WO2023102537A2 - Self-assembling virus-like particles for delivery of nucleic acid programmable fusion proteins and methods of making and using same - Google Patents
Self-assembling virus-like particles for delivery of nucleic acid programmable fusion proteins and methods of making and using same Download PDFInfo
- Publication number
- WO2023102537A2 WO2023102537A2 PCT/US2022/080834 US2022080834W WO2023102537A2 WO 2023102537 A2 WO2023102537 A2 WO 2023102537A2 US 2022080834 W US2022080834 W US 2022080834W WO 2023102537 A2 WO2023102537 A2 WO 2023102537A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- virus
- protein
- nes
- particle
- gag
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
- C07K14/08—RNA viruses
- C07K14/15—Retroviridae, e.g. bovine leukaemia virus, feline leukaemia virus human T-cell leukaemia-lymphoma virus
- C07K14/155—Lentiviridae, e.g. human immunodeficiency virus [HIV], visna-maedi virus or equine infectious anaemia virus
- C07K14/16—HIV-1 ; HIV-2
- C07K14/161—HIV-1 ; HIV-2 gag-pol, e.g. p55, p24/25, p17/18, p7, p6, p66/68, p51/52, p31/34, p32, p40
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/102—Mutagenizing nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
- C12N9/222—Clustered regularly interspaced short palindromic repeats [CRISPR]-associated [CAS] enzymes
- C12N9/226—Class 2 CAS enzyme complex, e.g. single CAS protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/78—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y305/00—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
- C12Y305/04—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in cyclic amidines (3.5.4)
- C12Y305/04001—Cytosine deaminase (3.5.4.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y305/00—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
- C12Y305/04—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in cyclic amidines (3.5.4)
- C12Y305/04004—Adenosine deaminase (3.5.4.4)
-
- C—CHEMISTRY; METALLURGY
- C40—COMBINATORIAL TECHNOLOGY
- C40B—COMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
- C40B40/00—Libraries per se, e.g. arrays, mixtures
- C40B40/04—Libraries containing only organic compounds
- C40B40/06—Libraries containing nucleotides or polynucleotides, or derivatives thereof
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/09—Fusion polypeptide containing a localisation/targetting motif containing a nuclear localisation signal
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/095—Fusion polypeptide containing a localisation/targetting motif containing a nuclear export signal
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
- C12N15/1137—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against enzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2320/00—Applications; Uses
- C12N2320/30—Special therapeutic applications
- C12N2320/34—Allele or polymorphism specific uses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/13011—Gammaretrovirus, e.g. murine leukeamia virus
- C12N2740/13022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/13011—Gammaretrovirus, e.g. murine leukeamia virus
- C12N2740/13023—Virus like particles [VLP]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/13011—Gammaretrovirus, e.g. murine leukeamia virus
- C12N2740/13041—Use of virus, viral particle or viral elements as a vector
- C12N2740/13045—Special targeting system for viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
- C12Y301/01—Carboxylic ester hydrolases (3.1.1)
- C12Y301/01064—Retinoid isomerohydrolase (3.1.1.64)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
- C12Y304/21—Serine endopeptidases (3.4.21)
- C12Y304/21061—Kexin (3.4.21.61), i.e. proprotein convertase subtilisin/kexin type 9
Definitions
- Cytosine base editors (CBEs) (Komor et al., 2016; Nishida et al., 2016) and adenine base editors (ABEs) (Gaudelli et al., 2017) in principle can together correct the majority of known disease-causing single-nucleotide variants (Anzalone et al., 2020; Rees and Liu, 2018).
- BEs have been applied to correct pathogenic point mutations and rescue disease phenotypes in mice and non-human primates (Levy et al., 2020; Yeh et al., 2020), highlighting the potential of in vivo base editing as a therapeutic strategy.
- eVLPs as a useful platform for transiently delivering gene editing agents (e.g., Cas9 or BE ribonucleoproteins) in vitro and in vivo with therapeutically relevant efficiencies and with minimized risk of off- target editing or DNA integration and similarly improves the in vivo delivery of other proteins and RNPs.
- gene editing agents e.g., Cas9 or BE ribonucleoproteins
- the present disclosure provides VLPs comprising a group- specific antigen (gag) protease (pro) polyprotein, a nucleic acid programmable DNA binding protein (napDNAbp), and a fusion protein comprising a gag nucleocapsid protein and a nuclear export sequence (NES), encapsulated by a lipid membrane and a viral envelope glycoprotein.
- the present disclosure provides VLPs comprising a mixture of cleaved and uncleaved products (i.e., some of the napDNAbps or BEs have been cleaved from the gag proteins and are free, while some have not yet been cleaved from the gag proteins).
- the napDNAbp is fused to one or more additional domains such as one or more NLS and/or one or more deaminase (z.e., to form a base editor).
- additional domains such as one or more NLS and/or one or more deaminase (z.e., to form a base editor).
- Each component of the pharmaceutical compositions provided herein may comprise any of the options described above in reference to the VLPs, or any of the other options provided by the present disclosure.
- a pharmaceutical composition further comprises a pharmaceutically acceptable excipient.
- FIGS. 2A-2G Optimization of BE-VLPs (identifying and engineering solutions to bottlenecks that limit VLP potency results in v2, v3, and v4 eVLPs).
- FIG. 2A More efficient linker cleavage leads to improved cargo release after VLP maturation.
- FIG. 2B Adenine base editing efficiencies of vl and v2 BE-eVLPs at position A7 of the BCL11A enhancer site in HEK293T cells. Optimization of protease-cleavable linker sequence is shown (see also FIG. 8).
- FIG 2C Improved localization of cargo in producer cells leads to more efficient incorporation into eVLPs.
- FIG. 1 Improved localization of cargo in producer cells leads to more efficient incorporation into eVLPs.
- FIG. 31 Molecules of BE-encoding DNA per v4 BE-eVLP detected by qPCR of lysed VLPs or lysis buffer only.
- FIG. 3J Amount of BE-encoding DNA detected by qPCR of lysate from cells that were either treated with BE- VLPs or transfected with BE-encoding plasmids.
- 8e- LV ABE8e-NG-LV
- 8e-eVLP v4 ABE8e-NG-eVLP.
- FIG. 7E Scotopic a-wave and b- wave amplitudes measured by ERG following overnight dark adaptation.
- FIG. 10D Comparison of editing efficiencies with particle
- the present disclosure provides pluralities of polynucleotides encoding the eVLP (e.g., BE- VLP) self-assembling component as described herein.
- the present disclosure provides pluralities of polynucleotides comprising: (i) a first polynucleotide (e.g., a plasmid) comprising a nucleic acid sequence encoding a viral envelope glycoprotein; (ii) a second polynucleotide (e.g., a plasmid) comprising a nucleic acid sequence encoding a group- specific antigen (gag) protease (pro) polyprotein; (iii) a third polynucleotide (e.g., a plasmid) comprising a nucleic acid sequence encoding a fusion protein, wherein the fusion protein comprises: (a) a group-specific antigen (gag) nucleocap
- FIGs. 19A-19B v4 BE-eVLPs enable efficient on-target editing with minimal off- target editing. Lower Cas-dependent off-target editing was observed compared to previous base editing approaches targeting the same site (e.g., Zeng et al., Nat. Med. (2020)).
- the ecTadA deaminase does not comprise an N-terminal methionine.
- the adenosine deaminase comprises ecTadA(8e) (z.e., as used in the base editor ABE8e) as described further herein. Reference is made to U.S. Patent Publication No. 2018/0073012, published March 15, 2018, which is incorporated herein by reference.
- Base editing refers to genome editing technology that involves the conversion of a specific nucleic acid base into another at a targeted genomic locus. In certain embodiments, this can be achieved without requiring double- stranded DNA breaks (DSB), or single stranded breaks (z.e., nicking).
- DSB double- stranded DNA breaks
- z.e., nicking single stranded breaks
- CRIS PR-based systems begin with the introduction of a DSB at a locus of interest. Subsequently, cellular DNA repair enzymes mend the break, commonly resulting in random insertions or deletions (indels) of bases at the site of the DSB.
- nucleobase editor is capable of deaminating an adenine (A) in DNA.
- nucleobase editors may include a nucleic acid programmable DNA binding protein (napDNAbp) fused to an adenosine deaminase.
- napDNAbp nucleic acid programmable DNA binding protein
- Some nucleobase editors include CRISPR-mediated fusion proteins that are utilized in the base editing methods described herein.
- the nucleobase editor comprises a DNA binding domain (e.g., a programmable DNA binding domain such as a dCas9 or nCas9) that directs it to a target sequence.
- the nucleobase editor comprises a nucleobase modification domain fused to a programmable DNA binding domain (e.g., dCas9 or nCas9).
- a to G editing is carried out by a deaminase, e.g., an adenosine deaminase.
- Nucleobase editors that can carry out other types of base conversions (e.g., C to G) are also contemplated.
- a “split nucleobase editor” refers to a nucleobase editor that is provided as an N- terminal portion (also referred to as a N-terminal half) and a C-terminal portion (also referred to as a C-terminal half) encoded by two separate nucleic acids.
- the polypeptides corresponding to the N-terminal portion and the C-terminal portion of the nucleobase editor may be combined to form a complete nucleobase editor.
- the “split” is located in the dCas9 or nCas9 domain, at positions as described herein in the split Cas9.
- cytosine deaminase refers to an enzyme that catalyzes the chemical reaction “cytosine + H2O uracil + NH3” or “5-methyl-cytosine + H2O thymine + NH3.”
- cytosine deaminase refers to an enzyme that catalyzes the chemical reaction “cytosine + H2O uracil + NH3” or “5-methyl-cytosine + H2O thymine + NH3.”
- cytosine deaminase or “cytidine deaminase” refers to an enzyme that catalyzes the chemical reaction “cytosine + H2O uracil + NH3” or “5-methyl-cytosine + H2O thymine + NH3.”
- a Cas9 nuclease is also referred to sometimes as a casnl nuclease or a CRTS PR (Clustered Regularly Interspaced Short Palindromic Repeat)-associated nuclease.
- CRISPR is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements, and conjugative plasmids).
- CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids.
- CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA).
- CRISPR biology as well as Cas9 nuclease sequences and structures are well known to those of skill in the art (see, e.g., “Complete genome sequence of an Ml strain of Streptococcus pyogenes.” Ferretti et al., J.
- the deaminases provided herein may be from any organism, such as a bacterium.
- the deaminase or deaminase domain is a variant of a naturally-occurring deaminase from an organism.
- the deaminase or deaminase domain does not occur in nature.
- the deaminase or deaminase domain is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75% at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally-occurring deaminase.
- Another example includes fusion of a Cas9 or equivalent thereof to a deaminase.
- Any of the proteins provided herein may be produced by any method known in the art.
- the proteins provided herein may be produced via recombinant protein expression and purification, which is especially suited for fusion proteins comprising a peptide linker.
- Methods for recombinant protein expression and purification are well known, and include those described by Green and Sambrook, Molecular Cloning: A Laboratory Manual (4 th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)), the entire contents of which is incorporated herein by reference.
- Gag proteins can vary widely.
- HIV-1 Gag additionally codes for a C-terminal p6 protein as well as two spacer proteins, SP1 and SP2, which demarcate the CA-NC and NC-p6 junctions, but HTLV-1 contains no additional sequences outside of MA, CA, and NC (Oroszlan and Copeland, 1985; Henderson et al., 1992).
- the linker is 5-200 amino acids in length, for example, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 30-35, 35-40, 40-45, 45- 50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-150, or 150-200 amino acids in length. Longer or shorter linkers are also contemplated.
- a “cleavable linker” refers to a linker that can be split or cut by any means.
- the linker can be an amino acid sequence.
- the linker between the NES and the napDNAbp of the BE-VLPs provided herein comprises a cleavable linker.
- a cleavable linker may comprise a self-cleaving peptide (e.g., a 2A peptide such as EGRGSLLTCGDVEENPGP (SEQ ID NO: 9), ATNFSLLKQAGDVEENPGP (SEQ ID NO: 10), QCTNYALLKLAGDVESNPGP (SEQ ID NO: 11), or VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 12)).
- a self-cleaving peptide e.g., a 2A peptide such as EGRGSLLTCGDVEENPGP (SEQ ID NO: 9), ATNFSLLKQAGDVEENPGP (SEQ ID NO: 10), QCT
- the binding mechanism of a napDNAbp - guide RNA complex includes the step of forming an R-loop whereby the napDNAbp induces the unwinding of a double-strand DNA target, thereby separating the strands in the region bound by the napDNAbp.
