WO2023102448A2 - Coronavirus vaccine formulations - Google Patents
Coronavirus vaccine formulations Download PDFInfo
- Publication number
- WO2023102448A2 WO2023102448A2 PCT/US2022/080700 US2022080700W WO2023102448A2 WO 2023102448 A2 WO2023102448 A2 WO 2023102448A2 US 2022080700 W US2022080700 W US 2022080700W WO 2023102448 A2 WO2023102448 A2 WO 2023102448A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- deletion
- cov
- months
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/215—Coronaviridae, e.g. avian infectious bronchitis virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/50—Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
- A61K9/51—Nanocapsules; Nanoparticles
- A61K9/5107—Excipients; Inactive ingredients
- A61K9/5123—Organic compounds, e.g. fats, sugars
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5252—Virus inactivated (killed)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55555—Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55577—Saponins; Quil A; QS21; ISCOMS
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/575—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B82—NANOTECHNOLOGY
- B82Y—SPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES
- B82Y5/00—Nanobiotechnology or nanomedicine, e.g. protein engineering or drug delivery
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20023—Virus like particles [VLP]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20071—Demonstrated in vivo effect
Definitions
- the present disclosure is generally related to non-naturally occurring coronavirus (CoV) Spike (S) polypeptides and nanoparticles and vaccines comprising the same, which are useful for stimulating immune responses.
- the nanoparticles provide antigens, for example, glycoprotein antigens, optionally associated with a detergent core and are typically produced using recombinant approaches.
- the nanoparticles have improved stability and enhanced epitope presentation.
- the disclosure also provides compositions containing the nanoparticles, methods for producing them, and methods of stimulating immune responses.
- SARS-CoV-2 coronavirus belongs to the same family of viruses as severe acute respiratory syndrome coronavirus (SARS-CoV) and Middle East respiratory syndrome coronavirus (MERS-CoV), which have killed hundreds of people in the past 17 years. SARS-CoV-2 causes the disease COVID-19.
- SARS-CoV-2 causes the disease COVID-19.
- the present disclosure provides non-naturally occurring CoV S polypeptides suitable for inducing immune responses against SARS-CoV-2.
- the disclosure also provides nanoparticles containing the glycoproteins as well as methods of stimulating immune responses.
- the present disclosure also provides CoV S polypeptides suitable for inducing immune responses against multiple coronaviruses, including SARS-CoV-2, Middle East Respiratory Syndrome (MERS), and Severe Acute Respiratory Syndrome (SARS).
- SARS-CoV-2 Middle East Respiratory Syndrome
- MERS Middle East Respiratory Syndrome
- SARS Severe Acute Respiratory Syndrome
- CoV S polypeptides comprising:
- an SI subunit with an inactivated furin cleavage site comprising an N-terminal domain (NTD), a receptor binding domain (RBD), subdomains 1 and 2 (SD1/2), wherein the inactivated furin cleavage site has an amino acid sequence of QQAQ (SEQ ID NO: 7); wherein the NTD optionally comprises one or more modifications selected from the group consisting of:
- S2 subunit wherein amino acids 973 and 974 are proline, wherein the S2 subunit optionally comprises one or more modifications selected from the group consisting of:
- the one or more modifications are selected from: (i) mutation of one or more of amino acids selected from the group consisting of 6, 14, 54, 70, 82, 129, 133, 134, 139, 143, 144, 170, 197, 199, 200, 239, 244, 326, 333, 355, 358, 360, 362, 363,
- the one or modifications are selected from: T6I, T6R, A14S, A54V, V70A, T82I, G129D, H133Q, K134E, W139R, E143G, F144L, Q170E, I197V, L199I, V200E, V200G, G239V, G244S, G326D, G326H, R333T, L355I, S358F, S358L, S360P, S362F, T363A, D392N, R395S, K404N, N427K, K431T, V432P, G433S, L439R, L439Q, N447K, S464N, T465K, E471A, F473V, F473S, F477S, Q480R, G483S, Q485R, N488Y, Y492H, T534K, T591I, D601G, G6
- CoV S glycoproteins comprising a combination of modifications selected from the group consisting of:
- the CoV S glycoprotein is at least 90 %, at least 91 %, at least 92 %, at least 93 %, at least 94 %, at least 95 %, at least 96 %, at least 97 %, at least 98 %, at least 99 %, or 100 % identical to any one of SEQ ID NOS: 174, 175, 186, 188, 190, 195, 217-228, 233-236, and 243..
- the NTD of the CoV S glycoprotein is at least 90 %, at least 91 %, at least 92 %, at least 93 %, at least 94 %, at least 95 %, at least 96 %, at least 97 %, at least 98 %, at least 99 %, or 100 % identical to an NTD of any one of SEQ ID NOS: 174, 175, 186, 188, 190, 195, 217-228, 233-236, and 243.
- the RBD of the CoV S glycoprotein is at least 90 %, at least 91 %, at least 92 %, at least 93 %, at least 94 %, at least 95 %, at least 96 %, at least 97 %, at least 98 %, at least 99 %, or 100 % identical to an RBD of any one of SEQ ID NOS: 174, 175, 186, 188, 190, 195, 217-228, 233-236, and 243.
- the SI subunit of the CoV S glycoprotein is at least 90 %, at least 91 %, at least 92 %, at least 93 %, at least 94 %, at least 95 %, at least 96 %, at least 97 %, at least 98 %, at least 99 %, or 100 % identical to an SI subunit of any one of SEQ ID NOS: 174, 175, 186, 188, 190, 195, 217-228, 233-236, and 243.
- the S2 subunit of the CoV S glycoprotein is at least 90 %, at least 91 %, at least 92 %, at least 93 %, at least 94 %, at least 95 %, at least 96 %, at least 97 %, at least 98 %, at least 99 %, or 100 % identical to an S2 subunit of any one of SEQ ID NOS: 174, 175, 186, 188, 190, 195, 217- 228, 233-236, and 243.
- the SD1/2 of the CoV S glycoprotein is at least 90 %, at least 91 %, at least 92 %, at least 93 %, at least 94 %, at least 95 %, at least 96 %, at least 97 %, at least 98 %, at least 99 %, or 100 % identical to an SD1/2 of any one of SEQ ID NOS: 174, 175, 186, 188, 190, 195, 217-228, 233-236, and 243.
- each of the NTD, RBD, SI subunit, S2 subunit, and SD1/2 of the CoV S glycoprotein is at least 90 %, at least 91 %, at least 92 %, at least 93 %, at least 94 %, at least 95 %, at least 96 %, at least 97 %, at least 98 %, at least 99 %, or 100 % identical to the respective NTD, RBD, SI subunit, S2 subunit, and SD1/2 of any one of SEQ ID NOS: 174, 175, 186, 188, 190, 195, 217-228, 233-236, and 243.
- the CoV S glycoprotein comprises a protein tag.
- the protein tag is at the N-terminus of the glycoprotein. In embodiments, the protein tag is at the C-terminus of the glycoprotein. In embodiments, the protein tag is selected from a polyglutamate tag, a FLAG-tag, a HA-tag, a polyHis-tag (having about 5-10 histidines) (SEQ ID NO: 101), a hexahistidine tag (SEQ ID NO: 100), an 8X-His-tag (having eight histidines) (SEQ ID NO: 102), a Myc-tag, a Glutathione-S-transferase-tag, a Green fluorescent proteintag, Maltose binding protein-tag, a Thioredoxin-tag, an Fc-tag, or a combination thereof.
- the CoV S glycoprotein comprises an N-terminal signal peptide. In embodiments, the N-terminal signal peptide is selected from any one of SEQ ID NOS: 5, 117, 154,
- nucleic acid comprising a CoV S glycoprotein described herein.
- the nucleic acid is at least 80 %, at least 85 %, at least 90 %, at least 91 %, at least 92 %, at least 93 %, at least 94 %, at least 95 %, at least 96 %, at least 97 %, at least 98 %, at least 99 %, or 100 % identical to the nucleic acid of any one of SEQ ID NOS: 196, 197, 198, 199, 201, 202, 204, 206, 208, 210, 212, 214, or 216.
- a vector comprising the nucleic acid of claim 18 or 19.
- a nanoparticle comprising the CoV S glycoprotein described herein and a non-ionic detergent core.
- the melting temperature of the nanoparticle is at least 55 °C, at least 56 °C, at least 57 °C, at least 58 °C, at least 59 °C, at least 60 °C, at least 61 °C, at least 62 °C, at least 63 °C, at least 64 °C, at least 65 °C, or from about 55 °C to about 65 °C after about one month of storage at 4 °C, as determined by differential scanning calorimetry.
- the melting temperature of the nanoparticle is at least 55 °C, at least 56 °C, at least 57 °C, at least 58 °C, at least 59 °C, at least 60 °C, at least 61 °C, at least 62 °C, at least 63 °C, at least 64 °C, at least 65 °C, or from about 55 °C to about 65 °C after about one month of storage at 25 °C, as determined by differential scanning calorimetry.
- the melting temperature of the nanoparticle is at least 55 °C, at least 56 °C, at least 57 °C, at least 58 °C, at least 59 °C, at least 60 °C, at least 61 °C, at least 62 °C, at least 63 °C, at least 64 °C, at least 65 °C, or from about 55 °C to about 65 °C after about one month of storage at 37 °C, as determined by differential scanning calorimetry.
- the nanoparticle has a Zavg diameter of from about 30 nm to about 65 nm or from about 30 nm to about 50 nm after about one month storage at 4 °C, as determined by dynamic light scattering.
- the nanoparticle has a Zavg diameter of from about 30 nm to about 65 nm or from about 30 nm to about 50 nm after about one month storage at 25 °C, as determined by dynamic light scattering. In embodiments, the nanoparticle has a Zavg diameter of from about 30 nm to about 120 nm, from about 30 nm to about 80 nm, or from about 30 nm to about 60 nm after about one month storage at 37 °C, as determined by dynamic light scattering.
- the nanoparticle has a poly dispersity index of from about 0.1 nm to about 0.4 nm, from about 0.15 nm to about 0.35 nm, or from about 0.2 nm to about 0.45 nm after about one month storage at 4 °C, as determined by dynamic light scattering. In embodiments, the nanoparticle has a poly dispersity index of from about 0.1 nm to about 0.4 nm, from about 0.15 nm to about 0.35 nm, or from about 0.2 nm to about 0.45 nm after about one month storage at 25 °C, as determined by dynamic light scattering.
- the nanoparticle has a poly dispersity index of from about 0.1 nm to about 0.4 nm, from about 0.15 nm to about 0.35 nm, or from about 0.2 nm to about 0.45 nm after about one month storage at 37 °C, as determined by dynamic light scattering.
- the non-ionic detergent is selected from the group consisting of polysorbate-20 (PS20), polysorbate-40 (PS40), polysorbate-60 (PS60), polysorbate-65 (PS65), and polysorbate-80 (PS80).
- the non-ionic detergent is PS80.
- a cell expressing a CoV glycoprotein described herein is a cell expressing a CoV glycoprotein described herein.
- the cell is an insect cell.
- an immunogenic composition comprising at least one CoV S glycoprotein described herein or a nanoparticle as described herein and a pharmaceutically acceptable buffer.
- the composition comprises two, three, four, five, six, seven, eight, nine, or ten different CoV S glycoproteins.
- At least one CoV S glycoprotein comprises a combination of modifications selected from the group consisting of: (i) A54V, T82I, G129D, L199I, G326D, S358L, S360P, S362F, K404N, N427K, G433S, S464N, T465K, E471A, Q480R, G483S, Q485R, N488Y, Y492H, T534K, D601G, H642Y, N666K, P668H, N751K, D783Y, N843K, Q941H, N956K, L968F, deletion of amino acid 56, deletion of amino acid 57, deletion of amino acid 130, deletion of amino acid 131, deletion of amino acid 132, deletion of amino acid 198, and insertion of a tripeptide having the amino acid sequence of EPE between amino acids 214 and 215; (ii) T6I, A14S, G129D,
- the immunogenic composition comprises at least one CoV S glycoprotein is at least 90 %, at least 91 %, at least 92 %, at least 93 %, at least 94 %, at least 95 %, at least 96 %, at least 97 %, at least 98 %, at least 99 %, or 100 % identical to any one of SEQ ID NOS: 174, 175, 186, 188, 190, 195, 217-228, 233-236, and 243.
- the immunogenic composition comprises a CoV S glycoprotein with at least 80 %, at least 85 %, at least 90 %, at least 91 %, at least 92 %, at least 93 %, at least 94 %, at least 95 %, at least 96 %, at least 97 %, at least 98 %, at least 99 %, or 100 % identity to a CoV S glycoprotein of SEQ ID NO: 87.
- the immunogenic composition comprises a CoV S glycoprotein with at least 80 %, at least 85 %, at least 90 %, at least 91 %, at least 92 %, at least 93 %, at least 94 %, at least 95 %, at least 96 %, at least 97 %, at least 98 %, at least 99 %, or 100 % identity to a CoV S glycoprotein of SEQ ID NOS: 85-89, 105, 106, and 112- 115.
- the immunogenic composition comprises an mRNA encoding a SARS- Cov-2 Spike glycoprotein, a plasmid DNA encoding a S ARS-Cov-2 Spike glycoprotein, a viral vector encoding a SARS-Cov-2 Spike glycoprotein, or an inactivated SARS-CoV-2 virus.
- the immunogenic composition comprises at least one, at least two, at least three, or at least four hemagglutinin (HA) glycoproteins, wherein each HA glycoprotein is from a different influenza strain.
- the immunogenic composition comprises a respiratory syncytial virus (RSV) fusion (F) glycoprotein.
- RSV respiratory syncytial virus
- the immunogenic composition comprises: (i) a first CoV S glycoprotein having at least 90 %, at least 91 %, at least 92 %, at least 93 %, at least 94 %, at least 95 %, at least 96 %, at least 97 %, at least 98 %, at least 99 %, or 100 % identity to a polypeptide of SEQ ID NO: 87 and (ii) a second CoV S glycoprotein having at least 90 %, at least 91 %, at least 92 %, at least 93 %, at least 94 %, at least 95 %, at least 96 %, at least 97 %, at least 98 %, at least 99 %, or 100 % identity to a polypeptide of SEQ ID NO: 175.
- the immunogenic composition comprises from about 1 pg to about 50 pg; from about 3 pg to about 25 pg, from about 5 pg to about 25 pg, or from about 5 pg to about 100 pg of CoV S glycoprotein. In embodiments, the immunogenic composition comprises from about 1 pg to about 50 pg; from about 3 pg to about 25 pg, from about 5 pg to about 25 pg, or from about 5 pg to about 100 pg of each CoV S glycoprotein. In embodiments, the immunogenic composition comprises about 5 pg of CoV S glycoprotein. In embodiments, the immunogenic composition comprises about 5 pg of each CoV S glycoprotein.
- the immunogenic composition comprises an adjuvant.
- the adjuvant is a saponin adjuvant.
- the saponin adjuvant comprises at least two iscom particles, wherein: the first iscom particle comprises fraction A of Quillaja Saponaria Molina and not fraction C of Quillaja Saponaria Molina; and the second iscom particle comprises fraction C of Quillaja Saponaria Molina and not fraction A of Quillaja Saponaria Molina.
- fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina account for about 85 % by weight and about 15 % by weight, respectively, of the sum of weights of fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina in the adjuvant. In embodiments, fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina account for about 92 % by weight and about 8 % by weight, respectively, of the sum of the weights of fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina in the adjuvant.
- fraction A of Quillaja Saponaria Molina accounts for at least about 85 % by weight
- fraction C of Quillaja Saponaria Molina accounts for the remainder, respectively, of the sum of the weights of fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina in the adjuvant.
- fraction A of Quillaja Saponaria Molina accounts for 50-96% by weight
- fraction C of Quillaja Saponaria Molina accounts for the remainder, respectively, of the sum of the weights of fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina in the adjuvant.
- the immunogenic composition comprises from about 25 pg to about 100 pg of adjuvant. In embodiments, the immunogenic composition comprises about 50 pg of adjuvant.
- a pre-filled syringe comprising an immunogenic composition described herein.
- a method of stimulating an immune response against SARS-CoV-2 or a heterogeneous SARS-CoV-2 strain comprising administering an immunogenic composition described herein to a subject.
- the method comprises administering 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 doses of the immunogenic composition.
- the method comprises administering a first dose of the immunogenic composition and a second dose of the immunogenic composition about three weeks after the first dose.
- the method comprises administering a first dose of the immunogenic composition and a second dose of the immunogenic composition about 21 days after the first dose.
- the method comprises administering a first dose of the immunogenic composition and a second dose of the immunogenic composition about 28 days after the first dose.
- the method comprises administering at least three doses of the immunogenic composition, wherein the third dose of the immunogenic composition is administered at least 6 months, at least 7 months, at least 8 months, at least 9 months, at least 10 months, at least 11 months, at least 12 months, at least 13 months, at least 14 months, at least 15 months, at least 16 months, at least 17 months, at least 18 months, at least 19 months, at least 20 months, at least 21 months, at least 22 months, at least 23 months, or at least 24 months after the first or second dose.
- the method comprises administering a second immunogenic composition that is different from the first immunogenic composition.
- the second immunogenic composition comprises an mRNA encoding a SARS-Cov-2 Spike glycoprotein, a plasmid DNA encoding a SARS-Cov-2 Spike glycoprotein, a viral vector encoding a SARS-Cov-2 Spike glycoprotein, or an inactivated SARS-CoV-2 virus.
- the second immunogenic composition comprises at least one, at least two, at least three, or at least four hemagglutinin (HA) glycoproteins, wherein each HA glycoprotein is from a different influenza strain.
- the second immunogenic composition comprises a different CoV S glycoprotein than the first immunogenic composition.
- the second immunogenic composition comprises a respiratory syncytial virus (RSV) fusion (F) protein.
- RSV respiratory syncytial virus
- F respiratory syncytial virus
- the immunogenic composition is administered intramuscularly.
- the method comprises administering the immunogenic composition in a pre-filled syringe.
- the method prevents COVID-19 with an efficacy from about 50 % to about 99 %, from about 50 % to about 95 %, from about 50 % to about 90 %, from about 50 % to about 85 %, from about 50 % to about 80 %, from about 60 % to about 99 %, from about 65 % to about 95 %, from about 65 % to about 90 %, from about 65 % to about 85 %, from about 69 % to about 81 %, from about 60 % to about 95 %, from about 60 % to about 90 %, from about 60 % to about 85 %, from about 60 % to about 80 %, from about 40 % to about 99 %, from about 40 % to about 95 %, from about 40 % to about 90 %, from about 40 % to about 85 %, from about 40 % to about 80 %, from about 40 % to about 75 %, from about 40 % to about 70 %, from about 40 %
- the method prevents COVID-19 with an efficacy from about 50 % to about 99 %, from about 50 % to about 95 %, from about 50 % to about 90 %, from about 50 % to about 85 %, from about 50 % to about 80 %, from about 60 % to about 99 %, from about 65 % to about 95 %, from about 65 % to about 90 %, from about 65 % to about 85 %, from about 69 % to about 81 %, from about 60 % to about 95 %, from about 60 % to about 90 %, from about 60 % to about 85 %, from about 60 % to about 80 %, from about 40 % to about 99 %, from about 40 % to about 95 %, from about 40 % to about 90 %, from about 40 % to about 85 %, from about 40 % to about 80 %, from about 40 % to about 75 %, from about 40 % to about 70 %, from about 40 %
- the heterogenous SARS-CoV-2 strain has a PANGO lineage selected from the group consisting of B.1.1.529; BA.l, BA.1.1, BA.2, BA.3, BA.4, BA.5, B.1.1.7, B.1.351, P.l, B.1.617.2, AY, B.1.427, B.1.429, B.1.525, B.1.526, B.1.617.1, B.1.617.3, P.2, B.1.621, or B.1.621.1.
- the heterogeneous SARS-CoV-2 strain has a World Health Organization Label of alpha, beta, gamma, delta, epsilon, iota, kappa, zeta, mu, or omicron.
- a method of stimulating an immune response against SARS-CoV-2, a heterogeneous SARS- CoV-2 strain, an influenza virus, or a combination thereof in a subject comprising administering an immunogenic composition described herein.
- a method of stimulating an immune response against SARS-CoV-2, a heterogeneous SARS-CoV-2 strain, an influenza virus, respiratory syncytial virus (RSV) or a combination thereof in a subject comprising administering an immunogenic composition described herein.
- Fig. 1 shows a schematic of the wild-type amino acid sequence of the SARS-CoV-2 Spike (S) protein (SEQ ID NO: 1).
- S SARS-CoV-2 Spike
- RRAR SEQ ID NO: 6
- FIG. 2 shows the primary structure of a SARS-CoV-2 S polypeptide, which has an inactive furin cleavage site, a fusion peptide deletion, and K986P and V987P mutations.
- the domain positions are numbered with respect to the amino acid sequence of the wild-type CoV S polypeptide from SARS-CoV-2 containing a signal peptide (SEQ ID NO: 1).
- FIG. 3 shows the primary structure of the BV2378 CoV S polypeptide, which has an inactive furin cleavage site, a fusion peptide deletion of amino acids 819-828, and K986P and V987P mutations.
- the domain positions are numbered with respect to the amino acid sequence of the wild-type CoV S polypeptide from SARS-CoV-2 containing a signal peptide (SEQ ID NO: 1).
- FIG. 4 shows purification of the CoV S polypeptides BV2364, BV2365, BV2366, BV2367, BV2368, BV2369, BV2373, BV2374, and BV2375.
- the data reveal that BV2365 (SEQ ID NO: 4) and BV2373 (SEQ ID NO: 87) which has an inactive furin cleavage site having an amino acid sequence of QQAQ (SEQ ID NO: 7) is expressed as a single chain (SO).
- CoV S polypeptides containing an intact furin cleavage site e.g. BV2364, BV2366, and BV2374
- are cleaved as evident by the presence of the cleavage product S2.
- Fig. 5 shows that the CoV S polypeptides BV2361, BV2365, BV2369, BV2365, BV2373, and BV2374 bind to human angiotensin-converting enzyme 2 precursor (hACE2) by bio-layer interferometry.
- hACE2 human angiotensin-converting enzyme 2 precursor
- Fig. 6 shows that BV2361 from SARS-CoV-2 does not bind the MERS-CoV receptor, dipeptidyl peptidase IV (DPP4) and the MERS S protein does not bind to human angiotensinconverting enzyme 2 precursor (hACE2) by bio-layer interferometry.
- Fig. 7 shows that BV2361 binds to hACE2 by enzyme-linked immunosorbent assay (ELISA).
- Fig. 8 shows the primary structure of the BV2373 CoV S polypeptide and modifications to the furin cleavage site, K986P, and V987P.
- Fig. 9 shows purification of the wild type CoV S polypeptide and the CoV S polypeptides BV2365 and BV2373.
- Fig. 10 shows a cryo-electron microscopy (cryoEM) structure of the BV2373 CoV S polypeptide overlaid on the cryoEM structure of the SARS-CoV-2 spike protein (EMB ID: 21374).
- cryoEM cryo-electron microscopy
- Figs. 11A-11F show that the CoV S Spike polypeptides BV2365 and BV2373 bind to hACE2.
- Bio-layer interferometry reveals that BV2365 (Fig. 11B) and BV2373 (Fig. HC) bind to hACE2 with similar dissociation kinetics to the wild-type CoV S polypeptide (Fig. 11A).
- ELISA shows that the wild-type CoV S polypeptide (Fig. 11D) and BV2365 (Fig. HE) bind to hACE2 with similar affinity while BV2373 binds to hACE2 at a higher affinity (Fig. HF)
- Figs. 12A-12B show the effect of stress conditions, such as temperature, two freeze/thaw cycles, oxidation, agitation, and pH extremes on binding of the CoV S polypeptides BV2373 (Fig. 12A) and BV2365 (Fig. 12B) to hACE2.
- stress conditions such as temperature, two freeze/thaw cycles, oxidation, agitation, and pH extremes on binding of the CoV S polypeptides BV2373 (Fig. 12A) and BV2365 (Fig. 12B) to hACE2.
- Figs. 13A-13B show anti-CoV S polypeptide IgG titers 13 days, 21 days, and 28 days after immunization of mice with two doses (Fig. 13A) and one dose of 0.1 pg to 10 pg of BV2373 with or without Fraction A and Fraction C iscom matrix (e.g., MATRIX-MTM) (Fig. 13B)
- Fig. 14 shows the induction of antibodies that block interaction of hACE2 in mice immunized with one dose or two doses of 0.1 pg to 10 pg of BV2373 with or without MATRIX-MTM.
- Fig. 15 shows virus neutralizing antibodies detected in mice immunized with one dose or two doses of 0.1 pg to 10 pg of BV2373 with or without MATRIX-MTM.
- Fig. 16 shows the virus load (SARS-CoV-2) in the lungs of Ad/CMV/hACE2 mice immunized with either a single dose of BV2373 or two doses of BV2373 spaced 14 days apart with or without MATRIX-MTM.
- Figs. 17A-17C shows weight loss exhibited by mice after immunization with BV2373.
- Fig. 17A shows the effect of immunization on weight loss with a single 0.01 pg, 0.1 pg, 1 pg, or 10 pg of BV2373 plus MATRIX-MTM.
- Fig. 17B shows the effect of immunization on weight loss with two doses of BV2373 (0.01 pg, 0.1 pg, 1 pg) plus MATRIX-MTM.
- Fig. 17C shows the effect of immunization on weight loss with two doses of BV2373 (10 pg) in the presence or absence of MATRIX-MTM.
- Figs. 18A-18B shows the effect of BV2373 on lung histopathology of mice four days (Fig. 18A) or seven days (Fig. 18B) after infection with SARS-CoV-2.
- Fig. 19 shows the number of IFN-y secreting cells after ex vivo stimulation in the spleens of mice immunized with BV2373 in the absence of adjuvant compared to mice immunized with BV2373 in the presence of MATRIX-MTM.
- Figs. 20A-20E shows the frequency of cytokine secreting CD4+ T cells in the spleens of mice immunized with BV2373 in the presence or absence of MATRIX-MTM.
- Fig. 20A shows the frequency of IFN-y secreting CD4+ T cells.
- Fig. 20B shows the frequency of TNF- a secreting CD4+ T cells.
- Fig. 20C shows the frequency of IL-2 secreting CD4+ T cells.
- Fig. 20D shows the frequency of CD4+ T cells that secrete two cytokines selected from IFN-y, TNF-a, and IL-2.
- Fig. 20E shows the frequency of CD4+ T cells that express IFN-y, TNF-a, and IL-2.
- Figs. 21A-21E shows the frequency of cytokine secreting CD8 + T cells in the spleens of mice immunized with BV2373 in the presence or absence of MATRIX-MTM.
- Fig. 21A shows the frequency of IFN-y secreting CD8 + T cells.
- Fig. 21B shows the frequency of TNF- a secreting CD8 + T cells.
- Fig. 21C shows the frequency of IL-2 secreting CD8 + T cells.
- Fig. 20D shows the frequency of CD8 + T cells that secrete two cytokines selected from IFN-y, TNF- a, and IL-2.
- Fig. 21E shows the frequency of CD8 + T cells that express IFN-y, TNF-a, and IL- 2.
- Fig. 22 illustrates the frequency of CD4 + or CD8 + cells that express one (single), two (double), or three (triple) cytokines selected from IFN-y, TNF-a, and IL-2 in the spleens of mice immunized with BV2373 in the presence or absence of MATRIX-MTM.
- Figs. 23A-23C illustrate the effect of immunization with BV2373 in the presence or absence of MATRIX-MTM on type 2 cytokine secretion from CD4 + T cells.
- Fig. 23A shows the frequency of IL-4 secreting cells.
- Fig. 23B shows the frequency of IL-5 CD4 + secreting cells.
- Fig. 23C shows the ratio of IFN-y secreting to IL-4 secreting CD4 + T cells.
- Figs. 24A-24B illustrate the effect of mouse immunization with BV2373 in the presence or absence of MATRIX-MTM on germinal center formation by assessing the presence of CD4 + T follicular helper cells (TFH).
- Fig. 24A shows the frequency of CD4 + T follicular helper cells in spleens
- Fig. 24B shows the phenotype (e.g. CD4 + CXCR5 + PD-1 + ) of the CD4 + T follicular helper cells.
- Figs. 24A shows the frequency of CD4 + T follicular helper cells in spleens
- Fig. 24B shows the phenotype (e.g. CD4 + CXCR5 + PD-1 + ) of the CD4 + T follicular helper cells.
- FIG. 25A-25B illustrate the effect of mouse immunization with BV2373 in the presence or absence of MATRIX-MTM on germinal center formation by assessing the presence of germinal center (GC) B cells.
- Fig. 25A shows the frequency of GC B cells in spleens
- Fig. 25B reveals the phenotype (e.g. CD19 + GL7 + CD-95 + ) of the CD4 + T follicular helper cells.
- Figs. 26A-26C show the effect of immunization with BV2373 in the presence or absence of MATRIX-MTM on antibody response in olive baboons.
- Fig. 26A shows the anti- SARS-CoV-2 S polypeptide IgG titer in baboons after immunization with BV2373.
- Fig. 26B shows the presence of hACE2 receptor blocking antibodies in baboons following a single immunization with 5 pg or 25 pg of BV2373 in the presence of MATRIX-MTM.
- Fig. 26C shows the titer of virus neutralizing antibodies following a single immunization with BV2373 and MATRIX-MTM.
- Fig. 27 shows the significant correlation between anti-SARS-CoV-2 S polypeptide IgG and neutralizing antibody titers in olive baboons after immunization with BV2373.
- Fig. 28 shows the frequency of IFN-y secreting cells in peripheral blood mononuclear cells (PBMC) of olive baboons immunized with BV2373 in the presence or absence of MATRIX-MTM.
- PBMC peripheral blood mononuclear cells
- Figs. 29A-29E shows the frequency of cytokine secreting CD4+ T cells in the PBMC of olive baboons immunized with BV2373 in the presence or absence of MATRIX-MTM.
- Fig. 29A shows the frequency of IFN-y secreting CD4+ T cells.
- Fig. 29B shows the frequency of IL-2 secreting CD4+ T cells.
- Fig. 29C shows the frequency of TNF-a secreting CD4+ T cells.
- Fig. 29D shows the frequency of CD4+ T cells that secrete two cytokines selected from IFN- y, TNF-a, and IL-2.
- Fig. 29E shows the frequency of CD4+ T cells that express IFN-y, TNF- a, and IL-2.
- Fig. 30 shows a schematic of the coronavirus Spike (S) protein (SEQ ID NO: 109) (BV2384).
- S coronavirus Spike
- GSAS SEQ ID NO: 97
- K986P and V987P mutations are underlined twice.
- Fig. 31 shows a schematic of the coronavirus Spike (S) protein (SEQ ID NO: 86) (BV2373).
- S coronavirus Spike
- SEQ ID NO: 86 coronavirus Spike protein
- Fig. 32 shows purification of the CoV S polypeptides BV2373 (SEQ ID NO: 87) and BV2384 (SEQ ID NO: 109).
- Fig. 33 shows a scanning densitometry plot of BV2384 (SEQ ID NO: 109) purity after purification.
- Fig. 34 shows a scanning densitometry plot of BV2373 (SEQ ID NO: 87) purity after purification
- Figs. 35A-35B illustrates induction of anti-S antibodies (Fig. 35A) and neutralizing antibodies (Fig. 35B) in response to administration of BV2373 and MATRIX-MTM.
- Cynomolgus macaques were administered one or two doses (Day 0 and Day 21) of 2.5 pg, 5 pg, or 25 pg of BV2373 with 25 pg or 50 pg MATRIX-MTM adjuvant. Controls received neither BV2373 or MATRIX-MTM.
- Antibodies were measured at Days 21 and 33.
- Figs. 36A-36B illustrates a decrease of SARS-CoV-2 viral replication by vaccine formulations disclosed herein as assessed in broncheoalveol lavage (BAL) in Cynomolgus macaques. Cynomolgus macaques were administered BV2373 and MATRIX-MTM as shown. Subjects were immunized Day 0 and in the groups with two doses Day 0 and Day 21. Subject animals were challenged Day 37 with IxlO 4 pfu SARS-CoV-2 virus. Viral RNA (Fig. 36A, corresponding to total RNA present) and viral sub-genomic RNA (Fig.
- RNA corresponding to replicating virus levels were assessed in bronchiolar lavage (BAL) at 2 days and 4 days postchallenge with infectious virus (d2pi and d4pi). Most subjects showed no viral RNA. At Day 2 small amounts of RNA were measured in some subjects. By Day 4, no RNA was measured except for two subjects at the lowest dose of 2.5 pg. Sub-genomic RNA was not detected at either 2 Days or 4 days except for 1 subject, again at the lowest dose.
