WO2023091968A1 - Methods for treating anemia of kidney disease - Google Patents

Methods for treating anemia of kidney disease Download PDF

Info

Publication number
WO2023091968A1
WO2023091968A1 PCT/US2022/079987 US2022079987W WO2023091968A1 WO 2023091968 A1 WO2023091968 A1 WO 2023091968A1 US 2022079987 W US2022079987 W US 2022079987W WO 2023091968 A1 WO2023091968 A1 WO 2023091968A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acid
seq
antibody
acid sequence
subject
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/079987
Other languages
English (en)
French (fr)
Inventor
Brian Macdonald
John QUISEL
Will SAVAGE
Hua Yang
Jonathan Yu
Min Wu
Maria BECONI
Jennifer M. Perez
Bernhard Mueller
Andreas Popp
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
AbbVie Deutschland GmbH and Co KG
AbbVie Inc
Disc Medicine Inc
Original Assignee
AbbVie Deutschland GmbH and Co KG
AbbVie Inc
Disc Medicine Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by AbbVie Deutschland GmbH and Co KG, AbbVie Inc, Disc Medicine Inc filed Critical AbbVie Deutschland GmbH and Co KG
Priority to CN202280082955.9A priority Critical patent/CN118715023A/zh
Priority to EP22840844.9A priority patent/EP4433160A1/en
Priority to US18/710,958 priority patent/US20240417458A1/en
Priority to JP2024529330A priority patent/JP2024540480A/ja
Priority to MX2024006006A priority patent/MX2024006006A/es
Priority to KR1020247019664A priority patent/KR20240101681A9/ko
Priority to AU2022394462A priority patent/AU2022394462A1/en
Priority to CA3235096A priority patent/CA3235096A1/en
Publication of WO2023091968A1 publication Critical patent/WO2023091968A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/06Antianaemics
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • Kidney disease is a condition characterized by abnormalities of kidney structure or function. Outcomes of kidney disease can include kidney failure, as well as complications of decreased kidney function and cardiovascular diseases. When kidney abnormalities persist for an extended period of time, the kidney disease may be classified as Chronic kidney disease (CKD). Cardiovascular mortality is the leading cause of death in CKD patients. As of 2017, the estimated prevalence of CKD worldwide was 9.1% of the world’s population, and this prevalence is rising. CKD most commonly typically presents in people aged 65 years or older. The stage of CKD is defined according to the level of glomerular filtration rate (GFR). [004] Many kidney disease patients have or develop anemia.
  • GFR glomerular filtration rate
  • hypoxia inducible factor prolyl hydroxylase inhibitor drugs that are designed to help prompt the body to make red blood cells.
  • HIF-PHI hypoxia inducible factor prolyl hydroxylase inhibitor
  • No HIF-PHI has been approved by the FDA to date.
  • HIF-PHI has been demonstrated to be safe and effective against anemia of CKD in US clinical trials to date.
  • a major efficacy concern with respect to HIF- PHI drugs is an overcorrection of hemoglobin (Hb) levels in serum, which can lead to adverse cardiovascular outcomes.
  • Hb hemoglobin
  • aspects of the present disclosure relate to methods for treating subjects having anemia that involve the use of hepcidin antagonists (e.g., hemojuvelin antagonists).
  • hepcidin antagonists e.g., hemojuvelin antagonists
  • methods are provided herein that involve administration of a hemojuvelin antagonist to treat anemia in a subject having kidney disease.
  • Further aspects of the disclosure provide methods for treating anemia in a subject having chronic kidney disease (CKD).
  • disclosed methods provide administration of a hemojuvelin antagonist to a subject having (or exhibiting) certain levels of glomerular filtration rate (GFR), as measured or estimated by a physician.
  • GFR glomerular filtration rate
  • methods provided herein involve subcutaneous administration of a hemojuvelin antagonist (e.g., an anti- hemojuvelin antagonist antibody) to treat the anemia, and thus, are advantageous for administration outside of a hospital or similar healthcare setting where intravenous and similar administrations or procedures are typically performed.
  • a hemojuvelin antagonist e.g., an anti- hemojuvelin antagonist antibody
  • subcutaneous administration-based methods provided herein may be performed in a physician’s office or as a self-administration by a subject or patient. Accordingly, aspects of the present disclosure are useful for treating anemia in subjects having kidney disease in which the subject is not undergoing a therapy (such as dialysis therapy, IV iron therapy, and other similar therapies) that involves one or more visit(s) to a hospital or similar healthcare setting where intravenous therapies can be readily administered.