- the guide RNA protospacer then hybridizes to the “target strand.” This displaces a “non-target strand” that is complementary to the target strand, which forms the single strand region of the R-loop.
- the napDNAbp includes one or more nuclease activities, which then cut the DNA, leaving various types of lesions.
- a "nickase” refers to a napDNAbp (e.g., a Cas protein) which is capable of cleaving only one of the two complementary strands of a double- stranded target DNA sequence, thereby generating a nick in that strand.
- the nickase cleaves a non-target strand of a double stranded target DNA sequence.
- the nickase comprises an amino acid sequence with one or more mutations in a catalytic domain of a canonical napDNAbp (e.g., a Cas protein), wherein the one or more mutations reduces or abolishes nuclease activity of the catalytic domain.
- nuclear export sequence refers to an amino acid sequence that promotes transport of a protein out of the cell nucleus to the cytoplasm, for example, through the nuclear pore complex by nuclear transport.
- Nuclear export sequences are known in the art and would be apparent to the skilled artisan.
- NES sequences are described in Xu, D. et al. Sequence and structural analyses of nuclear export signals in the NESdb database. Mol Biol. Cell. 2012, 23(18) 3677-3693, the contents of which are incorporated herein by reference.
- a protease cleavage site comprises an MMLV protease cleavage site or an FMLV protease cleavage site.
- a protease cleavage site comprises one of the amino acid sequences TSTLLMENSS (SEQ ID NO: 1 ), PRSSLYPALTP (SEQ ID NO: 2), VQALVLTQ (SEQ ID NO: 3), PLQVLTLNIERR (SEQ ID NO: 4), or an amino acid sequence at least 90% identical to any one of SEQ ID NOs: 1-4.
- protein refers to a polymer of amino acid residues linked together by peptide (amide) bonds.
- the terms refer to a protein, peptide, or polypeptide of any size, structure, or function. Typically, a protein, peptide, or polypeptide will be at least three amino acids long.
- a protein, peptide, or polypeptide may refer to an individual protein or a collection of proteins.
- the term “subject,” as used herein, refers to an individual organism, for example, an individual mammal.
- the subject is a human.
- the subject is a non-human mammal.
- the subject is a non-human primate.
- the subject is a rodent.
- the subject is a sheep, a goat, a cattle, a cat, or a dog.
- the subject is a vertebrate, an amphibian, a reptile, a fish, an insect, a fly, or a nematode.
- the subject is a research animal.
- the subject is genetically engineered, e.g., a genetically engineered non-human subject. The subject may be of either sex and at any stage of development.
- vector refers to a nucleic acid that can be modified to encode a gene of interest and that is able to enter a host cell, mutate, and replicate within the host cell, and then transfer a replicated form of the vector into another host cell.
- exemplary suitable vectors include viral vectors, such as retroviral vectors or bacteriophages and filamentous phage, and conjugative plasmids. Additional suitable vectors will be apparent to those of skill in the art based on the instant disclosure.
- a viral envelope glycoprotein is an adenoviral envelope glycoprotein, an adeno-associated viral envelope glycoprotein, a retroviral envelope glycoprotein, or a lentiviral envelope glycoprotein.
- a viral envelope glycoprotein is a vesicular stomatitis virus G protein (VSV-G), a baboon retroviral envelope glycoprotein (BaEVRless), a FuG-B2 envelope glycoprotein, an HIV-1 envelope glycoprotein, or an ecotropic murine leukemia virus (MLV) envelope glycoprotein.
- VSV-G vesicular stomatitis virus G protein
- BaEVRless baboon retroviral envelope glycoprotein
- FuG-B2 envelope glycoprotein an HIV-1 envelope glycoprotein
- MMV ecotropic murine leukemia virus
- the cargo protein is a base editor.
- the multi-protein core region of the VLPs further comprises one or more guide RNA molecules which are complexed with the napDNAbp or the base editor to form a ribonucleoprotein (RNP).
- RNP ribonucleoprotein
- the VLPs are prepared in a producer cell that is transiently transformed with plasmid DNA that encodes that various protein and nucleic acid (sgRNA) components of the VLPs. The components self-assemble at the cell membrane and bud out in accordance with the naturally occurring mechanism of retroviral budding in order to release from the cell fully-matured VLPs.
- the Gag-cargo fusion (e.g., Gag::BE) further comprises one or more nuclear export signals at one or more locations along the length of the fusion polypeptide protein which may be joined by a cleavable linker such that during VLP assembly in the producer cell, the Gag-cargo fusions (due to presence of competing NLS signals) do not accumulate in the nucleus of the producer cells but instead are available in the cytoplasm to undergo the VLP assembly process at the cell membrane.
- the NES may be cleaved by Pro-Pol thereby separating the cargo (e.g., napDNAbp or a BE) from the NES.
- the cargo e.g., napDNAbp or BE, typically flanked with one or more NLS elements
- the cargo will not comprise an NES element, which may otherwise prohibit the transport of the carbo into the nuclease and hinder gene editing activity.
- This is exemplified as v.3 VLPs described herein (or “third generation” VLPs).
- the inventors found an optimized stoichiometry ratio of Gag-cargo fusion to Gag-Pro-Pol fusion protein which balances the amount of Gag-cargo available to be packaged into VLPs with the amount of retrovirus protease (the “Pro” in the Gag-Pro-Pol fusion) required for VLP maturation.
- the optimized ratio of Gag-cargo fusion to Gag-Pro-Pol fusion protein is achieved by the appropriate ratio of plasmids encoding each component which are transiently delivered to the producer cells.
- wild type is a term of the art understood by skilled persons and means the typical form of an organism, strain, gene or characteristic as it occurs in nature as distinguished from mutant or variant forms.
- the present disclosure also describes the optimization of a protease cleavage site which separates the NES and VLP proteins from the rest of the base editor to promote highly efficient cleavage and delivery of the BE. Finally, the present disclosure also describes the optimization of the ratios of various components of the BE-VLPs, ensuring high efficiency of BE- VLP production.
- the eVLPs comprise a supra-molecular assembly comprising (a) an envelope comprising (i) a lipid membrane (e.g., single-layer or bi-layer membrane) and a (ii) viral envelope glycoprotein and (b) a multi-protein core region enclosed by the envelope and comprising (i) a Gag protein, (ii) a Gag-Pro-Pol protein, and (iii) a Gag-cargo fusion protein comprising a Gag protein fused to a cargo protein (e.g., a napDNAbp or BE) via a cleavable linker (e.g., a protease-cleavable linker).
- a cleavable linker e.g., a protease-cleavable linker
- the VLP is administered to a recipient cell and taken up by said recipient cell, the contents of the VLP are released, e.g., released BE RNP and/or napDNAbp RNP.
- the RNPs may translocate to the nuclease of the cell (in particular, where NLSs are included on the RNPs), where DNA editing may occur at target sites specified by the guide RNA.
- Various embodiments comprise one or more improvements.
- the Gag-cargo fusion (e.g., Gag-BE) further comprises one or more nuclear export signals at one or more locations along the length of the fusion polypeptide protein which may be joined by a cleavable linker such that during VLP assembly in the producer cell, the Gag-cargo fusions (due to presence of competing NLS signals) do not accumulate in the nucleus of the producer cells but instead are available in the cytoplasm to undergo the VLP assembly process at the cell membrane.
- the NES may be cleaved by Gag- Pro-Pol thereby separating the cargo (e.g., napDNAbp or a BE) from the NES.
- the present disclosure provides an eVLP comprising an (a) envelope, and (b) a multi-protein core, wherein the envelope comprises a lipid membrane (e.g., a lipid mono- or bi-layer membrane) and a viral envelope glycoprotein, and wherein the multi-protein core comprises a Gag (e.g., a retroviral Gag), a group- specific antigen (gag) protease (pro) polyprotein (z.e., “Gag-Pro-Pol”), and a fusion
- the Gag-cargo fusion proteins described herein comprise one or more cleavable linkers.
- the Gag-cargo fusion proteins comprise a cleavable linker joining the Gag to the cargo, such that once the Gag-cargo fusion has been packaged in mature VLPs (which will also contain the Gag-Pro-Pol, the protease activity can cleave the Gag-cargo cleavable linker, thereby releasing the cargo.
- a cleavable linker may also be provided in such a location such that when the cleavable linker is cleaved (e.g., by the Gag-Pro-Pol protein), the NES is separated away from the cargo protein.
- the gag-pro polyprotein of the BE-VLPs described herein comprises an MMLV gag-pro polyprotein or an FMLV gag-pro polyprotein.
- the gag nucleocapsid protein of the fusion protein in the BE-VLPs described herein comprises an MMLV gag nucleocapsid protein or an FMLV gag nucleocapsid protein.
- the fusion protein comprises the following non-limiting structures:
- viral vector particles which generally contain coding nucleic acids of interest
- virus-derived particles which do not contain coding nucleic acids of interest but instead are designed to deliver a protein cargo (e.g., a BE RNP).
- a protein cargo e.g., a BE RNP
- viral vector particles encompass retroviral, lentiviral, adenoviral, and adeno-associated viral vector particles that are well known in the art.
- the one skilled in the art may notably refer to Kushnir et al. (2012, Vaccine, Vol. 31: 58-83), Zeltons (2013, Mol Biotechnol, Vol. 53: 92-107), Ludwig et al. (2007, Curr Opin Biotechnol, Vol. 18(no 6): 537-55) and Naskalaska et al. (2015, Vol. 64 (no 1): 3-13).
- retroviral vector including lentiviral vectors
- the host range of retroviral vector may be expanded or altered by a process known as pseudotyping.
- Pseudotyped lentiviral vectors consist of viral vector particles bearing glycoproteins derived from other enveloped viruses. Such pseudotyped viral vector particles possess the tropism of the virus from which the glycoprotein is derived.
- a virus-like particle further comprises a viral envelope protein, wherein either (i) the said viral envelope protein originates from the same virus as the viral structural protein, e.g., originates from the same virus as the viral Gag protein, or (ii) the said viral envelope protein originates from a virus distinct from the virus from which originates the viral structural protein, e.g., originates from a virus distinct from the virus from which originates the viral Gag protein.
- Influenza virus-derived vector particles For preparing Influenza virus-derived vector particles, one skilled in the art may notably refer to the methods disclosed by Quan et al. (2012, Virology, Vol. 430: 127-135) and to Eatham et al. (2001, Journal of Virology, Vol. 75(no 13): 6154-6155), which is incorporated herein by reference.
- Hepatitis B virus-derived vector particles For preparing Hepatitis B virus-derived vector particles, one skilled in the art may notably refer to the methods disclosed by Hong et al. (2013, Vol. 87(no 12): 6615-6624), which is incorporated herein by reference.
- Hepatitis E virus-derived vector particles For preparing Hepatitis E virus-derived vector particles, one skilled in the art may notably refer to the methods disclosed by Li et al. (1997, Journal of Virology, Vol. 71(no 10): 7207-7213), which is incorporated herein by reference.
- Parvovirus-derived vector particles For preparing Parvovirus-derived vector particles, one skilled in the art may notably refer to the methods disclosed by Ogasawara et al. (2006, In Vivo, Vol. 20: 319-324), which is incorporated herein by reference.
- the BE-VLPs disclosed herein, as well as the fusion proteins that make up the core component of the presently described BE-VLPs comprise a nucleic acid programmable DNA binding protein (napDNAbp).
- napDNAbp nucleic acid programmable DNA binding protein
- the BE-VLPs and fusion proteins may include a napDNAbp domain having a wild type Cas9 sequence, including, for example the canonical Streptococcus pyogenes Cas9 sequence of SEQ ID NO: 13 , shown as follows:
- the BE-VLPs and fusion proteins described herein may include any of the above SpCas9 sequences, or any variant thereof having at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% sequence identity thereto.
- the Cas9 protein can be a wild type Cas9 ortholog from another bacterial species different from the canonical Cas9 from S. pyogenes.
- modified versions of the following Cas9 orthologs can be used in connection with the BE-VLPs and fusion proteins described in this specification by making mutations at positions corresponding to H840A or any other amino acids of interest in wild type SpCas9.
- any variant Cas9 orthologs having at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% sequence identity to any of the below orthologs may also be used with the base editors.
- Cas9 nucleases and sequences include Cas9 sequences from the organisms and loci disclosed in Chylinski, Rhun, and Charpentier, “The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems” (2013) RNA Biology 10:5, 726-737; the entire contents of which are incorporated herein by reference.
- a Cas9 nuclease has an inactive (e.g., an inactivated) DNA cleavage domain; that is, the Cas9 is a nickase.