- Figs. 37A-37B illustrates a decrease of SARS-CoV-2 viral replication by vaccine formulations disclosed herein as assessed in nasal swab in Cynomolgus macaques. Cynomolgus macaques were administered BV2373 with MATRIX-MTM as shown. Subjects were immunized Day 0 and in the groups with two doses Day 0 and Day 21. Subject animals were challenged Day 37 with IxlO 4 SARS-CoV-2 virus. Viral RNA (Fig. 37A) and viral sub- genomic (sg) RNA (Fig. 37B) were assessed by nasal swab at 2 days and 4 days post-infection (d2pi and d4pi). Most subjects showed no viral RNA.
- RNA was not detected at either 2 Days or 4 days. Subjects were immunized Day 0 and in the groups with two doses Day 0 and Day 21. These data show that the vaccine decreases nose total virus RNA by 100 - 1000 fold and sgRNA to undetectable levels, and confirm that immune response to the vaccine will block viral replication and prevent viral spread.
- Figs. 38A-38B show anti-CoV S polypeptide IgG titers 21 days and 35 days after immunization of Cynomolgus macaques with one dose (Fig. 38A) or two doses of BV2373 and 25 pg or 50 pg of MATRIX-MTM (Fig. 38B).
- Figs. 38C-38D shows the hACE2 inhibition titer of Cynomolgus macaques 21 days and 35 days after immunization of Cynomolgus macaques with one dose (Fig. 38C) or two doses of BV2373 (5 pg) and MATRIX-MTM (25 pg or 50 pg) (Fig. 38D).
- Fig. 38E shows the significant correlation between anti- CoV S polypeptide IgG titer and hACE2 inhibition titer in Cynomolgus macaques after administration of BV2373 and MATRIX-MTM. Data is shown for Groups 2-6 of Table 4.
- Fig. 39 shows the anti-CoV S polypeptide titers and hACE2 inhibition titer of Cynomolgus macaques 35 days after immunization with two doses of BV2373 and MATRIX- MTM or after immunization with convalescent human serum (Groups 2, 4, and 6) of Table 4.
- Figs. 40A-40B shows the SARS-CoV-2 neutralizing titers of Cynomolgus macaques immunized with BV2373 and MATRIX-MTM as determined by cytopathic effect (CPE) (Fig. 40A) and plaque reduction neutralization test (PRNT) (Fig. 40B).
- CPE cytopathic effect
- PRNT plaque reduction neutralization test
- Fig. 41 shows administration timings of a clinical trial that evaluated the safety and efficacy of a vaccine comprising BV2373 and optionally MATRIX-MTM.
- AESI denotes an adverse event of special interest.
- MAEE denotes a medically attended adverse event, and SAE denotes a serious adverse event.
- Figs. 42A-42B show the local (Fig. 42A) and systemic adverse events (Fig. 42B) experienced by patients in a clinical trial which evaluated a vaccine comprising BV2373 and MATRIX-MTM. Groups A-E are identified in Table 5. The data shows that the vaccine was well tolerated and safe.
- Figs. 43A-43B show the anti-CoV S polypeptide IgG (Fig. 43A) and neutralization titers (Fig. 43B) 21 days and 35 days after immunization of participants in a clinical trial which evaluated a vaccine comprising BV2373 and MATRIX-MTM.
- Horizontal bars represent interquartile range (IRQ) and median area under the curve, respectively. Whisker endpoints are equal to the maximum and minimum values below or above the median ⁇ 1.5 times the IQR.
- the convalescent serum panel includes specimens from PCR-confirmed COVID-19 participants from Baylor College of Medicine (29 specimens for ELISA and 32 specimens for microneutralization (MN IC>99).
- Figs. 44A-44C shows the correlation between anti- CoV S polypeptide IgG and neutralizing antibody titers in patients administered convalescent sera (Fig. 44A), two 25 pg doses of BV2373 (Fig. 44B), and two doses (5 pg and 25 pg) of BV2373 with MATRIX-MTM (Fig. 44C).
- Figs. 45A-45D show the frequencies of antigen-specific CD4 + T cells producing T helper 1 (Thl) cytokines interferon-gamma (IFN-y), tumor necrosis factor-alpha (TNF-a), and interleukin (IL)-2 and T helper 2 (Th2) cytokines IL-5 and IL- 13 indicated cytokines from participants in Groups A (placebo, Fig. 45A), B (25 pg BV2373, Fig. 45B), C (5 pg BV2373 and 50 pg MATRIX-MTM, Fig. 45C), and D (25 pg BV2373 and 50 pg MATRIX-MTM, Fig.
- Thl cytokine panel means CD4 + T cells that can produce two types of Thl cytokines at the same time.
- All 3 indicates CD4 + T cells that produce IFN-y, TNF-a, and IL-2 simultaneously.
- Bottom in Th2 panel means CD4 + T cells that can produce Th2 cytokines IL-5 and IL-13 at the same time.
- Fig. 46A shows the primary structure of a wild-type SARS-CoV-2 S polypeptide, containing a signal peptide, numbered with respect to SEQ ID NO: 1.
- Fig. 46B shows the primary structure of a wild-type SARS-CoV-2 S polypeptide, without a signal peptide, numbered with respect to SEQ ID NO: 2.
- Fig. 47 shows the randomization of subjects in a Phase 3 clinical trial that evaluated the efficacy, immunogenicity, and safety of BV2373 in combination with Fraction A and Fraction C i scorn matrix (MATRIX-MTM) adjuvant.
- Fig. 48 is a Kaplan-Meyer plot showing the incidence of symptomatic COVID-19 (Cumulative Event Rate (%) experienced by subjects after vaccination with BV2373 in combination with Fraction A and Fraction C iscom matrix (MATRIX-MTM) or placebo.
- Fig. 49 shows vaccine efficacy of BV2373 in combination with Fraction A and Fraction C iscom matrix (MATRIX-MTM) against SARS-CoV-2 comprising a CoV S polypeptide having the amino acid sequence of SEQ ID NO: 1 or the heterogeneous B.1.1.7 SARS-CoV-2 strain which comprises a CoV S polypeptide having deletions of amino acids 69, 70, and 144 and mutations ofN501Y, A570D, D614G, P681H, T716I, S982A, and D1118H.
- MATRIX-MTM Fraction A and Fraction C iscom matrix
- Fig. 50 is a graph showing adverse events experienced by subjects after a first vaccination dose (labeled “Vaccination 1”) and a second vaccination dose (labeled “Vaccination 2”) with BV2373 in combination with Fraction A and Fraction C iscom matrix (MATRIX-MTM) (labeled “A”) or placebo (labeled “B”).
- Fig. 51 shows a diagram of the BV2438 CoV S polypeptide.
- Structural elements include the cleavable signal peptide (SP), N-terminal domain (NTD), receptor binding domain (RBD), subdomains 1 and 2 (SD1 and SD2), S2 cleavage site (S2'), fusion peptide (FP), heptad repeat 1 (HR1), central helix (CH), heptad repeat 2 (HR2), transmembrane domain (TM), and cytoplasmic tail (CT).
- Amino acid changes from the CoV S polypeptide having an amino acid sequence of SEQ ID NO: 1 are shown in black text underneath the linear diagram.
- Fig. 52A shows a reduced SDS-PAGE gel with Coomassie blue staining of purified full-length BV2438 showing the main protein product at the expected molecular weight of -170 kD.
- Fig. 52B shows a graph of the scanning densitometry.
- Fig. 52C shows negative stain transmission electron micrographs of BV2438.
- BV2438 forms a well-defined lightbulb-shaped particle with a length of 15 nm and a width of 11 nm (left panel). Trimers exhibited an 8nm flexible linker connected to PS-80 micelles (left panel).
- Class average images showed a good fit of the rS-B.1.351 trimer with a cryo-EM solved structure of the prefusion SARS-CoV-2 trimeric spike protein ectodomain (PDB ID 6VXX) overlaid on the 2D image (middle panel).
- the right panel shows two BV2438 trimers anchored into a PS-80 micelle.
- Fig. 53 shows the mouse study design of Example 10.
- Antigen doses were 1 pg rS for each monovalent immunization, or 1 pg rS for each construct upon bivalent immunization (2 pg rS total). All antigen doses were administered with 5 pg saponin adjuvant.
- a control group received formulation buffer (Placebo). Sera and tissues were collected at the timepoints listed in the diagram.
- Figs. 54A-54B shows Anti-SARS-CoV-2 S IgG serum titers in sera collected on Day 21 of the mouse study of Example 10.
- ELISA was used to measure antibody titers against the Wuhan-Hu-1 spike protein (Fig. 54A) or B.1.351 spike protein (Fig. 54B). Bars indicate the geometric mean titer (GMT) and error bars represent 95% confidence interval (CI) for each group. Individual animal titers are indicated with colored symbols.
- Figs. 54C-D show functional antibody titers (as measured by ELISA) in sera collected on Day 21 capable of disrupting binding between the SARS-CoV-2 receptor hACE2 and Wuhan-Hu-1 spike protein (Fig.
- Fig. 54C B.1.351 spike protein
- Fig. 54D B.1.351 spike protein
- Bars indicate the geometric mean titer (GMT) and error bars represent 95% confidence interval (CI) for each group. Individual animal titers are indicated with colored symbols.
- Figs. 55A-55F show the protective efficacy of immunization with SARS-CoV-2 rS based on Wuhan-Hu-1 or B.1.351 against challenge with live SARS-CoV-2 B.1.351 or B.1.1.7 virus.
- Fig. 55A and Fig. 55B show the mean percentage body weight loss with symbols. Error bars represent standard error of the mean.
- Fig. 55C Half of the mice were sacrificed at 2 days post-challenge and lung tissue was subjected to a plaque formation assay to determine lung viral titers (Fig. 55C, Fig. 55D). The remaining mice were sacrificed at 4 days post-challenge.
- Figs. 56A-56H show cell-mediated immunity induced upon immunization with BV2373 or BV2438 regimens in mice.
- Antigen doses were 1 pg rS for each monovalent immunization, or 1 pg rS for each construct upon bivalent immunization (2 pg rS total). All immunizations were administered with 5 pg Matrix-Mi adjuvant.
- Fig. 56C were used to calculate the Thl/Th2 balance of responses to immunization (Fig. 56D).
- Fig. 56E shows the numbers of multifunctional CD4+ T cells that stained positively for three Thl cytokines (IFN-y, IL-2, and TNF-a) using intracellular cytokine staining were quantified and expressed as the number of triple cytokine positive cells per 10 6 CD4+ T cells.
- Fig. 56F shows quantification of T follicular helper cells. T follicular helper cells were quantified by determining the percentage of PD-1+CXCR5+ cells among all CD4+ T cells. Fig.
- Germinal center formation was evaluated by determining the percentage of GL7+CD95+ cells among CD 19+ B cells using flow cytometry. Gray bars represent means and error bars represent standard deviation. Individual animal data are shown with colored symbols.
- Figs. 57A-57E show the CD4+ and CD8+ T cell response from immunization with BV2373 or BV2438.
- Antigen doses were 1 pg rS for each monovalent immunization, or 1 pg rS for each construct upon bivalent immunization (2 pg rS total). All antigen doses were administered with 5 pg saponin adjuvant.
- Figs. 58A-58G show the immunogenicity of one or two booster BV2438 doses approximately one year after immunization with B V2373 in baboons.
- Fig. 58A shows the study design.
- Fig. 58B show the anti-CoV S IgG titer over the course of the study. Individual animals’ titers are shown over time, different colored symbols and lines represent different dose groups for the initial rS-WUl immunization series. Sera collected before BV2438 boost (Day 303) as well as 7, 21, 35, and 81 days after the boost were analyzed to determine anti-rS-WUl (Fig. 58C) and rS-B.1.351 (Fig.
- IgG titers by ELISA (horizontal lines represent means), antibody titers capable of disrupting the interaction between rS-WUl or rS-B.1.351 and the hACE2 receptor by ELISA (Fig. 58E, horizontal lines represent means), and antibody titers capable of neutralizing SARS-CoV-2 strains USA-WA1, B.1.351, and B.1.1.7 with a PRNT assay (Fig. 58F, gray bars represent geometric means and error bars represent 95% confidence intervals).
- Figs. 59A-59G show individual Cytokine Responses to BV2438 boost in baboons.
- All animals were boosted with one or two doses of 3 pg BV2438 with 50 pg saponin adjuvant on Day 318 and 339 (Weeks 45 and 48, respectively).
- PBMCs collected pre-boost (Day 303; Week 43), 7 days after the first rS-B.1.351 boost (Day 325; Week 46), and 35 days after the first rS-B.1.351 boost (Day 353; Week 50).
- PBMCs were stimulated with BV2373 or BV2438 and subjected to ELISA to measure (Fig. 59A) IFN-y producing cells as a Thl cytokine and (Fig. 59B) IL-4 producing cells as a Th2 cytokine.
- CD4+ T cells were also stimulated with BV2373 or BV2438, then subjected to ICS to measure cells producing IFN-y (Fig. 59C), IL-2 (Fig. 59D), TNF-a (Fig. 59E), IL-5 (Fig. 59F), and IL- 13 (Fig. 59G).
- Fig. 61 plots number of days from when a SARS-CoV-2 variant (e.g., the B.1.1.529 (“omicron”), delta, or beta variant) accounts for 1 % of sequenced SARS-CoV-2 infections versus the percentage of SARS-CoV-2 infections caused by the variant in South Africa. The plot shows that the omicron variant spreads more rapidly and outcompetes the other variants.
- Fig. 62 shows that positive tests for SARS-CoV-2 increased from 1 % to 30 % in Tshwane, South Africa. The omicron variant was first discovered on November 11, 2021, suggesting that the increased positive tests were caused by the omicron variant.
- Fig. 63 shows the mutations in the S protein of the SARS-CoV-2 omicron variant compared to the S protein of a SARS-CoV-2 protein having the sequence of SEQ ID NO: 1.
- Fig. 64 shows the position of mutations within the S protein of the SARS-CoV-2 omicron variant.
- the omicron variant contains multiple mutations in the RBD and NTD; mutations adjacent to the furin cleavage site (H655Y; N679K; P681H); a deletion of amino acids 105-107; and R203K and G204R mutations in the nucleocapsid.
- Figs. 65A-65D show that the CoV S Spike polypeptides BV2373 (Fig. 65A) and BV2509 (Fig. 65B) bind to hACE2 with similar binding kinetics.
- ELISA shows that the BV2373 polypeptide (Fig. 65C) and BV2509 (Fig. 65D) bind to hACE2 with similar affinity.
- Figs. 65A-65D show that the CoV S Spike polypeptides BV2373 (Fig. 65A) and BV2509 (Fig. 65B) bind to hACE2 with similar binding kinetics.
- ELISA shows that the BV2373 polypeptide (Fig. 65C) and BV2509 (Fig. 65D) bind to hACE2 with similar affinity.
- 66A-66B shows anti-S protein IgG titers before and after boost with BV2373 and a saponin adjuvant for the following SARS-CoV-2 variants: (i) SARS-CoV-2 virus having a CoV S polypeptide with a D614G mutation compared to the protein having an amino acid sequence of SEQ ID NO: 1; (ii) a SARS-CoV-2 alpha strain, a SARS-CoV-2 beta strain, a SARS-CoV-2 delta strain, and a SARS-CoV-2 omicron strain.
- Fig. 66A shows the fold increase from day 35 to day 217.
- Fig. 66B shows the fold increase from day 189 to day 217.
- Figs. 67A-67D shows the functional hACE2 inhibition before and after boost with BV2373 and a saponin adjuvant for the following SARS-CoV-2 variants: (i) SARS-CoV- 2 virus having a CoV S polypeptide with a D614G mutation compared to the protein having an amino acid sequence of SEQ ID NO: 1; (ii) a SARS-CoV-2 alpha strain, a SARS-CoV-2 beta strain, a SARS-CoV-2 delta strain, and a SARS-CoV-2 omicron strain.
- Fig. 67A shows the fold increase from day 35 to day 217.
- Fig. 67B shows the fold increase from day 189 to day 217.
- Fig. 67C shows the fold increase from day 35 to day 217.
- Fig. 67D shows the functional hACE2 inhibition in adolescents. Adolescents (ages 12-18) exhibited 2.4-4 times the functional immune response against the variants than adults.
- Fig. 68 shows a diagram of booster dosing for participants of the trial described in Example 11.
- Figs. 69A-69B show local (Fig. 69A) and systemic (Fig. 69B) reactogenicity of patients in Group B2 of the trial described in Example 11.
- Fig. 70 shows serum IgG titers to the ancestral SARS-CoV-2 strain by study day of the patients described in Example 11.
- Fig. 71 shows neutralizing antibody activity for the ancestral SARS-CoV-2 strain by study day of the patients described in Example 11.
- Fig. 72 shows the neutralizing antibody 99 (neut99) values for the immunogenic composition comprising BV2373 and saponin adjuvant of Example 11 against the SARS-CoV- 2 strain containing a D614G mutation, the B.1.617.2 (delta variant), and the B. 1.1.529 (omicron variant).
- Fig. 73 shows the neutralizing antibody 99 (neut99) values for the immunogenic compositions comprising BV2373, BV2509, or a combination thereof, and a saponin adjuvant (see Example 12) against the SARS-CoV-2 Omicron BA. l variant, WAI variant, and delta variant.
- Figs. 74A-74B shows the viral load in mice lungs two days after challenge with the SARS CoV-2 Omicron BA. l variant (Fig. 74A) or the WAI variant (Fig. 74B). Each composition reduced viral load compared to placebo. The mice were immunized according to the methods in Example 12.
- Figs. 75A-75E shows Tris-acetate gels of the purified SARS-CoV-2 S proteins having sequences of SEQ ID NO: 186 (Fig. 75A); SEQ ID NO: 188 (Fig. 75B); SEQ ID NO: 190 (Fig. 75C); SEQ ID NO: 192 (Fig. 75D), and SEQ ID NO: 87 (Fig. 75E).
- Figs. 76A-76E show the particle size distribution of proteins having the amino acid sequences of SEQ ID NO: 188 (Fig. 76A); SEQ ID NO: 186 (Fig. 76B); SEQ ID NO: 190 (Fig. 76C); SEQ ID NO: 192 (Fig. 76D), and SEQ ID NO: 87 (Fig. 76E).
- Figs. 77A-77E show the HPLC-SEC trace of SARS-CoV-2 S proteins having the amino acid sequences of SEQ ID NO: 188 (Fig. 77A); SEQ ID NO: 186 (Fig. 77B); SEQ ID NO: 190 (Fig. 77C); SEQ ID NO: 192 (Fig. 77D), and SEQ ID NO: 87 (Fig. 77E).
- Figs. 78A-78E show the binding kinetics of SARS-CoV-2 S proteins having the amino acid sequences of SEQ ID NO: 188 (Fig. 78A); SEQ ID NO: 186 (Fig. 78B); SEQ ID NO: 190 (Fig. 78C); SEQ ID NO: 192 (Fig. 78D), and SEQ ID NO: 87 (Fig. 78E).
- Figs. 79A-79E show the binding to hACE2 of SARS-CoV-2 S proteins having the amino acid sequences of SEQ ID NO: 188 (Fig. 79A); SEQ ID NO: 186 (Fig. 79B); SEQ ID NO: 190 (Fig. 79C); SEQ ID NO: 192 (Fig. 79D), and SEQ ID NO: 87 (Fig. 79E).
- Figs. 80A-80E show the thermal stability of SARS-CoV-2 S proteins having the amino acid sequences of SEQ ID NO: 188 (Fig. 80A); SEQ ID NO: 186 (Fig. 80B); SEQ ID NO: 190 (Fig. 80C); SEQ ID NO: 192 (Fig. 80D), and SEQ ID NO: 87 (Fig. 80E).
- Fig. 81 shows the crystal structures of SARS-CoV-2 S proteins having the amino acid sequence of SEQ ID NO: 2; SEQ ID NO: 188; and SEQ ID NO: 92.
- adjuvant refers to a compound that, when used in combination with an immunogen, augments or otherwise alters or modifies the immune response induced against the immunogen. Modification of the immune response may include intensification or broadening the specificity of either or both antibody and cellular immune responses.
- the term “about” or “approximately” when preceding a numerical value indicates the value plus or minus a range of 10%. For example, “about 100” encompasses 90 and 110.
- immunogen As used herein, the terms “immunogen,” “antigen,” and “epitope” refer to substances such as proteins, including glycoproteins, and peptides that are capable of eliciting an immune response.
- an “immunogenic composition” is a composition that comprises an antigen where administration of the composition to a subject results in the development in the subject of a humoral and/or a cellular immune response to the antigen.
- a “subunit” composition for example a vaccine, that includes one or more selected antigens but not all antigens from a pathogen.
- a composition is substantially free of intact virus or the lysate of such cells or particles and is typically prepared from at least partially purified, often substantially purified immunogenic polypeptides from the pathogen.
- the antigens in the subunit composition disclosed herein are typically prepared recombinantly, often using a baculovirus system.
- substantially refers to isolation of a substance (e.g. a compound, polynucleotide, or polypeptide) such that the substance forms the majority percent of the sample in which it is contained.
- a substantially purified component comprises 85%, preferably 85%-90%, more preferably at least 95%-99.5%, and most preferably at least 99% of the sample. If a component is substantially replaced the amount remaining in a sample is less than or equal to about 0.5% to about 10%, preferably less than about 0.5% to about 1.0%.
- beneficial or desired results may include inhibiting or suppressing the initiation or progression of an infection or a disease; ameliorating, or reducing the development of, symptoms of an infection or disease; or a combination thereof.
- prevention is used interchangeably with “prophylaxis” and can mean complete prevention of an infection or disease, or prevention of the development of symptoms of that infection or disease; a delay in the onset of an infection or disease or its symptoms; or a decrease in the severity of a subsequently developed infection or disease or its symptoms.
- an “effective dose” or “effective amount” refers to an amount of an immunogen sufficient to induce an immune response that reduces at least one symptom of pathogen infection.
- An effective dose or effective amount may be determined e.g., by measuring amounts of neutralizing secretory and/or serum antibodies, e.g., by plaque neutralization, complement fixation, enzyme-linked immunosorbent (ELISA), or microneutralization assay.
- ELISA enzyme-linked immunosorbent
- the term “vaccine” refers to an immunogenic composition, such as an immunogen derived from a pathogen, which is used to induce an immune response against the pathogen that provides protective immunity (e.g., immunity that protects a subject against infection with the pathogen and/or reduces the severity of the disease or condition caused by infection with the pathogen).
- the protective immune response may include formation of antibodies and/or a cell-mediated response.
- the term “vaccine” may also refer to a suspension or solution of an immunogen that is administered to a subject to produce protective immunity.
- the term “subject” includes humans and other animals.
- the subject is a human.
- the subject may be an adult, a teenager, a child (2 years to 14 years of age), an infant (birth to 2 year), or a neonate (up to 2 months).
- the subject is up to 4 months old, or up to 6 months old.
- the adults are seniors about 65 years or older, or about 60 years or older.
- the subject is a pregnant woman or a woman intending to become pregnant.
- subject is not a human; for example a non-human primate; for example, a baboon, a chimpanzee, a gorilla, or a macaque.
- the subject may be a pet, such as a dog or cat.
- the subject is immunocompromised.
- the immunocompromised subject is administered a medication that causes immunosuppression.
- medications that cause immunosuppression include corticosteroids (e.g., prednisone), alkylating agents (e.g., cyclophosphamide), antimetabolites (e.g., azathioprine or 6-mercaptopurine), transplant-related immunosuppressive drugs (e.g., cyclosporine, tacrolimus, sirolimus, or mycophenolate mofetil), mitoxantrone, chemotherapeutic agents, methotrexate, tumor necrosis factor (TNF)-blocking agents (e.g., etanercept, adalimumab, infliximab).
- corticosteroids e.g., prednisone
- alkylating agents e.g., cyclophosphamide
- antimetabolites e.g., azathioprin
- the immunocompromised subject is infected with a virus (e.g., human immunodeficiency virus or Epstein-Barr virus).
- the virus is a respiratory virus, such as respiratory syncytial virus, influenza, parainfluenza, adenovirus, or a picomavirus.
- the immunocompromised subject has acquired immunodeficiency syndrome (AIDS).
- the immunocompromised subject is a person living with human immunodeficiency virus (HIV).
- the immunocompromised subject is immunocompromised due to a treatment regiment designed to prevent inflammation or prevent rejection of a transplant.
- the immunocompromised subject is a subject who has received a transplant.
- the immunocompromised subject has undergone radiation therapy or a splenectomy.
- the immunocompromised subject has been diagnosed with cancer, an autoimmune disease, tuberculosis, a substance use disorder (e.g., an alcohol, opioid, or cocaine use disorder), stroke or cerebrovascular disease, a solid organ or blood stem cell transplant, sickle cell disease, thalassemia, autoimmune lymphoproliferative syndrome (ALPS), autoimmune polyglandular syndrome type 1 (APS-1), B-cell expansion with NF-KB and T-cell anergy (BENTA) disease, capsase eight deficiency state (CEDS), chronic granulomatous disease (CGD), common variable immunodeficiency (CVID), congenital neutropenia syndromes, a deficiency in the cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4), a DOCK8 deficiency, a GATA2 deficiency, a glycosylation disorder with immunodefici
- CTLA-4
- the immunocompromised subject is a current or former cigarette smoker.
- the immunocompromised subject has a B-cell defect, T-cell defect, macrophage defect, cytokine defect, phagocyte deficiency, phagocyte dysfunction, complement deficiency or a combination thereof.
- the subject is overweight or obese.
- an overweight subject has a body mass index (BMI) > 25 kg/m 2 and ⁇ 30 kg/m 2 .
- BMI body mass index
- an obese subject has a BMI that is > 30 kg/m 2 .
- the subject has a mental health condition.
- the mental health condition is depression, schizophrenia, or anxiety.
- the term "pharmaceutically acceptable” means being approved by a regulatory agency of a U.S. Federal or a state government or listed in the U.S. Pharmacopeia, European Pharmacopeia or other generally recognized pharmacopeia for use in mammals, and more particularly in humans. These compositions can be useful as a vaccine and/or antigenic compositions for inducing a protective immune response in a vertebrate.
- NVX-CoV2373 refers to a vaccine composition comprising the BV2373 Spike glycoprotein (SEQ ID NO: 87) and Fraction A and Fraction C iscom matrix (e.g., MATRIX-MTM).
- modification refers to mutation, deletion, or addition of one or more amino acids of the CoV S polypeptide.
- the location of a modification within a CoV S polypeptide can be determined based on aligning the sequence of the polypeptide to SEQ ID NO: 1 (CoV S polypeptide containing signal peptide) or SEQ ID NO: 2 (mature CoV S polypeptide lacking a signal peptide).
- SARS-CoV-2 “variant”, used interchangeably herein with a “heterogeneous SARS-CoV-2 strain,” refers to a SARS-CoV-2 virus comprising a CoV S polypeptide having one or more modifications as compared to a SARS-CoV S polypeptide having the amino acid sequence of SEQ ID NO: 2.
- a SARS-CoV-2 variant may have at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, at least about 7, at least about 8, at least about 9, at least about 10, at least about 11, at least about 12, at least about 13, at least about 14, at least about 15, at least about 16, at least about 17, at least about 18, at least about 19, at least about 20, at least about 21, at least about 22, at least about 23, at least about 24, at least about 25, at least about 26, at least about 27, at least about 28, at least about 29, at least about 30, at least about 31, at least about 32, at least about 33, at least about 34, or at least about 35 modifications, as compared to a CoV S polypeptide having the amino acid sequence of SEQ ID NO: 2.
- a SARS-CoV-2 variant may have at least one and up to 2, up to 3, up to 4, up to 5, up to 6, up to 7, up to 8, up to 9, up to 10, up to 11, up to 12, up to 13, up to 14, up to 15, up to 16, up to 17, up to 18, up to 19, up to 20, up to 21, up to 22, up to 23, up to 24, up to 25, up to 26, up to 27, up to 28, up to 29, up to 30, up to 31, up to 32, up to 33, up to 34, up to 35 modifications, up to 40 modifications, up to 45 modifications, up to 50 modifications, up to 55 modifications, up to 60 modifications, up to 65 modifications, up to 70 modifications, up to 75 modifications, up to 80 modifications, up to 85 modifications, up to 90 modifications, up to 95 modifications, or up to 100 modifications as compared to a CoV S polypeptide having the amino acid sequence of SEQ ID NO: 2.
- a SARS-CoV-2 variant may have between about 2 and about 35 modifications, between about 5 and about 10 modifications, between about 5 and about 20 modifications, between about 10 and about 20 modifications, between about 15 and about 25 modifications, between about 20 and 30 modifications, between about 20 and about 40 modifications, between about 25 and about 45 modifications, between about 25 and about 100 modifications, between about 25 and about 45 modifications, between about 35 and about 100 modifications, as compared to a CoV S polypeptide having the amino acid sequence of SEQ ID NO: 2.
- the heterogeneous SARS-CoV-2 strain is a SARS-CoV-2 virus comprising a CoV S polypeptide with at least about 70 %, at least about 75 %, at least about 80 %, at least about 85 %, at least about 90 %, at least about 95 %, at least about 96 %, at least about 97 %, at least about 98 %, or at least about 99 % identity to a CoV S polypeptide having the amino acid sequence of SEQ ID NO: 2.
- the heterogeneous SARS-CoV-2 strain is a SARS-CoV-2 virus comprising a CoV S polypeptide with between about 70 % and about 99.9 % identity to a CoV S polypeptide having the amino acid sequence of SEQ ID NO: 2.
- the heterogeneous SARS-CoV-2 strain is a SARS-CoV-2 virus comprising a CoV S polypeptide with between about 70 % and about 99.5 % identity to a CoV S polypeptide having the amino acid sequence of SEQ ID NO: 2.
- the heterogeneous SARS-CoV-2 strain is a SARS-CoV-2 virus comprising a CoV S polypeptide with between about 90 % and about 99.9 % identity to a CoV S polypeptide having the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2.
- the heterogeneous SARS- CoV-2 strain is a SARS-CoV-2 virus comprising a CoV S polypeptide with between about 90 % and about 99.8 % identity to a CoV S polypeptide having the amino acid sequence of SEQ ID NO: 2.
- the heterogeneous SARS-CoV-2 strain is a SARS-CoV-2 virus comprising a CoV S polypeptide with between about 95 % and about 99.9 % identity to a CoV S polypeptide having the amino acid sequence of SEQ ID NO: 2.
- the heterogeneous SARS-CoV-2 strain is a SARS-CoV-2 virus comprising a CoV S polypeptide with between about 95 % and about 99.8 % identity to a CoV S polypeptide having the amino acid sequence of SEQ ID NO: 2.
- the heterogeneous SARS-CoV-2 strain is a SARS-CoV-2 virus comprising a CoV S polypeptide with between about 95 % and about 99 % identity to a CoV S polypeptide having the amino acid sequence of SEQ ID NO: 2.
- the heterogeneous SARS-CoV-2 strain has a World Health Organization Label of alpha, beta, gamma, delta, epsilon, eta, iota, kappa, zeta, mu, or omicron.
- the heterogeneous SARS-CoV-2 strain has a PANGO lineage selected from the group consisting of B.1.1.529; BA.l, BA.1.1, BA.2, BA.3, BA.4, BA.5, B.1.1.7, B.1.351, P.l, B.1.617.2, AY, B.1.427, B.1.429, B.1.525, B.1.526, B.1.617.1, B.1.617.3, P.2, B.1.621, or B.1.621.1.
- the following document describes the Pango lineage designation and is incorporated by reference herein in its entirety: O’Toole et al. BMC Genomics, 23, 121 (2022).
- the heterogeneous SARS-CoV-2 strain has a World Health Organization Label of omicron.
- the heterogeneous SARS-CoV-2 strain with a World Health Organization Label of omicron has at least 35 modifications compared to the wild-type SARS-CoV-2 S polypeptide of SEQ ID NO: 2.
- the heterogeneous SARS-CoV-2 strain with a World Health Organization Label of omicron has from 35 to 55, from 35 to 65, from 35 to 75, from 35 to 85, from 35 to 95, or from 35 to 105 modifications compared to the wild-type SARS-CoV-2 S polypeptide of SEQ ID NO: 2.
