a complex with Cas9 protein.
- the tracrRNA sequence is about or more than about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100 or more nucleotides in length. In some embodiments, the tracrRNA is about 70 nucleotides in length. In some embodiments, the tracrRNA and crRNA are contained in a single transcript called single guide RNA (sgRNA). In some embodiments, the sgRNA includes a loop between the tracrRNA and sgRNA. In some embodiments, the loop forming sequences are 3, 4, 5 or more nucleotides in length.
- the loop has the sequence GAAA, AAAG, CAAA, AAAC, UUUU, UUAUAU, UUA, UUU and/or AAUCA.
- the loop has the sequence GAAA.
- the loop has the sequence AAAG.
- the loop has the sequence CAAA.
- the loop has the sequence AAAC.
- the loop has the sequence AAUCA.
- the loop has the sequence UUUU.
- the loop has the sequence UUAUAU.
- the loop has the sequence UUA.
- the loop has the sequence UUU.
- the loop has the sequence AAUCA.
- the tracrRNA and crRNA form a hairpin loop.
- sgRNA has at least two or more hairpins.
- sgRNA has two, three, four or five hairpins.
- sgRNA includes a transcription termination sequence, which includes a polyT sequences comprising six nucleotides.
- the sgRNA comprises a sequence having at least 80% identity to 5’- GUUUUAGUACUCUGUAAUUUUGAAAAAAAUUACAGAAUCUACUAAAACAAGGC AAAAUGCCGUGUUUAUCUCGUCAACUUGUUGACGAGAUUUUUU-3’ (SEQ ID NO: 43) for Seq2Cas9, In some embodiments, the sgRNA comprises a sequence having at least 80% identity to 5’- GUUUUAGAGCUAUGUUGGAAACAACAUAGCGAGUUAAAAUAAGGCAUUGUCCG UUAUCAGCUUUUAAAGCAAGCACUGUCUCGGUGCUUUUUU-3’ (SEQ ID NO: 44) for EhiCas9, In some embodiments, the sgRNA comprises a sequence having at least 80% identity to 5’- GUUUUUGUACUCUCAAGAUUUGAAAAAAAAUCUUGCAGAGCCUACAAAGAUAAGG CUUCAUGCC
- the sgRNA comprises a sequence having 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identity to SEQ ID NO: 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55 or 56.
- the sgRNA comprises a sequence identical to SEQ ID NO: 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55 or 56.
- the tracrRNA is a separate transcript, not contained with crRNA sequence in the same transcript.
- Cas9 Fusion Proteins In some embodiments, the Cas9 enzyme is fused to one or more heterologous protein domains. In some embodiments, the Cas9 enzyme is fused to more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more protein domains. In some embodiments, the heterologous protein domain is fused to the C-terminus of the Cas9 enzyme.
- the heterologous protein domain is fused to the N-terminus of the Cas9 enzyme. In some embodiments, the heterologous protein domain is fused internally, between the C-terminus and the N-terminus of the Cas9 enzyme. In some embodiments, the internal fusion is made within the Cas9 RuvCI, RuvC II, RuvCIII, HNH, REC I, or PAM interacting domain.
- a Cas9 protein may be directly or indirectly linked to another protein domain.
- a suitable CRISPR system contains a linker or spacer that joins a Cas9 protein and a heterologous protein.
- An amino acid linker or spacer is generally designed to be flexible or to interpose a structure, such as an alpha-helix, between the two protein moieties.
- a linker or spacer can be relatively short, or can be longer.
- a linker or spacer contains for example 1-100 (e.g., 1-100, 5-100, 10-100, 20-10030-100, 40-100, 50- 100, 60-100, 70-100, 80-100, 90-100, 5-55, 10-50, 10-45, 10-40, 10-35, 10-30, 10-25, 10-20) amino acids in length.
- a linker or spacer is equal to or longer than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 amino acids in length. Typically, a longer linker may decrease steric hindrance.
- a linker will comprise a mixture of glycine and serine residues. In some embodiments, the linker may additionally comprise threonine, proline and/or alanine residues.
- a Cas9 protein is fused to cellular localization signals, epitope tags, reporter genes, and protein domains with enzymatic activity, epigenetic modifying activity, RNA cleavage activity, nucleic acid binding activity, transcription modulation activity.
- the Cas9 protein is fused to a nuclear localization sequence (NLS), a FLAG tag, a HIS tag, and/or a HA tag.
- Suitable fusion partners include, but are not limited to, a polypeptide that provides for methyltransferase activity, demethylase activity, acetyltransferase activity, deacetylase activity, kinase activity, phosphatase activity, ubiquitin ligase activity, deubiquitinating activity, adenylation activity, deadenylation activity, SUMOylating activity, deSUMOylating activity, ribosylation activity, deribosylation activity, myristoylation activity, demyristoylation activity, integrase activity, transposase activity, recombinase activity, polymerase activity, ligase activity, helicase activity, or nuclease activity, any of which can modify DNA or a DNA-associated polypeptide (e.g., a histone or DNA binding protein).
- a DNA-associated polypeptide e.g., a histone or DNA binding protein
- the Cas9 protein is fused to a histone demethylase, a transcriptional activator or a deaminase.
- suitable fusion partners include, but are not limited to boundary elements (e.g., CTCF), proteins and fragments thereof that provide periphery recruitment (e.g., Lamin A, Lamin B, etc.), and protein docking elements (e.g., FKBP/FRB, Pill/Abyl, etc.).
- a Cas9 is fused to a cytidine or adenosine deaminase domain, e.g., for use in base editing.
- the terms “cytidine deaminase” and “cytosine deaminase” can be used interchangeably.
- the cytidine deaminase domain may have sequence identity of 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more to any cytidine deaminase described herein.
- the cytidine deaminase domain has cytidine deaminase activity, (e.g., converting C to U).
- the adenosine deaminase domain may have sequence identity of 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more to any adenosine deaminase described herein.
- the adenosine deaminase domain has adenosine deaminase activity, (e.g., converting A to I).
- the terms “adenosine deaminase” and “adenine deaminase” can be used interchangeably.
- a cytidine deaminase can comprise all or a portion of an apolipoprotein B mRNA editing complex (APOBEC) family deaminase.
- APOBEC apolipoprotein B mRNA editing complex
- APOBEC is a family of evolutionarily conserved cytidine deaminases. Members of this family are C-to-U editing enzymes.
- the N-terminal domain of APOBEC like proteins is the catalytic domain, while the C-terminal domain is a pseudocatalytic domain. More specifically, the catalytic domain is a zinc dependent cytidine deaminase domain and is important for cytidine deamination.
- APOBEC family members include APOBEC1, APOBEC2, APOBEC3A, APOBEC3B, APOBEC3C, APOBEC3D ("APOBEC3E” now refers to this), APOBEC3F, APOBEC3G, APOBEC3H, APOBEC4, and Activation-induced (cytidine or cytosine) deaminase.
- a deaminase incorporated into a fusion protein comprises all or a portion of an APOBEC1 deaminase.
- a deaminase incorporated into a fusion protein comprises all or a portion of APOBEC2 deaminase.
- a deaminase incorporated into a fusion protein comprises all or a portion of is an APOBEC3 deaminase. In some embodiments, a deaminase incorporated into a fusion protein comprises all or a portion of an APOBEC3A deaminase. In some embodiments, a deaminase incorporated into a fusion protein comprises all or a portion of APOBEC3B deaminase. In some embodiments, a deaminase incorporated into a fusion protein comprises all or a portion of APOBEC3C deaminase.
- a deaminase incorporated into a fusion protein comprises all or a portion of APOBEC3D deaminase. In some embodiments, a deaminase incorporated into a fusion protein comprises all or a portion of APOBEC3E deaminase. In some embodiments, a deaminase incorporated into a fusion protein comprises all or a portion of APOBEC3F deaminase. In some embodiments, a deaminase incorporated into a fusion protein comprises all or a portion of APOBEC3G deaminase.
- a deaminase incorporated into a fusion protein comprises all or a portion of APOBEC3H deaminase. In some embodiments, a deaminase incorporated into a fusion protein comprises all or a portion of APOBEC4 deaminase. In some embodiments, a deaminase incorporated into a fusion protein comprises all or a portion of activation-induced deaminase (AID). In some embodiments a deaminase incorporated into a fusion protein comprises all or a portion of cytidine deaminase 1 (CDA1).
- CDA1 cytidine deaminase 1
- a fusion protein can comprise a deaminase from any suitable organism (e.g., a human or a rat).
- a deaminase domain of a fusion protein is from a human, chimpanzee, gorilla, monkey, cow, dog, rat, or mouse.
- the deaminase domain of the fusion protein is derived from rat (e.g., rat APOBEC1).
- the deaminase domain is human APOBEC1.
- the deaminase domain is pmCDA1. Sequences of exemplary cytidine deaminases are provided below.
- an adenosine deaminase can comprise all or a portion of an adenosine deaminase ADAT.
- an adenosine deaminase can comprise all or a portion of an ADAT from Escherichia coli (EcTadA) comprising one or more of the following mutations: D108N, A106V, D147Y, E155V, L84F, H123Y, I157F, or a corresponding mutation in another adenosine deaminase.
- EcTadA Escherichia coli
- the adenosine deaminase can be derived from any suitable organism (e.g., E. coli).
- the adenosine deaminase is from Escherichia coli, Staphylococcus aureus, Salmonella typhi, Shewanella putrefaciens, Haemophilus influenzae, Caulobacter crescentus, or Bacillus subtilis. In some embodiments, the adenosine deaminase is from E. coli. In some embodiments, the adenine deaminase is a naturally-occurring adenosine deaminase that includes one or more mutations corresponding to any of the mutations provided herein (e.g., mutations in ecTadA).
- the corresponding residue in any homologous protein can be identified by e.g., sequence alignment and determination of homologous residues.
- the mutations in any naturally-occurring adenosine deaminase e.g., having homology to ecTadA
- the TadA is any one of the TadA described in PCT/US2017/045381 (WO 2018/027078), which is incorporated herein by reference in its entirety.
- TadA*7.10 variant 10 from seventh round of evolution
- adenosine deaminase activity on single stranded DNA as shown in Table 3.
- Table 3 Genotypes of TadA Variants
- the TadA is provided as a monomer or dimer (e.g., a heterodimer of wild-type E. coli TadA and an engineered TadA variant).
- the adenosine deaminase is an eighth generation TadA*8 variant as shown in Table 4 below. Table 4: TadA8* Adenosine Deaminase Variants
- the adenosine deaminase is a ninth generation TadA*9 variant containing an alteration at an amino acid position selected from the following: 21, 23, 25, 38, 51, 54, 70, 71, 72, 72, 94, 124, 133, 138, 139, 146, and 158 of a TadA variant as shown in the reference sequence below: 10 20 30 40 50 MSEVEFSHEY WMRHALTLAK RARDEREVPV GAVLVLNNRV IGEGWNRAIG 60 70 80 90 100 LHDPTAHAEI MALRQGGLVM QNYRLIDATL YVTFEPCVMC AGAMIHSRIG 110 120 130 140 150 RVVFGVRNAK TGAAGSLMDV LHYPGMNHRV EITEGILADE CAALLCYFFR 160 MPRQVFNAQK KAQSSTD (SEQ ID NO: 118)
- the adenosine deaminase variant contains alterations at two or more amino acid positions selected from the following
- the adenosine deaminase variant contains one or more (e.g., 2, 3, 4) alterations selected from the following: R21N, R23H, E25F, N38G, L51W, P54C, M70V, Q71M, N72K, Y73S, M94V, P124W, T133K, D139L, D139M, C146R, and A158K of SEQ ID NO. 1.
- the adenosine deaminase variant further contains one or more of the following alterations: Y147T, Y147R, Q154S, Y123H, and Q154R.
- the adenosine deaminase variant contains a combination of alterations relative to the above TadA reference sequence selected from the following: E25F + V82S + Y123H, T133K + Y147R + Q154R; E25F + V82S + Y123H + Y147R + Q154R; L51W + V82S + Y123H + C146R + Y147R + Q154R; Y73S + V82S + Y123H + Y147R + Q154R; P54C + V82S + Y123H + Y147R + Q154R; N38G + V82T + Y123H + Y147R + Q154R; N72K + V82S + Y123H + D139L + Y147R + Q154R; E25F + V82S + Y123H + D139M + Y147R + Q154R; Q71M + V82S + Y123H + Y147R + Q154R;
- the deaminase or other polypeptide sequence lacks a methionine, for example when included as a component of a fusion protein. This can alter the numbering of positions. However, the skilled person will understand that such corresponding mutations refer to the same mutation, e.g., Y73S and Y72S and D139M and D138M.
- Cas9 is fused to nuclear localization sequences, including an NLS of the SV40 large T antigen, nucleoplasmin, c-myc, hRNPA1 M9, IBB domain from importin-alpha, NLS of myoma T protein, human p53, c-abl IV, influenza virus NS1, hepatitis virus delta antigen, mouse Mx1, human poly(ADP-ribose) polymerase, steroid hormone receptor (human) glucocorticoid.
- nuclear localization sequences including an NLS of the SV40 large T antigen, nucleoplasmin, c-myc, hRNPA1 M9, IBB domain from importin-alpha, NLS of myoma T protein, human p53, c-abl IV, influenza virus NS1, hepatitis virus delta antigen, mouse Mx1, human poly(ADP-ribose) polymerase, steroid hormone receptor (human) glucocorticoid.
- a Cas9 protein is fused to epitope tags including, but not limited to hemagglutinin (HA) tags, histidine (His) tags, FLAG tags, Myc tags, V5 tags, VSV-G tags, SNAP tags, thioredoxin (Trx) tags.
- epitope tags including, but not limited to hemagglutinin (HA) tags, histidine (His) tags, FLAG tags, Myc tags, V5 tags, VSV-G tags, SNAP tags, thioredoxin (Trx) tags.