- the Cas9 protein comprises an amino acid sequence that is at least 85%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to the amino acid sequence of a Cas9 protein as provided by any one of the Cas9 orthologs in the above tables.
- the VLPs described herein can be used for delivery of any Cas9 equivalent to a target cell.
- Cas9 equivalent is a broad term that encompasses any napDNAbp protein that serves the same function as Cas9 despite that its amino acid primary sequence and/or its three-dimensional structure may be different and/or unrelated from an evolutionary standpoint.
- Cas9 is a bacterial enzyme that evolved in a wide variety of species. However, the Cas9 equivalents contemplated herein may also be obtained from archaea, which constitute a domain and kingdom of single-celled prokaryotic microbes different from bacteria.
- Cas9 equivalents may refer to Casl2e (CasX) or Casl2d (CasY), which have been described in, for example, Burstein et al., “New CRISPR-Cas systems from uncultivated microbes.” Cell Res. 2017 Feb 21. Doi: 10.1038/cr.2017.21, the entire contents of which is hereby incorporated by reference.
- CasX Casl2e
- CasY Casl2d
- Cas9 refers to Casl2e, or a variant of Casl2e. In some embodiments, Cas9 refers to a Casl2d, or a variant of Casl2d. It should be appreciated that other RNA-guided DNA binding proteins may be used as a nucleic acid programmable DNA binding protein (napDNAbp) and are within the scope of this disclosure. Also see Liu et al., “CasX enzymes comprises a distinct family of RNA-guided genome editors,” Nature, 2019, Vol.566: 218-223. Any of these Cas9 equivalents are contemplated by the present disclosure.
- the Cas9 equivalent comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally-occurring Casl2e (CasX) or Casl2d (CasY) protein.
- the napDNAbp is a naturally-occurring Casl2e (CasX) or Casl2d (CasY) protein.
- the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a wild-type Cas moiety or any Cas moiety provided herein.
- Casl2a Clustered Regularly Interspaced Short Palindromic Repeats from Prevotella and Francisella 1 (i.e., Casl2a (Cpfl)). Similar to Cas9, Casl2a (Cpfl) is also a Class 2 CRISPR effector, but it is a member of type V subgroup of enzymes, rather than the type II subgroup. It has been shown that Casl2a (Cpfl) mediates robust DNA interference with features distinct from Cas9.
- Casl2a is a single RNA-guided endonuclease lacking tracrRNA, and it utilizes a T-rich proto spacer- adjacent motif (TTN, TTTN, or YTN). Moreover, Cpfl cleaves DNA via a staggered DNA double- stranded break.
- TTN T-rich proto spacer- adjacent motif
- TTTN TTTN
- YTN T-rich proto spacer- adjacent motif
- Cpfl cleaves DNA via a staggered DNA double- stranded break.
- Cpfl proteins are known in the art and have been described previously, for example, in Yamano et al., “Crystal structure of Cpfl in complex with guide RNA and target DNA.” Cell (165) 2016, p. 949-962; the entire contents of which is hereby incorporated by reference.
- the Cas protein may include any CRISPR associated protein, including but not limited to, Casl2a, Casl2bl, Casl, CaslB, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csnl and Csxl2), CaslO, Csyl, Csy2, Csy3, Csel, Cse2, Cscl, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmrl, Cmr3, Cmr4, Cmr5, Cmr6, Csbl, Csb2, Csb3, Csxl7, Csxl4, CsxlO, Csxl6, CsaX, Csx3, Csxl, Csxl5, Csfl, Csf2, Csf3, Csf4, homologs thereof, or modified versions
- the napDNAbp can be any of the following proteins: a Cas9, a Casl2a (Cpfl), a Casl2e (CasX), a Casl2d (CasY), a Casl2bl (C2cl), a Casl3a (C2c2), a Casl2c (C2c3), a GeoCas9, a CjCas9, a Casl2g, a Casl2h, a Casl2i, a Casl3b, a Casl3c, a Casl3d, a Casl4, a Csn2, an xCas9, an SpCas9-NG, a circularly permuted Cas9, or an Argonaute (Ago) domain, or a variant thereof.
- a Cas9 a Casl2a (Cpfl), a Casl2e (CasX), a Ca
- the napDNAbp is a single effector of a microbial CRISPR-Cas system.
- Single effectors of microbial CRISPR-Cas systems include, without limitation, Cas9, Casl2a (Cpfl), Casl2bl (C2cl), Casl3a (C2c2), and Casl2c (C2c3).
- microbial CRISPR-Cas systems are divided into Class 1 and Class 2 systems. Class 1 systems have multi-subunit effector complexes, while Class 2 systems have a single protein effector.
- Cas9 and Cas 12a (Cpfl) are Class 2 effectors.
- Catalytic residues in the two conserved HEPN domains mediate cleavage. Mutations in the catalytic residues generate catalytically inactive RNA-binding proteins. See e.g., Abudayyeh et al., “C2c2 is a single-component programmable RNA-guided RNA-targeting CRISPR effector”, Science, 2016 Aug 5;
- TALENS are described in WO 2015/027134, U.S. 9,181,535, Boch et al., “Breaking the Code of DNA Binding Specificity of TAL-Type III Effectors”, Science, vol. 326, pp. 1509-1512 (2009), Bogdanove et al., TAL Effectors: Customizable Proteins for DNA Targeting, Science, vol. 333, pp. 1843-1846 (2011), Cade et al., “Highly efficient generation of heritable zebrafish gene mutations using homo- and heterodimeric TALENs”, Nucleic Acids Research, vol. 40, pp.
- the BE-VLPs and fusion proteins described herein further comprise a deaminase domain (e.g., when a base editor is being encapsulated and delivered in the VLP).
- a deaminase domain may be a cytosine deaminase domain or an adenosine deaminase domain.
- Base editors that convert a C to T in some embodiments, comprise a cytosine deaminase.
- the C to T base editor comprises a dCas9 or nCas9 fused to a cytosine deaminase.
- the cytosine deaminase domain is fused to the N-terminus of the dCas9 or nCas9.
- a base editor converts an A to G.
- the base editor comprises an adenosine deaminase.
- An “adenosine deaminase” is an enzyme involved in purine metabolism. It is needed for the breakdown of adenosine from food and for the turnover of nucleic acids in tissues. Its primary function in humans is the development and maintenance of the immune system.
- An adenosine deaminase catalyzes hydrolytic deamination of adenosine (forming inosine, which base pairs as G) in the context of DNA. There are no known adenosine deaminases that act on DNA.
- an adenosine deaminase comprises any of the following amino acid sequences, or an amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or at least 99.9% identical to any of the following amino acid sequences:
- ecTadA (D108N) SEVEFSHEYWMRHALTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPIGRHDPTA
- ecTadA E25M, R26G, L84F, A106V, R107P, D108N, H123Y, A142N, A143D,
- ecTadA (R26C, L84F, A106V, R107H, D108N, H123Y, A142N , D147Y, E155V,
- ecTadA N37T, P48T, L84F, A106V, D108N, H123Y, D147Y, E155V, I156F
- ecTadA H36L, L84F, A106V, D108N, H123Y, D147Y, E155V, I156F
- ecTadA H36L, P48L, L84F, A106V, D108N, H123Y, D147Y, E155V, I156F
- ecTadA H36L, L84F, A106V, D108N, H123Y, S146C, D147Y, E155V, I156F
- Shewanella putrefaciens S. putrefaciens
- TadA Shewanella putrefaciens
- TadA-8e(V106W) E. coli
- SEVEFSHEYWMRHALTLAKRARDEREVPVGAVLVLNNRVIGEGWNRAIGLHDPTA HAEIMALRQGGLVMQNYRLIDATLYVTFEPCVMCAGAMIHSRIGRVVFGWRNSKR GAAGSLMNVLNYPGMNHRVEITEGILADECAALLCDFYRMPRQVFNAQKKAQSSIN SEQ ID NO: 116
- the present disclosure provides eVLPs and fusion proteins for delivering base editors.
- Base editors are known in the art, and the presently described BE- VLPs may be used to deliver any base editor that is already known, or that is developed in the future.
- the base editors contemplated for delivery may comprise an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the base editor sequences provided herein.
- the BE-VLPs of the present disclosure comprise cytidine base editors (CBEs) comprising a napDNAbp domain and a cytosine deaminase domain that enzymatically deaminates a cytosine nucleobase of a C:G nucleobase pair to a uracil.
- CBEs cytidine base editors
- the uracil may be subsequently converted to a thymine (T) by the cell’s DNA repair and replication machinery.
- T thymine
- the mismatched guanine (G) on the opposite strand may subsequently be converted to an adenine (A) by the cell’s DNA repair and replication machinery.
- a target C:G nucleobase pair is ultimately converted to a T:A nucleobase pair.
- the CBEs in the BE-VLPs described herein may further comprise one or more nuclear localization signals (NLSs) and/or one or more uracil glycosylase inhibitor (UGI) domains.
- the base editors may comprise the structure: NH2-[first nuclear localization sequence]-[cytosine deaminase domain] -[napDNAbp domain] -[first UGI domain] -[second UGI domain] -[second nuclear localization sequence] -COOH, wherein each instance of “]-[” indicates the presence of an optional linker sequence.
- the CBEs in the presently disclosed BE-VLPs may comprise modified (or evolved) cytosine deaminase domains, such as deaminase domains that recognize an expanded PAM sequence, have improved efficiency of deaminating 5'-GC targets, and/or make edits in a narrower target window.
- the disclosed cytidine base editors comprise evolved nucleic acid programmable DNA binding proteins (napDNAbp), such as an evolved nucleic acid programmable DNA binding proteins (napDNAbp), such as an evolved
- Exemplary cytidine base editors are disclosed herein and may also comprise amino acid sequences that are at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or at least 99.5% identical to any one of the amino acid sequences disclosed herein.
- the cytidine base editors comprise an amino acid sequence that is at least 90% identical to any one of the CBE sequences disclosed herein.