- the modifications are selected from the group consisting of T6I, T6R, A14S, A54V, V70A, T82I, G129D, H133Q, K134E, W139R, E143G, F144L, Q170E, H97V, L199I, V200E, V200G, G239V, G244S, G326D, G326H, R333T, L355I, S358F, S358L, S360P, S362F, T363A, D392N, R395S, K404N, N427K, K431T, V432P, G433S, L439R, L439Q, N447K, S464N, T465K, E471A, F473V, F473S, F477S, Q480R, G483S, Q485R, N488Y, Y492H, T534K, T591I, D601G,
- the CoV S polypeptide of the variant comprises a combination of modifications selected from the group consisting of:
- deletion of amino acid 144 deletion of amino acid 145, T6R, E143G, L439R, T465K, D601G, P668R, and D937N;
- deletion of amino acid 144 deletion of amino acid 145, T6R, G129D, E143G, L439R, T465K, D601G, P668R, and D937N
- deletion of amino acid 144 deletion of amino acid 145, T6R, T82I, G129D, Y132H, E143G, A209V, K404N L439R, T465K, D601G, P668R, and D937N;
- deletion of amino acid 144 deletion of amino acid 145, T6R, W51H, H53W, G129D, E143G, D200V, L201R, W245I, K404N, N426K, L439R, T465K, E471K, N488Y, D601G, P668R, and D937N;
- deletion of amino acid 144 deletion of amino acid 145, T6R, G129D, E143G, K404N, L439R, T465K, E471Q, D601G, P668R, and D937N;
- efficacy of an immunogenic composition or vaccine composition described herein refers to the percentage reduction of disease (e.g., COVID-19) in a group administered an immunogenic composition as compared to a group that is not administered the immunogenic composition.
- immunogenic compositions described herein have an efficacy against a SARS-CoV-2 virus or heterogeneous SARS-CoV-2 strain that is at least about 50 %, at least about 55 %, at least about 60 %, at least about 65 %, at least about 70 %, at least about 75 %, at least about 80 %, at least about 85 %, at least about 90 %, at least about 91 %, at least about 92 %, at least about 93 %, at least about 94 %, at least about 95 %, at least about 96 %, at least about 97 %, at least about 98 %, at least about 99 %, between about 50 % and about 99 %, between about 50 % and about 98 %, between about 60 % and about 99 %, between about 60 % and about 98 %, between about 70 % and about 98 %, between about 70 % and about 95 %, between about 70 % and about 99 %, between about
- the disclosure provides non-naturally occurring coronavirus (CoV) Spike (S) polypeptides, nanoparticles containing CoV S polypeptides, and immunogenic compositions and vaccine compositions containing either non-naturally occurring CoV S polypeptides or nanoparticles containing CoV S polypeptides.
- CoV S polypeptides, nanoparticles, immunogenic compositions, and vaccine compositions to stimulate an immune response against a SARS-CoV-2 virus or a heterogeneous SARS-CoV-2 strain.
- the heterogeneous SARS-CoV-2 strain has a PANGO lineage selected from the group consisting of B.1.1.529; BA.l, BA.1.1, BA.2, BA.3, BA.4, BA.5, B. l.1.7, B.1.351, P. l, B.1.617.2, AY, B.1.427, B.1.429, B.1.525, B.1.526, B.1.617.1, B.1.617.3, P.2, B.1.621, or B.1.621.1.
- the heterogeneous SARS- CoV-2 strain has a World Health Organization label of alpha, beta, gamma, delta, epsilon, eta, iota, kappa, zeta, mu, or omicron.
- the methods provide nanoparticles that are substantially free from contamination by other proteins, such as proteins associated with recombinant expression of proteins in insect cells.
- expression occurs in baculovirus/Sf9 systems.
- the vaccine compositions of the disclosure contain non-naturally occurring CoV S polypeptides.
- CoV S polypeptides may be derived from coronaviruses, including but not limited to SARS-CoV-2, for example from SARS-CoV-2, from MERS CoV, and from SARS CoV.
- the CoV S polypeptide is derived from a heterogeneous SARS- CoV-2 strain.
- the SARS-CoV-2 S protein has a four amino acid insertion in the S1/S2 cleavage site resulting in a polybasic RRAR furin-like cleavage motif.
- the SARS-CoV-2 S protein is synthesized as an inactive precursor (SO) that is proteolytically cleaved at the furin cleavage site into SI and S2 subunits which remain non- covalently linked to form prefusion trimers.
- the S2 domain of the SARS-CoV-2 S protein comprises a fusion peptide (FP), two heptad repeats (HR1 and HR2), a transmembrane (TM) domain, and a cytoplasmic tail (CT).
- the SI domain of the SARS-CoV-2 S protein folds into four distinct domains: the N-terminal domain (NTD) and the C-terminal domain, which contains the receptor binding domain (RBD) and two subdomains SD1 and SD2.
- the prefusion SARS-CoV-2 S protein trimers undergo a structural rearrangement from a prefusion to a postfusion conformation upon S-protein receptor binding and cleavage.
- the CoV S polypeptides are glycoproteins, due to post- translational glycosylation.
- the glycoproteins comprise one or more of a signal peptide, an SI subunit, an S2 subunit, a NTD, a, RBD, two subdomains (SD1 and SD2, labeled SD1/2 in Figs. 46A-B and referred to as “SD1/2” herein), an intact or modified fusion peptide, an HR1 domain, an HR2 domain, a TM, and a CD.
- the amino acids for each domain are given in Fig- 2 and Fig. 46A (shown according to SEQ ID NO: 1), Fig. 46B (shown according to SEQ ID NO: 2), and Fig.
- each domain may have at least 95%, at least 96 %, at least 97%, at least 98 %, at least 99%, or at least 99.5% identity to the sequences for each domain as in SEQ ID NO: 1 or SEQ ID NO: 2.
- Each domain may have a deletion, an insertion, or mutation of up to about 1, up to about 2, up to about 3, up to about 4, up to about 5, up to about 10, up to about 20, or up to about 30 amino acids compared to those shown in SEQ ID NO: 1 or SEQ ID NO: 2.
- Each domain may have a deletion, an insertion, or mutation of between about 1 and about 5 amino acids, between about 3 and about 10 amino acids, between about 5 and 10 amino acids, between about 8 and 12 amino acids, between about 10 and 15 amino acids, between about 12 and 17 amino acids, between about 15 and 20 amino acids, between about 18 and 23 amino acids, between about 20 and 25 amino acids, between about 22 and about 27 amino acids, or between about 25 and 30 amino acids as compared to those shown in SEQ ID NO: 1 or SEQ ID NO: 2.
- Figs. 2 and 3 illustrate the 13 -amino acid N-terminal signal peptide that is absent from the mature peptide.
- the CoV S polypeptides may be used to stimulate immune responses against the native CoV Spike (S) polypeptide.
- the native CoV Spike (S) polypeptide (SEQ ID NO: 2) is modified resulting in non-naturally occurring CoV Spike (S) polypeptides (Fig. 1).
- the CoV Spike (S) glycoproteins comprise a SI subunit and a S2 subunit, wherein the SI subunit comprises an NTD, an RBD, a SD1/2, and an inactive furin cleavage site (amino acids 669-672), and wherein the S2 subunit comprises mutations of amino acids 973 and 974; wherein the NTD optionally comprises one or more modifications selected from the group consisting of:
- S2 subunit wherein amino acids 973 and 974 are proline, wherein the S2 subunit optionally comprises one or more modifications selected from the group consisting of:
- the CoV Spike (S) glycoproteins comprise a SI subunit and a S2 subunit, wherein the SI subunit comprises an NTD, an RBD, a SD1/2, and an inactive furin cleavage site (amino acids 669-672), wherein the S2 subunit comprises mutation of amino acids 973 and 974 to proline; and wherein the CoV S glycoprotein comprises a combination of modifications selected from the group consisting of:
- N956K deletion of amino acid 11, deletion of amino acid 12, deletion of amino acid 13, deletion of amino acid 56, and deletion of amino acid 57;
- FIG. 3 shows a CoV S polypeptide called BV2378, which has an inactive furin cleavage site, deleted fusion peptide (e.g., deletion of amino acids 819-828), a K986P, and a V987 mutation, wherein the amino acids are numbered with respect to SEQ ID NO: 1.
- the mature BV2378 polypeptide lacks one or more amino acids of the signal peptide, which are amino acids 1-13 of SEQ ID NO: 1.
- the CoV S polypeptides described herein exist in a prefusion conformation.
- the CoV S polypeptides described herein comprise a flexible HR2 domain. Unless otherwise mentioned, the flexibility of a domain is determined by transition electron microscopy (TEM) and 2D class averaging. A reduction in electron density corresponds to a flexible domain.
- TEM transition electron microscopy
- 2D class averaging A reduction in electron density corresponds to a flexible domain.
- the CoV S polypeptides contain one or more modifications to the SI subunit having an amino acid sequence of SEQ ID NO: 121.
- SI subunit The amino acid sequence of the SI subunit (SEQ ID NO: 121) is shown below. [00151] QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSN VTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLI VNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPF LMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGF S ALEPL VDLPIGIN ITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDC ALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASV YAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVY
- the CoV S polypeptides described herein comprise an SI subunit with at least 90 %, at least 91 %, at least 92 %, at least 93 %, at least 94 %, at least 95%, at least 96 %, at least 97%, at least 98 %, at least 99%, or at least 99.5 %, identity to the SI subunit of SEQ ID NO: 1 or SEQ ID NO: 2.
- the SI subunit may have a deletion, an insertion, or mutation of up to about 1, up to about 2, up to about 3, up to about 4, up to about 5, up to about 10, up to about 15, up to about 20, up to about 25, up to about 30 amino acids, up to about 35 amino acids, up to about 40 amino acids, up to about 45 amino acids, or up to about 50 amino acids compared to the amino acid sequence of the SI subunit of SEQ ID NO: 1 or SEQ ID NO: 2.
- the SI subunit may have a deletion, an insertion, or mutation of between about 1 and about 5 amino acids, between about 3 and about 10 amino acids, between about 5 and 10 amino acids, between about 8 and 12 amino acids, between about 10 and 15 amino acids, between about 12 and 17 amino acids, between about 15 and 20 amino acids, between about 18 and 23 amino acids, between about 20 and 25 amino acids, between about 22 and about 27 amino acids, or between about 25 and 30 amino acids as compared to the SI subunit of SEQ ID NO: 1 or SEQ ID NO: 2.
- the SI subunit may contain any combination of modifications shown in Table 1 A.
- the CoV S polypeptides contain one or more modifications to the NTD.
- the NTD has an amino acid sequence of SEQ ID NO: 118, which corresponds to amino acids 14-305 of SEQ ID NO: 1 or amino acids 1-292 of SEQ ID NO: 2.
- SEQ ID NO: 118 The amino acid sequence of an NTD (SEQ ID NO: 118) is shown below.
- the NTD has an amino acid sequence of SEQ ID NO: 45, which corresponds to amino acids 14 to 331 of SEQ ID NO: 1 or amino acids 1-318 of SEQ ID NO: 2.
- the amino acid sequence of an NTD (SEQ ID NO: 45) is shown below.
- the NTD and RBD overlap by up to about 1 amino acid, up to about 5 amino acids, up to about 10 amino acids, or up to about 20 amino acids.
- an NTD as provided herein may be extended at the C-terminus by up to 5, up to 10, up to 15, up to 20, up to 25, or up to 30 amino acids.
- the CoV S polypeptides described herein comprise a NTD with at least 95%, at least 96 %, at least 97%, at least 98 %, at least 99%, or at least 99.5 %, identity to the NTD of SEQ ID NO: 1 or SEQ ID NO: 2.
- the NTD may have a deletion, an insertion, or mutation of up to about 1, up to about 2, up to about 3, up to about 4, up to about 5, up to about 10, up to about 15, up to about 20, up to about 25, or up to about 30 amino acids compared to the amino acid sequence of the NTD of SEQ ID NO: 1 or SEQ ID NO: 2.
- the NTD may have a deletion, an insertion, or mutation of between about 1 and about 5 amino acids, between about 3 and about 10 amino acids, between about 5 and 10 amino acids, between about 8 and 12 amino acids, between about 10 and 15 amino acids, between about 12 and 17 amino acids, between about 15 and 20 amino acids, between about 18 and 23 amino acids, between about 20 and 25 amino acids, between about 22 and about 27 amino acids, or between about 25 and 30 amino acids as compared to the NTD of SEQ ID NO: 1 or SEQ ID NO: 2.
- the CoV S polypeptides contain a deletion of one or more amino acids from the N-terminal domain (NTD) (corresponding to amino acids 1-292 of SEQ ID NO: 2.
- NTD N-terminal domain
- the CoV S polypeptides contain a deletion of up to about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 292 amino acids of the NTD.
- the CoV S polypeptides contain a deletion of one or more amino acids from the NTD (corresponding to amino acids 1-318 of SEQ ID NO: 2). In embodiments, the CoV S polypeptides contain a deletion of amino acids 1-318 of the NTD of SEQ ID NO: 2. In embodiments, deletion of the NTD enhances protein expression of the CoV Spike (S) polypeptide. In embodiments, the CoV S polypeptides which have an NTD deletion have amino acid sequences represented by SEQ ID NOS: 46, 48, 49, 51, 52, and 54. In embodiments, the CoV S polypeptides which have an NTD deletion are encoded by an isolated nucleic acid sequence selected from the group consisting of SEQ ID NO: 47, SEQ ID NO: 50, and SEQ ID NO: 53.
- the NTD may contain any combination of modifications shown in Table IB. The modifications are shown with respect to SEQ ID NO:2, the mature S polypeptide sequence for reference.
- the CoV S polypeptides contain one or more modifications to the RBD.
- the RBD has an amino acid sequence of SEQ ID NO: 126, which corresponds to amino acids 331-527 of SEQ ID NO: 1 or amino acids 318-514 of SEQ ID NO: 2.
- amino acid sequence of the RBD (SEQ ID NO: 126) is shown below:
- the RBD has an amino acid sequence of SEQ ID NO: 116, which corresponds to amino acids 335-530 of SEQ ID NO: 1 or amino acids 322-517 of SEQ ID NO: 2.
- an RBD as provided herein may be extended at the N-terminus or C-terminus by up to 1 amino acid, up to 5 amino acids, up to 10 amino acids, up to 15 amino acids, up to 20 amino acids, up to 25 amino acids, or up to 30 amino acids.
- the CoV S polypeptides described herein comprise a RBD with at least 95%, at least 96 %, at least 97%, at least 98 %, at least 99%, or at least 99.5 %, identity to the RBD of SEQ ID NO: 1 or SEQ ID NO: 2.
- the RBD may have a deletion, an insertion, or mutation of up to about 1, up to about 2, up to about 3, up to about 4, up to about 5, up to about 10, up to about 15, up to about 20, up to about 25, or up to about 30 amino acids compared to the amino acid sequence of the RBD of SEQ ID NO: 1 or SEQ ID NO: 2.
- the RBD may have a deletion, an insertion, or mutation of between about 1 and about 5 amino acids, between about 3 and about 10 amino acids, between about 5 and 10 amino acids, between about 8 and 12 amino acids, between about 10 and 15 amino acids, between about 12 and 17 amino acids, between about 15 and 20 amino acids, between about 18 and 23 amino acids, between about 20 and 25 amino acids, between about 22 and about 27 amino acids, or between about 25 and 30 amino acids as compared to the RBD of SEQ ID NO: 1 or SEQ ID NO: 2.
- the CoV S polypeptide has at least one, at least two, at least three, at least four, at least four, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, or at least 20 mutations in the RBD.
- the RBD may contain any combination of modifications as shown in Table 1C.
- the CoV S polypeptides contain one or more modifications to the SD1/2 having an amino acid sequence of SEQ ID NO: 122, which corresponds to amino acids 542-681 of SEQ ID NO: 1 or amino acids 529-668 of SEQ ID NO: 2.
- the CoV S polypeptides described herein comprise a SD1/2 with at least 95%, at least 96 %, at least 97%, at least 98 %, at least 99%, or at least 99.5 %, identity to the SD1/2 of SEQ ID NO: 1 or SEQ ID NO: 2.
- the SD1/2 may have a deletion, an insertion, or mutation of up to about 1, up to about 2, up to about 3, up to about 4, up to about 5, up to about 10, up to about 15, up to about 20, up to about 25, or up to about 30 amino acids compared to the amino acid sequence of the SD1/2 of SEQ ID NO: 1 or SEQ ID NO: 2.
- the SD1/2 may have a deletion, an insertion, or mutation of between about 1 and about 5 amino acids, between about 3 and about 10 amino acids, between about 5 and 10 amino acids, between about 8 and 12 amino acids, between about 10 and 15 amino acids, between about 12 and 17 amino acids, between about 15 and 20 amino acids, between about 18 and 23 amino acids, between about 20 and 25 amino acids, between about 22 and about 27 amino acids, or between about 25 and 30 amino acids as compared to the SD1/2 of SEQ ID NO: 1 or SEQ ID NO: 2.
- the CoV S polypeptide has at least one, at least two, at least three, at least four, at least four, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, or at least 20 mutations in the SDl/2.
- the SD1/2 may contain any combination of modifications as shown in Table ID.
- the CoV S polypeptides contain a furin site (RRAR), which corresponds to amino acids 682-685 of SEQ ID NO: 1 or amino acids 669-672 of SEQ ID NO: 2, that is inactivated by one or more mutations. Inactivation of the furin cleavage site prevents furin from cleaving the CoV S polypeptide.
- RRAR furin site
- the CoV S polypeptides described herein which contain an inactivated furin cleavage site are expressed as a single chain.
- one or more of the amino acids comprising the native furin cleavage site is mutated to any natural amino acid.
- the amino acids are L- amino acids.
- Non-limiting examples of amino acids include alanine, arginine, glycine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, serine, threonine, histidine, lysine, methionine, proline, valine, isoleucine, leucine, tyrosine, tryptophan, and phenylalanine.
- one or more of the amino acids comprising the native furin cleavage site is mutated to glutamine. In embodiments, 1, 2, 3, or 4 amino acids may be mutated to glutamine. In embodiments, one of the arginines comprising the native furin cleavage site is mutated to glutamine. In embodiments, two of the arginines comprising the native furin cleavage site are mutated to glutamine. In embodiments, three of the arginines comprising the native furin cleavage site are mutated to glutamine.
- one or more of the amino acids comprising the native furin cleavage site is mutated to alanine.
- 1, 2, 3, or 4 amino acids may be mutated to alanine
- one of the arginines comprising the native furin cleavage site is mutated to alanine.
- two of the arginines comprising the native furin cleavage site are mutated to alanine.
- three of the arginines comprising the native furin cleavage site are mutated to alanine.
- one or more of the amino acids comprising the native furin cleavage site is mutated to glycine.
- 1, 2, 3, or 4 amino acids may be mutated to glycine.
- one of the arginines of the native furin cleavage site is mutated to glycine.
- two of the arginines comprising the native furin cleavage site are mutated to glycine.
- three of the arginines comprising the native furin cleavage site are mutated to glycine.
- one or more of the amino acids comprising the native furin cleavage site is mutated to asparagine.
- 1, 2, 3, or 4 amino acids may be mutated to asparagine.
- one of the arginines comprising the native furin cleavage site is mutated to asparagine.
- two of the arginines comprising the native furin cleavage site are mutated to asparagine.
- three of the arginines comprising the native furin cleavage site are mutated to asparagine.
- Non-limiting examples of the amino acid sequences of the inactivated furin sites contained within the CoV S polypeptides are found in Table IE.
- the CoV S polypeptides described herein contain an inactivated furin cleavage site.
- the amino acid sequence of the inactivated furin cleavage site is represented by any one of SEQ ID NO: 7-34 or SEQ ID NO: 97.
- the amino acid sequence of the inactivated furin cleavage site is QQAQ (SEQ ID NO: 7).
- the amino acid sequence of the inactivated furin cleavage site is GSAS (SEQ ID NO: 97).
- the amino acid sequence of the inactivated furin cleavage site is GSGA (SEQ ID NO: 111).
- the amino acid sequence of the inactivated furin cleavage site is GG, GGG (SEQ ID NO: 127), GGGG (SEQ ID NO: 128), or GGGGG (SEQ ID NO: 129).
- the CoV S polypeptides contain one or more modifications to the S2 subunit having an amino acid sequence of SEQ ID NO: 120, which corresponds to amino acids 686-1273 of SEQ ID NO: 1 or amino acids 673-1260 of SEQ ID NO: 2.
- the CoV S polypeptides described herein comprise an S2 subunit with at least 95%, at least 96 %, at least 97%, at least 98 %, at least 99%, or at least 99.5 %, identity to the S2 subunit of SEQ ID NO: 1 or SEQ ID NO: 2.
- the S2 subunit may have a deletion, an insertion, or mutation of up to about 1, up to about 2, up to about 3, up to about 4, up to about 5, up to about 10, up to about 15, up to about 20, up to about 25, or up to about 30 amino acids compared to the amino acid sequence of the S2 subunit of SEQ ID NO: 1 or SEQ ID NO: 2.
- the S2 subunit may have a deletion, an insertion, or mutation of between about 1 and about 5 amino acids, between about 3 and about 10 amino acids, between about 5 and 10 amino acids, between about 8 and 12 amino acids, between about 10 and 15 amino acids, between about 12 and 17 amino acids, between about 15 and 20 amino acids, between about 18 and 23 amino acids, between about 20 and 25 amino acids, between about 22 and about 27 amino acids, or between about 25 and 30 amino acids as compared to the S2 subunit of SEQ ID NO: 1 or SEQ ID NO: 2.
- the S2 subunit may contain any combination of modifications as shown in Table IF. [00199] Table IF
- the CoV S polypeptides contain a deletion, corresponding to one or more deletions within amino acids 676-685 of the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids of amino acids 676-685 of the native CoV Spike (S) polypeptide (SEQ ID NO:2) are deleted.
- the deletions of amino acids within amino acids 676-685 are consecutive e.g. amino acids 676 and 677 are deleted or amino acids 680 and 681 are deleted.
- the deletions of amino acids within amino acids 676-685 are non-consecutive e.g.
- CoV S polypeptides containing a deletion, corresponding to one or more deletions within amino acids 676-685 have an amino acid sequence selected from the group consisting of SEQ ID NO: 62 and SEQ ID NO: 63.
- the CoV S polypeptides contain a deletion, corresponding to one or more deletions within amino acids 702-711 of the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- S CoV Spike
- 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids of amino acids 702-711 of the native SARS-CoV-2 Spike (S) polypeptide (SEQ ID NO:2) are deleted.
- the one or more deletions of amino acids within amino acids 702-711 are consecutive e.g. amino acids 702 and 703 are deleted or amino acids 708 and 709 are deleted.
- the deletions of amino acids within amino acids 702-711 are non-consecutive e.g.
- amino acids 702 and 704 are deleted or amino acids 707 and 710 are deleted.
- the CoV S polypeptides containing a deletion, corresponding to one or more deletions within amino acids 702-711, have an amino acid sequence selected from the group consisting of SEQ ID NO: 64 and SEQ ID NO: 65.
- the CoV S polypeptides contain a deletion, corresponding to one or more deletions within amino acids 775-793 of the native CoV S polypeptide (SEQ ID NO: 2). In embodiments, up to about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or 19 amino acids of amino acids 775-793 of the native SARS-CoV-2 Spike (S) polypeptide (SEQ ID NO:2) are deleted. In embodiments, the one or more deletions of amino acids within amino acids 775-793 are consecutive e.g. amino acids 776 and 777 are deleted or amino acids 780 and 781 are deleted. In embodiments, the deletions of amino acids within amino acids 775- 793 are non-consecutive e.g. amino acids 775 and 790 are deleted or amino acids 777 and 781 are deleted.
- the CoV S polypeptides contain a deletion of the fusion peptide (SEQ ID NO: 104), which corresponds to amino acids 806-815 of SEQ ID NO: 2.
- S CoV Spike
- the deletions of amino acids within the fusion peptide are consecutive e.g. amino acids 806 and 807 are deleted or amino acids 809 and 810 are deleted.
- the deletions of amino acids within the fusion peptide are non-consecutive e.g. amino acids 806 and 808 are deleted or amino acids 810 and 813 are deleted.
- the CoV S polypeptides containing a deletion, corresponding to one or more amino acids of the fusion peptide have an amino acid sequence selected from SEQ ID NOS: 66, 77, and 105-108.
- the CoV S polypeptides contain a mutation at Lys-973 of the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- Lys-973 is mutated to any natural amino acid.
- Lys-973 is mutated to proline.
- Lys-(S) polypeptide SEQ ID NO: 2
- the CoV S polypeptides containing a mutation at amino acid 973 are selected from the group consisting of SEQ ID NO: 84-89, 105-106, and 109-110.
- the CoV S polypeptides contain a mutation at Val-974 of the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- Val-974 is mutated to any natural amino acid.
- Val-974 is mutated to proline.
- Val-S native CoV Spike
- the CoV S polypeptides containing a mutation at amino acid 974 are selected from the group consisting of SEQ ID NO: 84-89, 105-106, and 109-110.
- the CoV S polypeptides contain a mutation at Lys-973 and Val-974 of the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- Lys-973 and Val-974 are mutated to any natural amino acid.
- Lys-973 and Val-974 are mutated to proline.
- the CoV S polypeptides containing a mutation at amino acids 973 and 974 are selected from SEQ ID NOS: 84-89, 105-106, 109-110, 175, 220, and 217-228.
- the CoV S polypeptides contain one or more modifications to the HR1 domain having an amino acid sequence of SEQ ID NO: 119, which corresponds to amino acids 912-984 of SEQ ID NO: 1 or amino acids 889-971 of SEQ ID NO: 2.
- the CoV S polypeptides described herein comprise an HR1 domain with at least 95%, at least 96 %, at least 97%, at least 98 %, at least 99%, or at least 99.5 %, identity to the HR1 domain of SEQ ID NO: 1 or SEQ ID NO: 2.
- the HR1 domain may have a deletion, an insertion, or mutation of up to about 1, up to about 2, up to about 3, up to about 4, up to about 5, up to about 10, up to about 15, up to about 20, up to about 25, or up to about 30 amino acids compared to the amino acid sequence of the HR1 domain of SEQ ID NO: 1 or SEQ ID NO: 2.
- the HR1 domain may have a deletion, an insertion, or mutation of between about 1 and about 5 amino acids, between about 3 and about 10 amino acids, between about 5 and 10 amino acids, between about 8 and 12 amino acids, between about 10 and 15 amino acids, between about 12 and 17 amino acids, between about 15 and 20 amino acids, between about 18 and 23 amino acids, between about 20 and 25 amino acids, between about 22 and about 27 amino acids, or between about 25 and 30 amino acids as compared to the HR1 domain of SEQ ID NO: 1 or SEQ ID NO: 2.
- the HR1 domain may contain any combination of modifications as shown in Table 1G.
- the CoV S polypeptides contain one or more modifications to the HR2 domain having an amino acid sequence of SEQ ID NO: 125, which corresponds to amino acids 1163-1213 of SEQ ID NO: 1 or amino acids 1150-1200 of SEQ ID NO: 2.
- the CoV S polypeptides described herein comprise an HR2 domain with at least 95%, at least 96 %, at least 97%, at least 98 %, at least 99%, or at least 99.5 %, identity to the HR2 domain of SEQ ID NO: 1 or SEQ ID NO: 2.
- the HR2 domain may have a deletion, an insertion, or mutation of up to about 1, up to about 2, up to about 3, up to about 4, up to about 5, up to about 10, up to about 15, up to about 20, up to about 25, or up to about 30 amino acids compared to the amino acid sequence of the HR2 domain of SEQ ID NO: 1 or SEQ ID NO: 2.
- the HR2 domain may have a deletion, an insertion, or mutation of between about 1 and about 5 amino acids, between about 3 and about 10 amino acids, between about 5 and 10 amino acids, between about 8 and 12 amino acids, between about 10 and 15 amino acids, between about 12 and 17 amino acids, between about 15 and 20 amino acids, between about 18 and 23 amino acids, between about 20 and 25 amino acids, between about 22 and about 27 amino acids, or between about 25 and 30 amino acids as compared to the HR2 domain of SEQ ID NO: 1 or SEQ ID NO: 2.
- the CoV S polypeptides contain one or more modifications to the TM domain having an amino acid sequence of SEQ ID NO: 123, which corresponds to amino acids 1214-1237 of SEQ ID NO: 1 or amino acids 1201-1224 of SEQ ID NO: 2.
- the CoV S polypeptides described herein comprise a TM domain with at least 95%, at least 96 %, at least 97%, at least 98 %, at least 99%, or at least 99.5 %, identity to the TM domain of SEQ ID NO: 1 or SEQ ID NO: 2.
- the TM domain may have a deletion, an insertion, or mutation of up to about 1, up to about 2, up to about 3, up to about 4, up to about 5, up to about 10, up to about 15, up to about 20, up to about 25, or up to about 30 amino acids compared to the amino acid sequence of the TM domain of SEQ ID NO: 1 or SEQ ID NO: 2.
- the TM domain may have a deletion, an insertion, or mutation of between about 1 and about 5 amino acids, between about 3 and about 10 amino acids, between about 5 and 10 amino acids, between about 8 and 12 amino acids, between about 10 and 15 amino acids, between about 12 and 17 amino acids, between about 15 and 20 amino acids, between about 18 and 23 amino acids, between about 20 and 25 amino acids, between about 22 and about 27 amino acids, or between about 25 and 30 amino acids as compared to the TM domain of SEQ ID NO: 1 or SEQ ID NO: 2.
- the CoV S polypeptides described herein lack the entire TM domain. In embodiments, the CoV S polypeptides comprise the TM domain.
- the CoV S polypeptides contain one or more modifications to the CT having an amino acid sequence of SEQ ID NO: 124, which corresponds to amino acids 1238-1273 of SEQ ID NO: 1 or amino acids 1225-1260 of SEQ ID NO: 2.
- the CoV S polypeptides described herein comprise a CT with at least 95%, at least 96 %, at least 97%, at least 98 %, at least 99%, or at least 99.5 %, identity to the CT of SEQ ID NO: 1 or SEQ ID NO: 2.
- the CT may have a deletion, an insertion, or mutation of up to about 1, up to about 2, up to about 3, up to about 4, up to about 5, up to about 10, up to about 15, up to about 20, up to about 25, or up to about 30 amino acids compared to the amino acid sequence of the CT of SEQ ID NO: 1 or SEQ ID NO: 2.
- the CT may have a deletion, an insertion, or mutation of between about 1 and about 5 amino acids, between about 3 and about 10 amino acids, between about 5 and 10 amino acids, between about 8 and 12 amino acids, between about 10 and 15 amino acids, between about 12 and 17 amino acids, between about 15 and 20 amino acids, between about 18 and 23 amino acids, between about 20 and 25 amino acids, between about 22 and about 27 amino acids, or between about 25 and 30 amino acids as compared to the CT of SEQ ID NO: 1 or SEQ ID NO: 2.
- the CoV S polypeptides described herein lack a CT. In embodiments, the CoV S polypeptides comprise the CT.
- the CoV S polypeptides comprise a TM and a CT.
- the CoV Spike (S) polypeptides contain a deletion of one or more amino acids from the transmembrane and cytoplasmic tail (TMCT) (corresponding to amino acids 1201- 1260).
- the amino acid sequence of the TMCT is represented by SEQ ID NO: 39.
- the CoV S polypeptides which have a deletion of one or more residues of the TMCT have enhanced protein expression.
- the CoV Spike (S) polypeptides which have one or more deletions from the TMCT have an amino acid sequence selected from the group consisting of SEQ ID NO: 40, 41, 42, 52, 54, 59, 61, 88, and 89.
- the CoV S polypeptides which have one or more deletions from the TM-CD are encoded by an isolated nucleic acid sequence selected from the group consisting of SEQ ID NO: 39, 43, 53, and 60.
- the CoV S polypeptides contain a deletion of amino acids 56 and 57 of the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- the CoV S polypeptides contain deletions of amino acids 131 and 132 of the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- the CoV S polypeptides contain a deletion of amino acids 56 and 131 of the native CoV Spike (S) polypeptide (SEQ ID NO: 2). In embodiments, the CoV S polypeptides contain a deletion of amino acids 57 and 131 of the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- the CoV S polypeptides contain a deletion of amino acids 56, 57, and 131 of the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- the CoV S polypeptides contain a deletion of amino acids 56 and 132 of the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- the CoV S polypeptides contain a deletion of amino acids 57 and 132 of the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- the CoV S polypeptides contain a deletion of amino acids 56, 57, and 132 of the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- the CoV S polypeptides contain a deletion of amino acids 56, 57, 131, and 132 of the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- the CoV S polypeptides contain mutations that stabilize the prefusion conformation of the CoV S polypeptide.