  • a therapy such as dialysis therapy, IV iron therapy, and other similar therapies
  • the anemia is associated with kidney damage of the subject.
  • the kidney damage may have been present in the subject for at least three months.
  • the subject has a chronic kidney disease that is a non-dialysis dependent chronic kidney disease.
  • the subject is not undergoing dialysis therapy.
  • Anemia is a common complication in patients with CKD and has been associated with multiple adverse outcomes in this population.
  • Increased hepcidin is believed to be a central contributor to the development of anemia because of both reduced clearance and increased synthesis of hepcidin.
  • Treatment with hepcidin lowering drugs has been demonstrated to increase iron availability from systemic iron stores and to increase hemoglobin (Sheetz et al, Br J Clin Pharmacol. 2019;85:935-948, which is incorporated by reference herin).
  • an anti-hemojuvelin antibody anti-HJV Ab
  • methods provided herein are useful for treating subjects having anemia associated with kidney disease so as to decrease hepcidin levels or activity.
  • the subject may experience an improvement in iron uptake from the gastrointestinal system (z.e., from diet).
  • the subject may experience a restoration, either partial or complete, of iron levels.
  • methods provided herein are useful for treating subjects who have low TSAT levels (e.g., below 20%, below 30%, below 40%, or below 50%) and/or low ferritin levels (e.g., ferritin below ⁇ 50 ng/mL, ⁇ 100 ng/mL, or ⁇ 300 ng/mL).
  • methods provided herein are useful for treating subjects who exhibit low hemoglobin levels (e.g., Hb levels below 11 g/dL, 10 g/dL, or 9 g/dL).
  • methods provided herein are useful for treating subjects who exhibit normal to relatively high hepcidin levels.
  • the subjects further exhibit renal impairment, which may be chronic, with a glomerular filtration rate in the range of 15 mL/min to just below 60 (e.g., 59) mL/min per 1.73 m 2 .
  • the hemojuvelin antagonist is an anti-hemojuvelin antibody.
  • the anti-hemojuvelin antibody preferentially binds RGMc versus RGMa and RGMb.
  • the anti-hemojuvelin antibody binds RGMc with an equilibrium dissociation constant (KD) less than 100 nM.
  • the anti- HJV antibody is an anti-HJV antibody in Table 1.
  • the anti-hemojuvelin antibody comprises: (a) a variable heavy chain region comprising a CDR1 comprising the amino acid sequence of SEQ ID NO: 1, a CDR2 comprising the amino acid sequence of SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence of SEQ ID NO: 3; and/or (b) a variable light chain region comprising a CDR1 comprising an amino acid sequence of SEQ ID NO: 17, a CDR2 comprising an amino acid sequence of SEQ ID NO: 5, and a CDR3 comprising an amino acid sequence of SEQ ID NO: 27.
  • the antibody comprises a HC CDR1 of SEQ ID NO: 1, a HC CDR2 of SEQ ID NO: 2, a HC CDR3 of SEQ ID NO: 3; an LC CDR1 of SEQ ID NO: 17, a LC CDR2 of SEQ ID NO: 5, and a LC CDR3 of SEQ ID NO: 27.
  • the anti-hemojuvelin antibody is hHA-008. In some embodiments, the anti-hemojuvelin antibody is hHA-008-QL.
  • the antibody comprises a VH comprising an amino acid sequence of SEQ ID NO: 38, and a VL comprising an amino acid sequence of SEQ ID NO: 39.
  • the antibody may be selected from the group consisting of a full-length IgG, a Fab fragment, a F(ab') fragment, a F(ab’)2 fragment, a scFv, and a Fv.
  • the antibody is a full-length IgG comprising a heavy chain constant region of the isotype IgGl, IgG2, IgG3, or IgG4.
  • the antibody comprises a heavy chain comprising an amino acid sequence of SEQ ID NO: 61, and a light chain comprising an amino acid sequence of SEQ ID NO: 62. In other embodiments, the antibody comprises a heavy chain comprising an amino acid sequence of SEQ ID NO: 63, and a light chain comprising an amino acid sequence of SEQ ID NO: 62.
  • the anti-hemojuvelin antibody is administered to a subject in need thereof in an amount between 0.1 and 0.8 mg/kg of subject. In some embodiments, the antibody is administered in a dose of between about 7 mg and 56 mg, such as 56 mg. Any of these doses may be administered monthly or semi-monthly.
  • the subject is identified prior to the treatment as having high hepcidin levels. In some embodiments, the subject is identified as having a functional iron deficiency. In some embodiments, the subject is identified as exhibiting inflammation and/or iron-restricted erythropoiesis. In some embodiments, the subject is a human. In some embodiments, the subject has a nutritional iron deficiency. In some embodiments, the subject does not have a nutritional iron deficiency.