- the disclosed cytidine nucleobase editors comprise the amino acid sequence of any one of the
- V (SEQ ID NO: 125)
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- General Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- Virology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Crystallography & Structural Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- AIDS & HIV (AREA)
- Communicable Diseases (AREA)
- Hematology (AREA)
- Oncology (AREA)
- Immunology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP22851442.8A EP4441073A2 (en) | 2021-12-03 | 2022-12-02 | Self-assembling virus-like particles for delivery of nucleic acid programmable fusion proteins and methods of making and using same |
| IL312889A IL312889A (en) | 2021-12-03 | 2022-12-02 | Self-assembling virus-like particles for delivery of nucleic acid programmable fusion proteins and methods for their preparation and use |
| KR1020247022051A KR20240112361A (ko) | 2021-12-03 | 2022-12-02 | 핵산 프로그래밍가능한 융합 단백질의 전달을 위한 자가-조립 바이러스-유사 입자 및 그의 제조 및 사용 방법 |
| GB2409656.2A GB2630190A (en) | 2021-12-03 | 2022-12-02 | Self-assembling virus-like particles for delivery of nucleic acid programmable fusion proteins and methods of making and using the same |
| CA3238778A CA3238778A1 (en) | 2021-12-03 | 2022-12-02 | Self-assembling virus-like particles for delivery of nucleic acid programmable fusion proteins and methods of making and using same |
| US18/715,569 US20250382334A1 (en) | 2021-12-03 | 2022-12-02 | Self-assembling virus-like particles for delivery of nucleic acid programmable fusion proteins and methods of making and using same |
| CN202280079926.7A CN118748998A (zh) | 2021-12-03 | 2022-12-02 | 用于递送核酸可编程融合蛋白的自组装病毒样颗粒以及制备和使用其的方法 |
| AU2022400961A AU2022400961A1 (en) | 2021-12-03 | 2022-12-02 | Self-assembling virus-like particles for delivery of nucleic acid programmable fusion proteins and methods of making and using same |
| JP2024533013A JP2024544012A (ja) | 2021-12-03 | 2022-12-02 | 核酸プログラマブル融合タンパク質を送達するためのセルフアセンブルウイルス様粒子ならびにその作製方法および使用方法 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163285995P | 2021-12-03 | 2021-12-03 | |
| US63/285,995 | 2021-12-03 | ||
| US202263298621P | 2022-01-11 | 2022-01-11 | |
| US63/298,621 | 2022-01-11 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2023102537A2 true WO2023102537A2 (en) | 2023-06-08 |
| WO2023102537A3 WO2023102537A3 (en) | 2023-07-13 |
Family
ID=85158785
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/080834 Ceased WO2023102537A2 (en) | 2021-12-03 | 2022-12-02 | Self-assembling virus-like particles for delivery of nucleic acid programmable fusion proteins and methods of making and using same |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US20250382334A1 (enExample) |
| EP (1) | EP4441073A2 (enExample) |
| JP (1) | JP2024544012A (enExample) |
| KR (1) | KR20240112361A (enExample) |
| AU (1) | AU2022400961A1 (enExample) |
| CA (1) | CA3238778A1 (enExample) |
| GB (1) | GB2630190A (enExample) |
| IL (1) | IL312889A (enExample) |
| WO (1) | WO2023102537A2 (enExample) |
Cited By (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN118086408A (zh) * | 2024-04-25 | 2024-05-28 | 华南理工大学 | 一种可实现靶向肌肉细胞基因编辑的仿病毒颗粒及其制备方法和应用 |
| CN119162152A (zh) * | 2024-11-18 | 2024-12-20 | 南京农业大学三亚研究院 | 一种扩大编辑范围且提高编辑效率的高精准碱基编辑器 |
| WO2025051278A1 (en) * | 2023-09-09 | 2025-03-13 | Geneditbio Limited | Engineered protein delivery vehicle |
| WO2025096936A2 (en) | 2023-11-03 | 2025-05-08 | The Broad Institute, Inc. | Use of prime editing in correcting mutations in cdkl5 |
| US12319938B2 (en) | 2020-07-24 | 2025-06-03 | The General Hospital Corporation | Enhanced virus-like particles and methods of use thereof for delivery to cells |
| WO2025137543A1 (en) * | 2023-12-22 | 2025-06-26 | President And Fellows Of Harvard College | Methods for screening for next generation nucleic acid delivery vectors |
| US12351814B2 (en) | 2019-06-13 | 2025-07-08 | The General Hospital Corporation | Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells |
| WO2025153043A1 (zh) * | 2024-01-19 | 2025-07-24 | 微光基因(苏州)有限公司 | 用于递送核酸和蛋白质的类病毒样蛋白颗粒及其制备方法 |
| US12390514B2 (en) | 2017-03-09 | 2025-08-19 | President And Fellows Of Harvard College | Cancer vaccine |
| US12473573B2 (en) | 2013-09-06 | 2025-11-18 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| US12509680B2 (en) | 2019-03-19 | 2025-12-30 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12516308B2 (en) | 2017-03-09 | 2026-01-06 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US12522807B2 (en) | 2018-07-09 | 2026-01-13 | The Broad Institute, Inc. | RNA programmable epigenetic RNA modifiers and uses thereof |
| WO2026024856A2 (en) | 2024-07-23 | 2026-01-29 | The Broad Institute, Inc. | Compositions and methods for production of double-stranded dna in cells for programmable gene integration |
| US12559737B2 (en) | 2013-09-06 | 2026-02-24 | President And Fellows Of Harvard College | Cas9 variants and uses thereof |
Citations (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4880635A (en) | 1984-08-08 | 1989-11-14 | The Liposome Company, Inc. | Dehydrated liposomes |
| US4906477A (en) | 1987-02-09 | 1990-03-06 | Kabushiki Kaisha Vitamin Kenkyusyo | Antineoplastic agent-entrapping liposomes |
| US4911928A (en) | 1987-03-13 | 1990-03-27 | Micro-Pak, Inc. | Paucilamellar lipid vesicles |
| US4917951A (en) | 1987-07-28 | 1990-04-17 | Micro-Pak, Inc. | Lipid vesicles formed of surfactants and steroids |
| US4920016A (en) | 1986-12-24 | 1990-04-24 | Linear Technology, Inc. | Liposomes with enhanced circulation time |
| US4921757A (en) | 1985-04-26 | 1990-05-01 | Massachusetts Institute Of Technology | System for delayed and pulsed release of biologically active substances |
| WO2001038547A2 (en) | 1999-11-24 | 2001-05-31 | Mcs Micro Carrier Systems Gmbh | Polypeptides comprising multimers of nuclear localization signals or of protein transduction domains and their use for transferring molecules into cells |
| WO2012000618A2 (de) | 2010-07-02 | 2012-01-05 | Robert Bosch Gmbh | Wellenenergiewandler zur umwandlung von kinetischer energie in elektrische energie |
| US8440431B2 (en) | 2009-12-10 | 2013-05-14 | Regents Of The University Of Minnesota | TAL effector-mediated DNA modification |
| WO2015027134A1 (en) | 2013-08-22 | 2015-02-26 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (tale) domains and uses thereof |
| US20150166980A1 (en) | 2013-12-12 | 2015-06-18 | President And Fellows Of Harvard College | Fusions of cas9 domains and nucleic acid-editing domains |
| US9181535B2 (en) | 2012-09-24 | 2015-11-10 | The Chinese University Of Hong Kong | Transcription activator-like effector nucleases (TALENs) |
| WO2017070633A2 (en) | 2015-10-23 | 2017-04-27 | President And Fellows Of Harvard College | Evolved cas9 proteins for gene editing |
| WO2018027078A1 (en) | 2016-08-03 | 2018-02-08 | President And Fellows Of Harard College | Adenosine nucleobase editors and uses thereof |
| US10077453B2 (en) | 2014-07-30 | 2018-09-18 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| WO2018176009A1 (en) | 2017-03-23 | 2018-09-27 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable dna binding proteins |
| WO2019023680A1 (en) | 2017-07-28 | 2019-01-31 | President And Fellows Of Harvard College | METHODS AND COMPOSITIONS FOR EVOLUTION OF BASIC EDITORS USING PHAGE-ASSISTED CONTINUOUS EVOLUTION (PACE) |
| WO2019226953A1 (en) | 2018-05-23 | 2019-11-28 | The Broad Institute, Inc. | Base editors and uses thereof |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017068077A1 (en) * | 2015-10-20 | 2017-04-27 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Methods and products for genetic engineering |
| WO2020102709A1 (en) * | 2018-11-16 | 2020-05-22 | The Regents Of The University Of California | Compositions and methods for delivering crispr/cas effector polypeptides |
-
2022
- 2022-12-02 EP EP22851442.8A patent/EP4441073A2/en active Pending
- 2022-12-02 JP JP2024533013A patent/JP2024544012A/ja active Pending
- 2022-12-02 WO PCT/US2022/080834 patent/WO2023102537A2/en not_active Ceased
- 2022-12-02 KR KR1020247022051A patent/KR20240112361A/ko active Pending
- 2022-12-02 IL IL312889A patent/IL312889A/en unknown
- 2022-12-02 US US18/715,569 patent/US20250382334A1/en active Pending
- 2022-12-02 CA CA3238778A patent/CA3238778A1/en active Pending
- 2022-12-02 AU AU2022400961A patent/AU2022400961A1/en active Pending
- 2022-12-02 GB GB2409656.2A patent/GB2630190A/en active Pending
Patent Citations (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4880635B1 (en) | 1984-08-08 | 1996-07-02 | Liposome Company | Dehydrated liposomes |
| US4880635A (en) | 1984-08-08 | 1989-11-14 | The Liposome Company, Inc. | Dehydrated liposomes |
| US4921757A (en) | 1985-04-26 | 1990-05-01 | Massachusetts Institute Of Technology | System for delayed and pulsed release of biologically active substances |
| US4920016A (en) | 1986-12-24 | 1990-04-24 | Linear Technology, Inc. | Liposomes with enhanced circulation time |
| US4906477A (en) | 1987-02-09 | 1990-03-06 | Kabushiki Kaisha Vitamin Kenkyusyo | Antineoplastic agent-entrapping liposomes |
| US4911928A (en) | 1987-03-13 | 1990-03-27 | Micro-Pak, Inc. | Paucilamellar lipid vesicles |
| US4917951A (en) | 1987-07-28 | 1990-04-17 | Micro-Pak, Inc. | Lipid vesicles formed of surfactants and steroids |
| WO2001038547A2 (en) | 1999-11-24 | 2001-05-31 | Mcs Micro Carrier Systems Gmbh | Polypeptides comprising multimers of nuclear localization signals or of protein transduction domains and their use for transferring molecules into cells |
| US8440431B2 (en) | 2009-12-10 | 2013-05-14 | Regents Of The University Of Minnesota | TAL effector-mediated DNA modification |
| US8440432B2 (en) | 2009-12-10 | 2013-05-14 | Regents Of The University Of Minnesota | Tal effector-mediated DNA modification |
| US8450471B2 (en) | 2009-12-10 | 2013-05-28 | Regents Of The University Of Minnesota | TAL effector-mediated DNA modification |