- the CoV S polypeptides contain proline or glycine substitutions which stabilize the prefusion conformation. This strategy has been utilized for to develop a prefusion stabilized MERS-CoV S protein as described in the following documents which are each incorporated by reference herein in their entirety: Proc Natl Acad Sci USA. 2017 Aug 29;114(35):E7348-E7357; Sci Rep. 2018 Oct 24;8(1): 15701; U.S. Publication No. 2020/0061185; and PCT Application No. PCT/US2017/058370.
- the CoV S polypeptides contain a mutation at Lys-973 and Val-974 and an inactivated furin cleavage site.
- the CoV S polypeptides contain mutations of Lys-973 and Val-974 to proline and an inactivated furin cleavage site, having the amino acid sequence of QQAQ (SEQ ID NO: 7) or GSAS (SEQ ID NO: 96).
- An exemplary CoV S polypeptide containing a mutation at Lys-973 and Val-974 and an inactivated furin cleavage site is depicted in Fig. 8.
- the CoV S polypeptides containing mutations of Lys-973 and Val-974 to proline and an inactivated furin cleavage site have an amino acid sequences of SEQ ID NOS: 86 or 87 and a nucleic acid sequence of SEQ ID NO: 96.
- the CoV S polypeptides contain a mutation at Lys-973 and Val-974, an inactivated furin cleavage site, and a deletion of one or more amino acids of the fusion peptide.
- the CoV S polypeptides contain mutations of Lys-973 and Val-974 to proline, an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7) or GSAS (SEQ ID NO: 96), and deletion of one or more amino acids of the fusion peptide.
- the CoV S polypeptides containing mutations of Lys-973 and Val-974 to proline, an inactivated furin cleavage site, and deletion of one or more amino acids of the fusion peptide having an amino acid sequence of SEQ ID NO: 105 or 106.
- the CoV S polypeptide contains a mutation of Leu-5 to phenylalanine, mutation of Thr-7 to asparagine, mutation of Pro- 13 to serine, mutation of Asp- 125 to tyrosine, mutation of Arg- 177 to serine, mutation of Lys-404 to threonine, mutation of Glu-471 to lysine, mutation of Asn-488 to tyrosine, mutation of His-642 to tyrosine, mutation of Thr-1014 to isoleucine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7) or GSAS (SEQ ID NO: 96) relative to the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- the CoV S polypeptide contains a mutation of Trp-139 to cysteine, mutation of Leu-439 to arginine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7) or GSAS (SEQ ID NO: 96) relative to the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- the CoV S polypeptide contains a mutation of Trp-152 to cysteine, mutation of Leu-452 to arginine, mutation of Ser-13 to isoleucine, mutations of Lys-986 and Val-987 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7) or GSAS (SEQ ID NO: 96) relative to the native CoV Spike (S) polypeptide (SEQ ID NO: 1).
- the CoV S polypeptide contains a mutation of Lys-404 to threonine or asparagine, mutation of Glu-471 to lysine, mutation of Asn-488 to tyrosine, mutation of Leu-5 to phenylalanine, mutation of Asp-67 to alanine, mutation of Asp-202 to glycine, deletion of one or more of amino acids 229-231, mutation of Arg-233 to isoleucine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7) or GSAS (SEQ ID NO: 96) relative to the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- the CoV S polypeptide contains a mutation of Asn-488 to tyrosine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7) or GSAS (SEQ ID NO: 96) relative to the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- the CoV S polypeptide having a mutation of Asn-488 to tyrosine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7) or GSAS (SEQ ID NO: 96) comprises an amino acid sequence of SEQ ID NO: 112.
- the CoV S polypeptide contains a mutation of Asp-601 to glycine, a mutation of Asn-488 to tyrosine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7) or GSAS (SEQ ID NO: 96) relative to the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- the CoV S polypeptide having a mutation of Asn-488 to tyrosine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7) or GSAS (SEQ ID NO: 96) comprises an amino acid sequence of SEQ ID NO : 113.
- the CoV S polypeptide contains deletion of amino acids 56, 57, and 131, mutation of Asn-488 to tyrosine, a mutation of Ala-557 to aspartate, mutation of Asp-601 to glycine, mutation of Pro-668 to histidine, mutation of Thr-703 to isoleucine, mutation of Ser-969 to alanine, mutation of Asp-1105 to histidine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7), GSAS (SEQ ID NO: 96), or GG relative to the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- the CoV S polypeptide having deletion of amino acids 56, 57, and 131, mutation of Asn-488 to tyrosine, a mutation of Ala-557 to aspartate, mutation of Asp-601 to glycine, mutation of Pro-668 to histidine, mutation of Thr-703 to isoleucine, mutation of Ser-969 to alanine, mutation of Asp-1105 to histidine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7) or GSAS (SEQ ID NO: 96) comprises an amino acid sequence of SEQ ID NO: 114.
- the CoV S polypeptide having deletion of amino acids 56, 57, and 131, mutation of Asn-488 to tyrosine, a mutation of Ala-557 to aspartate, mutation of Asp-601 to glycine, mutation of Pro-668 to histidine, mutation of Thr- 703 to isoleucine, mutation of Ser-969 to alanine, mutation of Asp-1105 to histidine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7) or GSAS (SEQ ID NO: 96) or GG comprises an amino acid sequence of SEQ ID NO: 136.
- the CoV S polypeptide having deletion of amino acids 56, 57, and 131, mutation of Asn-488 to tyrosine, a mutation of Ala-557 to aspartate, mutation of Asp-601 to glycine, mutation of Pro-668 to histidine, mutation of Thr- 703 to isoleucine, mutation of Ser-969 to alanine, mutation of Asp-1105 to histidine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of GG comprises an amino acid sequence of SEQ ID NO: 137 or SEQ ID NO: 138.
- the CoV S polypeptide having an amino acid sequence of SEQ ID NO: 114 or SEQ ID NO: 136 is encoded by a nucleic acid having a nucleic acid sequence of SEQ ID NO: 135.
- the CoV S polypeptide having an amino acid sequence of SEQ ID NO: 137 or SEQ ID NO: 138 is encoded by a nucleic acid having a sequence of SEQ ID NO: 139.
- the CoV S polypeptide contains deletion of amino acids 56, 57, and 132, mutation of Asn-488 to tyrosine, a mutation of Ala-557 to aspartate, mutation of Asp-601 to glycine, mutation of Pro-668 to histidine, mutation of Thr-703 to isoleucine, mutation of Ser-969 to alanine, mutation of Asp-1105 to histidine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7) or GSAS (SEQ ID NO: 96 relative to the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- the CoV S polypeptide having a deletion of amino acids 56, 57, and 132, mutation of Asn-488 to tyrosine, a mutation of Ala-557 to aspartate, mutation of Asp-601 to glycine, mutation of Pro-668 to histidine, mutation of Thr- 703 to isoleucine, mutation of Ser-969 to alanine, mutation of Asp-1105 to histidine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7) or GSAS (SEQ ID NO: 96) comprises an amino acid sequence of SEQ ID NO: 114.
- the CoV S polypeptide contains mutation of Asn-488 to tyrosine, mutation of Asp-67 to alanine, mutation of Leu-229 to histidine, mutation of Asp-202 to glycine, mutation of Lys-404 to asparagine, mutation of Glu-471 to lysine, mutation of Ala- 688 to valine, mutation of Asp-601 to glycine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7) or GSAS (SEQ ID NO: 96) relative to the native CoV Spike (S) polypeptide (SEQ ID NO: 2).
- the CoV S polypeptide having a mutation of Asn-488 to tyrosine, mutation of Asp-67 to alanine, mutation of Leu-229 to histidine, mutation of Asp-202 to glycine, mutation of Lys-404 to asparagine, mutation of Glu-471 to lysine, mutation of Ala-688 to valine, mutation of Asp-601 to glycine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7) or GSAS (SEQ ID NO: 96) comprises an amino acid sequence of SEQ ID NO: 115.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, deletions of amino acid 56, deletion of amino acid 57, deletion of amino acid 131, N488Y, A557D, D601G, P668H, T703I, S969A, and D1105H, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the inactivated furin cleavage site has the amino acid sequence of QQAQ (SEQ ID NO: 7).
- the inactivated furin cleavage site has the amino acid sequence of GG.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, D67A, D202G, L229H, K404N, E471K, N488Y, D601G, and A688V, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the inactivated furin cleavage site has the amino acid sequence of QQAQ (SEQ ID NO: 7).
- the inactivated furin cleavage site has the amino acid sequence of GG.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, deletion of amino acids 229- 231, D67A, D202G, K404N, E471K, N488Y, D601G, and A688V, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7), deletion of amino acids 229-231, L5F, D67A, D202G, K404N, E471K, N488Y, D601G, and A688V, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide having one or more modifications selected from K973P, V974P, an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7), deletion of amino acids 229-231, L5F, D67A, D202G, K404N, E471K, N488Y, D601G, and A688V, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2 comprises the amino acid sequence of SEQ ID NO: 144.
- the CoV S polypeptide having the amino acid sequence of SEQ ID NO: 144 is encoded by a nucleic acid having a sequence of SEQ ID NO: 145.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site having the amino acid sequence of GG, deletion of amino acids 229-231, L5F, D67A, D202G, K404N, E471K, N488Y, D601G, and A688V, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide having one or more modifications selected from K973P, V974P, an inactivated furin cleavage site having the amino acid sequence of GG, deletion of amino acids 229-231, L5F, D67A, D202G, K404N, E471K, N488Y, D601G, and A688V, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2 comprises the amino acid sequence of SEQ ID NO: 144.
- the CoV S polypeptide having the amino acid sequence of SEQ ID NO: 144 is encoded by a nucleic acid having a sequence of SEQ ID NO: 145.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, L5F, T7N, P13S, D125Y, R177S, K404T, E471K, N488Y, D601G, H642Y, T1014I, and V1163F, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide having an amino acid sequence of SEQ ID NO: 151 is encoded by a nucleic acid having a sequence of SEQ ID NO: 150.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, deletion of amino acids 229- 231, L5F, D67A, D202G, L229H, K404N, E471K, N488Y, D601G, and A688V, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, K404N, E471K, N488Y, L5F, D67A, D202G, L229H, D601G, A688V, and deletion of amino acids 229-231, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the inactivated furin cleavage site has the amino acid sequence of QQAQ (SEQ ID NO: 7).
- the inactivated furin cleavage site has the amino acid sequence of GG.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, K404N, E471K, and N488K wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, K404N, E471K, and N488Y.
- the CoV S polypeptide is the RBD of the CoV S polypeptide having one or more modifications selected from K973P, V974P, an inactivated furin cleavage site, K404N, E471K, and N488K wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide is the RBD of the CoV S polypeptide having one or more modifications selected from K973P, V974P, an inactivated furin cleavage site, K404N, E471K, and N488Y wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site having the amino acid sequence of GG, D601G, E404N, E471K, andN488Y.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site having the amino acid sequence of GG, and a D601 G mutation, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide containing modifications selected from: K973P, V974P, an inactivated furin cleavage site having the amino acid sequence of GG, and a D601G mutation has an amino acid sequence of SEQ ID NO: 133.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, optionally wherein the inactivated furin cleavage site is QQAQ (SEQ ID NO: 7) or GG, K404N, E471K, N488K, D67A, D202G, L229H, D601G, and A688V, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide containing one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, optionally wherein the inactivated furin cleavage site is QQAQ (SEQ ID NO: 7) or GG, K404N, E471K, N488K, D67A, D202G, L229H, D601G, and A688V has an amino acid sequence of SEQ ID NO: 132 or SEQ ID NO: 141.
- the CoV S polypeptide having an amino acid sequence of SEQ ID NO: 132 is encoded by a nucleic acid having a nucleic acid sequence of SEQ ID NO: 131.
- the CoV S polypeptide having an amino acid sequence of SEQ ID NO: 132 is encoded by a nucleic acid having a nucleic acid sequence of SEQ ID NO: 142.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, W139C and L439R, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide comprising K973P, V974P, an inactivated furin cleavage site, W139C and L439R modifications is expressed with a signal peptide having an amino acid sequence of SEQ ID NO: 117 or SEQ ID NO: 5.
- the CoV S polypeptide comprises one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, D601G, W139C, and L439R, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide comprises K973P, V974P, an inactivated furin cleavage site, D601G, W139C, and L439R modifications and is expressed with a signal peptide having an amino acid sequence of SEQ ID NO: 117 or SEQ ID NO: 5.
- the CoV S polypeptide comprises one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, D601G, L5F, D67A, D202G, deletions of amino acids 229-231, R233I, K404N, E471K, N488Y, and A688V, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, optionally wherein the inactivated furin cleavage site is QQAQ (SEQ ID NO: 7), W139C, S481P, D601G, and L439R, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, optionally wherein the inactivated furin cleavage site is QQAQ (SEQ ID NO: 7), W139C, D601G, and L439R, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, optionally wherein the inactivated furin cleavage site is QQAQ (SEQ ID NO: 7), W139C, S481P, and D601G wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide containing one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, optionally wherein the inactivated furin cleavage site is QQAQ (SEQ ID NO: 7), W139C, S481P, D601G, and L439R has the amino acid sequence of SEQ ID NO: 153.
- the CoV S polypeptide having the amino acid sequence of SEQ ID NO: 153 comprises a signal peptide having an amino acid sequence of SEQ ID NO: 117.
- the CoV S polypeptide having the amino acid sequence of SEQ ID NO: 153 comprises a signal peptide having an amino acid sequence of SEQ ID NO: 5.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, optionally wherein the inactivated furin cleavage site is QQAQ (SEQ ID NO: 7), T82I, D240G, E471K, D601G, and A688V, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, optionally wherein the inactivated furin cleavage site is QQAQ (SEQ ID NO: 7), T82I, D240G, S464N, D601G, and A688V, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, optionally wherein the inactivated furin cleavage site is QQAQ (SEQ ID NO: 7), deletion of amino acid 56, deletion of amino acid 57, deletion of amino acid 131, aN488Y mutation, an A557D mutation, aD601G mutation, a P668H mutation, a T703I mutation, a S969A mutation, and a D1105H mutation, wherein the CoV S polypeptide is numbered with respect to the wild-type SARS-CoV-2 S polypeptide having the amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, optionally wherein the inactivated furin cleavage site is QQAQ (SEQ ID NO: 7), deletion of amino acid 56, deletion of amino acid 57, deletion of amino acid 132, a N488Y mutation, an A557D mutation, a D601G mutation, a P668H mutation, a T703I mutation, a S969A mutation, and a D1105H mutation, wherein the CoV S polypeptide is numbered with respect to the wild-type SARS-CoV-2 S polypeptide having the amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, optionally wherein the inactivated furin cleavage site is QQAQ (SEQ ID NO: 7), a D67A mutation, a L229H mutation, a R233I mutation, an A688V mutation, an N488Y mutation, a K404N mutation, a E471K mutation, and a D601G mutation, wherein the CoV S polypeptide is numbered with respect to the wild-type SARS-CoV-2 S polypeptide having the amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide contains one or more modifications selected from: K973P, V974P, an inactivated furin cleavage site, optionally wherein the inactivated furin cleavage site is QQAQ (SEQ ID NO: 7), a L5F mutation, a T7N mutation, a P13S mutation, a D125Y mutation, a R177S mutation, a K404T mutation, a E471K mutation, a N488Y mutation, a D601G mutation, a H642Y mutation, a T1014I mutation, and a T1163F mutation, wherein the CoV S polypeptide is numbered with respect to the wild-type SARS- CoV-2 S polypeptide having the amino acid sequence of SEQ ID NO: 2.
- the CoV S polypeptide contains one or more modifications selected from: K986P, V987P, an inactivated furin cleavage site, optionally wherein the inactivated furin cleavage site is QQAQ (SEQ ID NO: 7), a S 131 mutation, a W152C mutation, and a L452R mutation, wherein the CoV S polypeptide is numbered with respect to the wildtype SARS-CoV-2 S polypeptide having the amino acid sequence of SEQ ID NO: 1.
- the CoV S polypeptide contains one or more modifications selected from: K986P, V987P, an inactivated furin cleavage site, optionally wherein the inactivated furin cleavage site is QQAQ (SEQ ID NO: 7), a S13I mutation, a W152C mutation, and a L452R mutation, wherein the CoV S polypeptide is numbered with respect to the wild-type SARS- CoV-2 S polypeptide having the amino acid sequence of SEQ ID NO: 1 lacks an N-terminal signal peptide.
- the CoV S polypeptide contains one or more modifications selected from: K986P, V987P, A67V, T95I, G142D, L212I, G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493R, G496S, Q498R, N501Y,Y505H, T547K,D614G, H655Y, H679K, P681H, N764K, D796Y,N856K, Q954H, N969K, L981F, deletion of amino acids 69, 70, 143, 144, 145, and 211, and insertion of the amino acids EPE between amino acids 214 and 215, optionally wherein the inactivated furin cleavage site is QQAQ (SEQ ID NO: 7), wherein the CoV S polypeptide is numbered with
- the CoV S polypeptide contains one or more modifications selected from: K986P, V987P, A67V, T95I, G142D, L212I, G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N,T478K, E484A,Q493R, G496S, Q498R, N501Y,Y505H, T547K,D614G, H655Y, H679K, P681H, N764K, D796Y,N856K, Q954H, N969K, L981F, optionally wherein the inactivated furin cleavage site is QQAQ (SEQ ID NO: 7), wherein the CoV S polypeptide is numbered with respect to the wild-type SARS-CoV-2 S polypeptide having the amino acid sequence of SEQ ID NO: 1.
- the CoV S polypeptide is numbered with respect to the wild-
- the CoV S polypeptide is any one of SEQ ID NOS: 159 or 167.
- the amino acid sequence of the CoV S polypeptide has at least 90 %, at least 95 %, at least 96 %, at least 97 %, at least 98 %, at least 99 %, or at least 99.5 % identity to any one of SEQ ID NOS: 159 or 167.
- the CoV S polypeptide is any one of SEQ ID NOS: 160 or 170.
- the amino acid sequence of the CoV S polypeptide has at least 90 %, at least 95 %, at least 96 %, at least 97 %, at least 98 %, at least 99 %, or at least 99.5 % identity to any one of SEQ ID NOS: 160 or 170.
- the CoV S polypeptide is encoded by a nucleic acid of any one of SEQ ID NOS: 161, 162, 163, 164, 165, 166, 168, 169, 171, and 172.
- the CoV S polypeptide of any one of SEQ ID NOS: 160, 170, 159, or 167 lacks the N-terminal signal peptide.
- the CoV S polypeptide comprises the polypeptide sequence of SEQ ID NOS: 160, 170, 159, or 167, which is C-terminal to MFVFLVLLPLVSS (SEQ ID NO: 5).
- the CoV S polypeptide contains a set of modifications as described in the table below, wherein the modifications are numbered with respect to SEQ ID NO: 1.
- the CoV S polypeptide contains a set of modifications as described in the table below; an inactivated furin cleavage site (optionally wherein the furin cleavage site is QQAQ (SEQ ID NO: 7)), and K986P and V987P modifications, wherein the modifications are numbered with respect to SEQ ID NO: 1.
- the CoV Spike (S) polypeptides comprise a polypeptide linker.
- the polypeptide linker contains glycine and serine.
- the linker has about 50 %, about 55 %, about 60 %, about 65 %, about 70 %, about 75 %, about 80 %, about 85 %, about 90 %, about 95 %, or about 100 % glycine.
- the polypeptide linker has a repeat of (SGGG) n (SEQ ID NO:
- n is an integer from 1 to 50 (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50).
- the polypeptide linker has an amino acid sequence corresponding to SEQ ID NO: 90.
- the polypeptide linker has a repeat of (GGGGS) n (SEQ ID NO: 93), wherein n is an integer from 1 to 50 (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50).
- the polypeptide linker has a repeat of (GGGS) n (SEQ ID NO:
- n is an integer from 1 to 50 (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50).
- the polypeptide linker is a poly-(Gly)n linker, wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 16, 17, 18, 19, or 20.
- the linker is selected from the group consisting of: dipeptides, tripeptides, and quadripeptides.
- the linker is a dipeptide selected from the group consisting of alanine-serine (AS), leucine-glutamic acid (LE), and serine-arginine (SR).
- the polypeptide linker comprises between 1 to 100 contiguous amino acids of a naturally occurring CoV S polypeptide or of a CoV S polypeptide disclosed herein. In embodiments, the polypeptide linker has an amino acid sequence corresponding to SEQ ID NO: 94.
- the CoV Spike (S) polypeptides comprise a foldon. In embodiments, the TMCT is replaced with a foldon. In embodiments, a foldon causes trimerization of the CoV Spike (S) polypeptide. In embodiments, the foldon is an amino acid sequence known in the art. In embodiments, the foldon has an amino acid sequence of SEQ ID NO: 68.
- the foldon is a T4 fibritin trimerization motif.
- the T4 fibritin trimerization domain has an amino acid sequence of SEQ ID NO: 103.
- the foldon is separated in amino acid sequence from the CoV Spike (S) polypeptide by a polypeptide linker.
- S CoV Spike
- the disclosure provides CoV S polypeptides comprising a fragment of a coronavirus S protein and nanoparticles and vaccines comprising the same.
- the fragment of the coronavirus S protein is between 10 and 1500 amino acids in length (e.g.
- the fragment of the coronavirus S protein is selected from the group consisting of the receptor binding domain (RBD), subdomain 1, subdomain 2, upper helix, fusion peptide, connecting region, heptad repeat 1, central helix, heptad repeat 2, NTD, and TMCT.
- the CoV S polypeptide comprises an RBD and a subdomain 1.
- the CoV S polypeptide comprising an RBD and a subdomain 1 is amino acids 319 to 591 of SEQ ID NO: 1.
- the CoV S polypeptide contains a fragment of a coronavirus S protein, wherein the fragment of the coronavirus S protein is the RBD.
- the CoV S polypeptide contains two or more RBDs, which are connected by a polypeptide linker.
- the polypeptide linker has an amino acid sequence of SEQ ID NO: 90 or SEQ ID NO: 94.
- the CoV S polypeptide contains 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11,
- the CoV S polypeptide contains two or more SARS- CoV-2 RBDs, which are connected by a polypeptide linker.
- the antigen containing two or more SARS-CoV-2 RBDs has an amino acid sequence corresponding to one of SEQ ID NOS: 72-75.
- the CoV S polypeptide contains a SARS-CoV-2 RBD and a SARS RBD.
- the CoV S polypeptide comprises a SARS-CoV-2 RBD and a SARS RBD, wherein each RBD is separated by a polypeptide linker.
- the CoV S polypeptide comprising a SARS-CoV-2 RBD and a SARS RBD has an amino acid sequence selected from the group consisting of SEQ ID NOS: 76-79.
- the CoV S polypeptide contains a SARS-CoV-2 RBD and a MERS RBD. In embodiments, the CoV S polypeptide comprises a SARS-CoV-2 RBD and a MERS RBD, wherein each RBD is separated by a polypeptide linker.
- the CoV S polypeptide comprises a SARS RBD and a MERS RBD. In embodiments, the CoV S polypeptide comprises a SARS RBD and a MERS RBD, wherein each RBD is separated by a polypeptide linker.
- the CoV S polypeptide contains a SARS-CoV-2 RBD, a SARS RBD, and a MERS RBD.
- the CoV S polypeptide contains a SARS-CoV-2 RBD, a SARS RBD, and a MERS RBD, wherein each RBD is separated by a polypeptide linker.
- the CoV S polypeptide comprising a SARS-CoV-2 RBD, a SARS RBD, and a MERS RBD has an amino acid sequence selected from the group consisting of SEQ ID NOS: 80-83.
- the CoV S polypeptides described herein are expressed with an N-terminal signal peptide.
- the N-terminal signal peptide has an amino acid sequence of SEQ ID NO: 5 (MFVFLVLLPLVSS).
- the N-terminal signal peptide has an amino acid sequence of SEQ ID NO: 117 (MFVFLVLLPLVSI).
- the N-terminal signal peptide has an amino acid sequence of SEQ ID NO: 154 (MFVFFVLLPLVSS).
- the N-terminal signal peptide has an amino acid sequence of SEQ ID NO: 193 (MFGFLVLLPLVSS).
- the signal peptide may be replaced with any signal peptide that enables expression of the CoV S protein.
- one or more of the CoV S protein signal peptide amino acids may be deleted or mutated. An initiating methionine residue is maintained to initiate expression.
- the CoV S polypeptides are encoded by a nucleic acid sequence selected from the group consisting of SEQ ID NO: 35, SEQ ID NO: 37, SEQ ID NO: 95, SEQ ID NO: 43, SEQ ID NO: 47, SEQ ID NO: 50, SEQ ID NO: 53, SEQ ID NO: 55, SEQ ID NO: 57, SEQ ID NO: 96, SEQ ID NO: 60, SEQ ID NO: 131, SEQ ID NO: 135, SEQ ID NO: 142, SEQ ID NO: 145, SEQ ID NO: 148, SEQ ID NO: 150, SEQ ID NO: 196, SEQ ID NO: 197; SEQ ID NO: 198; SEQ ID NO: 199; SEQ ID NO: 201; SEQ ID NO: 202; SEQ ID NO: 204; SEQ ID NO: 206; SEQ ID NO:N 208; SEQ ID NO: 210; SEQ ID NO: 212; SEQ ID NO: 214; and SEQ ID NO:
- the N-terminal signal peptide of the CoV S polypeptide contains a mutation at Ser-13 relative to the native CoV Spike (S) signal polypeptide (SEQ ID NO: 5).
- Ser-13 is mutated to any natural amino acid.
- Ser-13 is mutated to alanine, methionine, isoleucine, leucine, threonine, or valine.
- Ser-13 is mutated to isoleucine.
- the N-terminal signal peptide is cleaved to provide the mature CoV protein sequence (SEQ ID NOS: 2, 4, 38, 41, 44, 48, 51, 54, 58, 61, 63, 65, 67, 73, 75, 78, 79, 82, 83, 85, 87, 89, 106, 110, 132, 133, 114, 138, 141, 144, 147, 151, 153, 156, 158, 174, 175, 176, 181-184, 186, 188, 190, 195, 217-228 233- 236, and 243.).
- the signal peptide is cleaved by host cell proteases.
- the full-length protein may be isolated from the host cell and the signal peptide cleaved subsequently.
- the disclosed CoV S polypeptides may have enhanced protein expression and stability relative to the native CoV Spike (S) protein.
- the CoV S polypeptides described herein contain further modifications from the native coronavirus S protein (SEQ ID NO: 2).
- the coronavirus S proteins described herein exhibit at least 80 %, or at least 90 % , or at least 95 %, or at least 97 %, or at least 99 % identity to the native coronavirus S protein.
- the CoV S polypeptides described herein are at least 90 %, at least 91 %, at least 92 %, at least 93 %, at least 94 %, at least 95%, at least 96 %, at least 97%, at least 98 %, at least 99%, or at least 99.5 % identical to the CoV S polypeptide having an amino acid sequence of any one of SEQ ID NO: 87, SEQ ID NO: 174, SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NOS: 181-184, SEQ ID NO: 186, SEQ ID NO: 188, SEQ ID NO: 190, SEQ ID NO: 195; SEQ ID NOS: 217-228, SEQ ID NOS: 233-236, and SEQ ID NO: 243.
- a CoV S polypeptide may have a deletion, an insertion, or mutation of up to about 1, up to about 2, up to about 3, up to about 4, up to about 5, up to about 10, up to about 15, up to about 20, up to about 25, up to about 30, up to about 35, up to about 40, up to about 45, or up to about 50 amino acids compared to the amino acid sequence of the CoV S polypeptide having an amino acid sequence of any one of SEQ ID NO: 87, SEQ ID NO: 174, SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NOS: 181-184, SEQ ID NO: 186, SEQ ID NO: 188, SEQ ID NO: 190, SEQ ID NO: 195; SEQ ID NOS: 217-228, SEQ ID NOS: 233-236, and SEQ ID NO: 243.
- a CoV S polypeptide may have may have a deletion, an insertion, or mutation of between about 1 and about 5 amino acids, between about 3 and about 10 amino acids, between about 5 and 10 amino acids, between about 8 and 12 amino acids, between about 10 and 15 amino acids, between about 12 and 17 amino acids, between about 15 and 20 amino acids, between about 18 and 23 amino acids, between about 20 and 25 amino acids, between about 22 and about 27 amino acids, between about 25 and 30 amino acids, between about 30 and 35 amino acids, between about 35 and 40 amino acids, between about 40 and 45 amino acids, or between about 45 and 50 amino acids, as compared to the CoV S polypeptide having an amino acid sequence of any one of SEQ ID NO: 87, SEQ ID NO: 174, SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NOS: 181-184, SEQ ID NO: 186, SEQ ID NO: 188, SEQ ID NO: 190, SEQ ID NO: 195; SEQ ID NOS: 217-228, SEQ ID NO
- the CoV S polypeptides described herein comprise about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, or about 25 substitutions compared to the coronavirus S protein having an amino acid sequence of any one of SEQ ID NO: 87, SEQ ID NO: 174, SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NOS: 181- 184, SEQ ID NO: 186, SEQ ID NO: 188, SEQ ID NO: 190, SEQ ID NO: 195; SEQ ID NOS: 217-228, SEQ ID NOS: 233-236, and SEQ ID NO: 243.
- the coronavirus S polypeptide is extended at the N-terminus, the C-terminus, or both the N-terminus and the C-terminus.
- the extension is a tag useful for a function, such as purification or detection.
- the tag contains an epitope.
- the tag may be a polyglutamate tag, a FLAG-tag, a HA-tag, a polyHis-tag (having about 5-10 histidines) (SEQ ID NO: 101), a hexahistidine tag (SEQ ID NO: 100), an 8X-His- tag (having eight histidines) (SEQ ID NO: 102), a Myc-tag, a Glutathione-S-transferase-tag, a Green fluorescent protein-tag, Maltose binding protein-tag, a Thioredoxin-tag, or an Fc-tag.
- the extension may be an N-terminal signal peptide fused to the protein to enhance expression.
- nanoparticles may contain the antigen with an intact signal peptide.
- the antigen when a nanoparticle comprises an antigen, the antigen may contain an extension and thus may be a fusion protein when incorporated into nanoparticles.
- extensions are not included.
- the tag is a protease cleavage site.
- Non-limiting examples of protease cleavage sites include the HRV3C protease cleavage site, chymotrypsin, trypsin, elastase, endopeptidase, caspase-1, caspase-2, caspase-3, caspase-4, caspase-5, caspase-6, caspase-7, caspase-8, caspase-9, caspase- 10, enterokinase, factor Xa, Granzyme B, TEV protease, and thrombin.
- the protease cleavage site is an HRV3C protease cleavage site.
- the protease cleavage site comprises an amino acid sequence of SEQ ID NO: 98.
- the CoV S glycoprotein comprises a fusion protein.
- the CoV S glycoprotein comprises an N-terminal fusion protein.
- the Cov S glycoprotein comprises a C-terminal fusion protein.
- the fusion protein encompasses a tag useful for protein expression, purification, or detection.
- the tag is a polyHis-tag (having about 5-10 histidines), a Myc-tag, a Glutathione-S-transferase-tag, a Green fluorescent protein-tag, Maltose binding protein-tag, a Thioredoxin-tag, a Strep-tag, a Twin-Strep-tag, or an Fc-tag.
- the tag is an Fc- tag.
- the Fc-tag is monomeric, dimeric, or trimeric.
- the tag is a hexahistidine tag, e.g. a polyHis-tag which contains six histidines (SEQ ID NO: 100).
- the tag is a Twin-Strep-tag with an amino acid sequence of SEQ ID NO: 99.
- the CoV S polypeptide is a fusion protein comprising another coronavirus protein.
- the other coronavirus protein is from the same coronavirus.
- the other coronavirus protein is from a different coronavirus.
- the CoV S protein may be truncated.
- the N-terminus may be truncated by about 10 amino acids, about 30 amino acids, about 50 amino acids, about 75 amino acids, about 100 amino acids, or about 200 amino acids.
- the C-terminus may be truncated instead of or in addition to the N-terminus.
- the C-terminus may be truncated by about 10 amino acids, about 30 amino acids, about 50 amino acids, about 75 amino acids, about 100 amino acids, or about 200 amino acids.
- identity is measured over the remaining portion of the protein.
- the mature CoV S polypeptide antigens are used to produce a vaccine comprising coronavirus S nanoparticles.
- nanoparticles of the present disclosure comprise the CoV S polypeptides described herein.