  • the subject has serum ferritin levels above 100
  • the subject has hepcidin levels in a range of more than 55 ng/ml. In some embodiments, the subject has IL-6 levels of more than 1.8 pg/mL. In some embodiments, the subject has serum creatinine values of more than 2 mg/dL.
  • the subject has been identified as having hemoglobin levels in the range of 1.5 to 2.0 g/dL or 2.0 to 4.0 g/dL or more below normal hemoglobin levels. In some embodiments, the subject presents with a serum hemoglobin level of less than 10 g/dL. In some embodiments, the subject presents with a serum hemoglobin level of less than 8 g/dL. In some embodiments, the administration of the hepcidin antagonist increases hemoglobin level at least Ig/dL from baseline.
  • methods of treating a subject further comprise administering to the subject one or more additional therapeutic agents, such as a growth differentiation factor (GDF) trap, an erythropoiesis stimulating agent (ESA), oral iron, intravenous iron (IV iron), a hypoxia inducible factor prolyl hydroxylase inhibitor (HIF-PHI), or a red blood cell transfusion.
  • GDF growth differentiation factor
  • ESA erythropoiesis stimulating agent
  • IV iron intravenous iron
  • HIF-PHI hypoxia inducible factor prolyl hydroxylase inhibitor
  • red blood cell transfusion e.g., red blood cell transfusion
  • GDF trap such as sotatercept or luspatercept
  • ESA erythropoietin
  • the additional therapeutic agent is oral iron.
  • the additional therapeutic agent is oral iron in a dose of about 30 mg, biweekly (twice a week).
  • the additional therapeutic agent is an HIF-PHI.
  • methods provided herein that decrease hepcidin levels or activity may be combined with oral iron therapy to facilitate restoration of iron levels.
  • such methods provided herein are useful for treating anemic subjects who are experiencing intolerance to oral iron or an unsatisfactory response to oral iron.
  • combination therapies comprising any of the disclosed hemojuvelin antagonists and one or more of a growth differentiation factor (GDF) trap, an erythropoiesis stimulating agent (ESA), oral iron, IV iron (such as MonoFerric®), a hypoxia inducible factor prolyl hydroxylase inhibitor (HIF-PHI), and a red blood cell transfusion.
  • GDF growth differentiation factor
  • ESA erythropoiesis stimulating agent
  • IV iron such as MonoFerric®
  • HIF-PHI hypoxia inducible factor prolyl hydroxylase inhibitor
  • red blood cell transfusion a red blood cell transfusion.
  • administration of any of the disclosed anti-hemojuvelin antibodies results in, or provides, an increase in hemoglobin levels in the subject at least 2, 4, 6, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more than 20 g/dL relative to an untreated subject.
  • the administration results in an increase in hemolobin level in the subject of about 17 g/dL.
  • Administration may result in an increase in reticulocyte hemoglobin (Ret-HGB) levels in the subject by at least 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.75, 0.8, 0.85, 0.9, 0.95, 1.0, or more than 1.0 pg relative to an untreated subject.
  • administration results in an increase in serum iron levels in the subject, relative to an untreated subject, of about 25, 27.5 30, 32.5, 35, 38.5, 40, or 45 pmol/L.
  • Administration may result in an increase in red blood cell (RBC) counts in the subject, relative to an untreated subject, of about 1, 2, 2.5, 3, 4, 5, 6, 7, 7.5, 8, 9, or 10 x 10 5 cells/pL.
  • RBC red blood cell
  • Administration may result in a decrease in reticulocyte (Ret) counts in the subject, relative to an untreated subject, of about 90, 100, 100, 120 or 125 x 10 9 cells/L.
  • Ret reticulocyte
  • the disclosed methods may be particularly useful for subcutaneous, intravenous, or intramuscular administration of the hemojuvelin antagonist (e.g., anti-hemojuvelin antibody). Accordingly, the disclosed methods may comprise a step of administration of the antagonist by subcutaneous, intravenous, or intramuscular injection. In exemplary embodiments, the step of administering is by subcutaneous injection. In some embodiments, the subcutaneous injection is performed as a self-administration.
  • the hemojuvelin antagonist e.g., anti-hemojuvelin antibody
  • the disclosed methods may comprise a step of administration of the antagonist by subcutaneous, intravenous, or intramuscular injection.
  • the step of administering is by subcutaneous injection.
  • the subcutaneous injection is performed as a self-administration.