- Cas9 is fused to reporter genes including, but not limited to glutathione-S-transferase (GST), horseradish peroxidase (HRP), chloramphenicol transferase (CAT), HcRed, DsRed, cyan fluorescent protein, yellow fluorescent protein and blue fluorescent protein, green fluorescent protein (GFP), including enhanced versions or superfolded GFP, as well as other modified versions of reporter genes.
- GST glutathione-S-transferase
- HRP horseradish peroxidase
- CAT chloramphenicol transferase
- HcRed HcRed
- DsRed cyan fluorescent protein
- yellow fluorescent protein yellow fluorescent protein and blue fluorescent protein
- GFP green fluorescent protein
- serum half-life of an engineered Cas9 protein is increased by fusion with heterologous proteins such as a human serum albumin protein, transferrin protein, human IgG and/or sialylated petide, such as the carboxy-terminal peptide (CTP, of chorionic gonadotropin ⁇ chain).
- serum half-life of an engineered Cas9 protein is decreased by fusion with destabilizing domains, including but not limited to geminin, ubiquitin, FKBP12- L106P, and/or dihydrofolate reductase.
- Suitable fusion partners that provide for increased or decreased stability include, but are not limited to degron sequences.
- Degrons are readily understood by one of ordinary skill in the art to be amino acid sequences that control the stability of the protein of which they are part.
- the stability of a protein comprising a degron sequence is controlled at least in part by the degron sequence.
- a suitable degron is constitutive such that the degron exerts its influence on protein stability independent of experimental control (i.e., the degron is not drug inducible, temperature inducible, etc.)
- the degron provides the variant Cas9 polypeptide with controllable stability such that the variant Cas9 polypeptide can be turned “on” (i.e., stable) or “off (i.e., unstable, degraded) depending on the desired conditions.
- the variant Cas9 polypeptide may be functional (i.e., "on", stable) below a threshold temperature (e.g., 42°C, 41°C, 40°C, 39°C, 38°C, 37°C, 36°C, 35°C, 34°C, 33°C, 32°C, 31°C, 30°C, etc.) but non-functional (i.e., "off, degraded) above the threshold temperature.
- a threshold temperature e.g., 42°C, 41°C, 40°C, 39°C, 38°C, 37°C, 36°C, 35°C, 34°C, 33°C, 32°C, 31°C, 30°C, etc.
- the presence or absence of drug can switch the protein from an "off (i.e., unstable) state to an "on” (i.e., stable) state or vice versa.
- An exemplary drug inducible degron is derived from the FKBP12 protein.
- the stability of the degron is controlled by the presence or absence of a small molecule that binds to the degron.
- suitable degrons include, but are not limited to those degrons controlled by Shield-1, DHFR, auxins, and/or temperature.
- Non-limiting examples of suitable degrons are known in the art (e.g., Dohmen et al., Science, 1994.263(5151): p.1273-1276: Heat- inducible degron: a method for constructing temperature-sensitive mutants; Schoeber et al., Am J Physiol Renal Physiol.2009 Jan;296(l):F204-l l : Conditional fast expression and function of multimeric TRPV5 channels using Shield-1 ; Chu et al., Bioorg Med Chem Lett.
- a Cas9 fusion protein can comprise a YFP sequence for detection, a degron sequence for stability, and transcription activator sequence to increase transcription of the target DNA.
- a Cas9 fusion protein comprises one or more (e.g.
- a target nucleic acid is a DNA molecule, RNA molecule, which is single-, double-, or multi-stranded DNA or RNA, genomic DNA, cDNA, DNA-RNA hybrids, or a polymer comprising purine and pyrimidine bases or other natural, chemically or biochemically modified, non-natural, or derivatized nucleotide bases either deoxyribonucleotides, ribonucleotides, or analogs thereof.
- Target nucleic acids may have three-dimensional structure, may include coding or non-coding regions, may include exons, introns, mRNA, tRNA, rRNA, siRNA, shRNA, miRNA, ribozymes, cDNA, plasmids, vectors, exogenous sequences, endogenous sequences.
- a target nucleic acid can comprise modified nucleotides, include methylated nucleotides, or nucleotide analogs.
- a target nucleic acid may be interspersed with non-nucleic acid components.
- a target nucleic acid is recognized by CRISPR-Cas9 system and binds Cas9.
- Recombinant Gene Technology there may be employed conventional molecular biology, microbiology, and recombinant DNA techniques within the skill of the art.
- Recombinant expression of a gene can include construction of an expression vector containing a nucleic acid that encodes the polypeptide. Once a polynucleotide has been obtained, a vector for the production of the polypeptide can be produced by recombinant DNA technology using techniques known in the art.
- RNA-targeting RNA and/or Cas9 protein is operably linked to a control element, e.g., a transcriptional control element, such as a promoter.
- the transcriptional control element may be functional in either a eukaryotic cell, e.g., a mammalian cell; or a prokaryotic cell (e.g., bacterial or archaeal cell).
- the eukaryotic cell is a human cell.
- a nucleotide sequence encoding a DNA-targeting RNA and/or a novel Cas9 protein is operably linked to multiple control elements that allow expression of the encoded nucleotide sequence in both prokaryotic and eukaryotic cells.
- a promoter can be a constitutively active promoter (i.e., a promoter that is constitutively in an active/"ON” state), it may be an inducible promoter (i.e., a promoter whose state, active/"ON” or inactive/"OFF", is controlled by an external stimulus, e.g., the presence of a particular temperature, compound, or protein.), it may be a spatially restricted promoter (i.e., transcriptional control element, enhancer, etc.)(e.g., tissue specific promoter, cell type specific promoter, etc.), and it may be a temporally restricted promoter (i.e., the promoter is in the "ON" state or "OFF” state during specific stages of embryonic development or during specific stages of a biological process, e.g., hair follicle cycle in mice).
- a constitutively active promoter i.e., a promoter that is constitutively in an active/"ON” state
- it may be an inducible promote
- Suitable promoters can be derived from viruses and can therefore be referred to as viral promoters, or they can be derived from any organism, including prokaryotic or eukaryotic organisms. Suitable promoters can be used to drive expression by any RNA polymerase (e.g., pol I, pol II, pol III).
- RNA polymerase e.g., pol I, pol II, pol III
- Exemplary promoters include, but are not limited to the SV40 early promoter, mouse mammary tumor virus long terminal repeat (LTR) promoter; adenovirus major late promoter (Ad MLP); a herpes simplex virus (HSV) promoter, a cytomegalovirus (CMV) promoter such as the CMV immediate early promoter region (CMVIE), a rous sarcoma virus (RSV) promoter, a human U6 small nuclear promoter (U6) (Miyagishi et al.
- LTR mouse mammary tumor virus long terminal repeat
- Ad MLP adenovirus major late promoter
- HSV herpes simplex virus
- CMV cytomegalovirus
- CMVIE CMV immediate early promoter region
- RSV rous sarcoma virus
- U6 small nuclear promoter U6 small nuclear promoter
- an enhanced U6 promoter e.g., Xia et al., Nucleic Acids Res.2003 Sep 1;31(17)
- a human HI promoter HI
- inducible promoters include, but are not limited toT7 RNA polymerase promoter, T3 RNA polymerase promoter, Isopropyl-beta-D-thiogalactopyranoside (IPTG) - regulated promoter, lactose induced promoter, heat shock promoter, Tetracycline-regulated promoter (e.g., Tet-ON, Tet-OFF, etc.), Steroid-regulated promoter, Metal-regulated promoter, estrogen receptor-regulated promoter, etc.
- Inducible promoters can therefore be regulated by molecules including, but not limited to, doxycycline, RNA polymerase, e.g., T7 RNA polymerase, an estrogen receptor and/or an estrogen receptor fusion.
- the promoter is a spatially restricted promoter (i.e., cell type specific promoter, tissue specific promoter, etc.) such that in a multi-cellular organism, the promoter is active (i.e., "ON") in a subset of specific cells.
- spatially restricted promoters may also be referred to as enhancers, transcriptional control elements, control sequences, etc.
- any convenient spatially restricted promoter may be used and the choice of suitable promoter (e.g., a brain specific promoter, a promoter that drives expression in a subset of neurons, a promoter that drives expression in the germline, a promoter that drives expression in the lungs, a promoter that drives expression in muscles, a promoter that drives expression in islet cells of the pancreas, etc.) will depend on the organism.
- a spatially restricted promoter can be used to regulate the expression of a nucleic acid encoding a subject site-directed polypeptide in a wide variety of different tissues and cell types, depending on the organism.
- Some spatially restricted promoters are also temporally restricted such that the promoter is in the "ON" state or “OFF” state during specific stages of embryonic development or during specific stages of a biological process (e.g., hair follicle cycle).
- examples of spatially restricted promoters include, but are not limited to, neuron-specific promoters, adipocyte-specific promoters, cardiomyocyte- specific promoters, smooth muscle-specific promoters, photoreceptor-specific promoters, etc.
- Neuron-specific spatially restricted promoters include, but are not limited to, a neuron- specific enolase (NSE) promoter, an aromatic amino acid decarboxylase (AADC) promoter, a neurofilament promoter, a synapsin promoter, a thy-1 promoter, a serotonin receptor promoter, a tyrosine hydroxylase promoter (TH), a GnRH promoter, an L7 promoter, a DNMT promoter, an enkephalin promoter, a myelin basic protein (MBP) promoter, a Ca 2+ - calmodulin- dependent protein kinase II-alpha (CamKIIa) promoter and/or a CMV enhancer/platelet-derived growth factor- ⁇ promoter.
- NSE neuron- specific enolase
- AADC aromatic amino acid decarboxylase
- a neurofilament promoter a synapsin promoter
- Adipocyte-specific spatially restricted promoters include, but are not limited to aP2 gene promoter/enhancer, e.g., a region from -5.4 kb to +21 bp of a human aP2 gene, a glucose transporter-4 (GLUT4) promoter, a fatty acid translocase (FAT/CD36) promoter, a stearoyl-CoA desaturase-1 (SCD1) promoter, a leptin promoter, and an adiponectin promoter, an adipsin promoter and/or a resistin promoter.
- aP2 gene promoter/enhancer e.g., a region from -5.4 kb to +21 bp of a human aP2 gene
- GLUT4 glucose transporter-4
- FAT/CD36 fatty acid translocase
- SCD1 stearoyl-CoA desaturase-1
- Cardiomyocyte-specific spatially restricted promoters include, but are not limited to control sequences derived from the following genes: myosin light chain-2, a-myosin heavy chain, AE3, cardiac troponin C, and/or cardiac actin.
- Smooth muscle-specific spatially restricted promoters include, but are not limited to an SM22a promoter, a smoothelin promoter, and/or an a-smooth muscle actin promoter.
- Photoreceptor-specific spatially restricted promoters include, but are not limited to, a rhodopsin promoter, a rhodopsin kinase promoter, a beta phosphodiesterase gene promoter, a retinitis pigmentosa gene promoter, an interphotoreceptor retinoid-binding protein (IRBP) gene enhancer, and/or an IRBP gene promoter.
- IRBP interphotoreceptor retinoid-binding protein
- the CRISPR-Cas9 system described herein is used in a method of altering the expression of a target nucleic acid.
- the CRISPR-Cas9 system described herein is used in a method of modifying a target nucleic acid in a desired target cell.
- the invention provides methods for site-specific modification of a target nucleic acid in eukaryotic cells to effectuate a desired modification in gene expression.
- the invention provides an engineered, non-naturally occurring CRISPR-Cas system comprising: an RNA guide or a nucleic acid encoding the RNA guide, wherein the RNA guide comprises a direct repeat sequence and a spacer sequence capable of hybridizing to a target nucleic acid; and a codon-optimized CRISPR-associated (Cas) protein having at least 80% sequence identity to SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14, and wherein the Cas protein is capable of binding to the RNA guide and of causing a break in the target nucleic acid sequence complementary to the RNA guide.
- a codon-optimized CRISPR-associated (Cas) protein having at least 80% sequence identity to SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14, and wherein the Cas protein is capable of binding to the RNA guide and of causing a break in the target nucleic acid sequence complementary to the RNA guide.
- the invention provides engineered, non-naturally occurring CRISPR-Cas system comprising: an RNA guide or a nucleic acid encoding the RNA guide, wherein the RNA guide comprises a direct repeat sequence and a spacer sequence capable of hybridizing to a target nucleic acid; and a codon-optimized CRISPR-associated (Cas) protein having at least 80% sequence identity to SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14; wherein the Cas protein is fused to a deaminase, and wherein the Cas protein fusion is capable of binding to the RNA guide and of editing the target nucleic acid sequence complementary to the RNA guide.
- a codon-optimized CRISPR-associated (Cas) protein having at least 80% sequence identity to SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14; wherein the Cas protein is fused to a deaminase, and wherein the Cas protein fusion is
- the invention provides a method of altering expression of a target nucleic acid in a eukaryotic cell comprising: contacting the cell with a Cas9 described herein, and an RNA guide or a nucleic acid encoding the RNA guide, wherein the RNA guide comprises a direct repeat sequence and a spacer sequence capable of hybridizing to the target nucleic acid, and wherein the Cas9 protein is capable of binding to the RNA guide and of causing a break in the target nucleic acid sequence complementary to the RNA guide.
- the invention provides a method of altering expression of a target nucleic acid in a eukaryotic cell comprising: contacting the cell with a Cas9 described herein, and an RNA guide or a nucleic acid encoding the RNA guide, wherein the RNA guide comprises a direct repeat sequence and a spacer sequence capable of hybridizing to the target nucleic acid, and wherein the Cas9 protein is capable of binding to the RNA guide and editing the target nucleic acid sequence complementary to the RNA guide.