- the nanoparticles of the present disclosure comprise CoV S polypeptides associated with a detergent core. The presence of the detergent facilitates formation of the nanoparticles by forming a core that organizes and presents the antigens.
- the nanoparticles may contain the CoV S polypeptides assembled into multi-oligomeric glycoprotein-detergent (e.g.PS80) nanoparticles with the head regions projecting outward and hydrophobic regions and PS80 detergent forming a central core surrounded by the glycoprotein.
- the CoV S polypeptide inherently contains or is adapted to contain a transmembrane domain to promote association of the protein into a detergent core.
- the CoV S polypeptide contains a head domain.
- Fig. 10 shows an exemplary structure of a CoV S polypeptide of the disclosure. Primarily the transmembrane domains of a CoV S polypeptide trimer associate with detergent; however, other portions of the polypeptide may also interact.
- the nanoparticles have improved resistance to environmental stresses such that they provide enhanced stability and/or improved presentation to the immune system due to organization of multiple copies of the protein around the detergent.
- the detergent core is a non-ionic detergent core.
- the CoV S polypeptide is associated with the non-ionic detergent core.
- the detergent is selected from the group consisting of polysorbate-20 (PS20), polysorbate-40 (PS40), polysorbate-60 (PS60), polysorbate-65 (PS65) and polysorbate-80 (PS80).
- the detergent is PS80.
- the CoV S polypeptide forms a trimer.
- the CoV S polypeptide nanoparticles are composed of multiple polypeptide trimers surrounding a non-ionic detergent core.
- the nanoparticles contain at least about 1 trimer or more.
- the nanoparticles contain at least about 5 trimers to about 30 trimers of the Spike protein.
- each nanoparticle may contain 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 15, 20, 25, or 30 trimers, including all values and ranges in between.
- Compositions disclosed herein may contain nanoparticles having different numbers of trimers.
- a composition may contain nanoparticles where the number of trimers ranges from 2-9; in embodiments, the nanoparticles in a composition may contain from 2-6 trimers.
- the compositions contain a heterogeneous population of nanoparticles having 2 to 6 trimers per nanoparticle, or 2 to 9 trimers per nanoparticle.
- the compositions may contain a substantially homogenous population of nanoparticles. For example, the population may contain about 95% nanoparticles having 5 trimers.
- the nanoparticles disclosed herein range in particle size.
- the nanoparticles disclosed herein range in particle size from a Z-ave size from about 20 nm to about 60 nm, about 20 nm to about 50 nm, about 20 nm to about 45 nm, about 20 nm to about 35 nm, about 20 nm to about 30 nm, about 25 nm to about 35 nm, about 25 nm to about 45 nm, about 30 nm to about 120 nm, about 30 nm to about 80 nm, about 30 nm to about 60 nm, about 30 nm to about 65 nm, or from about 30 nm to about 50 nm.
- Particle size (Z-ave) is measured by dynamic light scattering (DLS) using a Zetasizer NanoZS (Malvern, UK), unless otherwise specified.
- the nanoparticles comprising the CoV S polypeptides disclosed herein have a reduced particle size compared to nanoparticles comprising a wild-type CoV S polypeptide.
- the CoV S polypeptides are at least about 40 % smaller in particle size, for example, at least about 40 %, at least about 45 %, at least about 50 %, at least about 55 %, at least about 60 %, at least about 65 %, at least about 70 %, at least about 75 % , at least about 80 %, or at least about 85 % smaller in particle size.
- the nanoparticles comprising CoV S polypeptides disclosed herein are more homogenous in size, shape, and mass than nanoparticles comprising a wild-type CoV S polypeptide.
- the poly dispersity index (PDI) which is a measure of heterogeneity, is measured by dynamic light scattering using a Malvern Setasizer unless otherwise specified.
- the particles measured herein have a PDI from about 0.1 to about 0.45, for example, about 0.1, about 0.2, about 0.25, about 0.29, about 0.3, about 0.35, about 0.40, or about 0.45.
- the nanoparticles measured herein have a PDI that is at least about 25 % smaller than the PDI of nanoparticles comprising the wild-type CoV S polypeptide of SEQ ID NO: 2, for example, at least about 25 %, at least about 30 %, at least about 35 %, at least about 40 %, at least about 45 %, at least about 50 %, at least about 55 %, or at least about 60 %, smaller.
- the CoV S polypeptides and nanoparticles comprising the same have improved thermal stability as compared to the wild-type CoV S polypeptide or a nanoparticle thereof.
- the thermal stability of the CoV S polypeptides is measured using differential scanning calorimetry (DSC) unless otherwise specified.
- the enthalpy of transition (AHcal) is the energy required to unfold a CoV S polypeptide.
- the CoV S polypeptides have an increased AHcal as compared to the wild-type CoV S polypeptide.
- the AHcal of a CoV S polypeptide is about 2-fold, about 3-fold, about 4-fold, about 5-fold, about 6-fold, about 7-fold, about 8-fold, about 9-fold, or about 10-fold greater than the AHcal of a wild-type CoV S polypeptide.
- nanoparticle types may be included in vaccine compositions disclosed herein.
- the nanoparticle type is in the form of an anisotropic rod, which may be a dimer or a monomer.
- the nanoparticle type is a spherical oligomer.
- the nanoparticle may be described as an intermediate nanoparticle, having sedimentation properties intermediate between the first two types. Formation of nanoparticle types may be regulated by controlling detergent and protein concentration during the production process. Nanoparticle type may be determined by measuring sedimentation coefficient.
- the nanoparticles of the present disclosure are non-naturally occurring products, the components of which do not occur together in nature.
- the methods disclosed herein use a detergent exchange approach wherein a first detergent is used to isolate a protein and then that first detergent is exchanged for a second detergent to form the nanoparticles.
- the antigens contained in the nanoparticles are typically produced by recombinant expression in host cells. Standard recombinant techniques may be used.
- the CoV S polypeptides are expressed in insect host cells using a baculovirus system.
- the baculovirus is a cathepsin-L knock-out baculovirus, a chitinase knock-out baculovirus.
- the baculovirus is a double knock-out for both cathepsin-L and chitinase. High level expression may be obtained in insect cell expression systems.
- Non limiting examples of insect cells are, Spodoptera frugiperda (Sf) cells, e.g.
- the CoV S polypeptide described herein are produced in any suitable host cell.
- the host cell is an insect cell.
- the insect cell is an Sf9 cell.
- Typical transfection and cell growth methods can be used to culture the cells.
- Vectors e.g., vectors comprising polynucleotides that encode fusion proteins
- the vector is a recombinant baculovirus.
- Methods to grow host cells include, but are not limited to, batch, batch-fed, continuous and perfusion cell culture techniques.
- Cell culture means the growth and propagation of cells in a bioreactor (a fermentation chamber) where cells propagate and express protein (e.g. recombinant proteins) for purification and isolation.
- a bioreactor is a chamber used to culture cells in which environmental conditions such as temperature, atmosphere, agitation and/or pH can be monitored.
- the bioreactor is a stainless steel chamber.
- the bioreactor is a pre-sterilized plastic bag (e.g. Cellbag®, Wave Biotech, Bridgewater, N.J.).
- the presterilized plastic bags are about 50 L to 3500 L bags.
- the protein may be harvested from the host cells using detergents and purification protocols. Once the host cells have grown for 48 to 96 hours, the cells are isolated from the media and a detergent-containing solution is added to solubilize the cell membrane, releasing the protein in a detergent extract. Triton X-100 and TERGITOL® nonylphenol ethoxylate, also known as NP-9, are each preferred detergents for extraction.
- the detergent may be added to a final concentration of about 0.1% to about 1.0%. For example, the concentration may be about 0.1%, about 0.2%, about 0.3%, about 0.5%, about 0.7%, about 0.8%, or about 1.0 %. The range may be about 0.1% to about 0.3%. In aspects, the concentration is about 0.5%.
- first detergents may be used to isolate the protein from the host cell.
- the first detergent may be Bis(polyethylene glycol bis[imidazoylcarbonyl]), nonoxynol-9, Bis(polyethylene glycol bis[imidazoyl carbonyl]), BRIJ® Polyethylene glycol dodecyl ether 35, BRU® Polyethylene glycol (3) cetyl ether 56, BRU® alcohol ethoxylate 72, BRU® Polyoxyl 2 stearyl ether 76, BRU® polyethylene glycol monoolelyl ether 92V, BRIJ® Polyoxyethylene (10) oleyl ether 97, BRIJ® Polyethylene glycol hexadecyl ether 58P, CREMOPHOR® EL Macrogol glycerol ricinoleate, Decaethyleneglycol monododecyl ether, N-Decanoyl-N-methylglucamine, n-Decyl
- the nanoparticles may then be isolated from cellular debris using centrifugation.
- centrifugation such as using cesium chloride, sucrose and iodixanol, may be used.
- Other techniques may be used as alternatives or in addition, such as standard purification techniques including, e.g., ion exchange, affinity, and gel filtration chromatography.
- the first column may be an ion exchange chromatography resin, such as FRACTOGEL® EMD methacrylate based polymeric beads TMAE (EMD Millipore)
- the second column may be a lentil (Lens culinaris) lectin affinity resin
- the third column may be a cation exchange column such as a FRACTOGEL® EMD methacrylate based polymeric beads SO3 (EMD Millipore) resin.
- the cation exchange column may be an MMC column or a Nuvia C Prime column (Bio-Rad Laboratories, Inc).
- the methods disclosed herein do not use a detergent extraction column; for example a hydrophobic interaction column. Such a column is often used to remove detergents during purification but may negatively impact the methods disclosed here.
- the first detergent, used to extract the protein from the host cell is substantially replaced with a second detergent to arrive at the nanoparticle structure.
- NP-9 is a preferred extraction detergent.
- the nanoparticles do not contain detectable NP-9 when measured by HPLC.
- the second detergent is typically selected from the group consisting of PS20, PS40, PS60, PS65, and PS80.
- the second detergent is PS80.
- detergent exchange is performed using affinity chromatography to bind glycoproteins via their carbohydrate moiety.
- the affinity chromatography may use a legume lectin column.
- Legume lectins are proteins originally identified in plants and found to interact specifically and reversibly with carbohydrate residues. See, for example, Sharon and Lis, “Legume lectins— a large family of homologous proteins,” FASEB J. 1990 Nov;4(14):3198-208; Liener, “The Lectins: Properties, Functions, and Applications in Biology and Medicine,” Elsevier, 2012.
- Suitable lectins include concanavalin A (con A), pea lectin, sainfoin lect, and lentil lectin.
- Lentil lectin is a preferred column for detergent exchange due to its binding properties.
- Lectin columns are commercially available; for example, Capto Lentil Lectin, is available from GE Healthcare.
- the lentil lectin column may use a recombinant lectin.
- the carbohydrate moieties bind to the lentil lectin, freeing the amino acids of the protein to coalesce around the detergent resulting in the formation of a detergent core providing nanoparticles having multiple copies of the antigen, e.g., glycoprotein oligomers which can be dimers, trimers, or tetramers anchored in the detergent.
- the CoV S polypeptides form trimers.
- the CoV S polypeptide trimers are anchored in detergent.
- each CoV S polypeptide nanoparticle contains at least one trimer associated with a non-ionic core.
- the detergent when incubated with the protein to form the nanoparticles during detergent exchange, may be present at up to about 0.1% (w/v) during early purifications steps and this amount is lowered to achieve the final nanoparticles having optimum stability.
- the non-ionic detergent may be about 0.005% (v/v) to about 0.1% (v/v), for example, about 0.005 % (v/v), about 0.006 % (v/v), about 0.007 % (v/v), about 0.008 % (v/v), about 0.009 % (v/v), about 0.01 % (v/v), about 0.015 % (v/v), about 0.02 % (v/v), about 0.025 % (v/v), about 0.03 % (v/v), about 0.035 % (v/v), about 0.04 % (v/v), about 0.045 % (v/v), about 0.05 % (v/v), about 0.055 % (v/v), about 0.06 % (v/v), about 0.065 % (v/v), about 0.07 % (v/v), about 0.075 % (v/v), about 0.08 % (v/v), about 0.05% (v/v) to about 0.1%
- purified CoV S polypeptides are dialyzed. In embodiments, dialysis occurs after purification. In embodiments, the CoV S polypeptides are dialyzed in a solution comprising sodium phosphate, NaCl, and PS80.
- the dialysis solution comprising sodium phosphate contains between about 5 mM and about 100 mM of sodium phosphate, for example, about 5 mM, about 10 mM, about 15 mM, about 20 mM, about 25 mM, about 30 mM, about 35 mM, about 40 mM, about 45 mM, about 50 mM, about 55 mM, about 60 mM, about 65 mM, about 70 mM, about 75 mM, about 80 mM, about 85 mM, about 90 mM, about 95 mM, or about 100 mM sodium phosphate.
- the pH of the solution comprising sodium phosphate is about 6.5, about 6.6, about 6.7, about 6.8, about 6.9, about 7.0, about 7.1, about 7.2, about 7.3, about 7.4, or about 7.5.
- the dialysis solution comprising sodium chloride comprises about 50 mM NaCl to about 500 mM NaCl, for example, about 50 mM, about 60 mM, about 70 mM, about 80 mM, about 90 mM, about 100 mM, about 110 mM, about 120 mM, about 130 mM, about 140 mM, about 150 mM, about 160 mM, about 170 mM, about 180 mM, about 190 mM, about 200 mM, about 210 mM, about 220 mM, about 230 mM, about 240 mM, about 250 mM, about 260 mM, about 270 mM, about 280 mM, about 290 mM,
- the dialysis solution comprising PS80 comprises about 0.005 % (v/v), about 0.006 % (v/v), about 0.007 % (v/v), about 0.008 % (v/v), about 0.009 % (v/v), about 0.01 % (v/v), about 0.015 % (v/v), about 0.02 % (v/v), about 0.025 % (v/v), about 0.03 % (v/v), about 0.035 % (v/v), about 0.04 % (v/v), about 0.045 % (v/v), about 0.05 % (v/v), about 0.055 % (v/v), about 0.06 % (v/v), about 0.065 % (v/v), about 0.07 % (v/v), about 0.075 % (v/v), about 0.08 % (v/v), about 0.085 % (v/v), about 0.09 % (v/v), about 0.095 % (v/v),
- Detergent exchange may be performed with proteins purified as discussed above and purified, frozen for storage, and then thawed for detergent exchange.
- Stability of compositions disclosed herein may be measured in a variety of ways.
- a peptide map may be prepared to determine the integrity of the antigen protein after various treatments designed to stress the nanoparticles by mimicking harsh storage conditions.
- a measure of stability is the relative abundance of antigen peptides in a stressed sample compared to a control sample.
- the stability of nanoparticles containing the CoV S polypeptides may be evaluated by exposing the nanoparticles to various pHs, proteases, salt, oxidizing agents, including but not limited to hydrogen peroxide, various temperatures, freeze/thaw cycles, and agitation. Figs.
- BV2373 SEQ ID NO: 87
- BV2365 SEQ ID NO: 4
- the position of the glycoprotein anchored into the detergent core provides enhanced stability by reducing undesirable interactions.
- the improved protection against protease-based degradation may be achieved through a shielding effect whereby anchoring the glycoproteins into the core at the molar ratios disclosed herein results in steric hindrance blocking protease access. Stability may also be measured by monitoring intact proteins.
- Fig. 33 and Fig. 34 compare nanoparticles containing CoV polypeptides having amino acid sequences of SEQ ID NOS: 109 and 87, respectively. Fig.
- CoV polypeptides having an amino acid sequence of SEQ ID NO: 87 show particularly good stability during purification.
- the polypeptide of Fig. 34 comprises a furin cleavage site having an amino acid sequence of QQAQ (SEQ ID NO: 7).
- the disclosure provides vaccine compositions comprising CoV S polypeptides, for example, in a nanoparticle.
- the vaccine composition may contain nanoparticles with antigens from more than one viral strain from the same species of virus.
- the disclosures provide for a pharmaceutical pack or kit comprising one or more containers filled with one or more of the components of the vaccine compositions.
- Compositions disclosed herein may be used either prophylactically or therapeutically, but will typically be prophylactic. Accordingly, the disclosure includes methods for treating or preventing infection. The methods involve administering to the subject a therapeutic or prophylactic amount of the immunogenic compositions of the disclosure.
- the pharmaceutical composition is a vaccine composition that provides a protective effect.
- the protective effect may include amelioration of a symptom associated with infection in a percentage of the exposed population.
- the composition may prevent or reduce one or more virus disease symptoms selected from: fever fatigue, muscle pain, headache, sore throat, vomiting, diarrhea, rash, symptoms of impaired kidney and liver function, internal bleeding and external bleeding, compared to an untreated subject.
- the nanoparticles may be formulated for administration as vaccines in the presence of various excipients, buffers, and the like.
- the vaccine compositions may contain sodium phosphate, sodium chloride, and/or histidine.
- Sodium phosphate may be present at about 10 mM to about 50 mM, about 15 mM to about 25 mM, or about 25 mM; in particular cases, about 22 mM sodium phosphate is present.
- Histidine may be present about 0.1% (w/v), about 0.5% (w/v), about 0.7% (w/v), about 1% (w/v), about 1.5% (w/v), about 2% (w/v), or about 2.5% (w/v).
- Sodium chloride when present, may be about 150 mM. In certain compositions, the sodium chloride may be present in higher concentrations, for example from about 200 mM to about 500 mM. In embodiments, the sodium chloride is present in a high concentration, including but not limited to about 200 mM, about 250 mM, about 300 mM, about 350 mM, about 400 mM, about 450 mM, or about 500 mM.
- the nanoparticles described herein have improved stability at certain pH levels.
- the nanoparticles are stable at slightly acidic pH levels.
- the nanoparticles that are stable at a slightly acidic pH for example from pH 5.8 to pH 7.0.
- the nanoparticles and compositions containing nanoparticles may be stable at pHs ranging from about pH 5.8 to about pH 7.0, including about pH 5.9 to about pH 6.8, about pH 6.0 to about pH 6.5, about pH 6.1 to about pH 6.4, about pH 6.1 to about pH 6.3, or about pH 6.2.
- the nanoparticles and compositions described herein are stabile at neutral pHs, including from about pH 7.0 to about pH 7.4.
- the nanoparticles and compositions described herein are stable at slightly alkaline pHs, for example from about pH 7.0 to about pH 8.5, from about pH 7.0 to about pH 8.0, or from about pH 7.0 to about pH 7.5, including all values and ranges in between.
- compositions disclosed herein may be combined with one or more adjuvants to enhance an immune response.
- the compositions are prepared without adjuvants, and are thus available to be administered as adjuvant-free compositions.
- adjuvant-free compositions disclosed herein may provide protective immune responses when administered as a single dose. Alum-free compositions that induce robust immune responses are especially useful in adults about 60 and older.
- the adjuvant may be alum (e.g. AIPO4 or Al(0H)3).
- the nanoparticle is substantially bound to the alum.
- the nanoparticle may be at least 80% bound, at least 85% bound, at least 90% bound or at least 95% bound to the alum.
- the nanoparticle is 92% to 97% bound to the alum in a composition.
- the amount of alum is present per dose is typically in a range between about 400 pg to about 1250 pg.
- the alum may be present in a per dose amount of about 300 pg to about 900 pg, about 400 pg to about 800 pg, about 500 pg to about 700 pg, about 400 pg to about 600 pg, or about 400 pg to about 500 pg.
- the alum is present at about 400 pg for a dose of 120 pg of the protein nanoparticle.
- Adjuvants containing saponin may also be combined with the immunogens disclosed herein.
- Saponins are glycosides derived from the bark of the Quillaja saponaria Molina tree. Typically, saponin is prepared using a multi-step purification process resulting in multiple fractions.
- a saponin fraction from Quillaja saponaria Molina is used generically to describe a semi-purified or defined saponin fraction of Quillaja saponaria or a substantially pure fraction thereof.
- Fractions A, B, and C are described in U.S. Pat. No. 6,352,697 and may be prepared as follows.
- a lipophilic fraction from Quil A a crude aqueous Quillaja saponaria Molina extract, is separated by chromatography and eluted with 70% acetonitrile in water to recover the lipophilic fraction.
- This lipophilic fraction is then separated by semi-preparative HPLC with elution using a gradient of from 25% to 60% acetonitrile in acidic water.
- Fraction A The fraction referred to herein as “Fraction A” or “QH-A” is, or corresponds to, the fraction, which is eluted at approximately 39% acetonitrile.
- Fraction B The fraction referred to herein as “Fraction B” or “QH-B” is, or corresponds to, the fraction, which is eluted at approximately 47% acetonitrile.
- Fraction C The fraction referred to herein as “Fraction C” or “QH-C” is, or corresponds to, the fraction, which is eluted at approximately 49% acetonitrile. Additional information regarding purification of Fractions is found in U.S Pat. No. 5,057,540.
- Fractions A, B and C of Quillaja saponaria Molina each represent groups or families of chemically closely related molecules with definable properties.
- the chromatographic conditions under which they are obtained are such that the batch-to-batch reproducibility in terms of elution profile and biological activity is highly consistent.
- Fractions B3, B4 and B4b are described in EP 0436620.
- Fractions QA1-QA22 are described EP03632279 B2, Q-VAC (NorFeed, AS Denmark), Quillaja saponaria Molina Spikoside (Isconova AB, Ultunaallen 2B, 756 51 Uppsala, Sweden).
- the saponin fractions described herein and used for forming adjuvants are often substantially pure fractions; that is, the fractions are substantially free of the presence of contamination from other materials.
- a substantially pure saponin fraction may contain up to 40% by weight, up to 30% by weight, up to 25% by weight, up to 20% by weight, up to 15% by weight, up to 10% by weight, up to 7% by weight, up to 5% by weight, up to 2% by weight, up to 1% by weight, up to 0.5% by weight, or up to 0.1% by weight of other compounds such as other saponins or other adjuvant materials.
- Saponin fractions may be administered in the form of a cage-like particle referred to as an ISCOM (Immune Stimulating COMplex).
- ISCOMs may be prepared as described in EP0109942B1, EP0242380B1 and EP0180546 Bl.
- a transport and/or a passenger antigen may be used, as described in EP 9600647-3 (PCT/SE97/00289).
- the ISCOM is an ISCOM matrix complex.
- An ISCOM matrix complex comprises at least one saponin fraction and a lipid.
- the lipid is at least a sterol, such as cholesterol.
- the ISCOM matrix complex also contains a phospholipid.
- the ISCOM matrix complexes may also contain one or more other immunomodulatory (adjuvant-active) substances, not necessarily a glycoside, and may be produced as described in EP0436620B1, which is incorporated by reference in its entirety herein.
- the ISCOM is an ISCOM complex.
- An ISCOM complex contains at least one saponin, at least one lipid, and at least one kind of antigen or epitope.
- the ISCOM complex contains antigen associated by detergent treatment such that that a portion of the antigen integrates into the particle.
- ISCOM matrix is formulated as an admixture with antigen and the association between ISCOM matrix particles and antigen is mediated by electrostatic and/or hydrophobic interactions.
- the saponin fraction integrated into an ISCOM matrix complex or an ISCOM complex, or at least one additional adjuvant, which also is integrated into the ISCOM or ISCOM matrix complex or mixed therewith is selected from fraction A, fraction B, or fraction C of Quillaja saponaria, a semipurified preparation of Quillaja saponaria, a purified preparation of Quillaja saponaria, or any purified sub-fraction e.g., QA 1- 21.
- each ISCOM particle may contain at least two saponin fractions. Any combinations of weight % of different saponin fractions may be used. Any combination of weight % of any two fractions may be used.
- the particle may contain any weight % of fraction A and any weight % of another saponin fraction, such as a crude saponin fraction or fraction C, respectively.
- each ISCOM matrix particle or each ISCOM complex particle may contain from 0.1 to 99.9 by weight, 5 to 95% by weight, 10 to 90% by weight 15 to 85% by weight, 20 to 80% by weight, 25 to 75% by weight, 30 to 70% by weight, 35 to 65% by weight, 40 to 60% by weight, 45 to 55% by weight, 40 to 60% by weight, or 50% by weight of one saponin fraction, e.g. fraction A and the rest up to 100% in each case of another saponin e.g. any crude fraction or any other faction e.g. fraction C.
- the weight is calculated as the total weight of the saponin fractions.
- Examples of ISCOM matrix complex and ISCOM complex adjuvants are disclosed in U.S Published Application No. 2013/0129770, which is incorporated by reference in its entirety herein.
- the ISCOM matrix or ISCOM complex comprises from 5-99% by weight of one fraction, e.g. fraction A and the rest up to 100% of weight of another fraction e.g. a crude saponin fraction or fraction C. The weight is calculated as the total weight of the saponin fractions.
- the ISCOM matrix or ISCOM complex comprises from 40% to 99% by weight of one fraction, e.g. fraction A and from 1% to 60% by weight of another fraction, e.g. a crude saponin fraction or fraction C. The weight is calculated as the total weight of the saponin fractions.
- the ISCOM matrix or ISCOM complex comprises from 70% to 95% by weight of one fraction e.g., fraction A, and from 30% to 5% by weight of another fraction, e.g., a crude saponin fraction, or fraction C. The weight is calculated as the total weight of the saponin fractions.
- the saponin fraction from Quillaja saponaria Molina is selected from any one of QA 1-21.
- ISCOM matrix particles and ISCOM complex particles may each be formed using only one saponin fraction.
- Compositions disclosed herein may contain multiple particles wherein each particle contains only one saponin fraction. That is, certain compositions may contain one or more different types of ISCOM-matrix complexes particles and/or one or more different types of ISCOM complexes particles, where each individual particle contains one saponin fraction from Quillaja saponaria Molina, wherein the saponin fraction in one complex is different from the saponin fraction in the other complex particles.
- one type of saponin fraction or a crude saponin fraction may be integrated into one ISCOM matrix complex or particle and another type of substantially pure saponin fraction, or a crude saponin fraction, may be integrated into another ISCOM matrix complex or particle.
- a composition or vaccine may comprise at least two types of complexes or particles each type having one type of saponins integrated into physically different particles.
- mixtures of ISCOM matrix complex particles and/or ISCOM complex particles may be used in which one saponin fraction Quillaja saponaria Molina and another saponin fraction Quillaja saponaria Molina are separately incorporated into different ISCOM matrix complex particles and/or ISCOM complex particles.
- the ISCOM matrix or ISCOM complex particles which each have one saponin fraction, may be present in composition at any combination of weight %.
- a composition may contain 0.1% to 99.9% by weight, 5% to 95% by weight, 10% to 90% by weight, 15% to 85% by weight, 20% to 80% by weight, 25% to 75% by weight, 30% to 70% by weight, 35% to 65% by weight, 40% to 60% by weight, 45% to 55% by weight, 40 to 60% by weight, or 50% by weight, of an ISCOM matrix or complex containing a first saponin fraction with the remaining portion made up by an ISCOM matrix or complex containing a different saponin fraction.
- the remaining portion is one or more ISCOM matrix or complexes where each matrix or complex particle contains only one saponin fraction.
- the ISCOM matrix or complex particles may contain more than one saponin fraction.
- the only saponin fraction in a first ISCOM matrix or ISCOM complex particle is Fraction A and the only saponin fraction in a second ISCOM matrix or ISCOM complex particle is Fraction C.
- the Fraction A of Quillaja Saponaria Molina accounts for at least about 80 %, 81 %, 82 %, 83 %, 84 %, 85 %, 86 %, 87 %, 88 %, 89 %, 90 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 %, or 99 % by weight
- fraction C of Quillaja Saponaria Molina accounts for the remainder, respectively, of the sum of the weights of fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina in the adjuvant.
- compositions comprise a first ISCOM matrix containing Fraction A and a second ISCOM matrix containing Fraction C, wherein the Fraction A ISCOM matrix constitutes about 70% per weight of the total saponin adjuvant, and the Fraction C ISCOM matrix constitutes about 30% per weight of the total saponin adjuvant.
- the Fraction A ISCOM matrix constitutes about 85% per weight of the total saponin adjuvant
- the Fraction C ISCOM matrix constitutes about 15% per weight of the total saponin adjuvant.
- the Fraction A ISCOM matrix constitutes about 92% per weight of the total saponin adjuvant
- the Fraction C ISCOM matrix constitutes about 8% per weight of the total saponin adjuvant.
- the Fraction A ISCOM matrix is present in a range of about 70% to about 85%, and Fraction C ISCOM matrix is present in a range of about 15% to about 30%, of the total weight amount of saponin adjuvant in the composition.
- the Fraction A ISCOM matrix is present in a range of about 70% to about 92%, and Fraction C ISCOM matrix is present in a range of about 8% to about 30%, of the total weight amount of saponin adjuvant in the composition.
- the Fraction A ISCOM matrix accounts for SO- 96 % by weight and Fraction C ISCOM matrix accounts for the remainder, respectively, of the sums of the weights of Fraction A ISCOM matrix and Fraction C ISCOM in the adjuvant.
- MATRIX-MTM In a particularly preferred composition, referred to herein as MATRIX-MTM, the Fraction A ISCOM matrix is present at about 85 % and Fraction C ISCOM matrix is present at about 15% of the total weight amount of saponin adjuvant in the composition.
- MATRIX-MTM may be referred to interchangeably as Matrix-Mi.
- adjuvants include complete Freund's adjuvant (a non-specific stimulator of the immune response containing killed Mycobacterium tuberculosis), incomplete Freund's adjuvants and aluminum hydroxide adjuvant.
- Other adjuvants comprise GMCSP, BCG, MDP compounds, such as thur-MDP and nor-MDP, CGP (MTP-PE), lipid A, and monophosphoryl lipid A (MPL), MF-59, RIB I, which contains three components extracted from bacteria, MPL, trehalose dimycolate (TDM) and cell wall skeleton (CWS) in a 2% squalene/TWEEN® polysorbate 80 emulsion.
- MDP compounds such as thur-MDP and nor-MDP
- CGP CGP
- MPL monophosphoryl lipid A
- RIB I which contains three components extracted from bacteria, MPL, trehalose dimycolate (TDM) and cell wall skeleton (CWS) in a
- the adjuvant may be a paucilamellar lipid vesicle; for example, NOVASOMES®.
- NOVASOMES® are paucilamellar nonphospholipid vesicles ranging from about 100 nm to about 500 nm. They comprise BRIJ® alcohol ethoxylate 72, cholesterol, oleic acid and squalene.
- NOVASOMES® have been shown to be an effective adjuvant (see, U.S. Pat. Nos. 5,629,021, 6,387,373, and 4,911,928.
- the disclosure provides a method for eliciting an immune response against one or more coronaviruses.
- the response is against one or more of the SARS-CoV-2 virus, MERS, and SARS.
- the response is against a heterogeneous SARS-CoV-2 strain.
- the heterogeneous SARS-CoV-2 strain has a World Health Organization Label of alpha, beta, gamma, delta, epsilon, eta, iota, kappa, zeta, mu, or omicron.
- the heterogeneous SARS-CoV-2 strain has a PANGO lineage selected from the group consisting of B.1.1.529; BA.l, BA.1.1, BA.2, BA.3, BA.4, BA.5, B.1.1.7, B.1.351, P. l, B.1.617.2, AY, B.1.427, B.1.429, B.1.525, B.1.526, B.1.617.1, B.1.617.3, P.2, B.1.621, or B.1.621.1.
- the method involves administering an immunologically effective amount of a composition containing a nanoparticle or containing a recombinant CoV Spike (S) polypeptide to a subject.
- the proteins disclosed herein induce one or more of particularly useful anti-coronavirus responses.
- the nanoparticles or CoV S polypeptides are administered with an adjuvant.
- the nanoparticles or CoV S polypeptides are administered without an adjuvant.
- the adjuvant may be bound to the nanoparticle, such as by a non-covalent interaction.
- the adjuvant is co-administered with the nanoparticle but the adjuvant and nanoparticle do not interact substantially.
- the nanoparticles or CoV S polypeptides may be used for the prevention and/or treatment of one or more of a SARS-CoV-2 infection, a heterogeneous SARS-CoV-2 strain infection, a SARS infection, or a MERS infection.
- the disclosure provides a method for eliciting an immune response against one or more of the SARS-CoV-2 virus, heterogeneous SARS-CoV-2 virus, MERS, and SARS.
- the method involves administering an immunologically effective amount of a composition containing a nanoparticle or a CoV S polypeptide to a subject.
- the proteins disclosed herein induce particularly useful anti-coronavirus responses.