| WO2012000618A2 (de) | 2010-07-02 | 2012-01-05 | Robert Bosch Gmbh | Wellenenergiewandler zur umwandlung von kinetischer energie in elektrische energie |
| US9181535B2 (en) | 2012-09-24 | 2015-11-10 | The Chinese University Of Hong Kong | Transcription activator-like effector nucleases (TALENs) |
| WO2015027134A1 (en) | 2013-08-22 | 2015-02-26 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (tale) domains and uses thereof |
| US9840699B2 (en) | 2013-12-12 | 2017-12-12 | President And Fellows Of Harvard College | Methods for nucleic acid editing |
| US20150166980A1 (en) | 2013-12-12 | 2015-06-18 | President And Fellows Of Harvard College | Fusions of cas9 domains and nucleic acid-editing domains |
| US10077453B2 (en) | 2014-07-30 | 2018-09-18 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| WO2017070633A2 (en) | 2015-10-23 | 2017-04-27 | President And Fellows Of Harvard College | Evolved cas9 proteins for gene editing |
| WO2017070632A2 (en) | 2015-10-23 | 2017-04-27 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US20170121693A1 (en) | 2015-10-23 | 2017-05-04 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US10167457B2 (en) | 2015-10-23 | 2019-01-01 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US20180073012A1 (en) | 2016-08-03 | 2018-03-15 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US10113163B2 (en) | 2016-08-03 | 2018-10-30 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| WO2018027078A1 (en) | 2016-08-03 | 2018-02-08 | President And Fellows Of Harard College | Adenosine nucleobase editors and uses thereof |
| WO2018176009A1 (en) | 2017-03-23 | 2018-09-27 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable dna binding proteins |
| WO2019023680A1 (en) | 2017-07-28 | 2019-01-31 | President And Fellows Of Harvard College | METHODS AND COMPOSITIONS FOR EVOLUTION OF BASIC EDITORS USING PHAGE-ASSISTED CONTINUOUS EVOLUTION (PACE) |
| WO2019226953A1 (en) | 2018-05-23 | 2019-11-28 | The Broad Institute, Inc. | Base editors and uses thereof |
Non-Patent Citations (185)
| Title |
|---|
| "Controlled Drug Bioavailability, Drug Product Design and Performance", 1984, WILEY |
| "Medical Applications of Controlled Release", 1974, CRC PRESS |
| "The Cambridge Dictionary of Science and Technology", 1988 |
| ABIFADEL, M.VARRET, M.RABES, J.P.ALLARD, D.OUGUERRAM, K.DEVILLERS, M.CRUAUD, CBENJANNET, S.WICKHAM, L.ERLICH, D. ET AL.: "Mutations in PCSK9 cause autosomal dominant hypercholesterolemia", NAT GENET, vol. 34, 2003, pages 154 - 156, XP055484799, DOI: 10.1038/ng1161 |
| ABUDAYYEH ET AL.: "C2c2 is a single-component programmable RNA-guided RNA-targeting CRISPR effector", SCIENCE, vol. 353, no. 6299, 5 August 2016 (2016-08-05), XP055407082, DOI: 10.1126/science.aaf5573 |
| AKCAKAYA, P.BOBBIN, M.L.GUO, J.A.MALAGON-LOPEZ, J.CLEMENT, K.GARCIA, S.P.FELLOWS, M.DPORRITT, M.J.FIRTH, M.ACARRERAS, A. ET AL.: "In vivo CRISPR editing with no detectable genome-wide off-target mutations", NATURE, vol. 561, 2018, pages 416 - 419, XP036902697, DOI: 10.1038/s41586-018-0500-9 |
| ALANIS-LOBATO, G.ZOHREN, J.MCCARTHY, AFOGARTY, N.M.E.KUBIKOVA, N.HARDMAN, EGRECO, MWELLS, DTURNER, J.M.A.NIAKAN, K.K.: "Frequent loss of heterozygosity in CRISPR-Cas9-edited early human embryos", PROC NATL ACAD SCI USA, 2021, pages 118 |
| ANZALONE, A.VKOBLAN, L.WLIU, D.R.: "Genome editing with CRISPR-Cas nucleases, base editors, transposases and prime editors", NAT BIOTECHNOL, vol. 38, 2020, pages 824 - 844, XP037622140, DOI: 10.1038/s41587-020-0561-9 |
| AUTIERIAGRAWAL, J. BIOL. CHEM., vol. 273, 1998, pages 14731 - 37 |
| BANERJEE, V.MUKHOPADHYAY, S., VIRUSDISEASE, vol. 27, no. 1, 2016, pages 1 - 11 |
| BOCH ET AL.: "Breaking the Code of DNA Binding Specificity of TAL-Type III Effectors", SCIENCE, vol. 326, 2009, pages 1509 - 1512, XP055250971, DOI: 10.1126/science.1178811 |
| BOGDANOVE ET AL.: "TAL Effectors: Customizable Proteins for DNA Targeting", SCIENCE, vol. 333, 2011, pages 1843 - 1846, XP055093385, DOI: 10.1126/science.1204094 |
| BUCHWALD ET AL., SURGERY, vol. 88, 1980, pages 507 |
| BURSTEIN ET AL.: "New CRISPR-Cas systems from uncultivated microbes", CELL RES., 21 February 2017 (2017-02-21) |
| CADE ET AL.: "Highly efficient generation of heritable zebrafish gene mutations using homo- and heterodimeric TALENs", NUCLEIC ACIDS RESEARCH, vol. 40, 2012, pages 8001 - 8010, XP055086692, DOI: 10.1093/nar/gks518 |
| CAMPBELL, L.A.COKE, L.M.RICHIE, C.T.FORTUNE, L.V.PARK, A.Y.HARVEY, B.K.: "Gesicle-Mediated Delivery of CRISPR/Cas9 Ribonucleoprotein Complex for Inactivating the HIV Provirus", MOL THER, vol. 27, 2019, pages 151 - 163 |
| CARROLL ET AL.: "Genome Engineering with Zinc-Finger Nucleases", GENETICS, vol. 188, August 2011 (2011-08-01), pages 773 - 782, XP055171682, DOI: 10.1534/genetics.111.131433 |
| CERMAK ET AL.: "Efficient design and assembly of custom TALEN and other TAL effector-based constructs for DNA targeting", NUCLEIC ACIDS RESEARCH, vol. 39, no. 17, 2011, pages e82 |
| CERVERA ET AL., J BIOTECHNOL, vol. 166, no. 4, pages 152 - 165 |
| CHANDLER, R.J.SANDS, M.S.VENDITTI, C.P.: "Recombinant Adeno-Associated Viral Integration and Genotoxicity: Insights from Animal Models", HUM GENE THER, vol. 28, 2017, pages 314 - 322 |
| CHEN, P.J.HUSSMANN, J.AYAN, J.KNIPPING, FRAVISANKAR, PCHEN, P.FCHEN, C.NELSON, J.W.NEWBY, G.A.SAHIN, M. ET AL.: "Enhanced prime editing systems by manipulating cellular determinants of editing outcomes", CELL, vol. 184, 2021, pages 5635 - 5652 |
| CHOI, J.G.DANG, Y.ABRAHAM, S.MA, H.ZHANG, J.GUO, HCAI, Y.MIKKELSEN, J.GWU, H.SHANKAR, P. ET AL.: "Lentivirus pre-packed with Cas9 protein for safer gene editing", GENE THER, vol. 23, 2016, pages 627 - 633, XP055333406, DOI: 10.1038/gt.2016.27 |
| CHYLINSKI, RHUN, CHARPENTIER: "The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems", RNA BIOLOGY, vol. 10, no. 5, 2013, pages 726 - 737, XP055116068, DOI: 10.4161/rna.24321 |
| CIDECIYAN, A.V.: "Leber congenital amaurosis due to RPE65 mutations and its treatment with gene therapy", PROG RETIN EYE RES, vol. 29, 2010, pages 398 - 427, XP027135675 |
| CLEMENT, K.REES, HCANVER, M.CGEHRKE, J.M.FAROUNI, R.HSU, J.Y.COLE, M.ALIU, D.R.JOUNG, J.K.BAUER, D.E. ET AL.: "CRISPResso2 provides accurate and rapid genome editing sequence analysis", NAT BIOTECHNOL, vol. 37, 2019, pages 224 - 226, XP036900605, DOI: 10.1038/s41587-019-0032-3 |
| COHEN, J.C.BOERWINKLE, E.MOSLEY, T.H., JR.HOBBS, H.H.: "Sequence variations in PCSK9, low LDL, and protection against coronary heart disease", N ENGL J MED, vol. 354, 2006, pages 1264 - 1272 |
| COHEN, J.PERTSEMLIDIS, A.KOTOWSKI, I.K.GRAHAM, RGARCIA, C.KHOBBS, H.H.: "Low LDL cholesterol in individuals of African descent resulting from frequent nonsense mutations in PCSK9", NAT GENET, vol. 37, 2005, pages 161 - 165, XP008102949, DOI: 10.1038/ng1509 |
| COKOL ET AL.: "Finding nuclear localization signals", EMBO REP., vol. 1, no. 5, 2000, pages 411 - 415 |
| COLD SPRING HARB PROTOC, no. 1, pages 118 - 123 |
| CRONIN, J.ZHANG, X.YREISER, J: "Altering the tropism of lentiviral vectors through pseudotyping", CURR GENE THER, vol. 5, no. 4, 2005, pages 387 - 398, XP055199682, DOI: 10.2174/1566523054546224 |
| DAVID, R.M.DOHERTY, A.T.: "Viral Vectors: The Road to Reducing Genotoxicity", TOXICOL SCI, vol. 155, 2017, pages 315 - 325 |
| DAVIS, K.M.PATTANAYAK, V.THOMPSON, D.BZURIS, J.A.LIU, D.R: "Small molecule-triggered Cas9 protein with improved genome-editing specificity", NAT CHEM BIOL, vol. 11, 2015, pages 316 - 318, XP055452335, DOI: 10.1038/nchembio.1793 |
| DELTCHEVA E.CHYLINSKI KSHARMA C.M.GONZALES K.CHAO YPIRZADA Z.A.ECKERT M.R.VOGEL J.CHARPENTIER E.: "CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III", NATURE, vol. 471, 2011, pages 602 - 607, XP055308803, DOI: 10.1038/nature09886 |
| DEN HOLLANDER, A.I.ROEPMAN, R.KOENEKOOP, R.KCREMERS, F.P: "Leber congenital amaurosis: genes, proteins and disease mechanisms", PROG RETIN EYE RES, vol. 27, 2008, pages 391 - 419, XP023611414, DOI: 10.1016/j.preteyeres.2008.05.003 |
| DEVERMAN, B.E.PRAVDO, P.LSIMPSON, B.P.KUMAR, S.R.CHAN, K.Y.BANERJEE, AWU, W.LYANG, BHUBER, NPASCA, S.P. ET AL.: "Cre-dependent selection yields AAV variants for widespread gene transfer to the adult brain", NAT BIOTECHNOL, vol. 34, 2016, pages 204 - 209, XP055328659, DOI: 10.1038/nbt.3440 |
| DOMAN, J.L.RAGURAM, ANEWBY, G.A.LIU, D.R.: "Evaluation and minimization of Cas9-independent off-target DNA editing by cytosine base editors", NAT BIOTECHNOL, vol. 38, 2020, pages 620 - 628, XP037113487, DOI: 10.1038/s41587-020-0414-6 |
| DOUDNA, J.A.: "The promise and challenge of therapeutic genome editing.", NATURE, vol. 578, 2020, pages 229 - 236, XP037019025, DOI: 10.1038/s41586-020-1978-5 |
| DURAI ET AL.: "Zinc finger nucleases: custom-designed molecular scissors for genome engineering of plant and mammalian cells", NUCLEIC ACIDS RES, vol. 33, 2005, pages 5978 - 90, XP002511419, DOI: 10.1093/NAR/GKI912 |
| DURING ET AL., ANN. NEUROL., vol. 25, 1989, pages 351 |
| EAST-SELETSKY ET AL.: "wo distinct Rnase activities of CRISPR-Casl3a enable guide-RNA processing and RNA detection", NATURE, vol. 538, no. 7624, 13 October 2016 (2016-10-13), pages 270 - 273, XP055719305, DOI: 10.1038/nature19802 |
| FEHER, A.BOROSS, P.SPERKA, T.MIKLOSSY, G.KADAS, JBAGOSSI, POROSZLAN, S.WEBER, I.T.TOZSER, J.: "Characterization of the murine leukemia virus protease and its comparison with the human immunodeficiency virus type 1 protease", J GEN VIROL, vol. 87, 2006, pages 1321 - 1330 |
| FITZGERALD, KFRANK-KAMENETSKY, M.SHULGA-MORSKAYA, S.LIEBOW, A.BETTENCOURT, B.RSUTHERLAND, J.E.HUTABARAT, R.MCLAUSEN, V.AKARSTEN, V: "Effect of an RNA interference drug on the synthesis of proprotein convertase subtilisin/kexin type 9 (PCSK9) and the concentration of serum LDL cholesterol in healthy volunteers: a randomised, single-blind, placebo-controlled, phase 1 trial", LANCET, vol. 383, 2014, pages 60 - 68, XP055314123, DOI: 10.1016/S0140-6736(13)61914-5 |
| FONTANA ET AL., VACCINE, vol. 32, no. 24, 2014, pages 2799 - 27804 |