  • FIGs. 1A-1G are graphs showing generation and characterization of anti-HJV antibodies.
  • FIG. 1A shows a schematic process of generation of the anti-hemojuvelin antibody, humanization, and affinity maturation.
  • FIGs. 1B-1G shows the sensorgrams by BIAcore analysis of antibodies HA, hHA-004, hHA-008, hHA-009 and hHA-011.
  • FIGs. 2A-2C are graphs showing the BMP reporter gene assay for anti-HJV antibodies.
  • FIG. 2A shows the general principle of HJV BMP reporter assay.
  • FIG. 2B shows the effect of anti-HJV antibodies in inhibiting RGMc BMP signaling.
  • FIG. 2C shows the effect of anti-HJV antibodies in inhibiting RGMa BMP signaling.
  • FIG. 3 is a graph showing anti-HJV antibodies non-specific binding to HEK293 cells. Bars from left to right in each group: 100 pg/ml, 10 pg/ml, and 1 pg/ml.
  • FIGs. 4A-4C are schematic illustrations showing the structure and designs of hHA- 008 and hHA-008-QL.
  • FIG. 4A shows the structure of hHA-008.
  • FIG. 4B shows the structure of hHA-008-QL.
  • FIG. 4C shows a comparison in antibody structure between hHA-008 and hHA-008-QL.
  • FIGs. 5A-5B are graphs showing the CD4+ T cell response peripheral blood mononuclear cells (PBMCs) challenged with hHA-008 or hHA-008-QL.
  • PBMCs peripheral blood mononuclear cells
  • FIGs. 6A-6C are graphs showing PK/PD analysis of hHA-008 in rats.
  • FIG. 6A shows maximal effect of hHA-008 measured by TSAT% occurred between 4-8 days post treatment.
  • FIG. 6B shows hHA-008 reached maximum effect as measured by TSAT% about 1-4 days after injection in female cynos.
  • FIG. 6C shows hHA-008 reached maximum effect as measured by TSAT% about 1-4 days after injection in male cynos, but one of the males did not respond to hHA-008 treatment.
  • FIGs. 8A-8C show that hHA-008 antibody modulates TSAT% in a dose-dependent manner.
  • FIG. 8A shows TSAT% and hHA008 concentrations after animals were treated with either 0 (vehicle control) or 0.6 mpk hHA-008.
  • FIG. 8B shows TSAT% and hHA-008 concentrations after animals were treated with either 0 (vehicle control) or 3 mpk hHA-008.
  • FIG. 8C shows TSAT% and hHA-008 concentrations after animals were treated with either 0 (vehicle control) or 60 mpk hHA-008.
  • FIGs. 9A-9C are graphs showing the PK/PD comparison between hHA-008 and hHA-008-QL.
  • FIG. 9A shows TS AT% changes over time in Cynos post treatment of hHA- 008 or hHA-008-QL.
  • FIG. 9A shows TSAT% changes over time in Cynos post treatment of hHA-008 or hHA-008-QL.
  • FIG. 9B shows plasma concentration of the antibodies over time in Cynos post treatment of hHA-008 or hHA-008-QL.
  • FIG. 9C shows a time course of decline of plasma concentration of hHA-008 and hHA-008-QL.
  • FIGs. 10A-10D are graphs showing binding of FcRn of hHA-008 and hHA-008- QL at pH 6.0 or 7.4.
  • FIGs. 10A-10B shows binding of FcRn of hHA-008 and hHA-008-QL at pH 6.0.
  • FIGs. 10C-10D shows binding of FcRn of hHA-008 and hHA-008-QL at pH 7.4.
  • X axis Time.
  • Y Axis Response.
  • FIG. 11 depicts a myeloproliferation cycle characteristic of certain high hepcidin disorders.
  • FIG. 12 depicts the hepcidin stimulatory pathway and the physiological regulation of iron homeostasis by hepcidin.
  • FIG. 13 is a graph showing that IL-6 induces hepcidin expression in Cynos, and hHA-008 treatment prevents inflammation-induced (IL 6) hepcidin-25 increase in a dosedependent manner.
  • FIG. 14 shows hHA-008 interacts with amino acids 170-183 (SSPMALGANATATR (SEQ ID NO: 121)) on 3720-RG-050. The interaction happens on amino acids 170, 171, 180, 182, 183 on 3720-RG-050.
  • FIGs. 15A-15J show the interaction of 3720-RG-050 and hHA-008.
  • a 3720-RG- 050 PDB structure was generated by homology using Swiss Model software.