- the nanoparticles or CoV S polypeptides described herein have an efficacy against a SARS-CoV-2 virus or a heterogeneous SARS-CoV-2 strain that is between about 50 % and about 99 %, between about 80 % and about 99 %, between about 75 % and about 99 %, between about 80 % and about 95 %, between about 90 % and about 98 %, between about 75 % and about 95 %, at least about 50 %, at least about 55 %, at least about 60 %, at least about 65 %, at least about 70 %, at least about 75 %, at least about 80 %, at least about 85 %, at least about 90 %, at least about 91 %, at least about 92 %, at least about 93 %, at least about 94 %, at least about 95 %, at least about 96 %, at least about 97 %, at least about 98 %, or at least about 99 %
- compositions disclosed herein may be administered via a systemic route or a mucosal route or a transdermal route or directly into a specific tissue.
- systemic administration includes parenteral routes of administration.
- parenteral administration includes subcutaneous, intraperitoneal, intravenous, intraarterial, intramuscular, or intrasternal injection, intravenous, or kidney dialytic infusion techniques.
- the systemic, parenteral administration is intramuscular injection.
- the term “mucosal administration” includes oral, intranasal, intravaginal, intra-rectal, intra-tracheal, intestinal and ophthalmic administration.
- administration is intramuscular.
- compositions may be administered on a single dose schedule or a multiple dose schedule. Multiple doses may be used in a primary immunization schedule or in a booster immunization schedule. In embodiments, about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 doses are administered. In a multiple dose schedule the various doses may be given by the same or different routes e.g., a parenteral prime and mucosal boost, a mucosal prime and parenteral boost, etc.
- a boost dose is administered about 2 weeks, about 3 weeks, about 4 weeks, about 5 weeks, about 6 weeks, about 2 months, about 3 months, about 4 months, about 5 months, about 6 months, about 7 months, about 8 months, about 9 months, about 10 months, about 11 months, about 12 months (1 year), about 2 years, about 3 years, about 4 years, about 5 years, about 6 years, about 7 years, about 8 years, about 9 years, or about 10 years after the first dose.
- a boost dose is administered every year after administration of the initial dose.
- the follow-on boost dose is administered 3 weeks or 4 weeks after administration of the prior dose.
- the first dose is administered at day 0, and the boost dose is administered at day 21.
- the first dose is administered at day 0, and the boost dose is administered at day 28.
- the first dose is administered at day 0, a boost dose is administered at day 21, and a second boost dose is administered about six months after administration of the first dose or second dose.
- the first dose is administered at day 0, and the boost dose is administered at day 28, and a second boost dose is administered about six months after administration of the first dose.
- the first dose is administered at day 0, a boost dose is administered at day 21, and a second boost dose is administered about six months after administration of the second dose.
- the first dose is administered at day 0, and the boost dose is administered at day 28, and a second boost dose is administered about six months after administration of the second dose.
- the first dose is administered at day 0, a boost dose is administered at day 21, and a second boost dose is administered about 1 year after administration of the first dose or the first boost dose.
- the first dose is administered at day 0, a first boost dose is administered at day 28, and a second boost dose is administered about 1 year after administration of the first dose.
- the first dose is administered at day 0, a boost dose is administered at day 21, and a second boost dose is administered about 1 year after administration of the second dose.
- the first dose is administered at day 0, a first boost dose is administered at day 28, and a second boost dose is administered about 1 year after administration of the second dose.
- the second boost dose is administered from 6 months to 24 months or from 12 to 24 months after the first boost dose.
- the boost dose comprises the same immunological composition as the initial dose.
- the boost dose comprises a different immunological composition than the initial dose.
- the different immunological composition is a SARS-CoV-2 Spike glycoprotein, an mRNA encoding a SARS-Cov-2 Spike glycoprotein, a plasmid DNA encoding a SARS-Cov-2 Spike glycoprotein, an viral vector encoding a SARS-Cov-2 Spike glycoprotein, or an inactivated SARS-CoV-2 virus.
- the boost dose comprises the initial composition.
- the initial dose comprises a SARS-CoV-2 S glycoprotein (e.g., a SARS CoV-2 S glycoprotein having the amino acid sequence of SEQ ID NO: 87), and the boost dose comprises the same SARS-CoV- 2 S glycoprotein (e.g., a SARS CoV-2 S glycoprotein having the amino acid sequence of SEQ ID NO: 87).
- the initial dose comprises a SARS-CoV-2 S glycoprotein (e.g., a SARS CoV-2 S glycoprotein having the amino acid sequence of SEQ ID NO: 87), and the boost dose comprises a different SARS-CoV-2 S glycoprotein (e.g., a SARS CoV-2 S glycoprotein having the amino acid sequence of SEQ ID NO: 132).
- the initial dose comprises a combination of SARS-CoV-2 S glycoproteins (e.g., a SARS CoV-2 S glycoprotein having the amino acid sequence of SEQ ID NO: 87 and a SARS CoV-2 S glycoprotein having the amino acid sequence of SEQ ID NO: 132).
- the boost dose comprises a combination of SARS-CoV-2 S glycoproteins (e.g., a SARS CoV-2 S glycoprotein having the amino acid sequence of SEQ ID NO: 87 and a SARS CoV-2 S glycoprotein having the amino acid sequence of SEQ ID NO: 132).
- the initial dose comprises a SARS-CoV-2 S glycoprotein, a plasmid DNA encoding a SARS-Cov-2 S glycoprotein, an viral vector encoding a SARS-CoV-2 Spike glycoprotein, or an inactivated SARS-CoV-2 virus.
- the initial dose comprises a SARS-CoV-2 Spike glycoprotein, a plasmid DNA encoding a SARS-CoV-2 Spike glycoprotein, an viral vector encoding a SARS-Cov-2 Spike glycoprotein, or an inactivated SARS-CoV-2 virus
- the boost dose comprises one or more SARS-CoV-2 S glycoproteins.
- the dose as measured in pg, may be the total weight of the dose including the solute, or the weight of the CoV S polypeptide nanoparticles, or the weight of the CoV S polypeptide. Dose is measured using protein concentration assay either A280 or ELISA.
- the dose of antigen may be in the range of about 5 pg to about 25 pg, about 1 pg to about 300 pg, about 90 pg to about 270 pg, about 100 pg to about 160 pg, about 110 pg to about 150 pg, about 120 pg to about 140 pg, or about 140 pg to about 160 pg.
- the dose is about 120 pg, administered with alum.
- a pediatric dose may be in the range of about 1 pg to about 90 pg.
- the dose of CoV Spike (S) polypeptide is about 1 pg, about 2 pg, about 3 pg, about 4 pg, about 5 pg, about 6 pg, about 7 pg, about 8 pg, about 9 pg, about 10 pg, about 11 pg, about 12 pg, about 13 pg, about 14 pg, about 15 pg, about 16 pg, about 17 pg, about 18 pg, about 19 pg, about 20 pg, about 21, about 22, about 23, about 24, about 25 pg, about 26 pg, about 27 pg, about 28 pg, about 29 pg, about 30 pg, about 40 pg, about 50, about 60, about 70, about 80 , about 90 about 100 pg, about 110 pg, about 120 pg , about 130 pg, about 140 pg, about 150 pg, about 160 pg, about 170 pg, about 180
- the dose of CoV S polypeptide is 5 pg. In embodiments, the dose of CoV S polypeptide is 25 pg. In embodiments, the dose of a CoV S polypeptide is the same for the initial dose and for boost doses. In embodiments, the dose of a CoV S polypeptide is the different for the initial dose and for boost doses.
- compositions may be free of added adjuvant. In such circumstances, the dose may be increased by about 10%.
- the immunogenic compositions described herein are provided in pre-filled syringes.
- the immunogenic composition is prepared in a pre-filled syringe, the CoV S polypeptides and adjuvant are combined in advance of administration.
- the dose of the adjuvant administered with a non-naturally occurring CoV S polypeptide is from about 1 pg to about 100 pg, for example, about 1 pg, about 2 pg, about 3 pg, about 4 pg, about 5 pg, about 6 pg, about 7 pg, about 8 pg, about 9 pg, about 10 pg, about 11 pg, about 12 pg, about 13 pg, about 14 pg, about 15 pg, about 16 pg, about 17 pg, about 18 pg, about 19 pg, about 20 pg, about 21, about 22, about 23, about 24, about 25 pg, about 26 pg, about 27 pg, about 28 pg, about 29 pg, about 30 pg, about 31 pg, about 32 pg, about 33 pg, about 34 pg, about 35 pg, about 36 pg, about 37 pg, about 38
- the dose is administered in a volume of about 0.1 mL to about 1.5 mL, for example, about 0.1 mL, about 0.2 mL, about 0.25 mL, about 0.3 mL, about 0.4 mL, about 0.5 mL, about 0.6 mL, about 0.7 mL, about 0.8 mL, about 0.9 mL, about 1.0 mL, about 1.1 mL, about 1.2 mL, about 1.3 mL, about 1.4 mL, or about 1.5 mL.
- the dose is administered in a volume of 0.25 mL.
- the dose is administered in a volume of 0.5 mL.
- the dose is administered in a volume of 0.6 mL.
- the dose may comprise a CoV S polypeptide concentration of about 1 pg/mL to about 50 pg/mL, 10 pg/mL to about 100 pg/mL, about 10 pg/mL to about 50 pg/mL, about 175 pg/mL to about 325 pg/mL, about 200 pg/mL to about 300 pg/mL, about 220 pg/mL to about 280 pg/mL, or about 240 pg/mL to about 260 pg/mL.
- the disclosure provides a method of formulating a vaccine composition that induces immunity to an infection or at least one disease symptom thereof to a mammal, comprising adding to the composition an effective dose of a nanoparticle or a CoV S polypeptide.
- the disclosed CoV S polypeptides and nanoparticles are useful for preparing compositions that stimulate an immune response that confers immunity or substantial immunity to infectious agents.
- the disclosure provides a method of inducing immunity to infections or at least one disease symptom thereof in a subject, comprising administering at least one effective dose of a nanoparticle and/or a CoV S polypeptide.
- the CoV S polypeptides or nanoparticles comprising the same are administered in combination with an additional immunogenic composition.
- the additional immunogenic composition induces an immune response against SARS-CoV-2.
- the additional immunogenic composition is administered within about 1 minute, about 5 minutes, about 10 minutes, about 20 minutes, about 30 minutes, about 40 minutes, about 50 minutes, about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 11 hours, about 12 hours, about 13 hours, about 14 hours, about 15 hours, about 16 hours, about 17 hours, about 18 hours, about 19 hours, about 20 hours, about 21 hours, about 22 hours, about 23 hours, about 1 day, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 8 days, about 9 days, about 10 days, about 11 days, about 12 days, about 13 days, about 14 days, about 15 days, about 16 days, about 17 days, about 18 hours, about 19 hours,
- the additional composition is administered with a first dose of a composition comprising a CoV S polypeptide or nanoparticle comprising the same. In embodiments, the additional composition is administered with a boost dose of a composition comprising a CoV S polypeptide or nanoparticle comprising the same.
- the additional immunogenic composition comprises an mRNA encoding a SARS-Cov-2 Spike glycoprotein, a plasmid DNA encoding a SARS-Cov-2 Spike glycoprotein, an viral vector encoding a SARS-Cov-2 Spike glycoprotein, or an inactivated SARS-CoV-2 virus.
- the additional immunogenic composition comprises mRNA that encodes for a CoV S polypeptide.
- the mRNA encodes for a CoV S polypeptide comprising proline substitutions at positions 986 and 987 of SEQ ID NO: 1.
- the mRNA encodes for a CoV S polypeptide comprising an intact furin cleavage site.
- the mRNA encodes for a CoV S polypeptide comprising proline substitutions at positions 986 and 987 of SEQ ID NO: 1 and an intact furin cleavage site.
- the mRNA encodes for a CoV S polypeptide comprising proline substitutions at positions 986 and 987 of SEQ ID NO: 1 and an inactive furin cleavage site.
- the mRNA encodes for a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 87.
- the mRNA encoding for a CoV S polypeptide is encapsulated in a lipid nanoparticle.
- An exemplary immunogenic composition comprising mRNA that encodes for a CoV S polypeptide is described in Jackson et al. N. Eng. J. Med. 2020. An mRNA Vaccine against SARS-CoV-2- preliminary report, which is incorporated by reference in its entirety herein.
- the composition comprising mRNA that encodes for a CoV S polypeptide is administered at a dose of 25 pg, 100 pg, or 250 pg.
- the additional immunogenic composition comprises an adenovirus vector encoding for a CoV S polypeptide.
- the AAV vector encodes for a wild-type CoV S polypeptide.
- the AAV vector encodes for a CoV S polypeptide comprising proline substitutions at positions 986 and 987 of SEQ ID NO: 1 and an intact furin cleavage site.
- the AAV vector encodes for a CoV S polypeptide comprising proline substitutions at positions 986 and 987 of SEQ ID NO: 1 and an inactive furin cleavage site.
- the AAV vector encodes for a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 87.
- the additional immunogenic composition comprises deoxyribonucleic acid (DNA).
- the additional immunogenic composition comprises plasmid DNA.
- the plasmid DNA encodes for a CoV S polypeptide.
- the DNA encodes for a CoV S polypeptide comprising proline substitutions at positions 986 and 987 of SEQ ID NO: 1 and an intact furin cleavage site.
- the DNA encodes for a CoV S polypeptide comprising proline substitutions at positions 986 and 987 of SEQ ID NO: 1 and an inactive furin cleavage site.
- the DNA encodes for a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 87.
- the DNA encodes for a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 174 or SEQ ID NO: 175.
- the additional immunogenic composition comprises an inactivated virus vaccine.
- the CoV S polypeptides or nanoparticles comprising CoV S polypeptides are administered to a patient that has or has previously had a confirmed infection caused by SARS-CoV-2 or a heterogeneous SARS-CoV-2 strain.
- the infection with SARS- CoV-2 or a heterogeneous SARS-CoV-2 strain may be confirmed by a nucleic acid amplification test (e.g., polymerase chain reaction) or serological testing (e.g., testing for antibodies against a SARS-CoV-2 viral antigen).
- the CoV S polypeptides or nanoparticles comprising CoV S polypeptides are administered to a patient at least about 3 days, at least about 1 week, at least about 2 weeks, at least about 3 weeks, at least about 4 weeks after a patient has been diagnosed with COVID-19.
- the CoV S polypeptides or nanoparticles comprising CoV S polypeptides are administered to a patient between 1 week and 1 year after the patient’s diagnosis with COVID-19, for example, about 1 week, about 2 weeks, about 3 weeks, about 4 weeks, about 5 weeks, about 6 weeks, about 1 month, about 2 months, about 3 months, about 4 months, about 5 months, about 6 months, about 7 months, about 8 months, about 9 months, about 10 months, about 11 months, or about 1 year.
- the CoV S polypeptides or nanoparticles comprising CoV S polypeptides are administered to a patient between 1 week and 20 years after the patient’s diagnosis with COVID-19, for example, about 1 week, about 2 weeks, about 3 weeks, about 4 weeks, about 5 weeks, about 6 weeks, about 1 month, about 2 months, about 3 months, about 4 months, about
- the CoV S polypeptides or nanoparticles comprising the same are administered after the patient has been administered a first immunogenic composition.
- first immunogenic compositions include a SARS-CoV-2 Spike glycoprotein, an mRNA encoding a SARS-Cov-2 Spike glycoprotein, a plasmid DNA encoding a SARS-Cov-2 Spike glycoprotein, an viral vector encoding a SARS-Cov-2 Spike glycoprotein, or an inactivated SARS-CoV-2 virus.
- the CoV S polypeptides or nanoparticles comprising the same are administered between about 1 week and about 1 year, between about 1 week and 1 month, between about 3 weeks and 4 weeks, between about 1 week and 5 years, between about 1 year and about 5 years, between about 1 year and about 3 years, between about 3 years and about 5 years, between about 5 years and about 10 years, between about 1 year and about 10 years, or between about 1 year and about 2 years after administration of the first immunogenic composition.
- the CoV S polypeptides or nanoparticles comprising the same are administered between about 1 week and about 1 year after administration of the first immunogenic composition, for example, about 1 week, about 2 weeks, about 3 weeks, about 4 weeks, about 5 weeks, about 6 weeks, about 7 weeks, about 8 weeks, about 9 weeks, about 10 weeks, about 1 month, about 2 months, about 3 months, about 4 months, about 5 months, about 6 months, about 7 months, about 8 months, about 9 months, about 10 months, about 11 months, or about 1 year after administration of the first immunogenic composition.
- the CoV S proteins or nanoparticles comprising CoV S proteins are useful for preparing immunogenic compositions to stimulate an immune response that confers immunity or substantial immunity to one or more of MERS, SARS, SARS-CoV- 2, and a heterogeneous SARS-CoV-2 strain.
- Both mucosal and cellular immunity may contribute to immunity to infection and disease.
- Antibodies secreted locally in the upper respiratory tract are a maj or factor in resistance to natural infection.
- Secretory immunoglobulin A (slgA) is involved in protection of the upper respiratory tract and serum IgG in protection of the lower respiratory tract.
- the immune response induced by an infection protects against reinfection with the same virus or an antigenically similar viral strain.
- the antibodies produced in a host after immunization with the nanoparticles disclosed herein can also be administered to others, thereby providing passive administration in the subject.
- the CoV S proteins or nanoparticles comprising CoV S proteins induce cross-neutralizing antibodies against SARS-CoV-2 viruses containing S proteins with one or more modifications selected from: deletion of one or more amino acids selected from the group consisting of amino acid 11-14, 56, 57, 130, 131, 132, 144, 145, 198, 199, 228, 229, 230, 231, 234, 235, 236, 237, 238, 239, 240, 676-685, 676-702, 702-711, 775- 793, 806-815 and combinations thereof; (b) mutation of one or more amino acids selected from the group consisting of amino acid 5, 6, 7, 11, 12, 13, 14, 51, 53, 54, 56, 57, 62, 63, 67, 70, 82, 125, 129, 131, 132, 133, 134, 139, 143, 144, 145, 170, 177, 197, 198, 199, 200, 201, 202
- the CoV S proteins or nanoparticles comprising CoV S proteins induce cross-neutralizing antibodies against SARS-CoV-2 viruses containing S proteins with one or more modifications selected from: deletions of amino acid 56, deletion of amino acid 57, deletion of amino acid 131, N488Y, A557D, D601G, P668H, T703I, S969A, DI 105H, N426K, and Y440F, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S protein or nanoparticle comprising a CoV S protein induces cross-neutralizing antibodies against SARS-CoV-2 viruses containing S proteins with one or more modifications selected from: deletions of amino acid 56, deletion of amino acid 57, deletion of amino acid 131, N488Y, A557D, D601G, P668H, T703I, S969A, and D1105H, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2
- the CoV S protein or nanoparticle comprising a CoV S protein induces cross-neutralizing antibodies against SARS-CoV-2 viruses containing S proteins with one or more modifications selected from: D67A, D202G, L229H, K404N, E471K, N488Y, D601G, and A688V, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S protein or nanoparticle comprising a CoV S protein induces cross-neutralizing antibodies against SARS-CoV-2 viruses containing S proteins with one or more modifications selected from: deletion of amino acids 229-231, D67A, D202G, K404N, E471K, N488Y, D601G, and A688V, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S protein or nanoparticle comprising a CoV S protein induces cross-neutralizing antibodies against SARS-CoV-2 viruses containing S proteins with one or more modifications selected from: deletion of amino acids 229-231, L5F, D67A, D202G, K404N, E471K, N488Y, D601G, and A688V wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S protein or nanoparticle comprising a CoV S protein induces cross-neutralizing antibodies against SARS-CoV-2 viruses containing S proteins with one or more modifications selected from: L5F, T7N, P13S, D125Y, R177S, K404T, E471K, N488Y, D601G, H642Y, T1014I, and V1163F, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S protein or nanoparticle comprising a CoV S protein induces cross-neutralizing antibodies against SARS-CoV-2 viruses with an S protein comprising one or more modifications selected from: W139C and L439R, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S protein comprising W139C and L439R modifications is expressed with a signal peptide having an amino acid sequence of SEQ ID NO: 117 or SEQ ID NO: 5.
- the CoV S protein or nanoparticle comprising a CoV S protein induces cross-neutralizing antibodies against SARS-CoV-2 viruses with one or more modifications selected from: D601G, W139C, and L439R, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S protein or nanoparticle comprising D601G, W139C, and L439R modifications is expressed with a signal peptide having an amino acid sequence of SEQ ID NO: 117 or SEQ ID NO: 5.
- the CoV S protein or nanoparticle comprising a CoV S protein induces cross-neutralizing antibodies against SARS-CoV-2 viruses with one or more modifications selected from: D601G, L5F, D67A, D202G, deletions of amino acids 229-231, R233I, K404N, E471K, N488Y, and A688V, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the CoV S protein or nanoparticle comprising a CoV S protein induces crossneutralizing antibodies against SARS-CoV-2 viruses with one or more modifications selected from: L5F, D67A, D202G, deletions of amino acids 229-231, R233I, K404N, E471K, N488Y, and A688V, wherein the amino acids are numbered with respect to a CoV S polypeptide having an amino acid sequence of SEQ ID NO: 2.
- the present disclosure provides a method of producing one or more of high affinity anti-MERS-CoV, anti-SARS-CoV, and anti-SARS-CoV-2 virus antibodies.
- the high affinity antibodies produced by immunization with the nanoparticles disclosed herein are produced by administering an immunogenic composition comprising an S CoV polypeptide or a nanoparticle comprising an S CoV polypeptide to an animal, collecting the serum and/or plasma from the animal, and purifying the antibody from the serum/ and or plasma.
- the animal is a human.
- the animal is a chicken, mouse, guinea pig, rat, rabbit, goat, human, horse, sheep, or cow.
- the animal is bovine or equine.
- the bovine or equine animal is transgenic.
- the transgenic bovine or equine animal produces human antibodies.
- the animal produces monoclonal antibodies.
- the animal produces polyclonal antibodies.
- the method further comprises administration of an adjuvant or immune stimulating compound.
- the purified high affinity antibody is administered to a human subject.
- the human subject is at risk for infection with one or more of MERS, SARS, and SARS-CoV-2.
- the CoV S proteins or nanoparticles are co-administered with an influenza glycoprotein or nanoparticle comprising an influenza glycoprotein or a respiratory syncytial virus (RSV) fusion (F) glycoprotein.
- RSV respiratory syncytial virus
- the CoV S proteins or nanoparticles are co-formulated with RSV F glycoproteins, influenza glycoproteins, or a combination thereof. Suitable glycoproteins and nanoparticles are described in US Publication No. 2018/0133308 and US Publication No. 2019/0314487, each of which is incorporated by reference herein in its entirety.
- the CoV S protein or nanoparticle is coadministered with: (a) a detergent- core nanoparticle, wherein the detergent-core nanoparticle comprises a recombinant influenza hemagglutinin (HA) glycoprotein from a Type B influenza strain; and (b) a Hemagglutinin Saponin Matrix Nanoparticle (HaSMaN), wherein the HaSMaN comprises a recombinant influenza HA glycoprotein from a Type A influenza strain and ISCOM matrix adjuvant.
- HA hemagglutinin
- HaSMaN Hemagglutinin Saponin Matrix Nanoparticle
- the CoV S protein or nanoparticle is coadministered with a nanoparticle comprising a non-ionic detergent core and an influenza HA glycoprotein, wherein the influenza HA glycoprotein contains a head region that projects outward from the non-ionic detergent core and a transmembrane domain that is associated with the non-ionic detergent core, wherein the influenza HA glycoprotein is a HAO glycoprotein, wherein the amino acid sequence of the influenza HA glycoprotein has 100% identity to the amino acid sequence of the native influenza HA protein.
- the influenza glycoprotein or nanoparticle is coformulated with the CoV S protein or nanoparticle.
- the disclosure provides co-formulation (i.e., pre-filled syringes or pre-mix) strategies for immunogenic compositions comprising a CoV S glycoprotein and an adjuvant (e.g., a saponin adjuvant).
- Typical vaccine administration strategies currently being utilized are bedside mix formulations. That is, vaccine compositions and adjuvants are stored separately and are mixed prior to administration. Pre-mix, coformulation, or pre-filled syringe strategies for vaccine are less common due to the concerns of the stability of the antigens (e.g., a a CoV S glycoprotein) and their subsequent immunogenic capabilities.
- the present disclosure provides immunogenic compositions that can be pre-mixed and stored in advance.
- the disclosed vaccination strategies and formulations may improve the efficiency of vaccination and may reduce the risks of bedside mixing errors, while maintaining the overall safety and immunogenicity.
- a variety of containers may be used to store and transport the pre-mix formulations, including syringes for single administrations and plastic ampules.
- plastic ampules can be manufactured using the blow-fill-seal manufacturing technique or method.
- the blow-fill-seal (BFS) manufacturing method includes extruding a plastic material (e.g., resin) to form a parison, which is then placed into a mold and cut to size. A filling needle or mandrel is then used to inflate the plastic, which in turn, results in a hollow ampule that substantially conforms to the shape of the mold.
- BFS can be an automated process that can be performed in a sterile environment without direct human intervention.
- BFS technology has not been compatible with all pharmaceutical liquids, products, etc.
- some known BFS manufacturing methods include delivering the liquid or product into the ampule while the plastic is still relatively hot, which can result in adverse effects to temperature sensitive liquids and/or products such as vaccines, biologies, etc.
- Advances in cool BFS technology have increased the variety of suitable products, liquids, etc. allowing some vaccines, biologies, and/or other temperature sensitive pharmaceuticals to be contained in BFS ampules.
- a BFS ampule can have a size, shape, and/or configuration that is at least partially based on a desired use and/or a desired pharmaceutical liquid or dosage that the ampule is configured to contain.
- some known BFS ampules can include a pierce through top, a twist-off top, a top including a male or female luer, and/or the like.
- Some known BFS ampules can have a size and/or shape based on volume of the liquid or dosage configured to be disposed therein.
- some known BFS ampules can be manufactured in a strip of multiple, temporarily connected ampules, which can increase manufacturing, packaging, and/or storing efficiencies and/or the like.
- the immunogenic compositions described herein are provided in pre-filled syringes.
- an antigen and adjuvant is combined in advance of administration.
- the prefilled syringe contains a CoV S glycoprotein and an adjuvant (e.g., a saponin adjuvant).
- the pre-filled syringe contains a CoV S glycoprotein and a saponin adjuvant, wherein the adjuvant comprises at least two iscom particles, wherein the first iscom particle comprises fraction A of Quillaja Saponaria Molina and not fraction C of Quillaja Saponaria Molina; and the second iscom particle comprises fraction C of Quillaja Saponaria Molina and not fraction A of Quillaja Saponaria Molina; wherein fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina account for about 85 % by weight and about 15 % by weight, respectively, of the sum of weights of fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina in the adjuvant.
- the pre-filled syringe contains a CoV S glycoprotein and a saponin adjuvant, wherein the adjuvant comprises at least two iscom particles, wherein the first iscom particle comprises fraction A of Quillaja Saponaria Molina and not fraction C of Quillaja Saponaria Molina; and the second iscom particle comprises fraction C of Quillaja Saponaria Molina and not fraction A of Quillaja Saponaria Molina; wherein fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina account for about 92 % by weight and about 8 % by weight, respectively, of the sum of weights of fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina in the adjuvant.
- the adjuvant comprises at least two iscom particles, wherein the first iscom particle comprises fraction A of Quillaja Saponaria Molina and not fraction C of Quillaja Saponaria Molina; and the second iscom particle comprises fraction C of Qui
- the pre-filled syringe contains a CoV S glycoprotein and a saponin adjuvant, wherein the adjuvant comprises at least two iscom particles, wherein the first iscom particle comprises fraction A of Quillaja Saponaria Molina and not fraction C of Quillaja Saponaria Molina; and the second iscom particle comprises fraction C of Quillaja Saponaria Molina and not fraction A of Quillaja Saponaria Molina; wherein fraction A of Quillaja Saponaria Molina accounts for at least about 75 % by weight and fraction C of Quillaja Saponaria Molina accounts for the remainder of the sum of weights of fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina in the adjuvant.
- the adjuvant comprises at least two iscom particles, wherein the first iscom particle comprises fraction A of Quillaja Saponaria Molina and not fraction C of Quillaja Saponaria Molina; and the second iscom particle comprises fraction C of Quillaja Sapon
- the native coronavirus Spike (S) polypeptide (SEQ ID NO: 1 and SEQ ID NO:2) and CoV Spike polypeptides which have amino acid sequences corresponding to SEQ ID NOS: 3, 4, 38, 41, 44, 48, 51, 54, 58, 61, 63, 65, 67, 73, 75, 78, 79, 82, 83, 85, 87, 106, 108, 89, 112-115, 132, 133, 114, 138, 141, 144, 147, 151, 153, 156, 158, 174-176, 186, 188, 190, 195, 217-228, 233-236 have been expressed in a baculovirus expression system and recombinant plaques expressing the coronavirus Spike (S) polypeptides were picked and confirmed.
- the signal peptide is SEQ ID NO: 5.
- Fig. 4 and Fig. 9 show successful purification of the CoV Spike polypeptides BV2364, BV2365, BV2366, BV2367, BV2368, BV2369, BV2373, BV2374, and BV2375.
- Table 2 shows the sequence characteristics of the aforementioned CoV Spike polypeptides.
- CoV S polypeptides encoded by a nucleic acid of any one of SEQ ID NOS: 161, 162, 163, 164, 165, 166, 168, 169, 171, 172, 196-199, 201, 202, 204, 206, 208, 210, 212, 214, 216, and 237-241 are produced.
- CoV S polypeptides that comprise the polypeptide sequence of SEQ ID NOS: 87, 159, 167, 160, 170, 174, 175, 186, 188, 190, 195, 217-228, 233-236, and 243 which is C-terminal to a signal peptide having the amino acid sequence of any one of SEQ ID NOS: 5, 154, 193, or 117 are produced.
- the wild-type BV2361 protein (SEQ ID NO: 2) binds to human angiotensinconverting enzyme 2 precursor (hACE2). Bio-layer interferometry and ELISA were performed to assess binding of the CoV S polypeptides.
- binding is specific.
- the wild-type CoV S protein, BV2361 and the CoV S polypeptides BV2365 and BV2373 do not bind the MERS-CoV receptor, dipeptidyl peptidase IV (DPP4).
- DPP4 dipeptidyl peptidase IV
- the MERS S protein does not bind to human angiotensinconverting enzyme 2 precursor (hACE2) (Fig. 6 and Figs. 11D-F).
- HRP horseradish peroxidase conjugated anti-histidine
- TMB 3,3’,5,5’-tetramethylbenzidine peroxidase substrate
- EC50 values were calculated by 4-parameter fitting using GraphPad Prism 7.05 software.
- the recombinant virus is amplified by infection of Sf9 insect cells.
- the culture and supernatant is harvested 48-72 hrs post-infection.
- the crude cell harvest approximately 30 mL, is clarified by centrifugation for 15 minutes at approximately 800 x g.
- the resulting crude cell harvests containing the coronavirus Spike (S) protein are purified as nanoparticles as described below.
- non-ionic surfactant TERGITOL® nonylphenol ethoxylate NP-9 is used in the membrane protein extraction protocol. Crude extraction is further purified by passing through anion exchange chromatography, lentil lectin affinity /HIC and cation exchange chromatography. The washed cells are lysed by detergent treatment and then subjected to low pH treatment which leads to precipitation of BV and Sf9 host cell DNA and protein. The neutralized low pH treatment lysate is clarified and further purified on anion exchange and affinity chromatography before a second low pH treatment is performed.
- Affinity chromatography is used to remove Sf9/BV proteins, DNA and NP-9, as well as to concentrate the coronavirus Spike (S) protein.
- lentil lectin is a metalloprotein containing calcium and manganese, which reversibly binds polysaccharides and glycosylated proteins containing glucose or mannose.
- the coronavirus Spike (S) protein - containing anion exchange flow through fraction is loaded onto the lentil lectin affinity chromatography resin (Capto Lentil Lectin, GE Healthcare).
- the glycosylated coronavirus Spike (S) protein is selectively bound to the resin while non-glycosylated proteins and DNA are removed in the column flow through.
- the coronavirus Spike (S) protein composition comprising a CoV S polypeptide of SEQ ID NO: 87 (also called “BV2373”) as described in Example 1 was evaluated for immunogenicity and toxicity in a murine model, using female BALB/c mice (7-9 weeks old; Harlan Laboratories Inc., Frederick, MD). The compositions were evaluated in the presence and in the absence of a saponin adjuvant, e.g., MATRIX-MTM. Compositions containing MATRIX-MTM contained 5 pg of MATRIX-MTM.
- Vaccines containing coronavirus Spike (S) polypeptide at various doses were administered intramuscularly as a single dose (also referred to as a single priming dose) (study day 14) or as two doses (also referred to as a prime/boost regimen) spaced 14-days apart (study day 0 and 14).