| FREITAS ET AL.: "Mechanisms and Signals for the Nuclear Import of Proteins", CURRENT GENOMICS, vol. 10, no. 8, 2009, pages 550 - 7, XP055502464 |
| FUNG, H. Y. J. ET AL.: "Structural determinants of nuclear export signal orientation in binding to exportin CRM1", ELIFE, vol. 4, 2015, pages 10034 |
| GAJ ET AL.: "ZFN, TALEN, and CRISPR/Cas-based methods for genome engineering", TRENDS BIOTECHNOL., vol. 31, 2013, pages 397 - 405 |
| GAUDELLI, N.M.LAM, D.K.REES, H.A.SOLA-ESTEVES, N.M.BARRERA, L.A.BORN, D.AEDWARDS, A.GEHRKE, J.M.LEE, S.JLIQUORI, A.J. ET AL.: "Directed evolution of adenine base editors with increased activity and therapeutic application", NAT BIOTECHNOL, vol. 38, 2020, pages 892 - 900, XP037187542, DOI: 10.1038/s41587-020-0491-6 |
| GAUDELLI, N.MKOMOR, A.C.REES, H.APACKER, M.SBADRAN, A.HBRYSON, D.I.LIU, D.R.: "Programmable base editing of A*T to G*C in genomic DNA without DNA cleavage", NATURE, vol. 551, 2017, pages 464 - 471 |
| GEE, P.LUNG, M.S.Y.OKUZAKI, Y.SASAKAWA, N.IGUCHI, TMAKITA, Y.HOZUMI, HMIURA, Y.YANG, L.F.IWASAKI, M. ET AL.: "Extracellular nanovesicles for packaging of CRISPR-Cas9 protein and sgRNA to induce therapeutic exon skipping", NAT COMMUN, vol. 11, 2020, pages 1334 |
| GIANNOUKOS, G.CIULLA, D.MMARCO, E.ABDULKERIM, H.SBARRERA, L.ABOTHMER, ADHANAPAL, VGLOSKOWSKI, S.W.JAYARAM, HMAEDER, M.L. ET AL.: "UDiTaS, a genome editing detection method for indels and genome rearrangements", BMC GENOMICS, vol. 19, 2018, pages 212 |
| GIRARD-GAGNEPAIN ET AL., BLOOD, vol. 124, no. 8, 2014, pages 1221 - 1231 |
| GOLCZAK, MKISER, P.DLODOWSKI, D.T.MAEDA, A.PALCZEWSKI, K.: "Importance of Membrane Structural Integrity for RPE65 Retinoid Isomerization Activity.", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 285, 2010, pages 9667 - 9682 |
| GUIBINGUA ET AL., MOLECULAR THERAPY, vol. 5, no. 5, 2002, pages 538 - 546 |
| GUTKIN ET AL., NAT. BIOTECHNOL., 2021 |
| HALEMARHAM, THE HARPER COLLINS DICTIONARY OF BIOLOGY, 1991 |
| HAMILTON, J. R. ET AL., CELL REPORTS, vol. 35, no. 9, 2021, pages 109207 |
| HAMILTON, J. R. ET AL.: "Targeted delivery of CRISPR-Cas9 and transgenes enables complex immune cell engineering", CELL REPORTS., vol. 35, 2021, pages 109207 |
| HAMILTON, J.R.TSUCHIDA, C.ANGUYEN, D.N.SHY, B.R.MCGARRIGLE, E.R.SANDOVAL ESPINOZA, C.RCARR, D.BLAESCHKE, FMARSON, A.DOUDNA, J.A.: "Targeted delivery of CRISPR-Cas9 and transgenes enables complex immune cell engineering", CELL REP, vol. 35, 2021, pages 109207 |
| HERBST-KRALOVETZ ET AL., EXPERT REV VACCINES, vol. 9, no. 3, 2010, pages 299 - 307 |
| HOOPER, A.J.MARAIS, A.D.TANYANYIWA, D.M.BURNETT, J.R.: "The C679X mutation in PCSK9 is present and lowers blood cholesterol in a Southern African population", ATHEROSCLEROSIS, vol. 193, 2007, pages 445 - 448, XP022233724, DOI: 10.1016/j.atherosclerosis.2006.08.039 |
| HOWARD ET AL., J. NEUROSURG., vol. 71, 1989, pages 105 |
| HUANG, T.P.ZHAO, K.TMILLER, S.M.GAUDELLI, N.M.OAKES, B.LFELLMANN, C.SAVAGE, D.FLIU, D.R: "Circularly permuted and PAM-modified Cas9 variants broaden the targeting scope of base editors", NAT BIOTECHNOL, vol. 37, 2019, pages 626 - 631, XP036900674, DOI: 10.1038/s41587-019-0134-y |
| HUMBEL, M.RAMOSAJ, M.ZIMMER, VREGIO, S.AEBY, LMOSER, S.BOIZOT, A.SIPION, M.REY, M.DEGLON, N.: "Maximizing lentiviral vector gene transfer in the CNS", GENE THER, vol. 28, 2021, pages 75 - 88, XP037798715, DOI: 10.1038/s41434-020-0172-6 |
| INDIKOVA, I.INDIK, S.: "Highly efficient 'hit-and-run' genome editing with unconcentrated lentivectors carrying Vpr.Prot.Cas9 protein produced from RRE-containing transcripts", NUCLEIC ACIDS RES, vol. 48, 2020, pages 8178 - 8187 |
| JALAGUIER ET AL., PLOSONE, vol. 6, no. 11, 2011, pages e28314 |
| JANG, H.K.JO, D.H.LEE, S.N.CHO, C.S.JEONG, Y.K.JUNG, Y.YU, J.KIM, J.H.WOO, J.S.BAE, S.: "High-purity production and precise editing of DNA base editing ribonucleoproteins.", SCI ADV, vol. 7, 2021 |
| JINEK M.CHYLINSKI K.FONFARA I.HAUER M.DOUDNA J.A.CHARPENTIER E.: "A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity", SCIENCE, vol. 337, 2012, pages 816 - 821, XP055229606, DOI: 10.1126/science.1225829 |
| JINEK M.CHYLINSKI K.FONFARA I.HAUER M.DOUDNA J.ACHARPENTIER E.: "A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity.", SCIENCE, vol. 337, 2012, pages 816 - 821, XP055229606, DOI: 10.1126/science.1225829 |
| JO, D.H., JANG, H.-K., CHO, C.S., HAN, J.H., RYU, G., JUNG, Y., BAE, S., KIM, J.H.: "Therapeutic adenine base editing corrects nonsense mutation and improves visual function in a mouse model of Leber congenital amaurosis", BIORXIV, 2021 |
| JOHNSON, S., WHEELER, J.X., THORPE, R., COLLINS, M., TAKEUCHI, Y., ZHAO, Y.: "Mass spectrometry analysis reveals differences in the host cell protein species found in pseudotyped lentiviral vectors", BIOLOGICALS, vol. 52, 2018, pages 59 - 66 |
| JUNE, C.H., O'CONNOR, R.S., KAWALEKAR, O.U., GHASSEMI, S., MILONE, M.C.: "CAR T cell immunotherapy for human cancer", SCIENCE, vol. 359, 2018, pages 1361 - 1365 |
| KACZMARCZYK ET AL., PROC NATL ACAD SCI USA, vol. 108, no. 41, 2011, pages 16998 - 17003 |
| KACZMARCZYK, S.J., SITARAMAN, K., YOUNG, H.A., HUGHES, S.H., CHATTERJEE, D.K.: "Protein delivery using engineered virus-like particles", PROC NATL ACAD SCI U S A, vol. 108, 2011, pages 16998 - 17003, XP055072810, DOI: 10.1073/pnas.1101874108 |
| KANG ET AL., VIRUSES, vol. 7, 2015, pages 1134 - 1152 |
| KATO, S. ET AL.: "A lentiviral strategy for highly efficient retrograde gene transfer by pseudotyping with fusion envelope glycoprotein", HUMAN GENE THER., vol. 22, no. 2, 2011, pages 197 - 206, XP002695633, DOI: 10.1089/hum.2009.179 |
| KATO, S. ET AL.: "Selective Neural Pathway Targeting Reveals Key Roles of Thalamostriatal Projection in the Control of Visual Discrimination", J. NEUROSCI., vol. 31, no. 47, 2011, pages 17169 - 17179 |
| KATO, S.KURAMOCHI, M.KOBAYASHI, K.FUKABORI, R.OKADA, K.UCHIGASHIMA, M.WATANABE, MTSUTSUI, Y.KOBAYASHI, K.: "Selective neural pathway targeting reveals key roles of thalamostriatal projection in the control of visual discrimination", J NEUROSCI, vol. 31, 2011, pages 17169 - 17179 |
| KOBLAN ET AL., NAT BIOTECHNOL., vol. 36, no. 9, 2018, pages 843 - 846 |
| KOBLAN, L.W.DOMAN, J.L.WILSON, C.LEVY, J.M.TAY, T.NEWBY, G.A.MAIANTI, J.P.RAGURAM, A.LIU, D.R: "Improving cytidine and adenine base editors by expression optimization and ancestral reconstruction", NAT BIOTECHNOL, vol. 36, 2018, pages 843 - 846, XP036929657, DOI: 10.1038/nbt.4172 |
| KOBLAN, L.W.ERDOS, M.R.WILSON, C.CABRAL, W.ALEVY, J.M.XIONG, Z.M.TAVAREZ, U.L.DAVISON, L.M.GETE, Y.G.MAO, X. ET AL.: "In vivo base editing rescues Hutchinson-Gilford progeria syndrome in mice", NATURE, vol. 589, 2021, pages 608 - 614, XP037351694, DOI: 10.1038/s41586-020-03086-7 |
| KOMOR, A.CKIM, Y.B.PACKER, M.SZURIS, J.A.LIU, D.R.: "Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage", NATURE, vol. 533, 2016, pages 420 - 424, XP055968803, DOI: 10.1038/nature17946 |
| KOSICKI, M.TOMBERG, K.BRADLEY, A.: "Repair of double-strand breaks induced by CRISPR-Cas9 leads to large deletions and complex rearrangements", NAT BIOTECHNOL, vol. 36, 2018, pages 765 - 771, XP036929645, DOI: 10.1038/nbt.4192 |
| KOSUGI, S. ET AL.: "Nuclear Export Signal Consensus Sequences Defined Using a Localization-based Yeast Selection System", TRAFFIC, vol. 9, no. 12, 2008, pages 2053 - 2062 |
| KUSHNIR ET AL., VACCINE, vol. 31, 2012, pages 58 - 83 |
| LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533 |
| LATHAM ET AL., JOURNAL OF VIROLOGY, vol. 75, no. 13, 2001, pages 6154 - 6155 |
| LAZZAROTTO, C.R.MALININ, N.L.LI, Y.ZHANG, RYANG, Y.LEE, GCOWLEY, E.HE, YLAN, XJIVIDEN, K. ET AL.: "CHANGE-seq reveals genetic and epigenetic effects on CRISPR-Cas9 genome-wide activity", NATURE BIOTECHNOLOGY, vol. 38, 2020, pages 1317 - 1327, XP037614246, DOI: 10.1038/s41587-020-0555-7 |
| LEIBOWITZ, M.L.PAPATHANASIOU, S.DOERFLER, P.ABLAINE, L.JSUN, LYAO, Y.ZHANG, C.Z.WEISS, M.J.PELLMAN, D.: "Chromothripsis as an on-target consequence of CRISPR-Cas9 genome editing", NAT GENET, vol. 53, 2021, pages 895 - 905, XP037475892, DOI: 10.1038/s41588-021-00838-7 |
| LEIBUNDGUT-LANDMANN, S.WALDBURGER, J.M.KRAWCZYK, MOTTEN, L.A.SUTER, T.FONTANA, A.ACHA-ORBEA, HREITH, W.: "Mini-review: Specificity and expression of CIITA, the master regulator of MHC class II genes", EUR J IMMUNOL, vol. 34, 2004, pages 1513 - 1525, XP055004616, DOI: 10.1002/eji.200424964 |
| LEVY ET AL., SCIENCE, vol. 228, 1985, pages 190 |
| LEVY, J.MYEH, W.H.PENDSE, N.DAVIS, J.R.HENNESSEY, E.BUTCHER, R.KOBLAN, L.WCOMANDER, J.LIU, Q.LIU, D.R.: "Cytosine and adenine base editing of the brain, liver, retina, heart and skeletal muscle of mice via adeno-associated viruses", NAT BIOMED ENG, vol. 4, 2020, pages 97 - 110, XP036990727, DOI: 10.1038/s41551-019-0501-5 |
| LI ET AL., JOURNAL OF VIROLOGY, vol. 71, no. 10, 1997, pages 7207 - 7213 |
| LI, Y. ET AL., FRONT. IMMUNOL., vol. 12, 2021, pages 1 - 12 |
| LIU ET AL.: "C2c1-sgRNA Complex Structure Reveals RNA-Guided DNA Cleavage Mechanism", MOL. CELL, vol. 65, no. 2, 19 January 2017 (2017-01-19), pages 310 - 322, XP029890333, DOI: 10.1016/j.molcel.2016.11.040 |
| LIU ET AL.: "CasX enzymes comprise a distinct family of RNA-guided genome editors", NATURE, vol. 566, 2019, pages 218 - 223, XP036746431, DOI: 10.1038/s41586-019-0908-x |
| LIU ET AL.: "CasX enzymes comprises a distinct family of RNA-guided genome editors", NATURE, vol. 566, 2019, pages 218 - 223 |
| LUDWIG ET AL., CURR OPIN BIOTECHNOL, vol. 18, no. 6, 2007, pages 537 - 55 |
| LYU, P., LU, Z., CHO, S.I., YADAV, M., YOO, K.W., ATALA, A., KIM, J.S., LU, B.: "Adenine Base Editor Ribonucleoproteins Delivered by Lentivirus-Like Particles Show High On-Target Base Editing and Undetectable RNA Off-Target Activities", CRISPR J, vol. 4, 2021, pages 69 - 81, XP055895447, DOI: 10.1089/crispr.2020.0095 |
| LYU, P.JAVIDI-PARSIJANI, PATALA, A.LU, B.: "Delivering Cas9/sgRNA ribonucleoprotein (RNP) by lentiviral capsid-based bionanoparticles for efficient 'hit-and-run' genome editing", NUCLEIC ACIDS RES, vol. 47, 2019, pages e99 |