- the invention provides a method of modifying a target nucleic acid in a eukaryotic cell comprising: contacting the cell with a Cas9 described herein, and an RNA guide or a nucleic acid encoding the RNA guide, wherein the RNA guide comprises a direct repeat sequence and a spacer sequence capable of hybridizing to the target nucleic acid, and wherein the Cas9 protein is capable of binding to the RNA guide and editing the target nucleic acid sequence complementary to the RNA guide.
- the Cas protein has about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% identity to SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14.
- the Cas protein is identical to SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14.
- Suitable guide RNA, Cas9 mutations and fusion proteins for use in the CRISPR-Cas9 system and method are as described throughout this disclosure.
- the method comprises binding of the CRISPR-Cas9 to a target nucleic acid and effecting cleavage of a target nucleic acids.
- the CRISPR- Cas9 system cleaves target DNA or RNA duplexes by introducing double-stranded breaks.
- the CRISPR-Cas9 system cleaves target DNA or RNA by introducing single-stranded breaks or nicks.
- the CRISPR-Cas9 method or system comprises a fusion protein with an effector that modifies target DNA in a site-specific manner, where the modifying activity includes methyltransferase activity, demethylase activity, acetyltransferase activity, deacetylase activity, kinase activity, phosphatase activity, ubiquitin ligase activity, deubiquitinating activity, adenylation activity, deadenylation activity, SUMOylating activity, deSUMOylating activity, ribosylation activity, deribosylation activity, myristoylation activity, demyristoylation activity, integrase activity, transposase activity, recombinase activity, polymerase activity, ligase activity, helicase activity, or nuclease activity, any of which can modify DNA or a DNA-associated polypeptide (e.g., a histone or DNA binding protein).
- the modifying activity includes methyltransfera
- the CRISPR-Cas9 method or system comprises a fusion protein with enzymes that can edit DNA sequences by chemically modifying nucleotide bases, including deaminase enzymes that can modify adenosine or cytosine bases and function as site-specific base editors.
- deaminase enzymes that can modify adenosine or cytosine bases and function as site-specific base editors.
- APOBEC1 cytidine deaminase which usually uses RNA as a substrate, can be targeted to single-stranded and double-stranded DNA when it is fused to Cas9, converting cytidine to uridine directly, and ADAR enzymes deaminate adenosine to inosine.
- ‘base editing’ using deaminases enables programmable conversion of one target DNA base into another.
- the Cas9 enzymes (Seq2Cas9, EhiCas9, SeqCas9, SsiCas9, SinCas9, SsaCas9, Ssc2Cas9, Sor2Cas9, SorCas9, SwaCas9, SscCas9, SgaCas9, LkuCas9 and SsuCas9) described herein is a component of a nucleobase editor.
- the base editor is the adenine deaminase TadA8 or TadA9.
- base editing results in the introduction of stop codons to silence genes.
- base editing results in altered protein function by altering amino acid sequences.
- the CRISPR-Cas9 method or system comprises epigenetic modification of target DNA by fusion with a histone.
- the CRISPR- Cas9 system comprises epigenetic modification of target DNA by fusion with an epigenetic modifying enzyme such as a reader, writer or eraser protein.
- the CRISPR-Cas9 system comprises fusion with a histone modifying enzyme to alter the histone modification pattern in a selected region of target DNA. Histone modifications can occur in many different ways including methylation, acetylation, ubiquitination, phosphorylation, and in many different combinations, leading to structural changes in DNA.
- histone modification leads to transcriptional repression or activation.
- the CRISPR-Cas9 method or system modulates transcription of target DNA by increasing or decreasing transcription through fusion with transcriptional activator proteins or transcriptional repressor proteins, small molecule/drug-responsive transcriptional regulators, inducible transcription regulators.
- the CRISPR-Cas9 system is used to control the expression of a target coding mRNA (i.e. a protein encoding gene) where binding results in increased or decreased gene expression.
- the CRISPR-Cas9 method or system is used to control gene regulation by editing genetic regulatory elements such as promoters or enhancers.
- the CRISPR-Cas9 method or system is used to control the expression of a target non-coding RNA, including tRNA, rRNA, snoRNA, siRNA, miRNA, and long ncRNA.
- the CRISPR-Cas9 method or system is used for targeted engineering of chromatin loop structures. Targeted engineering of chromatin loops between regulatory genomic regions provides a means to manipulate endogenous chromatin structures and enable the formation of new enhancer-promoter connections to overcome genetic deficiencies or inhibit aberrant enhancer-promoter connections.
- CRISPR-Cas9 is used for live cell imaging.
- Fluorescently labelled Cas9 is targeted to repetitive genomic regions such as centromeres and telomeres to track native chromatin loci throughout the cell cycle and determine differential positioning of transcriptionally active and inactive regions in the 3D nuclear space.
- the CRISPR-Cas9 method or system is used for correction of pathogenic mutations by insertion of beneficial clinical variants or suppressor mutations.
- Nucleobase Editors Disclosed herein, are novel base editors or nucleobase editors for editing, modifying or altering a target nucleotide sequence of a polynucleotide comprising a Cas9.
- nucleobase editor or a base editor comprising a polynucleotide programmable nucleotide binding domain (e.g., Cas9) and a nucleobase editing domain (e.g., adenosine deaminase).
- a polynucleotide programmable nucleotide binding domain e.g., Cas9
- nucleobase editing domain e.g., adenosine deaminase
- a polynucleotide programmable nucleotide binding domain (e.g., Cas9), when in conjunction with a bound guide polynucleotide (e.g., gRNA), can specifically bind to a target polynucleotide sequence (i.e., via complementary base pairing between bases of the bound guide nucleic acid and bases of the target polynucleotide sequence) and thereby localize the base editor to the target nucleic acid sequence desired to be edited.
- the target polynucleotide sequence comprises single-stranded DNA or double- stranded DNA.
- the target polynucleotide sequence comprises RNA.
- the target polynucleotide sequence comprises a DNA-RNA hybrid.
- Base editing systems as provided herein provide a new way to provide genome editing without generating double-strand DNA breaks, without requiring a donor DNA template, and without inducing an excess of stochastic insertions and deletions.
- the base editors provided herein are capable of modifying a specific nucleotide base without generating a significant proportion of indels.
- any of the base editors provided herein are capable of generating a greater proportion of intended modifications (e.g., point mutations or deaminations) versus indels.
- any of base editor systems provided herein result in less than 50%, less than 40%, less than 30%, less than 20%, less than 19%, less than 18%, less than 17%, less than 16%, less than 15%, less than 14%, less than 13%, less than 12%, less than 11%, less than 10%, less than 9%, less than 8%, less than 7%, less than 6%, less than 5%, less than 4%, less than 3%, less than 2%, less than 1%, less than 0.9%, less than 0.8%, less than 0.7%, less than 0.6%, less than 0.5%, less than 0.4%, less than 0.3%, less than 0.2%, less than 0.1%, less than 0.09%, less than 0.08%, less than 0.07%, less than 0.06%, less than 0.05%, less than 0.04%, less than 0.03%, less than 0.02%, or less than 0.01% indel formation in the target polynucleotide sequence.
- any of the base editors provided herein are capable of efficiently generating an intended mutation, such as a point mutation, in a nucleic acid (e.g., a nucleic acid within a genome of a subject) without generating a significant number of unintended mutations, such as unintended point mutations.
- any of the base editors provided herein are capable of generating at least 0.01% of intended mutations (i.e. at least 0.01% base editing efficiency).
- any of the base editors provided herein are capable of generating at least 0.01%, 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 40%, 45%, 50%, 60%, 70%, 80%, 90%, 95%, or 99% of intended mutations.
- the base editors provided herein are capable of generating a ratio of intended point mutations to indels that is greater than 1:1.
- the base editors provided herein are capable of generating a ratio of intended point mutations to indels that is at least 1.5:1, at least 2:1, at least 2.5:1, at least 3:1, at least 3.5:1, at least 4:1, at least 4.5:1, at least 5:1, at least 5.5:1, at least 6:1, at least 6.5:1, at least 7:1, at least 7.5:1, at least 8:1, at least 8.5:1, at least 9:1, at least 10:1, at least 11:1, at least 12:1, at least 13:1, at least 14:1, at least 15:1, at least 20:1, at least 25:1, at least 30:1, at least 40:1, at least 50:1, at least 100:1, at least 200:1, at least 300:1, at least 400:1, at least 500:1, at least 600:1, at least 700:1, at least 800:1, at least 900:1, or at least 1000:1, or more.
- the number of intended mutations and indels can be determined using any suitable method, for example, as described in International PCT Application Nos. PCT/2017/045381 (WO2018/027078) and PCT/US2016/058344 (WO2017/070632); Komor, A.C., et al., “Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage” Nature 533, 420-424 (2016); Gaudelli, N.M., et al., “Programmable base editing of A•T to G•C in genomic DNA without DNA cleavage” Nature 551, 464-471 (2017); and Komor, A.C., et al., “Improved base excision repair inhibition and bacteriophage Mu Gam protein yields C:G-to-T:A base editors with higher efficiency and product purity” Science Advances 3:eaao4774 (2017); the entire contents of which are hereby incorporated by reference.
- sequencing reads are scanned for exact matches to two 10-bp sequences that flank both sides of a window in which indels can occur. If no exact matches are located, the read is excluded from analysis. If the length of this indel window exactly matches the reference sequence the read is classified as not containing an indel. If the indel window is two or more bases longer or shorter than the reference sequence, then the sequencing read is classified as an insertion or deletion, respectively.
- the base editors provided herein can limit formation of indels in a region of a nucleic acid.
- the region is at a nucleotide targeted by a base editor or a region within 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides of a nucleotide targeted by a base editor.
- the number of indels formed at a target nucleotide region can depend on the amount of time a nucleic acid (e.g., a nucleic acid within the genome of a cell) is exposed to a base editor.
- the number or proportion of indels is determined after at least 1 hour, at least 2 hours, at least 6 hours, at least 12 hours, at least 24 hours, at least 36 hours, at least 48 hours, at least 3 days, at least 4 days, at least 5 days, at least 7 days, at least 10 days, or at least 14 days of exposing the target nucleotide sequence (e.g., a nucleic acid within the genome of a cell) to a base editor.
- the target nucleotide sequence e.g., a nucleic acid within the genome of a cell
- the CRISPR-Cas9 methods or systems described herein can have various therapeutic applications.
- a method of treating a disorder or a disease in a subject in need thereof comprising administering to the subject a CRISPR-Cas9 system comprising a Cas9 as described herein, wherein the guide RNA is complementary to at least 10 nucleotides of a target nucleic acid associated with the condition or disease; wherein the Cas protein associates with the guide RNA; wherein the guide RNA binds to the target nucleic acid; wherein the Cas protein causes a break in the target nucleic acid, optionally wherein the Cas9 is an inactive Cas9 (dCas9) fused to a deaminase and results in one or more base edits in the target nucleic acid, thereby treating the disorder or disease.
- dCas9 inactive Cas9
- the CRISPR-Cas9 methods or systems can be used to treat various diseases and disorders, e.g., genetic disorders (e.g., monogenetic diseases), diseases that can be treated by nuclease activity, and various cancers, etc.
- the CRISPR methods or systems described herein can be used to edit a target nucleic acid to modify the target nucleic acid (e.g., by inserting, deleting, or mutating one or more nucleic acid residues).
- the CRISPR systems described herein comprise an exogenous donor template nucleic acid (e.g., a DNA molecule or a RNA molecule), which comprises a desirable nucleic acid sequence.
- the molecular machinery of the cell Upon resolution of a cleavage event induced with the CRISPR system described herein, the molecular machinery of the cell will utilize the exogenous donor template nucleic acid in repairing and/or resolving the cleavage event. Alternatively, the molecular machinery of the cell can utilize an endogenous template in repairing and/or resolving the cleavage event. In some embodiments, the CRISPR systems described herein may be used to alter a target nucleic acid resulting in an insertion, a deletion, and/or a point mutation).
- the insertion is a scarless insertion (i.e., the insertion of an intended nucleic acid sequence into a target nucleic acid resulting in no additional unintended nucleic acid sequence upon resolution of the cleavage event).
- Donor template nucleic acids may be double stranded or single stranded nucleic acid molecules (e.g., DNA or RNA).
- the CRISPR methods or systems described herein comprise a nucleobase editor.
- the Cas9 proteins described herein are fused to a polypeptide having nucleobase editing activity.
- the CRISPR methods or systems described herein can be used for treating a disease caused by overexpression of RNAs, toxic RNAs, and/or mutated RNAs (e.g., splicing defects or truncations).
- the CRISPR methods or systems described herein can also target trans-acting mutations affecting RNA- dependent functions that cause various diseases.
- the CRISPR methods or systems described herein can also be used to target mutations disrupting the cis-acting splicing codes that can cause splicing defects and diseases.
- the CRISPR methods or systems described herein can further be used for antiviral activity, in particular against RNA viruses.
- the CRISPR-associated proteins can target the viral RNAs using suitable RNA guides selected to target viral RNA sequences.
- the CRISPR methods or systems described herein can also be used to treat a cancer in a subject (e.g., a human subject).
- the CRISPR-associated proteins described herein can be programmed with crRNA targeting a RNA molecule that is aberrant (e.g., comprises a point mutation or are alternatively-spliced) and found in cancer cells to induce cell death in the cancer cells (e.g., via apoptosis).
- the CRISPR methods or systems described herein can also be used to treat an infectious disease in a subject.
- the CRISPR-associated proteins described herein can be programmed with crRNA targeting a RNA molecule expressed by an infectious agent (e.g., a bacteria, a virus, a parasite or a protozoan) in order to target and induce cell death in the infectious agent cell.
- an infectious agent e.g., a bacteria, a virus, a parasite or a protozoan
- the CRISPR systems may also be used to treat diseases where an intracellular infectious agent infects the cells of a host subject.
- By programming the CRISPR- associated protein to target a RNA molecule encoded by an infectious agent gene cells infected with the infectious agent can be targeted and cell death induced.