- a placebo group served as a non-immunized control. Serum was collected for analysis on study days -1, 13, 21, and 28.
- Vaccinated and control animals were intranasally challenged with SARS-CoV-2 42 days following one (a single dose) or two (two doses) immunizations.
- mice were challenged with SARS-CoV-2. Since mice do not support replication of the wild-type SARS- CoV-2 virus, on day 52 post initial vaccination, mice were intranasally infected with an adenovirus expressing hACE2 (Ad/hACE2) to render them permissive. Mice were intranasally inoculated with 1.5 x 10 5 pfu of SARS-CoV-2 in 50 pL divided between nares. Challenged mice were weighed on the day of infection and daily for up to 7 days post infection. At 4- and 7-days post infection, 5 mice were sacrificed from each vaccination and control group, and lungs were harvested and prepared for pulmonary histology.
- Ad/hACE2 adenovirus expressing hACE2
- the viral titer was quantified by a plaque assay. Briefly, the harvested lungs were homogenized in PBS using 1.0 mm glass beads (Sigma Aldrich) and a Beadruptor (Omini International Inc.). Homogenates were added to Vero E6 near confluent cultures and SARS- CoV-2 virus titers determined by counting plaque forming units (pfu) using a 6-point dilution curve
- mice immunized with BV2363 without MATRIX-MTM had 10 3 pfu/lung (Fig. 16).
- the BV2373 with MATRIX-MTM prime-only groups of mice exhibited a dose dependent reduction in virus titer, with recipients of the 10 pg BV2373 dose having no detectable virus at day 4 post infection.
- Mice receiving 1 pg, 0.1 pg and 0.01 pg BV2373 doses all showed a marked reduction in titer compared to placebo-vaccinated mice.
- mice immunized with 10 pg, 1 pg and 0.1 pg doses had almost undetectable lung virus loads, while the 0.01 pg group displayed a reduction of 1 log reduction relative to placebo animals.
- the BV2373 immunized mice showed significant reduction in lung pathology at both day 4 and day 7 post infection in a dose-dependent manner.
- the prime only group displays reduced inflammation at the 10 pg and 1 pg dose with a reduction in inflammation surrounding the bronchi and arterioles compared to placebo mice.
- lung inflammation resembles that of the placebo groups, correlating with weight loss and lung virus titer.
- the prime/boost immunized groups displayed a significant reduction in lung inflammation for all doses tested, which again correlated with lung viral titer and weight loss data.
- the epithelial cells in the large and small bronchi at day 4 and 7 were substantially preserved with minimal bronchiolar sloughing and signs of viral infection.
- the arterioles of animals immunized with 10 pg, 1 pg and 0.1 pg doses have minimal inflammation with only moderate cuffing seen with the 0.01 pg dose, similar to placebo.
- Antigen-specific T cell responses were measured by ELISPOTTM enzyme linked immunosorbent assay and intracellular cytokine staining (ICCS) from spleens collected 7-days after the second immunization (study day 28).
- ICCS assays were performed in combination with surface marker staining.
- the frequency of multifunctional CD4+ and CD8+ T cells, which simultaneously produce at least two or three cytokines was also significantly increased (p ⁇ 0.0001) in spleens from the BV2373/ MATRIX-MTM immunized mice as compared to mice immunized in the absence of adjuvant (Figs. 20D-E and Figs. 21D-E).
- Immunization with BV2373/ MATRIX-MTM resulted in higher proportions of multifunctional phenotypes (e.g., T cells that secrete more than one of IFN-y, TNF-a, and IL-2) within both CD4+ and CD8+ T cell populations.
- the proportions of multifunctional phenotypes detected in memory CD4+ T cells were higher than those in CD8+ T cells (Fig. 22).
- Type 2 cytokine IL-4 and IL-5 secretion from CD4+ T cells was also determined by ICCS and ELISPOTTM respectively. Immunization with BV2373/ MATRIX-MTM also increased type 2 cytokine IL-4 and IL-5 secretion (2-fold) compared to immunization with BV2373 alone, but to a lesser degree than enhancement of type 1 cytokine production (e.g. IFN-y increased 20-fold) (Figs. 23A-C). These results indicate that administration of the MATRIX-MTM adjuvant skewed the CD4+ T cell development toward Thl responses.
- TFH CD4+ T follicular helper
- GC germinal center
- a vaccine composition comprising BV2373 in baboons was assessed.
- Adult olive baboons were immunized with a dose range (1 pg, 5 pg and 25 pg) of BV2373 and 50 pg MATRIX-MTM adjuvant administered by intramuscular (IM) injection in two doses spaced 21-days apart.
- IM intramuscular
- PBMCs were collected 7 days after the second immunization (day 28), and the T cell response was measured by ELISPOT assay.
- PBMCs from animals immunized with BV2373 (5 pg or 25 pg) and MATRIX-MTM had the highest number of IFN-y secreting cells, which was 5-fold greater compared to animals immunized with 25 pg BV2373 alone or BV2373 (1 pg) and MATRIX-MTM (Fig. 28).
- immunization with BV2373 (5 pg) and MATRIX-MTM showed the highest frequency of IFN-y+, IL-2+, and TNF-a+ CD4+ T cells (Figs. 29A-C). This trend was also true for multifunctional CD4+ T cells, in which at least two or three type 1 cytokines were produced simultaneously (Figs. 29D-E).
- the thermal stability of the S-trimers was determined by differential scanning calorimetry (DSC).
- Tmax 61.3°C and 60.4°C, respectively
- AHcal 3 - 5 fold increased enthalpy of transition required to unfold the BV2365 and BV2373 variants
- AHcal 153 kJ/mol
- BV2384 has a furin cleavage site sequence of GSAS (SEQ ID NO: 97), whereas BV2373 has a furin cleavage site of QQAQ (SEQ ID NO: 7).
- SDS-PAGE and Western Blot BV2384 showed extensive degradation in comparison to BV2373 (Fig. 32).
- scanning densitometry and recovery data demonstrate the unexpected loss of full length CoV S protein BV2384, lower purity, and recovery (Fig. 33) in comparison to BV2373 (Fig. 34).
- a vaccine comprising BV2373 resulted in the induction of anti-CoV-S antibodies (Fig. 35A) including neutralizing antibodies (Fig. 35B).
- Anti-CoV-S antibodies were induced after administration of one (Fig. 38A) or two doses (Fig. 38B) of BV2373.
- Administration of the vaccine comprising BV2373 also resulted in the production of antibodies that blocked binding of the CoV S protein to hACE2 (Fig. 38C and Fig. 38D).
- Fig. 38E There was a significant correlation between anti- CoV S polypeptide IgG titer and hACE2 inhibition titer in Cynomolgus macaques after administration of BV2373
- CPE cytopathic effect
- PRNT plaque reduction neutralization test
- the vaccine comprising BV2373’s ability to induce anti-CoV-S antibodies and antibodies that block binding of hACE2 to the CoV S protein in Cynomolgus macaques was compared to human convalescent serum.
- the BV2373 vaccine formulation also caused a decrease of SARS-CoV-2 viral replication (Figs. 36A-B).
- Viral RNA Fig. 36A, corresponding to total RNA present
- viral sub-genomic RNA Fig. 36B, corresponding to replicating virus
- BAL bronchiolar lavage
- Most subjects showed no viral RNA.
- small amounts of RNA were measured in some subjects.
- no RNA was measured except for two subjects at the lowest dose of 2.5 pg.
- Sub-genomic RNA was not detected at either 2 days or 4 days except for 1 subject, again at the lowest dose.
- Viral RNA Fig. 37A
- viral sub-genomic RNA Fig. 37B
- d2pi and d4pi were assessed by nasal swab at 2 days and 4 days post-infection. Most subjects showed no viral RNA. At Day 2 and Day 4 small amounts of RNA were measured in some subjects. Sub-genomic RNA was not detected at either 2 Days or 4 days. Subjects were immunized Day 0 and in the groups with two doses Day 0 and Day 21. These data show that the vaccine decreases nose total virus RNA by 100 - 1000 fold and sgRNA to undetectable levels, and confirm that immune response to the vaccine will block viral replication and prevent viral spread.
- a single vaccination with BV2373/ MATRIX-MTM achieved similar anti-CoV-S titer levels to those in asymptomatic (exposed) COVID-19 patients.
- a second vaccination achieved GMEU levels that exceeded convalescent serum from outpatient-treated COVID-19 patients by sixfold, achieved levels similar to convalescent serum from patients hospitalized with COVID-19, and exceeded overall convalescent serum anti-CoV-S antibodies by nearly six-fold.
- the responses in the two-dose 5-pg and 25-pg BV2373/ MATRIX-MTM regimens were similar. This highlights the ability of the adjuvant (MATRIX-MTM) to enable dose sparing.
- Convalescent serum obtained from COVID-19 patients with clinical symptoms requiring medical care, demonstrated proportional anti-CoV-S IgG and neutralization titers that increased with illness severity (Figs. 43A-B).
- T-cell responses in 16 participants showed that BV2373/MATRIX-MTM regimens induced antigen-specific polyfunctional CD4+ T-cell responses in terms of IFN-y, IL-2, and TNF-a production upon stimulation with BV2373.
- BV2373/MATRIX-MTM regimens induced antigen-specific polyfunctional CD4+ T-cell responses in terms of IFN-y, IL-2, and TNF-a production upon stimulation with BV2373.
- Thl cytokines Figs.
- CoV S polypeptides having the amino acid sequence of SEQ ID NO: 186; SEQ ID NO: 188, SEQ ID NO: 190, SEQ ID NO: 192, and SEQ ID NO: 195 were expressed in a baculovirus expression system and recombinant plaques expressing the coronavirus Spike (S) polypeptides were picked and confirmed. Nanoparticles comprising the proteins were purified according to the method described in Example 1. Tris-acetate gels of the purified SARS-CoV-2 S proteins having sequences of SEQ ID NO: 186; SEQ ID NO: 188; SEQ ID NO: 190; and SEQ ID NO: 192 are shown in Fig. 75A.
- FIG. 75B A tris-acetate gel of purified BV2373 (SEQ ID NO: 87) is shown in Fig. 75B.
- Figs. 76A-E show the particle size distribution of proteins having the amino acid sequences of SEQ ID NO: 188 (Fig. 76A); SEQ ID NO: 186 (Fig. 76B); SEQ ID NO: 190 (Fig. 76C); SEQ ID NO: 192 (Fig. 76D), and SEQ ID NO: 87 (Fig. 76E) as determined by dynamic light scattering (DLS), is shown in. DLS parameters are found in the table below.
- Figs. 77A-E show the HPLC-SEC trace of SARS-CoV-2 S proteins having the amino acid sequences of SEQ ID NO: 188 (Fig. 77A); SEQ ID NO: 186 (Fig. 77B); SEQ ID NO: 190 (Fig. 77C); SEQ ID NO: 192 (Fig. 77D), and SEQ ID NO: 87 (Fig. 77E).
- the concentration of each protein and the retention time for each protein is shown in the table below.
- Figs. 78A-E show the binding kinetics of SARS-CoV-2 S proteins having the amino acid sequences of SEQ ID NO: 188 (Fig. 78A); SEQ ID NO: 186 (Fig. 78B); SEQ ID NO: 190 (Fig. 78C); SEQ ID NO: 192 (Fig. 78D), and SEQ ID NO: 87 (Fig. 78E).
- Figs. 79A-E show the binding to hACE2 of SARS-CoV-2 S proteins having the amino acid sequences of SEQ ID NO: 188 (Fig. 79A); SEQ ID NO: 186 (Fig. 79B); SEQ ID NO: 190 (Fig. 79C); SEQ ID NO: 192 (Fig. 79D), and SEQ ID NO: 87 (Fig. 79E).
- Figs. 80A- E show the thermal stability of SARS-CoV-2 S proteins having the amino acid sequences of SEQ ID NO: 188 (Fig. 80A); SEQ ID NO: 186 (Fig. 80B); SEQ ID NO: 190 (Fig. 80C); SEQ ID NO: 192 (Fig. 80D), and SEQ ID NO: 87 (Fig. 80E).
- SARS-CoV-2 S polypeptides having the amino acid sequence of SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, and SEQ ID NO: 175 are expressed in a baculovirus expression system and recombinant plaques expressing the coronavirus Spike (S) polypeptides are picked and confirmed.
- SARS-CoV-2 S polypeptides having a sequence of SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, and SEQ ID NO: 175 are expressed using an N-terminal signal peptide having an amino acid sequence of SEQ ID NO: 5.
- the SARS-CoV-2 S polypeptide having a sequence of SEQ ID NO: 112 comprises a mutation of Asn-488 to tyrosine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7).
- the SARS-CoV-2 S polypeptide having a sequence of SEQ ID NO: 113 comprises mutation of Asp-601 to glycine, mutation of Asn-488 to tyrosine, mutations of Lys- 973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7).
- the SARS-CoV-2 S polypeptide having a sequence of SEQ ID NO: 114 comprises deletion of amino acids 56, 57, and 131, mutation of Asn-488 to tyrosine, a mutation of Ala-557 to aspartate, mutation of Asp-601 to glycine, mutation of Pro-668 to histidine, mutation of Thr-703 to isoleucine, mutation of Ser-969 to alanine, mutation of Asp-1105 to histidine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ (SEQ ID NO: 7).
- the SARS-CoV-2 S polypeptide having a sequence of SEQ ID NO: 115 comprises mutation of Asn-488 to tyrosine, mutation of Asp-67 to alanine, mutation of Leu- 229 to histidine, mutation of Asp-202 to glycine, mutation of Lys-404 to asparagine, mutation of Glu-471 to lysine, mutation of Ala-688 to valine, mutation of Asp-601 to glycine, mutations of Lys-973 and Val-974 to proline, and an inactivated furin cleavage site having the amino acid sequence of QQAQ.
- SARS-CoV-2 S polypeptide nanoparticles are generated as in Example 1.
- the stability and immunogenicity of the aforementioned SARS-CoV-2 S polypeptides is evaluated as in Examples 2-7.
- the prototype SARS-CoV-2 strain comprises a CoV S protein having the amino acid sequence of SEQ ID NO: 2.
- the B. l.1.7 variant comprises a CoV S protein having deletions of amino acids 56, 57, and 131 and mutations of N488Y, A557D, D601G, P668H, T703I, S969A, and D1105H, wherein the CoV S polypeptide is numbered with respect to the wild-type SARS- CoV-2 S polypeptide having the amino acid sequence of SEQ ID NO: 2.
- Vaccine efficacy was similar across subgroups, including participants with comorbidities and those >65 years old. Reactogenicity was generally mild and transient and occurred more frequently in the group administered BV2373 and MATRIX-MTM. The incidence of serious adverse events was low and similar in the two groups.
- a two-dose regimen of BV2373 and MATRIX-MTM conferred 89.7% efficacy against a blend of prototype and B. l.1.7 variant, with a safety profile similar to that of other authorized COVID-19 vaccines.
- Solicited local and systemic adverse events were collected via an electronic diary for 7 days after each dose in a subgroup of participants (solicited adverse event subgroup). All participants were assessed for unsolicited adverse events from the first dose through 28 days after the second dose; serious adverse events, adverse events of special interest, and medically attended adverse events were assessed from the first dose through 1 year after the second dose. Safety data are reported for all participants who received at least one dose of vaccine or placebo.
- the primary endpoint was the efficacy of BV2373 and MATRIX-MTM against the first occurrence of virologically confirmed symptomatic mild, moderate, or severe COVID-19, with onset at least 7 days after second vaccination in participants who were seronegative at baseline. Symptomatic COVID-19 was defined according to US Food and Drug Administration (FDA) criteria.
- FDA Food and Drug Administration
- Symptoms of suspected COVID-19 were monitored throughout the trial and collected using a CO VID-19 electronic symptom diary (InFLUenza Patient-Reported Outcome [FLU-PRO®] questionnaire) for at least 10 days.
- CO VID-19 electronic symptom diary InFLUenza Patient-Reported Outcome [FLU-PRO®] questionnaire
- FLU-PRO® CO VID-19 electronic symptom diary
- respiratory specimens from the nose and throat were collected daily over a 3 -day period to confirm SARS-CoV-2 infection.
- Virological confirmation was performed using polymerase chain reaction (PCR) testing (UK DHSC laboratories) with the Thermo TaqPathTM system (Thermo Fisher Scientific, Waltham, MA, USA).
- the trial was designed and driven by the total number of events expected to achieve statistical significance for the primary endpoint - a target of 100 mild, moderate, or severe Covid-19 cases.
- the target number of 100 cases for the final analysis was chosen to provide >95% power for 70% or higher vaccine efficacy.
- a single interim analysis of efficacy was conducted based on the accumulation of approximately 50% (50 events) of the total anticipated primary endpoints using Pocock boundary conditions.
- the main (hypothesis testing) event-driven analysis for the interim and final analyses of the primary objective was carried out at an overall one-sided type I error rate of 0.025 for the primary endpoint.
- the primary endpoint was analyzed in participants who were seronegative at baseline, received both doses of study vaccine or placebo, had no major protocol deviations affecting the primary endpoint, and had no confirmed cases of symptomatic Covid- 19 within 6 days after the second injection (per-protocol efficacy population).
- Hypothesis testing of the primary endpoint was carried out against the null hypothesis: HO: vaccine efficacy ⁇ 30%. The success criterion required rejection of the null hypothesis to demonstrate a statistically significant vaccine efficacy.
- Baseline demographics were well balanced between the BV2373 and MATRIX-MTM and placebo groups in the per-protocol efficacy population, where 48.4% were female, 94.5% were White, 0.4% were Black or African American, 0.8% were Hispanic or Latino, and 44.6% had at least one comorbid condition (based on Centers for Disease Control and Prevention [CDC] definitions. The median age of these participants was 56 years, and 27.9% were >65 years old. Table 6 provides a summary of the baseline demographics of the participants of the clinical trial.
- SD standard deviation
- body mass index BMI
- m squared height
- Percentages are based on per-protocol efficacy analysis set within each treatment and overall. *Comorbid subjects are those identified who have at least one of the comorbid conditions reported as a medical history or have a screening BMI value greater than 30 kg/m 2 .
- the solicited adverse event subgroup included 2714 participants. Overall, BV2373 and MATRIX-MTM recipients reported higher frequencies of solicited local adverse events than placebo recipients after both the first dose (59.4% vs. 20.9%) and the second dose (80.2% vs. 17.0%) (Fig. 50).
- BV2373 and MATRIX-MTM recipients reported higher frequencies of solicited systemic adverse events than placebo recipients after both the first dose (47.6% vs. 37.9%) and the second dose (64.6% vs. 30.8%) (Fig. 50).
- the most commonly reported systemic adverse events were headache, muscle pain, and fatigue after both the first dose (24.5%, 22.3%, and 20.5%) and the second dose (40.7%, 41.1%, and 41.0%), with most events being grade 1 or 2 in severity and of short mean duration (1.6, 1.5, and 1.9 days after the first dose and 1.9, 1.8, and 1.9 days after the second dose).
- Grade 4 systemic adverse events were reported in two BV2373 and MATRIX-MTM participants after the first dose and in one BV2373 and MATRIX-MTM participant after the second dose. Systemic adverse events were reported more often by younger vaccine recipients than by older vaccine recipients and more often after dose 2 than dose 1. Notably, fever (temperature >38°C) was reported in 2.3% and 5.1% of BV2373 and MATRIX-MTM participants after the first and second doses, with grade 3 fever (39-40°C) in 0.4% and 0.6% of participants after the first and second doses, respectively; one grade 4 fever (>40°C) was reported after each dose of vaccine.
- BV2373 and saponin adjuvant demonstrated significant efficacy against all strains detected in trial participants.
- the 96.4% point estimate of efficacy determined against the prototype strain is similar to that reported against this strain for the BNT161b2 mRNA vaccine (95.0%) and the mRNA-1273 vaccine (94.1%) and greater than that demonstrated by the adenoviral vector vaccines.
- the BV2373 and saponin adjuvant composition also showed efficacy against the B.1.351 variant.
- compositions containing the recombinant CoV Spike (rS) protein BV2438 (SEQ ID NO: 132), BV2373 (SEQ ID NO: 87), or both, in combination with a saponin adjuvant was evaluated.
- the saponin adjuvant contains two iscom particles, wherein: the first iscom particle comprises fraction A of Quillaja Saponaria Molina and not fraction C of Quillaja Saponaria Molina; and the second iscom particle comprises fraction C of Quillaja Saponaria Molina and not fraction A of Quillaja Saponaria Molina.
- Fraction A and Fraction C account for 85 % and 15 % by weight, respectively, of the sum of the weights of fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina in the adjuvant.
- the efficacy of BV2438 and BV2373 immunization regimens alone or in combination with the aforementioned saponin adjuvant against the SARS-CoV-2/WAl, SARS-CoV-2/B.1.1.7 and SARS-CoV-2/B.1.351 strains were evaluated.
- the SARS-CoV- 2/WA1 strain has a CoV S polypeptide having the amino acid sequence of SEQ ID NO: 2.
- the SARS-CoV-2/B.1.1.7 strain has a CoV S polypeptide comprising deletions of amino acids 69, 70, and 144 and mutations of N501Y, A570D, D614G, P681H, T716I, S982A, and D1118H, wherein the CoV S polypeptide is numbered with respect to the wild-type SARS-CoV-2 S polypeptide having the amino acid sequence of SEQ ID NO: 1.
- the SARS-CoV-2/B.1.351 strain has a CoV S polypeptide comprising polypeptide comprising mutations of D80A, L242H, R246I, A701 V, N501 Y, K417N, E484K, and D614G, wherein the CoV S polypeptide is numbered with respect to the wild-type SARS-CoV-2 S polypeptide having the amino acid sequence of SEQ ID NO: 1.
- Vero E6 cells ATCC# CRL 1586 were cultured in DMEM (Quality Biological), supplemented with 10% (v/v) fetal bovine serum (Gibco), 1% (v/v) penicillin/streptomycin (Gemini Bio-products) and 1% (v/v) L-glutamine (2 mM final concentration, Gibco) (Vero media). Cells were maintained at 37°C and 5% CO2. SARS-CoV-2/WAl were provided by the CDC (BEI #NR-52281).
- SARS-CoV-2/B.1.17 and SARS-CoV-2/B.1.351 were generously provided by Dr. Andy Pekosz at The Johns Hopkins Universityobtained.
- Stocks for both viruses were prepared by infection of Vero E6 cells for two days when CPE was starting to be visible. Media were collected and clarified by centrifugation prior to being aliquoted for storage at -80°C. Titer of stock was determined by plaque assay using Vero E6 cells as described previously.
- SARS-CoV-2 Protein Expression SARS-CoV-2 constructs were synthetically produced from the full-length S glycoprotein gene sequence (GenBank N908947 nucleotides 21563-25384). The full-length S-genes were codon optimized for expression in Spodoptera frugiperda (Sf9) cells and synthetically produced by GenScript (Piscataway, NJ, USA).
- the QuikChange Lightning site-directed mutagenesis kit (Agilent) was used to produce two spike protein variants: the furin cleavage site (682-RRAR-685) was mutated to 682-QQAQ-685 to be protease resistant and two proline substitutions at positions K986P and V987P (2P) were introduced to produce the double mutant, BV2373.
- the furin cleavage site (682-RRAR-685) was mutated to 682-QQAQ-685 to be protease resistant and two proline substitutions at positions K986P and V987P (2P) were introduced to produce the double mutant, BV2373.
- the following point mutations were also introduced: D60A, D215G, L242H, K417N, E484K, N501Y, D614G, and A701V.
- Recombinant baculovirus constructs were plaque purified and master seed stocks prepared and used to produce the working virus stocks.
- the baculovirus master and working stock titers were determined using rapid titer kit (Clontech, Mountain View, CA).
- Recombinant baculovirus stocks were prepared by infecting Sf9 cells with a multiplicity of infection (MOI) of ⁇ 0.01 plaque forming units (pfu) per cell.
- MOI multiplicity of infection
- SARS-CoV-2 S proteins were produced in Sf9 cells as previously described. Briefly, cells were expanded in serum-free medium and infected with recombinant baculovirus. Cells were cultured at 27 ⁇ 2°C and harvested at 68-72 hours post-infection by centrifugation (4000 * g for 15 min). Cell pellets were suspended in 25 mM Tris HC1 (pH 8.0), 50 mM NaCl and 0.5-1.0% (v/v) polyoxyethylene nonylphenol (NP-9, TERGITOL®) NP-9 with leupeptin.
- S-proteins were extracted from the plasma membranes with Tris buffer containing NP-9 detergent, clarified by centrifugation at 10,000 x g for 30 min. S-proteins were purified by TMAE anion exchange and lentil lectin affinity chromatography. Hollow fiber tangential flow filtration was used to formulate the purified spike protein at 100- 150 pg mL-1 in 25 mM sodium phosphate (pH 7.2), 300 mM NaCl, 0.02% (v/v) polysorbate 80 (PS 80).
- Purified S-proteins were evaluated by 4-12% gradient SDS-PAGE stained with Gel-Code Blue reagent (Pierce, Rockford, IL) and purity was determined by scanning densitometry using the OneDscan system (BD Biosciences, Rockville, MD).
- Electron microscopy was perform by NanoImaging Services (San Diego, CA) with a FEI Tecani T12 electron microscope, operated at 120keV equipped with a FEI Eagle 4k x 4k CCD camera.
- SARS-CoV-2 S proteins were diluted to 2.5 pg mL-1 in formulation buffer.
- the samples (3 pL) were applied to nitrocellulose-supported 400-mesh copper grids and stained with uranyl format. Images of each grid were acquired at multiple scales to assess the overall distribution of the sample.
- High-magnification images were acquired at nominal magnifications of 150,000x (X nm/pixel) and 92,000x (0.16 nm/pixel). The images were acquired at a nominal defocus of -2.0pm to -1.5pm (110,000x) and electron doses of ⁇ 25 e/A 2 .
- rS-WUlBV2373 20 per group were immunized by intramuscular (IM) injection with two doses spaced 14 days apart (study day 0 and 14) of rS-WUlBV2373, rS-B.1.351BV2438 with 5 pg saponin-based Matrix-MTM adjuvant (Novavax, AB, Uppsala, SE) either alone, in combination, or as a heterologous prime/boost.
- a placebo group was injected with vaccine formulation buffer as a negative control. Serum was collected for analysis on study days -1, 14, 21, and 32. Vaccinated and control animals were intranasally challenged with SARS-CoV-2 on study day 46.
- mice were anaesthetized by intraperitoneal injection 50 pL of a mix of xylazine (0.38 mg/mouse) and ketamine (1.3 mg/mouse) diluted in phosphate buffered saline (PBS).
- PBS phosphate buffered saline
- mice were intranasally inoculated with either 7 * 104 pfu of B.1.117 or 1 x 105 pfu of B.1.351 strains of SARS-CoV-2 in 50 pL. Challenged mice were weighed on day of infection and daily for 4 days post infection. At days 2- and 4-days post infection, 5 mice were sacrificed from each vaccination and control group, and lungs were harvested to determine viral titer by a plaque assay and viral RNA levels by qRT-PCR.
- SARS-CoV-2 Plaque Assay SARS-CoV-2 lung titers were quantified by homogenizing harvested lungs in PBS (Quality Biological Inc.) using 1.0 mm glass beads (Sigma Aldrich) and a Beadruptor (Omini International Inc.). Homogenates were added to Vero E6 near confluent cultures and SARS-CoV-2 virus titers determined by counting plaque forming units (pfu) using a 6-point dilution curve.
- Anti-SARS-CoV-2 Spike IgG by ELISA An ELISA was used to determine anti- SARS-CoV-2 S IgG titers. Briefly, 96 well microtiter plates (ThermoFischer Scientific, Rochester, NY, USA) were coated with 1.0 pg mL-1 of SARS-CoV-2 spike protein. Plates were washed with PBS-T and blocked with TBS Startblock blocking buffer (ThermoFisher, Scientific). Mouse, baboon or human serum samples were serially diluted (10-2 to 10-8) and added to the blocked plates before incubation at room temperature for 2 hours.
- EC50 values were calculated by 4-parameter fitting using SoftMax Pro 6.5.1 GxP software.
- Individual animal anti-SARS-CoV-2 S IgG titers and group geometric mean titers (GMT) and 95% confidence interval ( ⁇ 95% CI) were plotted GraphPad Prism 7.05 software.
- hACE2 receptor blocking antibodies Human ACE2 receptor blocking antibodies were determined by ELISA. Ninety-six well plates were coated with 1.0 pg mL-1 SARS-CoV-2 S protein overnight at 4°C. After washing with PBS-T and blocking with StartingBlock (TBS) blocking buffer (ThermoFisher Scientific), serially diluted serum from groups of immunized mice, baboons or humans were added to coated wells and incubated for 1 hour at room temperature. After washing, 30 ng mL-1 of histidine-tagged hACE2 (Sino Biologies, Beijing, CHN) was added to wells for 1 hour at room temperature.
- TBS StartingBlock
- Serum dilution versus % Inhibition plot was generated and curve fitting was performed by 4 parameter logistic (4PL) curve fitting to data.
- Serum antibody titer at 50% inhibition (IC50) of hACE2 to SARS-CoV-2 S protein was determined in the SoftMax Pro program.
- SARS-CoV-2 Neutralization Titer by Plaque Reduction Neutralization Titer Assay PRNTs were processed as described previously(20). Briefly, serum samples were diluted in DMEM (Quality Biological) at an initial 1 :40 dilution with 1 :2 serial dilutions for a total of 11 dilutions. A no-sera control was included on every plate. SARS-CoV-2 was then added 1 : 1 to each dilution for a target of 50 PFU per plaque assay well and incubated at 37 °C (5.0% CO2) for 1 hr. Samples titers where then determined by plaque assay and neutralization titers determined as compared to the non-treatment control. A 4-parameter logistic curve was fit to these neutralization data in PRISM (GraphPad, San Diego, CA) and the dilution required to neutralize 50% of the virus (PRNT50) was calculated based on that curve fit.
- PRISM GraphPad, San Diego, CA
- cytokine staining For surface staining, murine splenocytes were first incubated with an anti-CD16/32 antibody to block the Fc receptor. To characterize T follicular helper cells (Tfh), splenocytes were incubated with the following antibodies or dye: BV650-conjugated anti-CD3, APC-H7-conjugated anti-CD4, FITC- conjugated anti-CD8, Percp-cy5.5-conjugated anti-CXCR5, APC-conjugated anti-PD-1, Alexa Fluor 700-conjugated anti-CD19, PE-conjugated anti-CD49b (BD Biosciences, San Jose, CA) and the yellow LIVE/DEAD® dye (Life Technologies, NY).
- Tfh T follicular helper cells
- splenocytes were labeled with FITC-conjugated anti-CD3, PerCP-Cy5.5-conjugated anti- B220, APC-conjugated anti-CD19, PE-cy7-conjugated anti-CD95, and BV421 -conjugated anti-GL7 (BD Biosciences) and the yellow viability dye (LIVE/DEAD®) (Life Technologies, NY).
- cytokine staining For intracellular cytokine staining (ICCS) of murine splenocytes, cells were cultured in a 96-well U-bottom plate at 2 * 106 cells per well. The cells were stimulated with rS-WU!BV2373 or rS-B.1.351BV2438 spike protein. The plate was incubated 6 h at 37°C in the presence of BD GolgiPlugTM and BD GolgiStopTM (BD Biosciences) for the last 4 h of incubation.
- BD GolgiPlugTM and BD GolgiStopTM BD Biosciences
- Cells were labeled with murine antibodies against CD3 (BV650), CD4 (APC-H7), CD8 (FITC), CD44 (Alexa Fluor 700), and CD62L (PE) (BD Pharmingen, CA) and the yellow LIVE/DEAD® dye. After fixation with Cytofix/Cytoperm (BD Biosciences), cells were incubated with PerCP-Cy5.5-conjugated anti-IFN-y, BV421 -conjugated anti-IL-2, PE-cy7- conjugated anti-TNF-a, and APC-conjugated anti-IL-4 (BD Biosciences).
- PBMCs collected at the timepoints listed in Figure 5A were stimulated as described above with rS-WUlBV2373 or rS-B.1.351BV2438.
- Cells were labelled with human/NHP antibodies BV650-conjugated anti-CD3, APC-H7-conjugated anti-CD4, FITC-conjugated anti-CD8, BV421 -conjugated anti -IL-2, PerCP-Cy5.5-conjugated anti-fFN-y, PE-cy7-conjugated anti-TNF-a, APC-conjugated anti-IL-15, BV711 -conjugated anti-IL-13 (BD Biosciences), and the a yellow LIVE/DEAD®viability dye.