| MAETZIG ET AL., CURRENT GENE THERAPY, vol. 12, 2012, pages 389 - 409 |
| MAGIN ET AL., VIROLOGY, vol. 274, 2000, pages 11 - 16 |
| MAKAROVA ET AL.: "C2c2 is a single-component programmable RNA-guided RNA-targeting CRISPR effector", SCIENCE, vol. 353, no. 6299, 2016, XP055407082, DOI: 10.1126/science.aaf5573 |
| MANGEOT ET AL., JOURNAL OF VIROLOGY, vol. 71, no. 18, 2000, pages 8307 - 8315 |
| MANGEOT ET AL., MOLECULAR THERAPY, vol. 19, no. 9, 2011, pages 1656 - 1666 |
| MANGEOT ET AL., NAT. COMMUN., vol. 10, 2019, pages 45 |
| MANGEOT ET AL., NUCLEIC ACIDS RESEARCH, vol. 32, no. 12, 2004, pages e102 |
| MANGEOT ET AL.: "Genome editing in primary cells and in vivo using viral-derived Nanoblades loaded with Cas9-sgRNA ribonucleoproteins", NATURE COMMUNICATIONS, 2019 |
| MANGEOT, P.E.DOLLET, S.GIRARD, M.CIANCIA, C.JOLY, S.PESCHANSKI, M.LOTTEAU, V: "Protein transfer into human cells by VSV-G-induced nanovesicles", MOL THER, vol. 19, 2011, pages 1656 - 1666, XP055531213, DOI: 10.1038/mt.2011.138 |
| MANGEOT, P.E.RISSON, V.FUSIL, F.MARNEF, ALAURENT, E.BLIN, J.MOUMETAS, V.MASSOURIDES, ESOHIER, T.J.M.CORBIN, A. ET AL.: "Genome editing in primary cells and in vivo using viral-derived Nanoblades loaded with Cas9-sgRNA ribonucleoproteins", NAT COMMUN, vol. 10, 2019, pages 45, XP055563461, DOI: 10.1038/s41467-018-07845-z |
| MCSHAN W.M.AJDIC D.J.SAVIC D.JSAVIC GLYON K.PRIMEAUX C.SEZATE S.SUVOROV A.N.KENTON S.LAI H.S., PROC. NATL. ACAD. SCI. U.S.A., vol. 98, 2001, pages 4658 - 4663 |
| MERCURI, E.DARRAS, B.TCHIRIBOGA, C.A.DAY, J.W.CAMPBELL, CCONNOLLY, A.M.IANNACCONE, S.T.KIRSCHNER, J.KUNTZ, N.L.SAITO, K. ET AL.: "Nusinersen versus Sham Control in Later-Onset Spinal Muscular Atrophy", N ENGL J MED, vol. 378, 2018, pages 625 - 635 |
| MEUNIER, L.LARREY, D.: "Drug-Induced Liver Injury: Biomarkers, Requirements, Candidates, and Validation", FRONT PHARMACOL, vol. 10, 2019, pages 1482 |
| MILONE, M.C.O'DOHERTY, U.: "Clinical use of lentiviral vectors", LEUKEMIA, vol. 32, 2018, pages 1529 - 1541, XP036541149, DOI: 10.1038/s41375-018-0106-0 |
| MOEDE ET AL., FEBS LETT., vol. 461, 1999, pages 229 - 34 |
| MSELLI-LAKHAL ET AL., J VIROL METHODS, vol. 136, no. 1-2, 2006, pages 177 - 184 |
| MURAWSKI ET AL., JOURNAL OF VIROLOGY, vol. 84, no. 2, 2010, pages 1110 - 1123 |
| MUSUNURU, K.CHADWICK, A.C.MIZOGUCHI, TGARCIA, S.P.DENIZIO, J.E.REISS, C.WWANG, K.IYER, S.DUTTA, CCLENDANIEL, V. ET AL.: "In vivo CRISPR base editing of PCSK9 durably lowers cholesterol in primates", NATURE, vol. 593, 2021, pages 429 - 434, XP037513148, DOI: 10.1038/s41586-021-03534-y |
| NEGRE ET AL., GENE THERAPY, vol. 7, 2000, pages 1613 - 1623 |
| NEWBY, G.A.LIU, D.R.: "In vivo somatic cell base editing and prime editing", MOL THER, 2021 |
| NEWBY, G.A.YEN, J.SWOODARD, K.J.MAYURANATHAN, T.LAZZAROTTO, C.R.LI, Y.SHEPPARD-TILLMAN, HPORTER, S.N.YAO, Y.MAYBERRY, K. ET AL.: "Base editing of haematopoietic stem cells rescues sickle cell disease in mice", NATURE, vol. 595, 2021, pages 295 - 302, XP037514383, DOI: 10.1038/s41586-021-03609-w |
| NISHIDA, K.ARAZOE, T.YACHIE, N.BANNO, S.KAKIMOTO, M.TABATA, M.MOCHIZUKI, M.MIYABE, A.ARAKI, M.HARA, K.Y. ET AL.: "Targeted nucleotide editing using hybrid prokaryotic and vertebrate adaptive immune systems", SCIENCE, vol. 353, 2016, XP055482712, DOI: 10.1126/science.aaf8729 |
| OGASAWARA ET AL., IN VIVO, vol. 20, 2006, pages 319 - 324 |
| OLSEN, GENE THER, vol. 5, no. 11, 1998, pages 1481 - 1487 |
| OSBORN, M.J.NEWBY, G.A.MCELROY, A.N.KNIPPING, FNIELSEN, S.C.RIDDLE, M.J.XIA, LCHEN, W.EIDE, C.RWEBBER, B.R. ET AL.: "Base Editor Correction of COL7A 1 in Recessive Dystrophic Epidermolysis Bullosa Patient-Derived Fibroblasts and iPSCs", J INVEST DERMATOL, vol. 140, 2020, pages 338 - 347 |
| PAN, D.GUNTHER, RDUAN, W.WENDELL, SKAEMMERER, WKAFRI, T.VERMA, I.M.WHITLEY, C.B.: "Biodistribution and toxicity studies of VSVG-pseudotyped lentiviral vector after intravenous administration in mice with the observation of in vivo transduction of bone marrow", MOL THER, vol. 6, 2002, pages 19 - 29 |
| PANG, J.J.CHANG, B.HAWES, N.L.HURD, R.EDAVISSON, M.T.LI, J.NOORWEZ, S.MMALHOTRA, R.MCDOWELL, J.H.KAUSHAL, S. ET AL.: "Retinal degeneration 12 (rd 12): a new, spontaneously arising mouse model for human Leber congenital amaurosis (LCA", MOL VIS, vol. 11, 2005, pages 152 - 162 |
| PARR-BROWNLIE, L.C.BOSCH-BOUJU, CSCHODERBOECK, L.SIZEMORE, R.JABRAHAM, W.C.HUGHES, S.M.: "Lentiviral vectors as tools to understand central nervous system biology in mammalian model organisms", FRONT MOL NEUROSCI, vol. 8, 2015, pages 14 |
| PUPPO, A.CESI, G.MARROCCO, E.PICCOLO, P.JACCA, SSHAYAKHMETOV, D.MPARKS, R.J.DAVIDSON, B.L.COLLOCA, S.BRUNETTI-PIERN, N. ET AL.: "Retinal transduction profiles by high-capacity viral vectors", GENE THER, vol. 21, 2014, pages 855 - 865, XP037771255, DOI: 10.1038/gt.2014.57 |
| QI ET AL., CELL, vol. 152, no. 5, 2013, pages 1173 - 83 |
| QI ET AL.: "Repurposing CRISPR as an RNA-Guided Platform for Sequence-Specific Control of Gene Expression", CELL, vol. 152, no. 5, 2013, pages 1173 - 83, XP055346792, DOI: 10.1016/j.cell.2013.02.022 |
| QUAN ET AL., VIROLOGY, vol. 430, 2012, pages 127 - 135 |
| RANGERPEPPAS, MACROMOL. SCI. REV. MACROMOL. CHEM., vol. 23, 1983, pages 61 |
| RAO, A.S.LINDHOLM, D.RIVAS, M.AKNOWLES, J.W.MONTGOMERY, S.B.INGELSSON, E.: "Large-Scale Phenome-Wide Association Study of PCSK9 Variants Demonstrates Protection Against Ischemic Stroke", CIRC GENOM PRECIS MED, vol. 11, 2018, pages e002162 |
| RASMUSSEN ET AL., VIROLOGY, vol. 178, no. 2, 1990, pages 435 - 451 |
| REES, H.A.KOMOR, A.C.YEH, W.HCAETANO-LOPES, JWARMAN, MEDGE, A.S.B.LIU, D.R.: "Improving the DNA specificity and applicability of base editing through protein engineering and protein delivery", NAT COMMUN, vol. 8, 2017, pages 15790, XP055597104, DOI: 10.1038/ncomms15790 |
| REES, H.A.LIU, D.R.: "Base editing: precision chemistry on the genome and transcriptome of living cells", NAT REV GENET, vol. 19, 2018, pages 770 - 788 |
| REESLIU, NAT REV GENET., vol. 19, no. 12, 2018, pages 770 - 788 |
| REESLIU: "Base editing: precision chemistry on the genome and transcriptome of living cells", NAT. REV. GENET., vol. 19, no. 12, 2018, pages 770 - 788 |
| RENNER, T.M.TANG, V.A.BURGER, D.LANGLOIS, M.A.: "Intact Viral Particle Counts Measured by Flow Virometry Provide Insight into the Infectivity and Genome Packaging Efficiency of Moloney Murine Leukemia Virus", J VIROL, vol. 94, 2020 |
| RICHTER, M.F.ZHAO, K.TETON, E.LAPINAITE, A.NEWBY, G.A.THURONYI, B.W.WILSON, CKOBLAN, L.W.ZENG, JBAUER, D.E. ET AL.: "Phage-assisted evolution of an adenine base editor with improved Cas domain compatibility and activity", NAT BIOTECHNOL., 2020 |
| ROTHGANGL, T.DENNIS, M.K.LIN, P.J.COKA, R.WITZIGMANN, D.VILLIGER, LQI, W.HRUZOVA, M.KISSLING, L.LENGGENHAGER, D. ET AL.: "In vivo adenine base editing of PCSK9 in macaques reduces LDL cholesterol levels", NAT BIOTECHNOL, vol. 39, 2021, pages 949 - 957, XP037534467, DOI: 10.1038/s41587-021-00933-4 |
| SAENZ ET AL., COLD SPRING HARB PROTOC, no. 1, 2012, pages 124 - 125 |
| SAUDEK ET AL., N. ENGL. J. MED., vol. 321, 1989, pages 574 |
| SEFTON, CRC CRIT. REF. BIOMED. ENG., vol. 14, 1989, pages 201 |
| SERREZE, D.V., LEITER, E.H., CHRISTIANSON, G.J., GREINER, D., ROOPENIAN, D.C.: "Major histocompatibility complex class I-deficient NOD-B2mnull mice are diabetes and insulitis resistant", DIABETES, vol. 43, 1994, pages 505 - 509, XP000603733, DOI: 10.2337/diabetes.43.3.505 |
| SHARMA ET AL., PROC NATL ACAD SCI USA, vol. 94, 1997, pages 10803 - 10808 |
| SHMAKOV ET AL.: "Discovery and Functional Characterization of Diverse Class 2 CRISPR Cas Systems", MOL. CELL, vol. 60, no. 3, 5 November 2015 (2015-11-05), pages 385 - 397, XP055785070, DOI: 10.1016/j.molcel.2015.10.008 |
| SODI, A.BANFI, S.TESTA, F.DELLA CORTE, M.PASSERINI, IPELO, E.ROSSI, S.SIMONELLI, F.ITALIAN, I.R.D.W.G.: "RPE65-associated inherited retinal diseases: consensus recommendations for eligibility to gene therapy", ORPHANET J RARE DIS, vol. 16, 2021, pages 257 |
| SONG, Y.LIU, ZZHANG, YCHEN, MSUI, TLAI, L.LI, Z.: "Large-Fragment Deletions Induced by Cas9 Cleavage while Not in the BEs System", MOL THER NUCLEIC ACIDS, vol. 21, 2020, pages 523 - 526 |
| STADTMAUER, E.A.FRAIETTA, J.A.DAVIS, M.M.COHEN, A.D.WEBER, K.L.LANCASTER, E.MANGAN, P.A.KULIKOVSKAYA, IGUPTA, M.CHEN, F. ET AL.: "CRISPR-engineered T cells in patients with refractory cancer", SCIENCE, vol. 367, 2020, XP055896641, DOI: 10.1126/science.aba7365 |
| SUH, S.CHOI, E.H.LEINONEN, H.FOIK, A.T.NEWBY, G.AYEH, W.H.DONG, Z.KISER, P.D.LYON, D.C.LIU, D.R. ET AL.: "Restoration of visual function in adult mice with an inherited retinal disease via adenine base editing", NAT BIOMED ENG, vol. 5, 2021, pages 169 - 178, XP037367930, DOI: 10.1038/s41551-020-00632-6 |
| SWIECH, L.HEIDENREICH, M.BANERJEE, A.HABIB, N.LI, Y.TROMBETTA, J.SUR, MZHANG, F.: "In vivo interrogation of gene function in the mammalian brain using CRISPR-Cas9", NAT BIOTECHNOL, vol. 33, 2015, pages 102 - 106, XP055176807, DOI: 10.1038/nbt.3055 |
| TAKAHASHIYAMANAKA, CELL, vol. 126, no. 4, 2006, pages 663 - 76 |
| TANG ET AL., JOURNAL OF VIROLOGY, vol. 86, no. 14, 2012, pages 7662 - 7676 |
| TAYLOR, A.W.: "Ocular immune privilege", EYE (LOND, vol. 23, 2009, pages 1885 - 1889 |
| THOME, R.G.NICHOLSON, C.: "In vivo diffusion analysis with quantum dots and dextrans predicts the width of brain extracellular space", PROC NATL ACAD SCI U S A, vol. 103, 2006, pages 5567 - 5572 |
| TINLAND ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 89, 1992, pages 7442 - 46 |
| TOME-AMAT ET AL., MICROBIAL CELL FACTORIES, vol. 13, 2014, pages 134 - 142 |
| TSAI, S.Q.NGUYEN, N.T.MALAGON-LOPEZ, J.TOPKAR, V.V.ARYEE, M.J.JOUNG, J.K.: "CIRCLE-seq: a highly sensitive in vitro screen for genome-wide CRISPR-Cas9 nuclease off-targets", NAT METHODS, vol. 14, 2017, pages 607 - 614, XP055424040, DOI: 10.1038/nmeth.4278 |