- in vitro RNA sensing assays can be used to detect specific RNA substrates.
- the CRISPR-associated proteins can be used for RNA-based sensing in living cells.
- RNAs examples include DNA sequences, DNA sequences, and DNA sequences.
- a polynucleotide comprising a donor sequence to be inserted is also provided to the cell.
- donor sequence or “donor polynucleotide” it is meant a nucleic acid sequence to be inserted at the cleavage site induced by a site-directed modifying polypeptide.
- the donor polynucleotide will contain sufficient homology to a genomic sequence at the cleavage site, e.g.70%, 80%, 85%, 90%, 95%, or 100% homology with the nucleotide sequences flanking the cleavage site, e.g. within about 50 bases or less of the cleavage site, e.g. within about 30 bases, within about 15 bases, within about 10 bases, within about 5 bases, or immediately flanking the cleavage site, to support homology-directed repair between it and the genomic sequence to which it bears homology.
- Donor sequences can be of any length, e.g.10 nucleotides or more, 50 nucleotides or more, 100 nucleotides or more, 250 nucleotides or more, 500 nucleotides or more, 1000 nucleotides or more, 5000 nucleotides or more, etc.
- the donor sequence is typically not identical to the genomic sequence that it replaces.
- the donor sequence may contain at least one or more single base changes, insertions, deletions, inversions or rearrangements with respect to the genomic sequence, so long as sufficient homology is present to support homology-directed repair.
- the donor sequence comprises a non-homologous sequence flanked by two regions of homology, such that homology-directed repair between the target DNA region and the two flanking sequences results in insertion of the non-homologous sequence at the target region.
- Donor sequences may also comprise a vector backbone containing sequences that are not homologous to the DNA region of interest and that are not intended for insertion into the DNA region of interest.
- the homologous region(s) of a donor sequence will have at least 50% sequence identity to a genomic sequence with which recombination is desired. In certain embodiments, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 99.9% sequence identity is present. Any value between 1% and 100% sequence identity can be present, depending upon the length of the donor polynucleotide.
- the donor sequence may comprise certain sequence differences as compared to the genomic sequence, e.g.
- restriction sites nucleotide polymorphisms, selectable markers (e.g., drug resistance genes, fluorescent proteins, enzymes etc.), etc., which may be used to assess for successful insertion of the donor sequence at the cleavage site or in some cases may be used for other purposes (e.g., to signify expression at the targeted genomic locus).
- selectable markers e.g., drug resistance genes, fluorescent proteins, enzymes etc.
- nucleotide sequence differences will not change the amino acid sequence, or will make silent amino acid changes (i.e., changes which do not affect the structure or function of the protein).
- sequences differences may include flanking recombination sequences such as FLPs, loxP sequences, or the like, that can be activated at a later time for removal of the marker sequence.
- the donor sequence may be provided to the cell as single-stranded DNA, single- stranded RNA, double-stranded DNA, or double-stranded RNA. It may be introduced into a cell in linear or circular form. If introduced in linear form, the ends of the donor sequence may be protected (e.g., from exonucleolytic degradation) by methods known to those of skill in the art.
- one or more dideoxynucleotide residues are added to the 3' terminus of a linear molecule and/or self-complementary oligonucleotides are ligated to one or both ends.
- Additional methods for protecting exogenous polynucleotides from degradation include, but are not limited to, addition of terminal amino group(s) and the use of modified internucleotide linkages such as, for example, phosphorothioates, phosphor amidates, and O- methyl ribose or deoxyribose residues.
- additional lengths of sequence may be included outside of the regions of homology that can be degraded without impacting recombination.
- a donor sequence can be introduced into a cell as part of a vector molecule having additional sequences such as, for example, replication origins, promoters and genes encoding antibiotic resistance.
- donor sequences can be introduced as naked nucleic acid, as nucleic acid complexed with an agent such as a liposome or poloxamer, or can be delivered by viruses (e.g., adenovirus, AAV), as described above for nucleic acids encoding a DNA -targeting RNA and/or site - directed modifying polypeptide and/or donor polynucleotide.
- viruses e.g., adenovirus, AAV
- a DNA region of interest may be cleaved and modified, i.e. "genetically modified", ex vivo.
- the population of cells may be enriched for those comprising the genetic modification by separating the genetically modified cells from the remaining population.
- the "genetically modified" cells Prior to enriching, may make up only about 1% or more (e.g., 2% or more, 3% or more, 4% or more, 5% or more, 6% or more, 7% or more, 8% or more, 9% or more, 10% or more, 15% or more, or 20% or more) of the cellular population. Separation of "genetically modified" cells may be achieved by any convenient separation technique appropriate for the selectable marker used.
- cells may be separated by fluorescence activated cell sorting
- fluorescence activated cell sorting if a fluorescent marker has been inserted, cells may be separated from the heterogeneous population by affinity separation techniques, e.g. magnetic separation, affinity chromatography, "panning" with an affinity reagent attached to a solid matrix, or other convenient technique.
- Techniques providing accurate separation include fluorescence activated cell sorters, which can have varying degrees of sophistication, such as multiple color channels, low angle and obtuse light scattering detecting channels, impedance channels, etc.
- the cells may be selected against dead cells by employing dyes associated with dead cells (e.g. propidium iodide).
- any technique may be employed which is not unduly detrimental to the viability of the genetically modified cells.
- Cell compositions that are highly enriched for cells comprising modified DNA are achieved in this manner.
- highly enriched it is meant that the genetically modified cells will be 70% or more, 75% or more, 80% or more, 85% or more, 90% or more of the cell composition, for example, about 95% or more, or 98% or more of the cell composition.
- the composition may be a substantially pure composition of genetically modified cells.
- Genetically modified cells produced by the methods described herein may be used immediately. Alternatively, the cells may be frozen at liquid nitrogen temperatures and stored for long periods of time, being thawed and capable of being reused.
- the cells will usually be frozen in 10% dimethylsulfoxide (DMSO), 50% serum, 40% buffered medium, or some other such solution as is commonly used in the art to preserve cells at such freezing temperatures, and thawed in a manner as commonly known in the art for thawing frozen cultured cells.
- DMSO dimethylsulfoxide
- the genetically modified cells may be cultured in vitro under various culture conditions.
- the cells may be expanded in culture, i.e. grown under conditions that promote their proliferation.
- Culture medium may be liquid or semi-solid, e.g. containing agar, methylcellulose, etc.
- the cell population may be suspended in an appropriate nutrient medium, such as Iscove's modified DMEM or RPMI 1640, normally supplemented with fetal calf serum (about 5-10%), L-glutamine, a thiol, particularly 2-mercaptoethanol, and antibiotics, e.g. penicillin and streptomycin.
- the culture may contain growth factors to which the regulatory T cells are responsive. Growth factors, as defined herein, are molecules capable of promoting survival, growth and/or differentiation of cells, either in culture or in the intact tissue, through specific effects on a transmembrane receptor. Growth factors include polypeptides and non- polypeptide factors.
- Cells that have been genetically modified in this way may be transplanted to a subject for purposes such as gene therapy, e.g. to treat a disease or as an antiviral, antipathogenic, or anticancer therapeutic, for the production of genetically modified organisms in agriculture, or for biological research.
- the subject may be a neonate, a juvenile, or an adult.
- Mammalian species that may be treated with the present methods include canines and felines; equines; bovines; ovines; etc. and primates, particularly humans.
- Animal models, particularly small mammals e.g. mouse, rat, guinea pig, hamster, lagomorpha (e.g., rabbit), etc.
- small mammals e.g. mouse, rat, guinea pig, hamster, lagomorpha (e.g., rabbit), etc.
- Cells may be provided to the subject alone or with a suitable substrate or matrix, e.g. to support their growth and/or organization in the tissue to which they are being transplanted. Usually, at least 1x10 3 cells will be administered, for example 5x103 cells, 1x10 4 cells, 5x10 4 cells, 1x10 5 cells, 1 x 10 6 cells or more.
- the cells may be introduced to the subject via any of the following routes: parenteral, subcutaneous, intravenous, intracranial, intraspinal, intraocular, or into spinal fluid.
- the cells may be introduced by injection, catheter, or the like.
- Cells may also be introduced into an embryo (e.g., a blastocyst) for the purpose of generating a transgenic animal (e.g., a transgenic mouse).
- the number of administrations of treatment to a subject may vary. Introducing the genetically modified cells into the subject may be a one-time event; but in certain situations, such treatment may elicit improvement for a limited period of time and require an on-going series of repeated treatments. In other situations, multiple administrations of the genetically modified cells may be required before an effect is observed.
- the exact protocols depend upon the disease or condition, the stage of the disease and parameters of the individual subject being treated.
- the DNA-targeting RNA and/or site-directed modifying polypeptide and/or donor polynucleotide are employed to modify cellular DNA in vivo, again for purposes such as gene therapy, e.g. to treat a disease or as an antiviral, antipathogenic, or anticancer therapeutic, for the production of genetically modified organisms in agriculture, or for biological research.
- a DNA- targeting RNA and/or site -directed modifying polypeptide and/or donor polynucleotide are administered directly to the individual.
- a DNA-targeting RNA and/or site -directed modifying polypeptide and/or donor polynucleotide may be administered by any of a number of well-known methods in the art for the administration of peptides, small molecules and nucleic acids to a subject.
- a DNA-targeting RNA and/or site- directed modifying polypeptide and/or donor polynucleotide can be incorporated into a variety of formulations. More particularly, a DNA-targeting RNA and/or site-directed modifying polypeptide and/or donor polynucleotide of the present invention can be formulated into pharmaceutical compositions by combination with appropriate pharmaceutically acceptable carriers or diluents.
- compositions that include one or more a DNA- targeting RNA and/or site-directed modifying polypeptide and/or donor polynucleotide present in a pharmaceutically acceptable vehicle.
- “Pharmaceutically acceptable vehicles” may be vehicles approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in mammals, such as humans.
- vehicle refers to a diluent, adjuvant, excipient, or carrier with which a compound of the invention is formulated for administration to a mammal.
- Such pharmaceutical vehicles can be lipids, e.g. liposomes, e.g.
- liposome dendrimers such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like, saline; gum acacia, gelatin, starch paste, talc, keratin, colloidal silica, urea, and the like.
- auxiliary, stabilizing, thickening, lubricating and coloring agents may be used.
- Pharmaceutical compositions may be formulated into preparations in solid, semisolid, liquid or gaseous forms, such as tablets, capsules, powders, granules, ointments, solutions, suppositories, injections, inhalants, gels, microspheres, and aerosols.
- administration of the a DNA-targeting RNA and/or site -directed modifying polypeptide and/or donor polynucleotide can be achieved in various ways, including oral, buccal, rectal, parenteral, intraperitoneal, intradermal, transdermal, intratracheal, intraocular, etc., administration.
- the active agent may be systemic after administration or may be localized by the use of regional administration, intramural administration, or use of an implant that acts to retain the active dose at the site of implantation.
- the active agent may be formulated for immediate activity or it may be formulated for sustained release. For some conditions, particularly central nervous system conditions, it may be necessary to formulate agents to cross the blood-brain barrier (BBB).
- BBB blood-brain barrier
- BBB blood-brain barrier
- osmotic means such as mannitol or leukotrienes
- vasoactive substances such as bradykinin.
- a BBB disrupting agent can be co-administered with the therapeutic compositions of the invention when the compositions are administered by intravascular injection.
- an effective amount or effective dose of a DNA-targeting RNA and/or site- directed modifying polypeptide and/or donor polynucleotide in vivo is the amount to induce a 2 fold increase or more in the amount of recombination observed between two homologous sequences relative to a negative control, e.g. a cell contacted with an empty vector or irrelevant polypeptide.
- the amount of recombination may be measured by any convenient method, e.g. as described above and known in the art.
- the calculation of the effective amount or effective dose of a DNA-targeting RNA and/or site-directed modifying polypeptide and/or donor polynucleotide to be administered is within the skill of one of ordinary skill in the art, and will be routine to those persons skilled in the art.
- the final amount to be administered will be dependent upon the route of administration and upon the nature of the disorder or condition that is to be treated.
- the effective amount given to a particular patient will depend on a variety of factors, several of which will differ from patient to patient.
- a competent clinician will be able to determine an effective amount of a therapeutic agent to administer to a patient to halt or reverse the progression the disease condition as required.
- a clinician can determine the maximum safe dose for an individual, depending on the route of administration. For instance, an intravenously administered dose may be more than an intrathecally administered dose, given the greater body of fluid into which the therapeutic composition is being administered. Similarly, compositions which are rapidly cleared from the body may be administered at higher doses, or in repeated doses, in order to maintain a therapeutic concentration. Utilizing ordinary skill, the competent clinician will be able to optimize the dosage of a particular therapeutic in the course of routine clinical trials. For inclusion in a medicament, a DNA-targeting RNA and/or site -directed modifying polypeptide and/or donor polynucleotide may be obtained from a suitable commercial source.
- the total pharmaceutically effective amount of the a DNA-targeting RNA and/or site -directed modifying polypeptide and/or donor polynucleotide administered parenterally per dose will be in a range that can be measured by a dose response curve.
- Therapies based on a DNA-targeting RNA and/or site-directed modifying polypeptide and/or donor polynucleotides i.e. preparations of a DNA-targeting RNA and/or site-directed modifying polypeptide and/or donor polynucleotide to be used for therapeutic administration, must be sterile. Sterility is readily accomplished by filtration through sterile filtration membranes (e.g., 0.2 ⁇ m membranes).
- Therapeutic compositions generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
- the therapies based on a DNA- targeting RNA and/or site- directed modifying polypeptide and/or donor polynucleotide may be stored in unit or multi-dose containers, for example, sealed ampules or vials, as an aqueous solution or as a lyophilized formulation for reconstitution.
- a lyophilized formulation 10-mL vials are filled with 5 ml of sterile-filtered 1 % (w/v) aqueous solution of compound, and the resulting mixture is lyophilized.