- Enzyme Linked Immunosorbent Assay (ELISA): Murine IFN-y and IL-5 ELISpot assays were performed following the manufacturer’ s procedures for mouse IFN-y and IL-5 ELISpot kits (3321-2H and 3321-2A, Mabtech, Cincinnati, OH). Briefly, 4 x 105 splenocytes in a volume of 200 pL were stimulated with rS-WUlBV2373 or rS- B.1.351BV2438 in plates that were pre-coated with anti-IFN-y or anti-IL-5 antibodies. Detection secondary antibodies were clone RS-6A2 IFN-y and clone TRFK4. Each stimulation condition was carried out in triplicate.
- Assay plates were incubated 24-48 h at 37 °C in a 5% CO2 incubator and developed using BD ELISpot AEC substrate set (BD Biosciences, San Diego, CA). Spots were counted and analyzed using an ELISpot reader and ImmunoSpot software v6 (Cellular Technology, Ltd., Shaker Heights, OH). The number of IFN-y- or IL-5- secreting cells was obtained by subtracting the background number in the medium controls. Data shown in the graph are the average of triplicate wells.
- baboon IFN-y and IL-4 assays were carried out using NHP IFN-y and Human IL-4 assay kits from Mabtech.
- IFN-y coating antibody human IFN-y 3420-2H and detection antibody clone 7-B6-1 were used.
- IL-4 coating antibody human IL-43410-2H (clone IL4-I) and detection antibody clone IL4-II were used. Assays were performed in triplicate.
- BV2438 antigen Purified BV2438, when reduced and subjected to SDS-PAGE, migrated with the expected molecular weight of approximately 170 kDa (Fig. 52A).
- the thermal stability of BV2438 was compared to that of BV2373 by differential scanning calorimetry (DSC); the main peak of the BV2438 showed a 4°C increase in thermal transition temperature (T ma x) and 1.3-fold higher enthalpy of transition (AHCal) compared to the prototype BV2373 protein, indicating increased stability of BV2438 (Fig. 52B, Table 7).
- TEM Transmission electron microscopy
- 2D Two-dimensional
- 2D Two-dimensional
- TEM images revealed a lightbulb-shaped particle appearance with a 15nm length and an 1 Inm width, which was consistent with the prefusion form of the SARS-CoV-2 spike trimer (PDB ID 6VXX; Fig. 52C). This is consistent with what we have previously observed for the prototype BV2373 protein.
- Table 7 Thermostability and hACE2 binding of SARS-CoV-2 recombinant spike proteins
- Tmax melting temperature
- K a binding constant
- Kd dissociation constant
- EC50 half-maximal binding.
- mice were weighed daily throughout the post-challenge period, and at 2 and 4 days post infection (Study Days 48 and 50), 5 mice per group were euthanized by isoflurane inhalation. Lungs of each mouse were then assessed for viral load by plaque formation assay and viral RNA by RT-PCR. Placebo BALB/c mice infected with B.l.1.7 did not lose weight and there was no observed weight loss in any vaccinated group that was infected with this SARS-CoV-2 strain. For B.1.351 infected mice, 20% weight loss was observed in the placebo vaccination group by day 4 post infection with B.1.351 (Fig. 55A, Fig. 55B). All mice vaccinated with either regimen were protected from weight loss after infection with B.1.351, demonstrating a clinical correlate of protection in this model.
- Enzyme linked immunosorbent assay showed greater numbers of IFN-y producing cells compared to the number of IL-5 producing cells upon all vaccination regimens, signifying a Thl-skewed response (Figs. 56B-D).
- strong Thl responses were observed by ICS as measured by the presence of CD4+ T cells expressing IFN-y, IL-2, or TNF-a, and multifunctional CD4+ T cells expressing all 3 cytokines (Fig. 56E, Figs. 57A- E).
- CD4+ T cells that expressed the Th2 cytokine IL-4 but were negative for IL-2 and TNF-a were also present, but at a lower proportion than that observed for Thl cytokines (Figs. 57A- E).
- No significant differences in cytokine-positive cell number were observed among vaccination groups for any cytokine tested upon stimulation with either BV2373 or BV2438.
- T follicular helper cells (CSCR5+PD-1+CD4+) tended to represent a greater percentage of CD4+ T cells, though no statistically significant elevation was observed in vaccinated animals compared to placebo animals (Fig. 56F).
- Serum antibody titers capable of disrupting the interaction between the wildtype CoV S protein (SEQ ID NO: 2) or B.1.351 rS and hACE2 were also evaluated at before boost, and 7, 21, 35, and 89 days after the boost with 1 or 2 doses of BV2438.
- animals that had received adjuvanted vaccine during the primary immunization series exhibited a strong hACE2-inhibiting antibody response 7 days after the BV2438 boost, despite having undetectable titers before the boost.
- Neutralizing antibody titers were analyzed by live virus microneutralization assays by testing sera for the ability to neutralize WAI, B.1.351 and B.1.1.7. Sera collected before the BV2438 boost had undetectable neutralizing antibody levels against all these viruses. By 7 days post vaccination, high titer antibody that neutralized all 3 strains was detected and this antibody response stayed high through 35 days post vaccination. Animals immunized with unadjuvanted BV2373 in the primary series displayed significantly lower antibody levels with a much broader range of neutralization titers (Fig. 58F). Together, these data demonstrate a robust durable antibody response even 1 year after the primary vaccination senes.
- mice In mice, the antibodies produced after vaccination with the B.1.351 variant- directed vaccine were able to inhibit binding between hACE2 and variant spike or ancestral spike to the same degree, indicating that this variant-directed vaccine could efficiently protect “backward” against ancestral SARS-CoV-2 strains.
- Participants Healthy male and female participants > 18 to ⁇ 84 years of age were recruited for enrollment in this study. Participants were eligible if they had a body mass index of 17 to 35 kg/m 2 , were able to provide informed consent prior to enrollment, and (for female participants) agreed to remain heterosexually inactive or use approved forms of contraception. Participants with a history of severe acute respiratory syndrome (SARS) or a confirmed diagnosis of COVID-19, serious chronic medical conditions (e.g, diabetes mellitus, congestive heart failure, autoimmune conditions, malignancy), or that were currently being assessed for an undiagnosed illness which may lead to a new diagnosis, were excluded from the study. Pregnant or breastfeeding females were also excluded.
- SARS severe acute respiratory syndrome
- Randomization Patients were randomly assigned to five groups. Of the five treatment groups, one was a placebo control (Group A) and two were active vaccine groups that were considered for additional vaccination with a booster (Group B and Group C). After approximately 6 months, consenting participants who had been randomized to receive a primary vaccination series of either two doses of BV2373 (5 pg) and saponin adjuvant (50 pg) on Day 0 and Day 21 (Group B) or one dose of BV2373 (5 pg) and saponin adjuvant (50 pg) on Day 0 and placebo on Day 21 (Group C) were re-randomized 1 : 1 to receive either a single booster dose of BV2373 and saponin adjuvant at the same dose level (Groups B2 and C2) or placebo (Groups Bl or Cl) at Day 189. Group B participants are the main focus of this Example.
- Safety and immunogenicity parameters were assessed, including assays for IgG, MNso, and hACE2 inhibition against the ancestral SARS-CoV-2 strain and select variants (B.1.351 [Beta], B.1.1.7 [Alpha], B.1.617.2 [Delta], and B.1.1.529 [Omicron]).
- Participants utilized an electronic diary to record reactogenicity on the day of vaccination and for an additional 6 days thereafter. Blood samples for immunogenicity analysis were collected 28 days after receipt of the booster, with safety follow-up also being performed at this time. Measures of immune response included assays for serum immunoglobulin G (IgG) antibodies, neutralizing antibody activity (microneutralization assay at an inhibitory concentration >50% [MN50]), and human angiotensin-converting enzyme 2 (hACE2) receptor binding inhibition. Serum IgG antibody levels specific for the SARS-CoV-2 rS protein antigen were detected using a qualified IgG enzyme linked immunosorbent assay (ELISA).
- IgG serum immunoglobulin G
- MN50 human angiotensin-converting enzyme 2
- Neutralizing antibodies specific for SARS-CoV-2 virus were measured using a qualified wild-type virus MN assay. Serum IgG and MN50 assay data were collected for both the ancestral and Beta variant SARS-CoV-2 strains. A fit-for-purpose functional hACE2 inhibition assay and an anti-rS (anti -recombinant spike) IgG activity assay were both used to analyze responses against the ancestral, B.1.351 (Beta), B. l.1.7 (Alpha), B.1.617.2 (Delta), and Bl.1.529 (Omicron) variant strains of SARS-CoV-2.
- Safety outcomes included participant-reported reactogenicity events for 7 days following the booster, as well as unsolicited adverse events occurring through 28 days postbooster.
- Booster reactogenicity was documented separately by solicited local and systemic adverse events. Unsolicited adverse events from booster vaccination to 28 days post-booster were recorded. Data were also collected on whether an adverse event was serious, related to vaccination, related to COVID-19, a potentially immune-mediated medical condition (PIMMC), or lead to discontinuation or an unscheduled visit to a healthcare practitioner.
- Participant samples for immunogenicity analyses were collected immediately prior to and 28 days after the booster.
- the safety analysis included all participants who received a single booster injection of BV2373 and saponin adjuvant (Group B2) or placebo (Group Bl). Safety analyses were presented as numbers and percentages of participants with solicited local and systemic adverse events analyzed through 7 days after each vaccination and unsolicited adverse events through 28 days following the booster.
- IgG and MN50 titers increased robustly compared to both the pre-booster titers and to the Day 35 titers produced by the primary series (Fig. 70, Fig. 71).
- Beta variant IgG GMTs increased from 4,317 EU at Day 189 prebooster to 175,190 EU at Day 217 reflecting a post-booster increase of ⁇ 40.6-fold. These titers were 4-fold higher than those observed at Day 35 for the ancestral strain (GMT 175,190 EU vs 43,905 EU). Beta variant MN50 assay data showed a similar fold increase in titers from prebooster (Day 189) to post-booster (Day 217) of ⁇ 50.1-fold (GMT 13 vs 661), though titers were lower than those seen for the ancestral strain at Day 35 (GMT 661 vs 1,470). (Table 9, Table 10).
- 67D shows hACE2 inhibition titers in adolescents.
- a second assay comparing anti-rS IgG activity across the same strains of SARS-CoV-2 found that 5.4-fold (Ancestral), 11.1-fold (Delta), 6.5-fold (Beta), 9.7- fold (Alpha), and 9.34 fold (Omicron) higher titers were observed after the booster (Table 11 A, Table 1 IB, Figs. 66A-B).
- Beta variant 40- to 50-fold increases in IgG and MN antibody titers were seen following the booster and IgG titers were approximately 4-fold higher than those seen for the ancestral strain after the primary vaccination series. Unlike the observation with IgG, MNso GMTs for the Beta variant were lower following the booster than those for the ancestral strain following the primary vaccination series (GMT 661 vs 1,470) in alignment with the known decreased neutralizing responses for this variant.
- Table 13 shows the geometric mean titer for neutralization of 99 % of a SARS- CoV-2 virus having a D614G mutation compared to SEQ ID NO: 1, the SARS-CoV-2 delta variant, or the SARS-CoV-2 omicron variant.
- Fig. 72 shows the neutralizing antibody 99 (neut99) values for the immunogenic composition comprising BV2373 and saponin adjuvant of Example 11 against the SARS-CoV-2 strain containing a D614G mutation, the B.1.617.2 (delta variant), and the B. 1.1.529 (omicron variant).
- Table 8 Demographic and Baseline Characteristics for Groups A, Bl, and B2
- BMI body mass index
- SARS-CoV-2 severe acute respiratory syndrome coronavirus 2
- SD standard deviation
- CI confidence interval
- ELISA enzyme-linked immunosorbent assay
- EU ELISA unit
- GMT geometric mean titer
- Table 10 Neutralizing Antibody Activity after Primary and Booster Vaccination for the Ancestral and Beta Variant SARS- CoV-2 Strains by Study Day for Participants Receiving BV2373 and Saponin Adjuvant
- CI confidence interval
- GMT geometric mean titer
- MN50 microneutralization assay at an inhibitory concentration >50%
- Table 12A 50 % hACE2 inhibition titer over time
- Table 12B hACE2 Inhibition Geometric Mean Titers after Primary and Booster Vaccination for Ancestral and Variant SARS-CoV-2 Strains by Study Day for Participants Receiving BV2373 and Saponin Adjuvant
- CI confidence interval
- GMFR geometric mean fold rise
- GMT geometric mean titer
- hACE2 human angiotensin-converting enzyme 2
- SARS-CoV-2 severe acute respiratory syndrome coronavirus 2
- Table 13 Geometric Mean Titer for Neutralization of SARS-CoV-2 virus with
- compositions containing (i) BV2373, BV2509, or a combination thereof and (ii) a Saponin Adjuvant induce Protective Immune responses against heterogeneous SARS-CoV-2 Strains
- Purpose and Methods The immunogenicity and in vivo protection of compositions containing the recombinant CoV Spike (rS) protein BV2509 (SEQ ID NO: 175), BV2373 (SEQ ID NO: 87), or both, in combination with a saponin adjuvant was evaluated.
- the saponin adjuvant contained two iscom particles, wherein: the first iscom particle comprises fraction A of Quillaja Saponaria Molina and not fraction C of Quillaja Saponaria Molina; and the second iscom particle comprises fraction C of Quillaja Saponaria Molina and not fraction A of Quillaja Saponaria Molina.
- Fraction A and Fraction C account for 85 % and 15 % by weight, respectively, of the sum of the weights of fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina in the adjuvant.
- Each composition contained 5 pg of saponin adjuvant. Mice were immunized with the aforementioned compositions at days 0 and 14. The rS proteins were administered at a dose of 0.1 pg or a dose of 1 pg.
- Serum Microneutralization Assay Serum samples were heat inactivated at 56°C for
- Dilution plates were then transported into the BSL-3 laboratory and 100 pL of a SARS CoV-2 variant (i.e., the Omicron BAI variant, Delta variant, or WAI variant) was added to each well to result in a multiplicity of infection (MOI) of 0.01 upon transfer to 96-well titer plates.
- MOI multiplicity of infection
- a non-treated, virus-only control was included on every plate.
- the sample/virus mixture was then incubated at 37°C (5.0% CO2) for 1 hour before transferring to 96-well titer plates with confluent VeroE6 cells. Titer plates were incubated at 37°C (5.0% CO2) for 72 hours, followed by cytopathic effect (CPE) determination for each well in the plate.
- CPE cytopathic effect
- Fig. 73 shows that compared to the control composition, compositions containing rS proteins neutralized the Omicron BAI variant, Delta variant, and WAI variant.
- mice 28 days after immunization, mice were challenged with the SARS-CoV-2 Omicron
- Figs. 74A-B show the viral load in mice lungs two days after challenge with the SARS CoV-2 Omicron BAI variant (Fig. 74A) or the WAI variant (Fig. 74B). Each composition reduced viral load compared to placebo.
- SARS-CoV-2 S protein expression and purification are evaluated. The purity and yield of SARS-CoV-2 S proteins produced by each method is evaluated. Optionally, the purified S-proteins are evaluated by 4-12% gradient SDS-PAGE stained with Gel-Code Blue reagent (Pierce, Rockford, IL) and purity is determined by scanning densitometry using the OneDscan system (BD Biosciences, Rockville, MD).
- Method 1 SARS-CoV-2 S proteins are produced in Sf9 cells. Briefly, cells are expanded in serum-free medium and infected with recombinant baculovirus. Cells are cultured at 27 ⁇ 2°C and harvested at 68-72 hours post-infection by centrifugation (4000 * g for 15 min). Cell pellets are suspended in 25 mM Tris HC1 (pH 8.0), 50 mM NaCl and 0.5-1.0% (v/v) polyoxyethylene nonylphenol (NP-9, TERGITOL®) NP-9 with leupeptin.
- Tris HC1 pH 8.0
- 50 mM NaCl 0.5-1.0%
- NP-9, TERGITOL® polyoxyethylene nonylphenol
- S-proteins are extracted from the plasma membranes with Tris buffer containing NP-9 detergent, clarified by centrifugation at 10,000 x g for 30 min. S-proteins are purified by TMAE anion exchange and lentil lectin affinity chromatography. Hollow fiber tangential flow filtration is used to formulate the purified SARS- CoV-2 S protein at 100-150 pg mL' 1 in 25 mM sodium phosphate (pH 7.2), 300 mM NaCl, 0.02% (v/v) polysorbate 80 (PS80).
- Method 2 Recombinant virus expressing a SARS-CoV-2 S protein is amplified by infection of Sf9 insect cells.
- the culture and supernatant is harvested 48-72 hrs post-infection.
- the crude cell harvest approximately 30 mL, is clarified by centrifugation for 15 minutes at approximately 800 x g.
- the resulting crude cell harvests containing the coronavirus Spike (S) protein is purified as nanoparticles.
- non-ionic surfactant TERGITOL® nonylphenol ethoxylate NP-9 is used in the membrane protein extraction protocol. Crude extraction is further purified by passing through anion exchange chromatography, lentil lectin affinity /HIC and cation exchange chromatography. The washed cells are lysed by detergent treatment and then subjected to low pH treatment which leads to precipitation of BV and Sf9 host cell DNA and protein. The neutralized low pH treatment lysate is clarified and further purified on anion exchange and affinity chromatography before a second low pH treatment is performed. Affinity chromatography is used to remove Sf9/BV proteins, DNA and NP-9, as well as to concentrate the coronavirus Spike (S) protein.
- S coronavirus Spike
- lentil lectin is a metalloprotein containing calcium and manganese, which reversibly binds polysaccharides and glycosylated proteins containing glucose or mannose.
- the coronavirus Spike (S) protein -containing anion exchange flow through fraction is loaded onto the lentil lectin affinity chromatography resin (Capto Lentil Lectin, GE Healthcare).
- the glycosylated coronavirus Spike (S) protein is selectively bound to the resin while non-glycosylated proteins and DNA are removed in the column flow through. Weakly bound glycoproteins are removed by buffers containing high salt and low molar concentration of methyl alpha-D-mannopyranoside (MMP).
- MMP methyl alpha-D-mannopyranoside
- the column washes are also used to detergent exchange the NP-9 detergent with the surfactant polysorbate 80 (PS80).
- PS80 surfactant polysorbate 80
- the coronavirus Spike (S) polypeptides are eluted in nanoparticle structure from the lentil lectin column with a high concentration of MMP.
- Method 3 Recombinant virus expressing a SARS-CoV-2 S protein is amplified by infection of Sf9 insect cells.
- the crude cell harvest approximately 30 mL, is clarified by centrifugation for 20 minutes at approximately 800 x g.
- S-proteins are purified by TMAE anion exchange and lentil lectin affinity chromatography.
- the load pH for the TMAE anion exchange chromatography is 8.0 and the conductivity is 7.4 mS/cm.
- the equilibration buffer for lentil lectin chromatography is 25 mM Tris, 50 mM NaCl, 0.02 % NP-9, pH 8.
- the SARS- CoV-2 S protein is eluted in 1.2 M MMP.
- Method 4 Recombinant virus expressing a SARS-CoV-2 S protein is amplified by infection of Sf9 insect cells.
- the culture and supernatant is harvested 48-72 hrs post-infection.
- Cell pellets are suspended in 50 mM Tris HC1 (pH 8.0), 50 mM NaCl and 1.5 % (v/v) polyoxyethylene nonylphenol (NP-9, TERGITOL®) NP-9 with leupeptin.
- the culture and supernatant is harvested 48-72 hrs post-infection.
- the crude cell harvest approximately 30 mL, is clarified by centrifugation for 20 minutes at approximately 800 x g.
- S-proteins are purified by TMAE anion exchange and lentil lectin affinity chromatography.
- the load pH for the TMAE anion exchange chromatography is 7.9 and the conductivity is 7.3 mS/cm.
- the equilibration buffer for lentil lectin chromatography is 25 mM Tris, 50 mM NaCl, 0.02 % NP-9, pH 8.
- the SARS- CoV-2 S protein is eluted in 1.2 M MMP.
- a coronavirus (CoV) Spike (S) glycoprotein comprising
- an SI subunit with an inactivated furin cleavage site comprising an N-terminal domain (NTD), a receptor binding domain (RBD), subdomains 1 and 2 (SD1/2), wherein the inactivated furin cleavage site has an amino acid sequence of QQAQ (SEQ ID NO: 7); wherein the NTD optionally comprises one or more modifications selected from the group consisting of:
- S2 subunit wherein amino acids 973 and 974 are proline, wherein the S2 subunit optionally comprises one or more modifications selected from the group consisting of:
- coronavirus S glycoprotein of embodiment 1 comprising deletion of amino acids 676-685.
- coronavirus S glycoprotein of embodiment 1 comprising deletion of amino acids 702-711.
- coronavirus S glycoprotein of embodiment 1 comprising a deletion of amino acids 806-815.
- coronavirus S glycoprotein of embodiment 1 comprising a deletion of amino acids 775-793.
- coronavirus S glycoprotein of embodiment 1 comprising deletion of amino acids 1- 292 of the NTD.
- coronavirus S glycoprotein of embodiment 1 comprising deletion of amino acids 1201-1260 of the transmembrane and cytoplasmic tail (TMCT).
- coronavirus S glycoprotein of embodiment 1 comprising or consisting of an amino acid sequence selected from the group consisting of SEQ ID NOS: 85-89, 105, 106, and 112-115.
- coronavirus S glycoprotein of any one of embodiments 1 to 8 comprising a signal peptide, optionally wherein the signal peptide comprises an amino acid sequence of SEQ ID NO: 5 or SEQ ID NO: 117.
- the coronavirus S glycoprotein of any one of embodiments 1 to 9 comprising a C- terminal fusion protein.
- the coronavirus S glycoprotein of embodiment 12, wherein the foldon has an amino acid sequence corresponding to SEQ ID NO: 68.
- coronavirus S glycoprotein of any one of embodiments 1-14 wherein each of the S2 subunit, NTD, RBD, and SD1/2 is 99 % identical to the corresponding subunit or domain of the CoV S glycoprotein having an amino acid sequence of SEQ ID NO: 2.
- a vector comprising the nucleic acid of embodiment 19.
- a nanoparticle comprising the coronavirus S glycoprotein of any one of embodiments 1- 18.
- An immunogenic composition comprising one or more coronavirus S glycoproteins of embodiments 1-18 or 76-78 and a pharmaceutically acceptable buffer.
- the immunogenic composition of embodiment 25 comprising an adjuvant.
- fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina account for about 85 % by weight and about 15 % by weight, respectively, of the sum of weights of fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina in the adjuvant; or wherein fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina account for about 92 % by weight and about 8 % by weight, respectively, of the sum of weights of fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina in the adjuvant.
- fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina account for about 92 % by weight and about 8 % by weight, respectively, of the sum of the weights of fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina in the adjuvant.
- fraction A of Quillaja Saponaria Molina accounts for at least about 85 % by weight
- fraction C of Quillaja Saponaria Molina accounts for the remainder, respectively, of the sum of the weights of fraction A of Quillaja Saponaria Molina and fraction C of Quillaja Saponaria Molina in the adjuvant.
- the immunogenic composition of any one of embodiments 25-30 comprising from one to about 10 coronavirus S glycoproteins, for example, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 coronavirus S glycoproteins.
- the immunogenic composition of embodiment 27, comprising a first CoV S glycoprotein having the amino acid sequence of SEQ ID NO: 87.
- a method of stimulating an immune response against SARS-CoV-2 in a subject comprising administering the vaccine composition of any one of embodiments 25-30.
- the method of embodiment 31, wherein the subject is administered a first dose at day 0 and a boost dose at day 21.
- the method of embodiment 31, wherein the subject is administered between about 5 pg and about 25 pg of coronavirus S glycoprotein.
- the method of embodiment 31, wherein the subject is administered about 5 pg of coronavirus S glycoprotein.
- the method of any one of embodiments 31, 33, 34, and 35, wherein a single dose of the vaccine composition is administered.
- the method of any one of embodiments 31-35, wherein multiple doses of the vaccine composition are administered. 43.
- the method of any one of embodiments 31-37, wherein the vaccine composition is coadministered with an influenza glycoprotein.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Molecular Biology (AREA)
- Epidemiology (AREA)
- Communicable Diseases (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Mycology (AREA)
- Gastroenterology & Hepatology (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Oncology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Nanotechnology (AREA)
- Pulmonology (AREA)
- Optics & Photonics (AREA)
- Physics & Mathematics (AREA)
- Biomedical Technology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2022399829A AU2022399829A1 (en) | 2021-11-30 | 2022-11-30 | Coronavirus vaccine formulations |
| EP22902377.5A EP4440613A4 (en) | 2021-11-30 | 2022-11-30 | CORONAVIRUS VACCINE FORMULATIONS |
| MX2024006589A MX2024006589A (es) | 2021-11-30 | 2022-11-30 | Formulaciones de vacunas contra el coronavirus. |
| CA3241118A CA3241118A1 (en) | 2021-11-30 | 2022-11-30 | Coronavirus vaccine formulations |
| CN202280090166.XA CN118613279A (zh) | 2021-11-30 | 2022-11-30 | 冠状病毒疫苗制剂 |
| IL313254A IL313254A (en) | 2021-11-30 | 2022-11-30 | Coronavirus vaccine formulations |
| JP2024532444A JP2024545420A (ja) | 2021-11-30 | 2022-11-30 | コロナウイルスワクチン製剤 |
| KR1020247021797A KR20240125935A (ko) | 2021-11-30 | 2022-11-30 | 코로나바이러스 백신 제형물 |
| US18/715,010 US20250025549A1 (en) | 2021-11-30 | 2022-11-30 | Coronavirus vaccine formulations |
Applications Claiming Priority (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163284497P | 2021-11-30 | 2021-11-30 | |
| US63/284,497 | 2021-11-30 | ||
| US202163292120P | 2021-12-21 | 2021-12-21 | |
| US63/292,120 | 2021-12-21 | ||
| US202163293519P | 2021-12-23 | 2021-12-23 | |
| US63/293,519 | 2021-12-23 | ||
| US202263332530P | 2022-04-19 | 2022-04-19 | |
| US63/332,530 | 2022-04-19 | ||
| US202263367678P | 2022-07-05 | 2022-07-05 | |
| US63/367,678 | 2022-07-05 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2023102448A2 true WO2023102448A2 (en) | 2023-06-08 |
| WO2023102448A3 WO2023102448A3 (en) | 2023-08-31 |
Family
ID=86613115
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/080700 Ceased WO2023102448A2 (en) | 2021-11-30 | 2022-11-30 | Coronavirus vaccine formulations |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US20250025549A1 (enExample) |
| EP (1) | EP4440613A4 (enExample) |
| JP (1) | JP2024545420A (enExample) |
| KR (1) | KR20240125935A (enExample) |
| AU (1) | AU2022399829A1 (enExample) |
| CA (1) | CA3241118A1 (enExample) |
| IL (1) | IL313254A (enExample) |
| MX (1) | MX2024006589A (enExample) |
| TW (1) | TW202332685A (enExample) |
| WO (1) | WO2023102448A2 (enExample) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11878055B1 (en) | 2022-06-26 | 2024-01-23 | BioNTech SE | Coronavirus vaccine |
| US20240156949A1 (en) * | 2022-10-28 | 2024-05-16 | Glaxosmithkline Biologicals Sa | Nucleic Acid Based Vaccine |
| US12186387B2 (en) | 2021-11-29 | 2025-01-07 | BioNTech SE | Coronavirus vaccine |
| WO2025101668A1 (en) | 2023-11-06 | 2025-05-15 | Novavax, Inc. | Intranasal immunogenic compositions |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20230070886A1 (en) * | 2020-01-27 | 2023-03-09 | Novavax, Inc. | Coronavirus vaccine formulations |
| JP2023511633A (ja) * | 2020-01-28 | 2023-03-20 | モデルナティエックス インコーポレイテッド | コロナウイルスrnaワクチン |
| JP2023512519A (ja) * | 2020-01-31 | 2023-03-27 | ベス イスラエル ディーコネス メディカル センター インコーポレイテッド | コロナウイルス感染症を予防および処置するための組成物および方法-sars-cov-2ワクチン |
| AR128082A1 (es) * | 2021-12-23 | 2024-03-20 | Novavax Inc | ANTICUERPOS CONTRA LA ESPÍCULA (S) DEL SARS-CoV-2 Y SU USO EN EL TRATAMIENTO DE COVID-19 |
| CN119836572A (zh) * | 2022-07-26 | 2025-04-15 | 诺瓦瓦克斯股份有限公司 | 用于评价疫苗免疫原性的ace2抑制测定 |
| AU2023315949A1 (en) * | 2022-07-26 | 2025-02-20 | Novavax, Inc. | Pseudovirus based neutralization assay for evaluating vaccine immunogenicity |
-
2022
- 2022-11-30 US US18/715,010 patent/US20250025549A1/en active Pending
- 2022-11-30 IL IL313254A patent/IL313254A/en unknown
- 2022-11-30 WO PCT/US2022/080700 patent/WO2023102448A2/en not_active Ceased
- 2022-11-30 KR KR1020247021797A patent/KR20240125935A/ko active Pending
- 2022-11-30 MX MX2024006589A patent/MX2024006589A/es unknown
- 2022-11-30 AU AU2022399829A patent/AU2022399829A1/en active Pending
- 2022-11-30 EP EP22902377.5A patent/EP4440613A4/en active Pending
- 2022-11-30 JP JP2024532444A patent/JP2024545420A/ja active Pending
- 2022-11-30 TW TW111145944A patent/TW202332685A/zh unknown
- 2022-11-30 CA CA3241118A patent/CA3241118A1/en active Pending
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12186387B2 (en) | 2021-11-29 | 2025-01-07 | BioNTech SE | Coronavirus vaccine |
| US12208136B2 (en) | 2021-11-29 | 2025-01-28 | BioNTech SE | Coronavirus vaccine |
| US11878055B1 (en) | 2022-06-26 | 2024-01-23 | BioNTech SE | Coronavirus vaccine |
| US20240156949A1 (en) * | 2022-10-28 | 2024-05-16 | Glaxosmithkline Biologicals Sa | Nucleic Acid Based Vaccine |
| US12186389B2 (en) * | 2022-10-28 | 2025-01-07 | Glaxosmithkline Biologicals Sa | Nucleic acid base vaccine against emerging SARS-CoV-2 variants |
| WO2025101668A1 (en) | 2023-11-06 | 2025-05-15 | Novavax, Inc. | Intranasal immunogenic compositions |
Also Published As
| Publication number | Publication date |
|---|---|
| EP4440613A4 (en) | 2026-02-11 |
| WO2023102448A3 (en) | 2023-08-31 |
| IL313254A (en) | 2024-08-01 |
| CA3241118A1 (en) | 2023-06-08 |
| JP2024545420A (ja) | 2024-12-06 |
| MX2024006589A (es) | 2024-08-20 |
| AU2022399829A1 (en) | 2024-06-27 |
| EP4440613A2 (en) | 2024-10-09 |
| KR20240125935A (ko) | 2024-08-20 |
| US20250025549A1 (en) | 2025-01-23 |
| TW202332685A (zh) | 2023-08-16 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12491241B2 (en) | Coronavirus vaccine formulations | |
| US20220332765A1 (en) | Coronavirus vaccine formulations | |
| US20230070886A1 (en) | Coronavirus vaccine formulations | |
| US20250025549A1 (en) | Coronavirus vaccine formulations | |
| CA3217591A1 (en) | Coronavirus and influenza compositions and methods for using them | |
| CN118613279A (zh) | 冠状病毒疫苗制剂 | |
| US20240374712A1 (en) | Sars-cov-2 vaccine compositions | |
| CN117769433A (zh) | 冠状病毒疫苗制剂 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22902377 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2024532444 Country of ref document: JP Kind code of ref document: A Ref document number: 3241118 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 18715010 Country of ref document: US |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022399829 Country of ref document: AU Ref document number: 811777 Country of ref document: NZ Ref document number: AU2022399829 Country of ref document: AU |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112024010820 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202417045662 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 2022399829 Country of ref document: AU Date of ref document: 20221130 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20247021797 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202403721S Country of ref document: SG |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024117893 Country of ref document: RU Ref document number: 2022902377 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022902377 Country of ref document: EP Effective date: 20240701 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280090166.X Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22902377 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 112024010820 Country of ref document: BR Kind code of ref document: A2 Effective date: 20240529 |