| TURCHIANO, G.ANDRIEUX, G.KLERMUND, J.BLATTNER, G.PENNUCCI, V.EL GAZ, M.MONACO, G.PODDAR, S.MUSSOLINO, C.CORNU, T.I. ET AL.: "Quantitative evaluation of chromosomal rearrangements in gene-edited human stem cells by CAST-Seq", CELL STEM CELL, vol. 28, 2021, pages 1136 - 1147 |
| VOELKEL, C.GALLA, M.MAETZIG, T.WARLICH, E.KUEHLE, J.ZYCHLINSKI, DBODE, J.CANTZ, T.SCHAMBACH, A.BAUM, C.: "Protein transduction from retroviral Gag precursors.", PROC NATL ACAD SCI U S A, vol. 107, 2010, pages 7805 - 7810, XP055326796, DOI: 10.1073/pnas.0914517107 |
| WALPITA ET AL., PLOSONE, 2015 |
| WANG ET AL., EXPERT REV VACCINES, vol. 12, no. 2, 2013 |
| WANG, D.SHUKLA, C.LIU, X.SCHOEB, T.RCLARKE, L.A.BEDWELL, D.M.KEELING, K.M: "Characterization of an MPS I-H knock-in mouse that carries a nonsense mutation analogous to the human IDUA-W402X mutation", MOL GENET METAB, vol. 99, 2010, pages 62 - 71, XP026802472 |
| WANG, D.ZHANG, F.GAO, G.: "CRISPR-Based Therapeutic Genome Editing: Strategies and In Vivo Delivery by AAV Vectors", CELL, vol. 181, 2020, pages 136 - 150 |
| WEBBER, B.R.LONETREE, C.L.KLUESNER, M.G.JOHNSON, M.J.POMEROY, E.JDIERS, M.D.LAHR, W.S.DRAPER, G.MSLIPEK, N.J.SMEESTER, B.A ET AL.: "Highly efficient multiplex human T cell engineering without double-strand breaks using Cas9 base editors", NAT COMMUN, vol. 10, 2019, pages 5222, XP055834302, DOI: 10.1038/s41467-019-13007-6 |
| WEI, T.CHENG, Q.MIN, Y.L.OLSON, E.NSIEGWART, D.J.: "Systemic nanoparticle delivery of CRISPR-Cas9 ribonucleoproteins for effective tissue specific genome editing", NAT COMMUN, vol. 11, 2020, pages 3232, XP055873647, DOI: 10.1038/s41467-020-17029-3 |
| WHEELER, J.XJONES, CTHORPE, R.ZHAO, Y.: "Proteomics analysis of cellular components in lentiviral vector production using Gel-LC-MS/MS", PROTEOMICS CLIN APPL, vol. 1, 2007, pages 224 - 230 |
| WU, D.T.ROTH, M.J.: "MLV based viral-like-particles for delivery of toxic proteins and nuclear transcription factors", BIOMATERIALS, vol. 35, 2014, pages 8416 - 8426, XP028880170, DOI: 10.1016/j.biomaterials.2014.06.006 |
| XU, D ET AL.: "Sequence and structural analyses of nuclear export signals in the NESdb database", MOL BIOL. CELL, vol. 23, no. 18, 2012, pages 3677 - 3693 |
| XU, D. ET AL.: "Sequence and structural analyses of nuclear export signals in the NESdb database", MOL. BIOL. CELL, vol. 23, no. 18, 2012, pages 3677 - 3693 |
| YAMANO ET AL.: "Crystal structure of Cpfl in complex with guide RNA and target DNA", CELL, no. 165, 2016, pages 949 - 962 |
| YANG ET AL.: "PAM-dependent Target DNA Recognition and Cleavage by C2c1 CRISPR-Cas endonuclease", CELL, vol. 167, no. 7, 15 December 2016 (2016-12-15), pages 1814 - 1828, XP029850724, DOI: 10.1016/j.cell.2016.11.053 |
| YAO, X.LYU, P.YOO, K.YADAV, M.K.SINGH, R.ATALA, A.LU, B.: "Engineered extracellular vesicles as versatile ribonucleoprotein delivery vehicles for efficient and safe CRISPR genome editing", J EXTRACELL VESICLES, vol. 10, 2021, pages e12076, XP055897973, DOI: 10.1002/jev2.12076 |
| YEE ET AL., PROC NATL ACAD SCI, USA, vol. 91, 1994, pages 9564 - 9568 |
| YEH, W.H.CHIANG, H.REES, H.A.EDGE, A.S.B.LIU, D.R.: "In vivo base editing of post-mitotic sensory cells", NAT COMMUN, vol. 9, 2018, pages 2184 |
| YEH, W.H.SHUBINA-OLEINIK, O.LEVY, J.M.PAN, B.NEWBY, G.A.WORNOW, M.BURT, RCHEN, J.C.HOLT, J.R.LIU, D.R.: "In vivo base editing restores sensory transduction and transiently improves auditory function in a mouse model of recessive deafness", SCI TRANSL MED, vol. 12, 2020 |
| YU, Y.LEETE, T.C.BORN, D.A.YOUNG, L.BARRERA, L.A.LEE, S.J.REES, H.A.CIARAMELLA, G.GAUDELLI, N.M.: "Cytosine base editors with minimized unguided DNA and RNA off-target events and high on-target activity", NAT COMMUN, vol. 11, 2020, pages 2052, XP055904992, DOI: 10.1038/s41467-020-15887-5 |
| ZELTONS, MOL BIOTECHNOL, vol. 53, 2013, pages 92 - 107 |
| ZENG ET AL., NAT. MED., 2020 |
| ZENG, J.WU, Y.REN, C.BONANNO, J.SHEN, A.H.SHEA, D.GEHRKE, J.M.CLEMENT, K.LUK, K.YAO, Q ET AL.: "Therapeutic base editing of human hematopoietic stem cells", NAT MED, vol. 26, 2020, pages 535 - 541, XP037090965, DOI: 10.1038/s41591-020-0790-y |
| ZETSCHE ET AL., CELL, vol. 163, 2015, pages 759 - 771 |
| ZHANG Y. P. ET AL., GENE THER., vol. 6, 1999, pages 1438 - 47 |
| ZHANG, W.CAO, SMARTIN, J.LMUELLER, J.D.MANSKY, L.M.: "Morphology and ultrastructure of retrovirus particles", AIMS BIOPHYS, vol. 2, 2015, pages 343 - 369 |
| ZHONG, Z.RONG, F.DAI, Y.YIBULAYIN, A.ZENG, LLIAO, J.WANG, L.HUANG, Z.ZHOU, Z.CHEN, J.: "Seven novel variants expand the spectrum of RPE65-related Leber congenital amaurosis in the Chinese population", MOL VIS, vol. 25, 2019, pages 204 - 214 |
Cited By (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12584118B2 (en) | 2013-09-06 | 2026-03-24 | President And Fellows Of Harvard College | Cas9 variants and uses thereof |
| US12559737B2 (en) | 2013-09-06 | 2026-02-24 | President And Fellows Of Harvard College | Cas9 variants and uses thereof |
| US12473573B2 (en) | 2013-09-06 | 2025-11-18 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| US12390514B2 (en) | 2017-03-09 | 2025-08-19 | President And Fellows Of Harvard College | Cancer vaccine |
| US12516308B2 (en) | 2017-03-09 | 2026-01-06 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US12522807B2 (en) | 2018-07-09 | 2026-01-13 | The Broad Institute, Inc. | RNA programmable epigenetic RNA modifiers and uses thereof |
| US12570972B2 (en) | 2019-03-19 | 2026-03-10 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12509680B2 (en) | 2019-03-19 | 2025-12-30 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| US12404525B2 (en) | 2019-06-13 | 2025-09-02 | The General Hospital Corporation | Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells |
| US12351815B2 (en) | 2019-06-13 | 2025-07-08 | The General Hospital Corporation | Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells |
| US12351814B2 (en) | 2019-06-13 | 2025-07-08 | The General Hospital Corporation | Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells |
| US12319938B2 (en) | 2020-07-24 | 2025-06-03 | The General Hospital Corporation | Enhanced virus-like particles and methods of use thereof for delivery to cells |
| WO2025051278A1 (en) * | 2023-09-09 | 2025-03-13 | Geneditbio Limited | Engineered protein delivery vehicle |
| WO2025096936A2 (en) | 2023-11-03 | 2025-05-08 | The Broad Institute, Inc. | Use of prime editing in correcting mutations in cdkl5 |
| WO2025137543A1 (en) * | 2023-12-22 | 2025-06-26 | President And Fellows Of Harvard College | Methods for screening for next generation nucleic acid delivery vectors |
| WO2025153043A1 (zh) * | 2024-01-19 | 2025-07-24 | 微光基因(苏州)有限公司 | 用于递送核酸和蛋白质的类病毒样蛋白颗粒及其制备方法 |
| CN118086408A (zh) * | 2024-04-25 | 2024-05-28 | 华南理工大学 | 一种可实现靶向肌肉细胞基因编辑的仿病毒颗粒及其制备方法和应用 |
| WO2026024856A2 (en) | 2024-07-23 | 2026-01-29 | The Broad Institute, Inc. | Compositions and methods for production of double-stranded dna in cells for programmable gene integration |
| CN119162152A (zh) * | 2024-11-18 | 2024-12-20 | 南京农业大学三亚研究院 | 一种扩大编辑范围且提高编辑效率的高精准碱基编辑器 |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2022400961A1 (en) | 2024-05-30 |
| EP4441073A2 (en) | 2024-10-09 |
| US20250382334A1 (en) | 2025-12-18 |
| IL312889A (en) | 2024-07-01 |
| GB2630190A (en) | 2024-11-20 |
| JP2024544012A (ja) | 2024-11-26 |
| KR20240112361A (ko) | 2024-07-18 |
| WO2023102537A3 (en) | 2023-07-13 |
| CA3238778A1 (en) | 2023-06-08 |
| GB202409656D0 (en) | 2024-08-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20250382334A1 (en) | Self-assembling virus-like particles for delivery of nucleic acid programmable fusion proteins and methods of making and using same | |
| An et al. | Engineered virus-like particles for transient delivery of prime editor ribonucleoprotein complexes in vivo | |
| US20250084400A1 (en) | Compositions and methods for efficient in vivo delivery | |
| US20240093193A1 (en) | Dead guides for crispr transcription factors | |
| US12435320B2 (en) | CRISPR having or associated with destabilization domains | |
| US20250064979A1 (en) | Self-assembling virus-like particles for delivery of prime editors and methods of making and using same | |
| JP6968416B2 (ja) | Rna誘導性の、hiv感染の処置のための、方法および組成物 | |
| US20250136950A1 (en) | Compositions and methods for efficient in vivo delivery | |
| WO2024215652A2 (en) | Directed evolution of engineered virus-like particles (evlps) | |
| US12421507B2 (en) | Methods and compositions for optochemical control of CRISPR-CAS9 | |
| CN118748998A (zh) | 用于递送核酸可编程融合蛋白的自组装病毒样颗粒以及制备和使用其的方法 | |
| Rousseau | Engineering Virus-Like Particles for the Delivery of Genome Editing Enzymes | |
| TW202536173A (zh) | Rna-引導核酸酶及其活性片段及變體,以及使用方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22851442 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: AU2022400961 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 3238778 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022400961 Country of ref document: AU Date of ref document: 20221202 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280079926.7 Country of ref document: CN |
|
| ENP | Entry into the national phase |
Ref document number: 2024533013 Country of ref document: JP Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112024011035 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202417050359 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 20247022051 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 202409656 Country of ref document: GB Kind code of ref document: A Free format text: PCT FILING DATE = 20221202 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022851442 Country of ref document: EP Ref document number: 2409656.2 Country of ref document: GB |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022851442 Country of ref document: EP Effective date: 20240703 |
|
| ENP | Entry into the national phase |
Ref document number: 112024011035 Country of ref document: BR Kind code of ref document: A2 Effective date: 20240531 |
|
| WWP | Wipo information: published in national office |
Ref document number: 2409656.2 Country of ref document: GB |