- the infusion solution is prepared by reconstituting the lyophilized compound using bacteriostatic Water-for-Injection.
- Pharmaceutical compositions can include, depending on the formulation desired, pharmaceutically-acceptable, non-toxic carriers of diluents, which are defined as vehicles commonly used to formulate pharmaceutical compositions for animal or human administration.
- the diluent is selected so as not to affect the biological activity of the combination. Examples of such diluents are distilled water, buffered water, physiological saline, PBS, Ringer's solution, dextrose solution, and Hank's solution.
- the pharmaceutical composition or formulation can include other carriers, adjuvants, or non- toxic, nontherapeutic, nonimmunogenic stabilizers, excipients and the like.
- compositions can also include additional substances to approximate physiological conditions, such as pH adjusting and buffering agents, toxicity adjusting agents, wetting agents and detergents.
- the composition can also include any of a variety of stabilizing agents, such as an antioxidant for example.
- the pharmaceutical composition includes a polypeptide
- the polypeptide can be complexed with various well-known compounds that enhance the in vivo stability of the polypeptide, or otherwise enhance its pharmacological properties (e.g., increase the half-life of the polypeptide, reduce its toxicity, and enhance solubility or uptake). Examples of such modifications or complexing agents include sulfate, gluconate, citrate and phosphate.
- the nucleic acids or polypeptides of a composition can also be complexed with molecules that enhance their in vivo attributes.
- molecules include, for example, carbohydrates, polyamines, amino acids, other peptides, ions (e.g., sodium, potassium, calcium, magnesium, manganese), and lipids.
- the pharmaceutical compositions can be administered for prophylactic and/or therapeutic treatments. Toxicity and therapeutic efficacy of the active ingredient can be determined according to standard pharmaceutical procedures in cell cultures and/or experimental animals, including, for example, determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50/ED50.
- compositions intended for in vivo use are usually sterile.
- compositions for parental administration are also sterile, substantially isotonic and made under GMP conditions.
- Delivery Systems The CRISPR systems described herein, or components thereof, nucleic acid molecules thereof, and/or nucleic acid molecules encoding or providing components thereof, CRISPR- associated proteins, or RNA guides, can be delivered by various delivery systems such as vectors, e.g., plasmids and delivery vectors. Exemplary embodiments are described below.
- the CRISPR systems can be encoded on a nucleic acid that is contained in a viral vector.
- Viral vectors can include lentivirus, Adenovirus, Retrovirus, and Adeno-associated viruses (AAVs). Viral vectors can be selected based on the application. For example, AAVs are commonly used for gene delivery in vivo due to their mild immunogenicity. Adenoviruses are commonly used as vaccines because of the strong immunogenic response they induce. Packaging capacity of the viral vectors can limit the size of the base editor that can be packaged into the vector.
- the packaging capacity of the AAVs is ⁇ 4.5 kb including two 145 base inverted terminal repeats (ITRs).
- AAV is a small, single-stranded DNA dependent virus belonging to the parvovirus family.
- the 4.7 kb wild-type (wt) AAV genome is made up of two genes that encode four replication proteins and three capsid proteins, respectively, and is flanked on either side by 145-bp inverted terminal repeats (ITRs).
- the virion is composed of three capsid proteins, Vp1, Vp2, and Vp3, produced in a 1:1:10 ratio from the same open reading frame but from differential splicing (Vp1) and alternative translational start sites (Vp2 and Vp3, respectively).
- Vp3 is the most abundant subunit in the virion and participates in receptor recognition at the cell surface defining the tropism of the virus.
- a phospholipase domain which functions in viral infectivity, has been identified in the unique N terminus of Vp1.
- rAAV recombinant AAV
- rAAV utilizes the cis-acting 145-bp ITRs to flank vector transgene cassettes, providing up to 4.5 kb for packaging of foreign DNA.
- rAAV can express a fusion protein of the invention and persist without integration into the host genome by existing episomally in circular head-to-tail concatemers.
- the limited packaging capacity has limited the use of AAV-mediated gene delivery when the length of the coding sequence of the gene is equal or greater in size than the wt AAV genome.
- the small packaging capacity of AAV vectors makes the delivery of a number of genes that exceed this size and/or the use of large physiological regulatory elements challenging. These challenges can be addressed, for example, by dividing the protein(s) to be delivered into two or more fragments, wherein the N-terminal fragment is fused to a split intein-N and the C-terminal fragment is fused to a split intein-C. These fragments are then packaged into two or more AAV vectors.
- intein refers to a self-splicing protein intron (e.g., peptide) that ligates flanking N-terminal and C-terminal exteins (e.g., fragments to be joined).
- intron e.g., peptide
- flanking N-terminal and C-terminal exteins e.g., fragments to be joined.
- the CRISPR system of the invention can vary in length.
- a protein fragment ranges from 2 amino acids to about 1000 amino acids in length. In some embodiments, a protein fragment ranges from about 5 amino acids to about 500 amino acids in length.
- a protein fragment ranges from about 20 amino acids to about 200 amino acids in length. In some embodiments, a protein fragment ranges from about 10 amino acids to about 100 amino acids in length. Suitable protein fragments of other lengths will be apparent to a person of skill in the art.
- a portion or fragment of a nuclease e.g., Cas9 is fused to an intein. The nuclease can be fused to the N-terminus or the C-terminus of the intein. In some embodiments, a portion or fragment of a fusion protein is fused to an intein and fused to an AAV capsid protein.
- the intein, nuclease and capsid protein can be fused together in any arrangement (e.g., nuclease-intein-capsid, intein-nuclease-capsid, capsid-intein-nuclease, etc.).
- the N-terminus of an intein is fused to the C-terminus of a fusion protein and the C-terminus of the intein is fused to the N-terminus of an AAV capsid protein.
- dual AAV vectors are generated by splitting a large transgene expression cassette in two separate halves (5′ and 3′ ends, or head and tail), where each half of the cassette is packaged in a single AAV vector (of ⁇ 5 kb).
- the re-assembly of the full- length transgene expression cassette is then achieved upon co-infection of the same cell by both dual AAV vectors followed by: (1) homologous recombination (HR) between 5′ and 3′ genomes (dual AAV overlapping vectors); (2) ITR-mediated tail-to-head concatemerization of 5′ and 3′ genomes (dual AAV trans-splicing vectors); or (3) a combination of these two mechanisms (dual AAV hybrid vectors).
- the use of dual AAV vectors in vivo results in the expression of full-length proteins.
- the use of the dual AAV vector platform represents an efficient and viable gene transfer strategy for transgenes of >4.7 kb in size.
- the disclosed strategies for designing CRISPR systems including the Cas9 described herein can be useful for generating CRISPR systems capable of being packaged into a viral vector.
- the use of RNA or DNA viral based systems for the delivery of a base editor takes advantage of highly evolved processes for targeting a virus to specific cells in culture or in the host and trafficking the viral payload to the nucleus or host cell genome.
- Viral vectors can be administered directly to cells in culture, patients (in vivo), or they can be used to treat cells in vitro, and the modified cells can optionally be administered to patients (ex vivo).
- Conventional viral based systems could include retroviral, lentivirus, adenoviral, adeno- associated and herpes simplex virus vectors for gene transfer. Integration in the host genome is possible with the retrovirus, lentivirus, and adeno-associated virus gene transfer methods, often resulting in long term expression of the inserted transgene. Additionally, high transduction efficiencies have been observed in many different cell types and target tissues. The tropism of a retrovirus can be altered by incorporating foreign envelope proteins, expanding the potential target population of target cells.
- Lentiviral vectors are retroviral vectors that are able to transduce or infect non-dividing cells and typically produce high viral titers. Selection of a retroviral gene transfer system would therefore depend on the target tissue. Retroviral vectors are comprised of cis-acting long terminal repeats with packaging capacity for up to 6-10 kb of foreign sequence. The minimum cis-acting LTRs are sufficient for replication and packaging of the vectors, which are then used to integrate the therapeutic gene into the target cell to provide permanent transgene expression.
- Widely used retroviral vectors include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), Simian Immuno deficiency virus (SIV), human immuno deficiency virus (HIV), and combinations thereof (See, e.g., Buchscher et al., J. Virol.66:2731-2739 (1992); Johann et al., J. Virol.66:1635-1640 (1992); Sommnerfelt et al., Virol.176:58-59 (1990); Wilson et al., J. Virol.63:2374-2378 (1989); Miller et al., J.
- Retroviral vectors can require polynucleotide sequences smaller than a given length for efficient integration into a target cell.
- retroviral vectors of length greater than 9 kb can result in low viral titers compared with those of smaller size.
- a CRISPR system e.g., including the Cas9 disclosed herein
- a Cas9 is of a size so as to allow efficient packing and delivery even when expressed together with a guide nucleic acid and/or other components of a targetable nuclease system.
- adenoviral based systems can be used. Adenoviral based vectors are capable of very high transduction efficiency in many cell types and do not require cell division. With such vectors, high titer and levels of expression have been obtained. This vector can be produced in large quantities in a relatively simple system.
- Adeno-associated virus (“AAV”) vectors can also be used to transduce cells with target nucleic acids, e.g., in the in vitro production of nucleic acids and peptides, and for in vivo and ex vivo gene therapy procedures (See, e.g., West et al., Virology 160:38-47 (1987); U.S. Patent No.4,797,368; WO 93/24641; Kotin, Human Gene Therapy 5:793-801 (1994); Muzyczka, J. Clin. Invest.94:1351 (1994).
- the construction of recombinant AAV vectors is described in a number of publications, including U.S.
- a CRISPR system (e.g., including the Cas9 disclosed herein) described herein can therefore be delivered with viral vectors.
- One or more components of the base editor system can be encoded on one or more viral vectors.
- a base editor and guide nucleic acid can be encoded on a single viral vector.
- the base editor and guide nucleic acid are encoded on different viral vectors. In either case, the base editor and guide nucleic acid can each be operably linked to a promoter and terminator. The combination of components encoded on a viral vector can be determined by the cargo size constraints of the chosen viral vector.
- Non-Viral Delivery of Base Editors Non-viral delivery approaches for CRISPR are also available.
- One important category of non-viral nucleic acid vectors are nanoparticles, which can be organic or inorganic. Nanoparticles are well known in the art. Any suitable nanoparticle design can be used to deliver genome editing system components or nucleic acids encoding such components. For instance, organic (e.g. lipid and/or polymer) nanoparticles can be suitable for use as delivery vehicles in certain embodiments of this disclosure. Exemplary lipids for use in nanoparticle formulations, and/or gene transfer are shown in Table 5 (below). Table 5
- the delivery of genome editing system components or nucleic acids encoding such components may be accomplished by delivering a ribonucleoprotein (RNP) to cells.
- RNP ribonucleoprotein
- the RNP comprises the nucleic acid binding protein, e.g., Cas9, in complex with the targeting gRNA.
- RNPs may be delivered to cells using known methods, such as electroporation, nucleofection, or cationic lipid-mediated methods, for example, as reported by Zuris, J.A.
- RNPs are advantageous for use in CRISPR base editing systems, particularly for cells that are difficult to transfect, such as primary cells.
- RNPs can also alleviate difficulties that may occur with protein expression in cells, especially when eukaryotic promoters, e.g., CMV or EF1A, which may be used in CRISPR plasmids, are not well-expressed.
- the use of RNPs does not require the delivery of foreign DNA into cells.
- an RNP comprising a nucleic acid binding protein and gRNA complex is degraded over time, the use of RNPs has the potential to limit off-target effects.
- RNPs can be used to deliver binding protein (e.g., Cas9 variants) and to direct homology directed repair (HDR).
- a promoter used to drive the CRISPR system e.g., including the Cas9 described herein
- a promoter used to drive the CRISPR system can include AAV ITR. This can be advantageous for eliminating the need for an additional promoter element, which can take up space in the vector. The additional space freed up can be used to drive the expression of additional elements, such as a guide nucleic acid or a selectable marker. ITR activity is relatively weak, so it can be used to reduce potential toxicity due to over expression of the chosen nuclease.
- any suitable promoter can be used to drive expression of the Cas9 and, where appropriate, the guide nucleic acid.
- promoters that can be used include CMV, CAG, CBh, PGK, SV40, Ferritin heavy or light chains, etc.
- suitable promoters can include: SynapsinI for all neurons, CaMKIIalpha for excitatory neurons, GAD67 or GAD65 or VGAT for GABAergic neurons, etc.
- suitable promoters include the Albumin promoter.
- suitable promoters can include SP-B.
- suitable promoters can include ICAM.
- a promoter or viral vector can comprise a first promoter operably linked to a nucleic acid encoding the base editor and a second promoter operably linked to the guide nucleic acid.
- the promoter used to drive expression of a guide nucleic acid can include: Pol III promoters such as U6 or H1 Use of Pol II promoter and intronic cassettes to express gRNA Adeno Associated Virus (AAV).
- a Cas9 described herein with or without one or more guide nucleic can be delivered using adeno associated virus (AAV), lentivirus, adenovirus or other plasmid or viral vector types, in particular, using formulations and doses from, for example, U.S. Patent No. 8,454,972 (formulations, doses for adenovirus), U.S. Patent No.8,404,658 (formulations, doses for AAV) and U.S.
- Patent No.5,846,946 formulations, doses for DNA plasmids
- the route of administration, formulation and dose can be as in U.S. Patent No.8,454,972 and as in clinical trials involving AAV.
- the route of administration, formulation and dose can be as in U.S. Patent No. 8,404,658 and as in clinical trials involving adenovirus.
- the route of administration, formulation and dose can be as in U.S. Patent No.5,846,946 and as in clinical studies involving plasmids.
- Doses can be based on or extrapolated to an average 70 kg individual (e.g. a male adult human), and can be adjusted for patients, subjects, mammals of different weight and species. Frequency of administration is within the ambit of the medical or veterinary practitioner (e.g., physician, veterinarian), depending on usual factors including the age, sex, general health, other conditions of the patient or subject and the particular condition or symptoms being addressed.
- the viral vectors can be injected into the tissue of interest.
- the expression of the base editor and optional guide nucleic acid can be driven by a cell-type specific promoter.
- AAV can be advantageous over other viral vectors.
- AAV allows low toxicity, which can be due to the purification method not requiring ultra-centrifugation of cell particles that can activate the immune response. In some cases, AAV allows low probability of causing insertional mutagenesis because it doesn't integrate into the host genome.
- AAV has a packaging limit of 4.5 or 4.75 Kb. Constructs larger than 4.5 or 4.75 Kb can lead to significantly reduced virus production. For example, SpCas9 is quite large, the gene itself is over 4.1 Kb, which makes it difficult for packing into AAV. Therefore, embodiments of the present disclosure include utilizing a disclosed Cas9 which is shorter in length than conventional Cas9.
- An AAV can be AAV1, AAV2, AAV5 or any combination thereof.
- AAV8 is useful for delivery to the liver. A tabulation of certain AAV serotypes as to these cells can be found in Grimm, D. et al, J. Virol.82: 5887-5911 (2008)).
- Lentiviruses are complex retroviruses that have the ability to infect and express their genes in both mitotic and post-mitotic cells.
- Lentivirus The most commonly known lentivirus is the human immunodeficiency virus (HIV), which uses the envelope glycoproteins of other viruses to target a broad range of cell types.
- pCasES10 which contains a lentiviral transfer plasmid backbone
- lentiviral transfer plasmid pCasES10
- pMD2.G VSV-g pseudotype
- psPAX2 gag/pol/rev/tat
- Transfection can be done in 4 mL OptiMEM with a cationic lipid delivery agent (50 ⁇ l Lipofectamine 2000 and 100 ul Plus reagent). After 6 hours, the media is changed to antibiotic-free DMEM with 10% fetal bovine serum. These methods use serum during cell culture, but serum-free methods are preferred.
- Lentivirus can be purified as follows. Viral supernatants are harvested after 48 hours.
- Supernatants are first cleared of debris and filtered through a 0.45 ⁇ m low protein binding (PVDF) filter. They are then spun in an ultracentrifuge for 2 hours at 24,000 rpm. Viral pellets are resuspended in 50 ⁇ l of DMEM overnight at 4 ⁇ C. They are then aliquoted and immediately frozen at -80 ⁇ C.
- PVDF low protein binding
- minimal non-primate lentiviral vectors based on the equine infectious anemia virus (EIAV) are also contemplated.
- RetinoStat® an equine infectious anemia virus-based lentiviral gene therapy vector that expresses angiostatic proteins endostatin and angiostatin that is contemplated to be delivered via a subretinal injection.
- use of self-inactivating lentiviral vectors is contemplated.
- Any RNA of the systems for example a guide RNA or a Cas9-encoding mRNA, can be delivered in the form of RNA. Cas9 encoding mRNA can be generated using in vitro transcription.
- Cas9 mRNA can be synthesized using a PCR cassette containing the following elements: T7 promoter, optional kozak sequence (GCCACC), nuclease sequence, and 3’ UTR such as a 3’ UTR from beta globin-polyA tail.
- the cassette can be used for transcription by T7 polymerase.
- Guide polynucleotides e.g., gRNA
- GG sequence “GG”
- guide polynucleotide sequence can be modified to include one or more modified nucleoside e.g.
- the disclosure in some embodiments comprehends a method of modifying a cell or organism.
- the cell can be a prokaryotic cell or a eukaryotic cell.
- the cell can be a mammalian cell.
- the mammalian cell many be a non-human primate, bovine, porcine, rodent or mouse cell.
- the modification introduced to the cell by the base editors, compositions and methods of the present disclosure can be such that the cell and progeny of the cell are altered for improved production of biologic products such as an antibody, starch, alcohol or other desired cellular output.
- the modification introduced to the cell by the methods of the present disclosure can be such that the cell and progeny of the cell include an alteration that changes the biologic product produced.
- the system can comprise one or more different vectors.
- the Cas9 is codon optimized for expression the desired cell type, preferentially a eukaryotic cell, preferably a mammalian cell or a human cell.
- codon optimization refers to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon (e.g. about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence.
- Various species exhibit particular bias for certain codons of a particular amino acid.
- Codon bias (differences in codon usage between organisms) often correlates with the efficiency of translation of messenger RNA (mRNA), which is in turn believed to be dependent on, among other things, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules.
- mRNA messenger RNA
- tRNA transfer RNA
- the predominance of selected tRNAs in a cell is generally a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization. Codon usage tables are readily available, for example, at the “Codon Usage Database” available at www.kazusa.orjp/codon/ (visited Jul.9, 2002), and these tables can be adapted in a number of ways.
- codon optimizing a particular sequence for expression in a particular host cell are also available, such as Gene Forge (Aptagen; Jacobus, Pa.), are also available.
- one or more codons e.g.1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more, or all codons
- Packaging cells are typically used to form virus particles that are capable of infecting a host cell.
- Such cells include 293 cells, which package adenovirus, and psi.2 cells or PA317 cells, which package retrovirus.
- Viral vectors used in gene therapy are usually generated by producing a cell line that packages a nucleic acid vector into a viral particle.
- the vectors typically contain the minimal viral sequences required for packaging and subsequent integration into a host, other viral sequences being replaced by an expression cassette for the polynucleotide(s) to be expressed.
- the missing viral functions are typically supplied in trans by the packaging cell line.
- AAV vectors used in gene therapy typically only possess ITR sequences from the AAV genome which are required for packaging and integration into the host genome.
- Viral DNA can be packaged in a cell line, which contains a helper plasmid encoding the other AAV genes, namely rep and cap, but lacking ITR sequences.
- the cell line can also be infected with adenovirus as a helper.
- the helper virus can promote replication of the AAV vector and expression of AAV genes from the helper plasmid.
- the helper plasmid in some cases is not packaged in significant amounts due to a lack of ITR sequences. Contamination with adenovirus can be reduced by, e.g., heat treatment to which adenovirus is more sensitive than AAV.
- Pharmaceutical Compositions Other aspects of the present disclosure relate to pharmaceutical compositions comprising CRISPR system (e.g., including Cas9 disclosed herein).
- composition refers to a composition formulated for pharmaceutical use.
- the pharmaceutical composition further comprises a pharmaceutically acceptable carrier.
- the pharmaceutical composition comprises additional agents (e.g., for specific delivery, increasing half-life, or other therapeutic compounds).
- harmaceutically-acceptable material, composition or vehicle such as a liquid or solid filler, iluent, excipient, manufacturing aid (e.g., lubricant, talc magnesium, calcium or zinctearate, or steric acid), or solvent encapsulating material, involved in carrying or transportinghe compound from one site (e.g., the delivery site) of the body, to another site (e.g., organ, ssue or portion of the body).
- a pharmaceutically acceptable carrier is “acceptable” in theense of being compatible with the other ingredients of the formulation and not injurious tohe tissue of the subject (e.g., physiologically compatible, sterile, physiologic pH, etc.).
- materials which can serve as pharmaceutically-cceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, suchs corn starch and potato starch; (3) cellulose, and its derivatives, such as sodiumarboxymethyl cellulose, methylcellulose, ethyl cellulose, microcrystalline cellulose andellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) lubricating agents, suchs magnesium stearate, sodium lauryl sulfate and talc; (8) excipients, such as cocoa butter anduppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive il, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as lycerin, sorbitol, mannitol and polyethylene glycol (PEG); (12) esters, such as e
- compositions can comprise one or more pH buffering compounds to maintain the pH of the formulation at a predetermined level that reflects physiological pH,uch as in the range of about 5.0 to about 8.0.
- the pH buffering compound used in thequeous liquid formulation can be an amino acid or mixture of amino acids, such as histidine r a mixture of amino acids such as histidine and glycine.
- the pH bufferingompound is preferably an agent which maintains the pH of the formulation at a redetermined level, such as in the range of about 5.0 to about 80 and which does not chelate calcium ions.
- a redetermined level such as in the range of about 5.0 to about 80 and which does not chelate calcium ions.
- pH buffering compounds include, but are not limited to, imidazole and acetate ions.
- the pH buffering compound may be present in any amount suitable to maintain the pH of the formulation at a predetermined level.
- compositions can also contain one or more osmotic modulating agents, i.e., a compound that modulates the osmotic properties (e.g, tonicity, osmolality, and/or osmotic pressure) of the formulation to a level that is acceptable to the blood stream and blood cells of recipient individuals.
- the osmotic modulating agent can be an agent that does not chelate calcium ions.
- the osmotic modulating agent can be any compound known or available to those skilled in the art that modulates the osmotic properties of the formulation. One skilled in the art may empirically determine the suitability of a given osmotic modulating agent for use in the inventive formulation.
- osmotic modulating agents include, but are not limited to: salts, such as sodium chloride and sodium acetate; sugars, such as sucrose, dextrose, and mannitol; amino acids, such as glycine; and mixtures of one or more of these agents and/or types of agents.
- the osmotic modulating agent(s) may be present in any concentration sufficient to modulate the osmotic properties of the formulation.
- the pharmaceutical composition is formulated for delivery to a subject, e.g., for gene editing.
- Suitable routes of administrating the pharmaceutical composition described herein include, without limitation: topical, subcutaneous, transdermal, intradermal, intralesional, intraarticular, intraperitoneal, intravesical, transmucosal, gingival, intradental, intracochlear, transtympanic, intraorgan, epidural, intrathecal, intramuscular, intravenous, intravascular, intraosseus, periocular, intratumoral, intracerebral, and intracerebroventricular administration.
- the pharmaceutical composition described herein is administered locally to a diseased site.
- the pharmaceutical composition described herein is administered to a subject by injection, by means of a catheter, by means of a suppository, or by means of an implant, the implant being of a porous, non-porous, or gelatinous material, including a membrane, such as a sialastic membrane, or a fiber.
- the pharmaceutical composition described herein is delivered in a controlled release system.
- a pump can be used (See, e.g., Langer, 1990, Science 249: 1527-1533; Sefton, 1989, CRC Crit. Ref. Biomed. Eng.14:201; Buchwald et al., 1980, Surgery 88:507; Saudek et al., 1989, N.
- polymeric materials can be used.
- Medical Applications of Controlled Release (Langer and Wise eds., CRC Press, Boca Raton, Fla., 1974); Controlled Drug Bioavailability, Drug Product Design and Performance (Smolen and Ball eds., Wiley, New York, 1984); Ranger and Peppas, 1983, Macromol. Sci. Rev. Macromol. Chem.23:61. See also Levy et al., 1985, Science 228: 190; During et al., 1989, Ann. Neurol.25:351; Howard et ah, 1989, J.
- the pharmaceutical composition is formulated in accordance with routine procedures as a composition adapted for intravenous or subcutaneous administration to a subject, e.g., a human.
- pharmaceutical composition for administration by injection are solutions in sterile isotonic use as solubilizing agent and a local anesthetic such as lignocaine to ease pain at the site of the injection.
- the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent.
- the pharmaceutical can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline.
- an ampoule of sterile water for injection or saline can be provided so that the ingredients can be mixed prior to administration.
- a pharmaceutical composition for systemic administration can be a liquid, e.g., sterile saline, lactated Ringer's or Hank's solution.
- the pharmaceutical composition can be in solid forms and re-dissolved or suspended immediately prior to use. Lyophilized forms are also contemplated.
- the pharmaceutical composition can be contained within a lipid particle or vesicle, such as a liposome or microcrystal, which is also suitable for parenteral administration.
- the particles can be of any suitable structure, such as unilamellar or plurilamellar, so long as compositions are contained therein.
- Compounds can be entrapped in “stabilized plasmid-lipid particles” (SPLP) containing the fusogenic lipid dioleoylphosphatidylethanolamine (DOPE), low levels (5-10 mol%) of cationic lipid, and stabilized by a polyethyleneglycol (PEG) coating (Zhang Y. P. et ah, Gene Ther.1999, 6: 1438-47).
- SPLP stabilized plasmid-lipid particles
- DOPE fusogenic lipid dioleoylphosphatidylethanolamine
- PEG polyethyleneglycol
- lipids such as N-[l-(2,3-dioleoyloxi)propyl]-N,N,N-trimethyl- amoniummethylsulfate, or “DOTAP,” are particularly preferred for such particles and vesicles.
- DOTAP N-[l-(2,3-dioleoyloxi)propyl]-N,N,N-trimethyl- amoniummethylsulfate
- the preparation of such lipid particles is well known. See, e.g. , U.S. Patent Nos. 4,880,635; 4,906,477; 4,911,928; 4,917,951; 4,920,016; and 4,921,757; each of which is incorporated herein by reference.
- the pharmaceutical composition described herein can be administered or packaged as a unit dose, for example.
- unit dose when used in reference to a pharmaceutical composition of the present disclosure refers to physically discrete units suitable as unitary dosage for the subject, each unit containing a predetermined quantity of active material calculated to produce the desired therapeutic effect in association with the required diluent; i.e., carrier, or vehicle.
- the pharmaceutical composition can be provided as a pharmaceutical kit comprising (a) a container containing a compound of the invention in lyophilized form and (b) a second container containing a pharmaceutically acceptable diluent (e.g., sterile used for reconstitution or dilution of the lyophilized compound of the invention.
- a pharmaceutically acceptable diluent e.g., sterile used for reconstitution or dilution of the lyophilized compound of the invention.
- Optionally associated with such container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.
- an article of manufacture containing materials useful for the treatment of the diseases described above is included.
- the article of manufacture comprises a container and a label.
- Suitable containers include, for example, bottles, vials, syringes, and test tubes.
- the containers can be formed from a variety of materials such as glass or plastic.
- the container holds a composition that is effective for treating a disease described herein and can have a sterile access port.
- the container can be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle.
- the active agent in the composition is a compound of the invention.
- the label on or associated with the container indicates that the composition is used for treating the disease of choice.
- the article of manufacture can further comprise a second container comprising a pharmaceutically- acceptable buffer, such as phosphate-buffered saline, Ringer's solution, or dextrose solution. It can further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.
- the CRISPR system (e.g., including the Cas9 described herein) are provided as part of a pharmaceutical composition.
- the pharmaceutical composition comprises any of the fusion proteins provided herein (e.g., including the nucleobase editor described herein comprising LubCas9).
- the pharmaceutical composition comprises any of the complexes provided herein.
- the pharmaceutical composition comprises a ribonucleoprotein complex comprising an RNA-guided nuclease (e.g., Cas9) that forms a complex with a gRNA and a cationic lipid.
- composition comprises a gRNA, a nucleic acid programmable DNA binding protein, a cationic lipid, and a pharmaceutically acceptable excipient.
- Pharmaceutical compositions can optionally comprise one or more additional therapeutically active substances.
- Kits In one aspect, the invention provides kits containing any one or more of the elements disclosed in the above methods and compositions. In some embodiments, the kit comprises a vector system and instructions for using the kit.
- the vector system comprises one or more insertion sites for inserting a guide sequence, wherein when expressed, the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a eukaryotic cell, wherein the CRISPR complex comprises a CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) a sequence that is hybridized to the tracrRNA sequence; and/or (b) a second regulatory element operably linked to an enzyme-coding sequence encoding said CRISPR enzyme comprising a nuclear localization sequence.
- Elements may be provide individually or in combinations, and may be provided in any suitable container, such as a vial, a bottle, or a tube.
- the kit includes instructions in one or more languages, for example in more than one language.
- the kit comprises a nucleobase editor.
- the kit includes a nucleobase editor comprising the Cas9 enzymes (ScoCas9, Seq2Cas9, EhiCas9, SeqCas9, SsiCas9, SinCas9, SsaCas9, Ssc2Cas9, Sor2Cas9, SorCas9, SwaCas9, SscCas9, SgaCas9, LkuCas9 and SsuCas9) described herein.
- Cas9 enzymes ScoCas9, Seq2Cas9, EhiCas9, SeqCas9, SsiCas9, SinCas9, SsaCas9, Ssc2Cas9, Sor2Cas9, SorCas9, SwaCa
- a kit comprises one or more reagents for use in a process utilizing one or more of the elements described herein.
- Reagents may be provided in any suitable container.
- a kit may provide one or more reaction or storage buffers.
- Reagents may be provided in a form that is usable in a particular assay, or in a form that requires addition of one or more other components before use (e.g. in concentrate or lyophilized form).
- a buffer can be any buffer, including but not limited to a sodium carbonate buffer, a sodium bicarbonate buffer, a borate buffer, a Tris buffer, a MOPS buffer, a HEPES buffer, and combinations thereof.
- the buffer is alkaline.
- the buffer has a pH from about 7 to about 10.
- the kit comprises one or more oligonucleotides corresponding to a guide sequence for insertion into a vector so as to operably link the guide sequence and a regulatory element.
- the kit comprises a homologous recombination template polynucleotide.
- Example 1 Screening for novel Cas9 enzymes, discovery and optimization of novel Cas9 enzymes This example describes a screen for the discovery of novel Cas9 enzymes.
- Bioinformatics was carried out using the tblastn variant of BLAST with an e-value threshold of 1e-6 for considering BLAST hits. Briefly, loci selected for testing were loci that remained intact in the presence of Cas9 proteins from other species. Loci were selected that had greater than three spacers within the CRISPR array and greater than 1 kb endogenous sequence 5’ of Cas9 and greater than 300 nt 3’ of the CRISPR array. Using this approach, novel Cas9 enzymes were identified from different bacterial species and codon optimized for expression in human cells. The novel engineered Cas9 enzymes were then recombinantly produced and tested. Example 2.
- Staphylococcus warneri strain 691 (FIG.1J)
- Staphylococcus sciuri strain SNUC 2430 (FIG.1K) recognize the consensus PAM sequence 5’-NNGR-3’
- Staphylococcus simulans strain 19 recognizes the consensus PAM sequence 5’-NNGRRT-3’ (FIG.1D)
- Streptococcus intermedius B196 strain G1552 recognizes the consensus PAM sequence 5’- NNAAAA-3’ (FIG.1E)
- Streptococcus sanguinis SK330 recognizes the consensus PAM sequence 5’-NGGNG-3’ (FIG.1F)
- Streptococcus sp (FIG.1C)
- Lactobacillus kullabergensis strain Biut2 recognizes the consensus PAM sequence 5’- NNGAAA-3’ (FIG.1M)
- Example 3 Predicting RNA folding structure of sgRNA for novel Cas9 enzymes from Streptococcus constellatus, Sharpea spp. isolate RUG017, Veillonella parvula, Ezakiella peruensis, Lactobacillus fermentum strain AF15-40LB and Peptoniphilus sp.
- RNA folding structure of exemplary sgRNA comprising crRNA and tracrRNA for use with novel Cas9 enzymes.
- Small RNA sequencing was carried out on RNA derived from an E.coli strain heterologously expressing Cas9 Crispr loci. Briefly, RNA was isolated from stationary phase bacteria by first resuspending the E.coli in Trizol, then homogenizing the bacteria with zirconia/silica beads in a homogenizer for three 1 min cycles. Total RNA was purified from homogenized samples, DNAse treated and 3’ dephosphorylated with T4 polynucleotide kinase and rRNA was removed.
- RNA libraries were prepared from rRNA-depleted RNA, and size selected for small RNA.
- transcripts were poly-A tailed with E.coli Poly (A) polymerase, ligated with 5’ RNA adapters using T4 RNA ligase 1 and reverse transcribed, followed by PCR amplification of cDNA with barcoded primers, and sequencing on a MiSeq. Reads from each sample were identified on the basis of their associated barcode and aligned to a reference sequence using BWA. Paired-end alignments were used to extract transcript sequences using Picard tools and the sequences were analyzed using Geneious software. RNA folding was based on prediction from Geneious 11.1.2 software.
- the single sgRNA transcript fuses the crRNA to tracrRNA mimicking the dual RNA structure required to guide site-specific Cas9 activity.
- the predicted RNA folding structure for the chimeric sgRNA for use with Seq2Cas9 from Streptococcus equinus ATCC 33317 is shown in FIG. 2A
- sgRNA for use with EhiCas9 from Enterococcus hirae strain F1129E is shown in FIG. 2B
- sgRNA for use with SeqCas9 from Streptococcus equinus strain AG46 is shown in FIG. 2C
- sgRNA for use with SsiCas9 from Staphylococcus simulans strain 19 is shown in FIG.
- FIG.2E sgRNA for use with SinCas9 from Streptococcus intermedius B196 strain G1552 is shown in FIG.2E
- sgRNA for use with SsaCas9 from Streptococcus sanguinis SK330 is shown in FIG.2F
- C150 is shown in FIG.2G
- oralis strain RH_1735_08 is shown in FIG.2H, sgRNA for use with Sor2Cas9 from Streptococcus oralis subsp.
- FIG.2I oralis strain RH_1735_08 is shown in FIG.2I
- sgRNA for use with SwaCas9 from Staphylococcus warneri strain 691 is shown in FIG.2J
- sgRNA for use with SsiCas9 from Staphylococcus sciuri strain SNUC 2430 is shown in FIG.2K
- sgRNA for use with SgaCas9 from Streptococcus gallolyticus strain AM24-4 is shown in FIG.2L
- sgRNA for use with LkuCas9 from Lactobacillus kullabergensis strain Biut2 is shown in FIG.2M
- SsuCas9 from Streptococcus suis strain LSS83 is shown in FIG.2N.
- Example 4 Base editing by Cas9 enzyme with an N-terminal fusion of an adenine base editor (ABE) or a cytidine base editor (CBE)
- ABE adenine base editor
- CBE a cytidine base editor
- 25,000 HEK293T cells were plated per 96-well.100 ng of Cas9 expression plasmid and 100 ng of guide expression plasmid were transfected 24h after plating. Cells were harvested 5 days after transfection and DNA was extracted. Deep sequencing was carried out to characterize A-to-G conversion in the HEK293T cells.
- Exemplary targets were amplified using a two-round PCR region to add Illumina adapters as well as unique barcodes to the target amplicons.
- PCR products were run on a 2% gel and gel extracted. Samples were pooled, quantified and cDNA libraries were prepared and sequenced on MiSeq. The percent A-to-G conversion was determined by deep sequencing for the N-terminal as well as the C-terminal TadA8 fusion constructs.
- Table 8 shows exemplary guide RNA sequences used with Seq2Cas9.
- FIG.3A is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a Seq2Cas9 D10A mutant.
- Table 8. Guide RNA Sequences and PAM Sequences used with Seq2Cas9
- Table 9 shows exemplary guide RNA sequences used with EhiCas9.
- FIG.3B is a graph that shows results of indel frequency and adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a EhiCas9 D10A mutant.
- FIG.3C is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SeqCas9 D10A mutant.
- Table 10 shows exemplary guide RNA sequences used with SsiCas9.
- FIG.3D is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SsiCas9 D10A mutant.
- Table 11. Guide RNA Sequences and PAM Sequences for use with SSiCas9 Table 12 shows exemplary guide RNA sequences used with SinCas9.
- FIG.3E is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SinCas9 D9A mutant. Table 12.
- FIG.3F is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SsaCas9 D11A mutant.
- Table 13 shows exemplary guide RNA sequences used with SsaCas9.
- FIG.3F is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SsaCas9 D11A mutant.
- Table 13 shows exemplary guide RNA sequences used with SsaCas9.
- FIG.3F is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SsaCas9 D11A mutant.
- Table 13 shows Guide RNA Sequences and P
- Table 14 shows exemplary guide RNA sequences used with Ssc2Cas9.
- FIG.3G is a graph that shows results of indel frequency and adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a Ssc2Cas9 D9A mutant.
- Table 14 Guide RNA Sequences and PAM Sequences for use with Ssc2Cas9
- Table 15 shows exemplary guide RNA sequences used with Sor2Cas9.
- FIG.3H is a graph that shows results of indel frequency and adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a Sor2Cas9 D9A mutant.
- Table 15. Guide RNA Sequences and PAM Sequences for use with Sor2Cas9
- Table 16 shows exemplary guide RNA sequences used with SorCas9.
- FIG.3I is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SorCas9 D9A mutant. Table 16.
- FIG.3J is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SwaCas9 mutant.
- Table 17 shows exemplary guide RNA sequences used with SscCas9.
- FIG.3K is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SscCas9 mutant.
- Table 18. Guide RNA Sequences and PAM Sequences for use with SscCas9
- Table 19 shows exemplary guide RNA sequences used with SgaCas9.
- FIG.3L is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SgaCas9 mutant.
- Table 20 shows exemplary guide RNA sequences used with LkuCas9.
- FIG.3M is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a LkuCas9 mutant.
- Table 20 Guide RNA Sequences and PAM Sequences for use with LkuCas9
- Table 21 shows exemplary guide RNA sequences used with SsuCas9.
- FIG.3N is a graph that shows results of adenine to guanine base (A-to-G) conversion percentage achieved with a base editor comprising an ABE fused to the N-terminus of a SsuCas9 mutant.
- Table 21 Guide RNA Sequences and PAM Sequences for use with SsuCas9 Table 22. Summary of Cas9 Orthologs, Predicted PAM, Seed Sequence and A to G Editing Efficiency
- Table 23 discloses sequences for exemplary Cas9 adenosine or adenine for base editing functions. Table 23. Sequences of exemplary Cas9 adenosine or adenine base editors
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Medicinal Chemistry (AREA)
- Plant Pathology (AREA)
- Biophysics (AREA)
- Crystallography & Structural Chemistry (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Cell Biology (AREA)
- Veterinary Medicine (AREA)
- Virology (AREA)
- Mycology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Enzymes And Modification Thereof (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020247023120A KR20240116827A (ko) | 2021-12-17 | 2022-12-16 | 신규한 crispr 효소, 방법, 시스템 및 이의 용도 |
| JP2024535360A JP2024546841A (ja) | 2021-12-17 | 2022-12-16 | 新規crispr酵素、方法、システム、及びそれらの使用 |
| EP22854331.0A EP4448772A2 (en) | 2021-12-17 | 2022-12-16 | Crispr enzymes, methzods, systems and uses thereof |
| AU2022413670A AU2022413670A1 (en) | 2021-12-17 | 2022-12-16 | Crispr enzymes, methzods, systems and uses thereof |
| CN202280091591.0A CN119095968A (zh) | 2021-12-17 | 2022-12-16 | Crispr酶、方法、系统及其用途 |
| CA3240917A CA3240917A1 (en) | 2021-12-17 | 2022-12-16 | Crispr enzymes, methzods, systems and uses thereof |
| US18/736,840 US20240327813A1 (en) | 2021-12-17 | 2024-06-07 | Crispr enzymes, methods, systems and uses thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163291252P | 2021-12-17 | 2021-12-17 | |
| US63/291,252 | 2021-12-17 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US18/736,840 Continuation US20240327813A1 (en) | 2021-12-17 | 2024-06-07 | Crispr enzymes, methods, systems and uses thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2023114953A2 true WO2023114953A2 (en) | 2023-06-22 |
| WO2023114953A3 WO2023114953A3 (en) | 2023-07-27 |
Family
ID=85172990
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/081728 Ceased WO2023114953A2 (en) | 2021-12-17 | 2022-12-16 | Novel crispr enzymes, methods, systems and uses thereof |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US20240327813A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4448772A2 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2024546841A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20240116827A (cg-RX-API-DMAC7.html) |
| CN (1) | CN119095968A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2022413670A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3240917A1 (cg-RX-API-DMAC7.html) |
| WO (1) | WO2023114953A2 (cg-RX-API-DMAC7.html) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024227047A2 (en) | 2023-04-28 | 2024-10-31 | Beam Therapeutics Inc. | Modified guide rna |
| WO2026012368A1 (zh) * | 2024-07-08 | 2026-01-15 | 华熙生物科技股份有限公司 | 一种Cas蛋白及其基因编辑系统和应用 |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN119876089A (zh) * | 2025-01-10 | 2025-04-25 | 上海市浦东医院(复旦大学附属浦东医院) | 基于SeqCas9蛋白的CRISPR/Cas9基因编辑系统及其相关应用 |
Citations (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4797368A (en) | 1985-03-15 | 1989-01-10 | The United States Of America As Represented By The Department Of Health And Human Services | Adeno-associated virus as eukaryotic expression vector |
| US4880635A (en) | 1984-08-08 | 1989-11-14 | The Liposome Company, Inc. | Dehydrated liposomes |
| US4906477A (en) | 1987-02-09 | 1990-03-06 | Kabushiki Kaisha Vitamin Kenkyusyo | Antineoplastic agent-entrapping liposomes |
| US4911928A (en) | 1987-03-13 | 1990-03-27 | Micro-Pak, Inc. | Paucilamellar lipid vesicles |
| US4917951A (en) | 1987-07-28 | 1990-04-17 | Micro-Pak, Inc. | Lipid vesicles formed of surfactants and steroids |
| US4920016A (en) | 1986-12-24 | 1990-04-24 | Linear Technology, Inc. | Liposomes with enhanced circulation time |
| US4921757A (en) | 1985-04-26 | 1990-05-01 | Massachusetts Institute Of Technology | System for delayed and pulsed release of biologically active substances |
| US5173414A (en) | 1990-10-30 | 1992-12-22 | Applied Immune Sciences, Inc. | Production of recombinant adeno-associated virus vectors |
| WO1993024641A2 (en) | 1992-06-02 | 1993-12-09 | The United States Of America, As Represented By The Secretary, Department Of Health & Human Services | Adeno-associated virus with inverted terminal repeat sequences as promoter |
| US5846946A (en) | 1996-06-14 | 1998-12-08 | Pasteur Merieux Serums Et Vaccins | Compositions and methods for administering Borrelia DNA |
| US8404658B2 (en) | 2007-12-31 | 2013-03-26 | Nanocor Therapeutics, Inc. | RNA interference for the treatment of heart failure |
| US8454972B2 (en) | 2004-07-16 | 2013-06-04 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Method for inducing a multiclade immune response against HIV utilizing a multigene and multiclade immunogen |
| US9405700B2 (en) | 2010-11-04 | 2016-08-02 | Sonics, Inc. | Methods and apparatus for virtualization in an integrated circuit |
| WO2017070632A2 (en) | 2015-10-23 | 2017-04-27 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| WO2018027078A1 (en) | 2016-08-03 | 2018-02-08 | President And Fellows Of Harard College | Adenosine nucleobase editors and uses thereof |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| SG11201906297QA (en) * | 2017-03-24 | 2019-10-30 | Curevac Ag | Nucleic acids encoding crispr-associated proteins and uses thereof |
-
2022
- 2022-12-16 CA CA3240917A patent/CA3240917A1/en active Pending
- 2022-12-16 AU AU2022413670A patent/AU2022413670A1/en active Pending
- 2022-12-16 EP EP22854331.0A patent/EP4448772A2/en active Pending
- 2022-12-16 WO PCT/US2022/081728 patent/WO2023114953A2/en not_active Ceased
- 2022-12-16 KR KR1020247023120A patent/KR20240116827A/ko active Pending
- 2022-12-16 JP JP2024535360A patent/JP2024546841A/ja active Pending
- 2022-12-16 CN CN202280091591.0A patent/CN119095968A/zh active Pending
-
2024
- 2024-06-07 US US18/736,840 patent/US20240327813A1/en active Pending
Patent Citations (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4880635B1 (en) | 1984-08-08 | 1996-07-02 | Liposome Company | Dehydrated liposomes |
| US4880635A (en) | 1984-08-08 | 1989-11-14 | The Liposome Company, Inc. | Dehydrated liposomes |
| US4797368A (en) | 1985-03-15 | 1989-01-10 | The United States Of America As Represented By The Department Of Health And Human Services | Adeno-associated virus as eukaryotic expression vector |
| US4921757A (en) | 1985-04-26 | 1990-05-01 | Massachusetts Institute Of Technology | System for delayed and pulsed release of biologically active substances |
| US4920016A (en) | 1986-12-24 | 1990-04-24 | Linear Technology, Inc. | Liposomes with enhanced circulation time |
| US4906477A (en) | 1987-02-09 | 1990-03-06 | Kabushiki Kaisha Vitamin Kenkyusyo | Antineoplastic agent-entrapping liposomes |
| US4911928A (en) | 1987-03-13 | 1990-03-27 | Micro-Pak, Inc. | Paucilamellar lipid vesicles |
| US4917951A (en) | 1987-07-28 | 1990-04-17 | Micro-Pak, Inc. | Lipid vesicles formed of surfactants and steroids |
| US5173414A (en) | 1990-10-30 | 1992-12-22 | Applied Immune Sciences, Inc. | Production of recombinant adeno-associated virus vectors |
| WO1993024641A2 (en) | 1992-06-02 | 1993-12-09 | The United States Of America, As Represented By The Secretary, Department Of Health & Human Services | Adeno-associated virus with inverted terminal repeat sequences as promoter |
| US5846946A (en) | 1996-06-14 | 1998-12-08 | Pasteur Merieux Serums Et Vaccins | Compositions and methods for administering Borrelia DNA |
| US8454972B2 (en) | 2004-07-16 | 2013-06-04 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Method for inducing a multiclade immune response against HIV utilizing a multigene and multiclade immunogen |
| US8404658B2 (en) | 2007-12-31 | 2013-03-26 | Nanocor Therapeutics, Inc. | RNA interference for the treatment of heart failure |
| US9405700B2 (en) | 2010-11-04 | 2016-08-02 | Sonics, Inc. | Methods and apparatus for virtualization in an integrated circuit |
| WO2017070632A2 (en) | 2015-10-23 | 2017-04-27 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| WO2018027078A1 (en) | 2016-08-03 | 2018-02-08 | President And Fellows Of Harard College | Adenosine nucleobase editors and uses thereof |
Non-Patent Citations (48)
| Title |
|---|
| "Drug Product Design and Performance", 1984, WILEY, article "Controlled Drug Bioavailability" |
| "Immobilized Cells and Enzymes", 1986, IRL PRESS |
| "Medical Applications of Controlled Release", 1974, CRC PRESS |
| ALTSCHUL ET AL., METHODS IN ENZYMOLOGY |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
| ALTSCHUL ET AL.: "Basic local alignment search tool", J. MOL. BIOL., vol. 215, no. 3, 1990, pages 403 - 410, XP002949123, DOI: 10.1006/jmbi.1990.9999 |
| ANIMAL CELL CULTURE, 1986 |
| B. PERBAL, A PRACTICAL GUIDE TO MOLECULAR CLONING, 1984 |
| BARBOUR ET AL., BIOSCI REP, vol. 33, no. 1, 18 January 2013 (2013-01-18) |
| BAXEVANIS ET AL.: "Bioinformatics : A Practical Guide to the Analysis of Genes and Proteins", 1998, WILEY |
| BUCHSCHER ET AL., J. VIROL., vol. 66, 1992, pages 1635 - 1640 |
| BUCHWALD ET AL., SURGERY, vol. 88, 1980, pages 507 |
| CHU ET AL., BIOORG MED CHEM LETT, vol. 18, no. 22, 15 November 2008 (2008-11-15), pages 5941 - 4 |
| DNA CLONING: A PRACTICAL APPROACH, 1985 |
| DOHMEN ET AL., SCIENCE, vol. 263, no. 5151, 1994, pages 1273 - 1276 |
| DURING ET AL., ANN. NEUROL., vol. 25, 1989, pages 351 |
| GAUDELLI, N.M. ET AL.: "Programmable base editing of A·T to G·C in genomic DNA without DNA cleavage", NATURE, vol. 551, 2017, pages 464 - 471 |
| GREUSSING ET AL., J VIS EXP, 10 November 2012 (2012-11-10) |
| GRIMM, D. ET AL., J. VIROL., vol. 82, 2008, pages 5887 - 5911 |
| HERMONATMUZYCZKA, PNAS, vol. 81, 1984, pages 6466 - 6470 |
| HOWARD, J. NEUROSURG, vol. 71, 1989, pages 105 |
| KANEMAKI, PFLUGERS ARCH, 28 December 2012 (2012-12-28) |
| KOMOR, A.C. ET AL.: "Improved base excision repair inhibition and bacteriophage Mu Gam protein yields C:G-to-T:A base editors with higher efficiency and product purity", SCIENCE ADVANCES, vol. 3, 2017, XP055453964, DOI: 10.1126/sciadv.aao4774 |
| KOMOR, A.C. ET AL.: "Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage", NATURE, vol. 533, 2016, pages 420 - 424, XP055968803, DOI: 10.1038/nature17946 |
| KOTIN, HUMAN GENE THERAPY, vol. 5, 1994, pages 793 - 801 |
| LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533 |
| LEVY ET AL., SCIENCE, vol. 228, 1985, pages 190 |
| MILLER ET AL., J. VIROL., vol. 65, 1991, pages 2220 - 2224 |
| MIYAGISHI ET AL., NATURE BIOTECHNOLOGY, vol. 20, 2002, pages 497 - 500 |
| MUZYCZKA, J. CLIN. INVEST., vol. 94, 1994, pages 1351 |
| NAKAMURA, Y. ET AL.: "Codon usage tabulated from the international DNA sequence databases: status for the year 2000", NUCL. ACIDS RES., vol. 28, 2000, pages 292, XP002941557, DOI: 10.1093/nar/28.1.292 |
| NUCLEIC ACID HYBRIDIZATION, 1985 |
| OLIGONUCLEOTIDE SYNTHESIS, 1984 |
| RANGERPEPPAS, MACROMOL. SCI. REV. MACROMOL. CHEM., vol. 23, 1983, pages 61 |
| REES, H.A. ET AL.: "Base editing: precision chemistry on the genome and transcriptome of living cells", NAT REV GENET, vol. 19, no. 12, December 2018 (2018-12-01), pages 770 - 788 |
| REESLIU, NATURE REVIEW GENETICS, vol. 19, no. 12, 2018, pages 770 - 788 |
| SAMULSKI ET AL., J. VIROL., vol. 63, 1989, pages 03822 - 3828 |
| SAUDEK ET AL., N. ENGL. J. MED., vol. 321, 1989, pages 574 |
| SCHOEBER ET AL., AM J PHYSIOL RENAL PHYSIOL., vol. 296, January 2009 (2009-01-01) |
| SEFTON, CRC CRIT. REF. BIOMED. ENG., vol. 14, 1989, pages 201 |
| SOMMNERFELT ET AL., VIROL, vol. 176, 1990, pages 58 - 59 |
| TRATSCHIN ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 3251 - 3260 |
| WEST ET AL., VIROLOGY, vol. 160, 1987, pages 38 - 47 |
| WOOD ET AL., J. BIOL. CHEM., vol. 289, no. 21, 2014 |
| XIA ET AL., NUCLEIC ACIDS RES., vol. 31, 1 September 2003 (2003-09-01), pages 17 |
| YANG ET AL., MOL CELL, vol. 48, no. 4, 30 November 2012 (2012-11-30), pages 487 - 8 |
| ZHANG Y. P., GENE THER, vol. 132, 1999, pages 1438 - 47 |
| ZURIS, J.A. ET AL., NAT. BIOTECHNOLOGY, vol. 33, no. 1, 2015, pages 73 - 80 |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024227047A2 (en) | 2023-04-28 | 2024-10-31 | Beam Therapeutics Inc. | Modified guide rna |
| WO2026012368A1 (zh) * | 2024-07-08 | 2026-01-15 | 华熙生物科技股份有限公司 | 一种Cas蛋白及其基因编辑系统和应用 |
Also Published As
| Publication number | Publication date |
|---|---|
| CN119095968A (zh) | 2024-12-06 |
| WO2023114953A3 (en) | 2023-07-27 |
| CA3240917A1 (en) | 2023-06-22 |
| US20240327813A1 (en) | 2024-10-03 |
| AU2022413670A1 (en) | 2024-07-04 |
| JP2024546841A (ja) | 2024-12-26 |
| EP4448772A2 (en) | 2024-10-23 |
| KR20240116827A (ko) | 2024-07-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240167008A1 (en) | Novel crispr enzymes, methods, systems and uses thereof | |
| JP7826199B2 (ja) | 合成ガイドrna、組成物、方法、およびそれらの使用 | |
| US20230279373A1 (en) | Novel crispr enzymes, methods, systems and uses thereof | |
| US20240327813A1 (en) | Crispr enzymes, methods, systems and uses thereof | |
| US20240376468A1 (en) | CIRCULAR GUIDE RNAs FOR CRISPR/CAS EDITING SYSTEMS | |
| KR20240037299A (ko) | Crispr/cas 편집 시스템용 가이드 rna | |
| US20250101394A1 (en) | Novel crispr-cas12i systems and uses thereof | |
| US20240252550A1 (en) | Genetic modification of hepatocytes | |
| WO2024108092A1 (en) | Prime editor delivery by aav | |
| US20250288690A1 (en) | Rna base editing compositions, systems, methods and uses thereof | |
| CN117916373A (zh) | 用于crispr/cas编辑系统的引导rna |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22854331 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3240917 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024535360 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022413670 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 20247023120 Country of ref document: KR Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022854331 Country of ref document: EP Effective date: 20240717 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280091591.0 Country of ref document: CN |