  • 3720-RG-050 amino acids 170-183 (SSPMALGANATATR (SEQ ID NO: 121)) are shown in FIG.s 15A, 15B, 15C, 15D, 15E: ribbon/surface representation of front view (FIG. 15A); back view (FIG. 15B), side view 1 (FIG. 15C), side view 2 (FIG. 15D) and top view (FIG. 15E).
  • FIGs. 15F, FIG. 15G, FIG. 15H, FIG. 151, FIG. 15J ribbon representation of front view (FIG. 15F); back view (FIG. 15G), side view 1 (FIG. 15H), side view 2 (FIG. 151) and top view (FIG. 15J).
  • FIG. 16 shows hHA-008-QL interacts with amino acids 169-182 (TSSPMALGANATAT (SEQ ID NO: 122)) and 289-300 (SQRLSRSERNRR (SEQ ID NO: 127)) of 3720-RG-050.
  • TSSPMALGANATAT SEQ ID NO: 122
  • SQRLSRSERNRR SEQ ID NO: 127
  • FIGs. 17A-17J show the interaction 3720-RG-050/hHA-008-QL.
  • a 3720-RG-050 PDB structure was generated by homology using Swiss Model software.
  • 3720-RG-050 amino acids 169-182 (TSSPMALGANATAT (SEQ ID NO: 122)) and 289-291 (SQR) are shown in FIGs. 17A, 17B, 17C, 17D, 17E: ribbon/surface representation of front view (FIG. 17A); back view (FIG. 17B), side view 1 (FIG. 17C), side view 2 (FIG. 17D) and top view (FIG. 17E).
  • FIGs. 17F, 17G, 17H, 171, 17J ribbon representation of front view (FIG. 17F); back view (FIG. 17G), side view 1 (FIG. 17H), side view 2 (FIG. 171) and top view (FIG. 17J).
  • FIG. 18 shows that hHA-008 was effective in preventing IL-6-induced serum iron suppression in a dose-dependent manner in cynomolgus monkeys.
  • FIG. 19 shows that decline in PD response (e.g., Hepcidin-25 concentration and TSAT%) was consistent with the decrease of hHA-008 serum concentration (FIG .19) after subcutaneous administration of hHA-008 to Sprague-Dawley Rats.
  • PD response e.g., Hepcidin-25 concentration and TSAT%
  • FIGs. 20A-20D show PK/PD analysis in cynomolgus monkeys after subcutaneous administration of hHA-008.
  • FIG. 20A shows serum concentration-time profiles became indistinguishable between SC injection and IV injection 4 days after administration.
  • FIGs. 20B-20D show the return of serum iron to baseline levels was consistent with the decline in hHA-008 serum concentrations after 0.3 mpk, 0.6 mpk and 1 mpk injection of hHA-008 either by subcutaneous injection or intravenous injection.
  • FIGs. 21A and 21B illustrate functional iron deficiency in chronic kidney disease (CKD).
  • FIG. 21A depicts functional iron deficiency in the context of CKD .
  • FIG. 21B shows pathways of CKD and inflammation leading to anemia.
  • FIG. 22 depicts the hepcidin stimulatory pathway and the physiological regulation of iron homeostasis by hepcidin.
  • FIGs. 23A-23G illustrate the role of hepcidin in functional iron deficiency (FID) and examples of regulating hepcidin level by hepcidin antagonists.
  • FIG. 23A depicts the mechanism of functional iron deficiency.
  • FIG. 23B shows that functional iron deficiency is a common feature of anemia of inflammation and chronic diseases including chronic kidney disease (CKD).
  • FIG. 23C shows that functional iron deficiency is associated with high iron level and high hepcidin level.
  • FIG. 23D is a schematic illustration of decreasing hepcidin level to normal by using hepcidin antagonists for treatment of iron restriction diseases.
  • FIG. 23A depicts the mechanism of functional iron deficiency.
  • FIG. 23B shows that functional iron deficiency is a common feature of anemia of inflammation and chronic diseases including chronic kidney disease (CKD).
  • FIG. 23C shows that functional iron deficiency is associated with high iron level and high hepcidin level.
  • FIG. 23E depicts using anti-HJV antibody as one example to inhibit the HJV induced BMP signaling pathway to reduce hepcidin to normal level.
  • FIG. 23F shows that Matriptase-2 negatively regulates hepcidin by cleaving membrane bound HJV.
  • FIG. 23G depicts examples of possible hepcidin antagonists for regulation of hepcidin level.
  • FIG. 24 shows serum Fe concentrations after subcutaneous (SC) hHA-008 administrations to male and female rats as either a single 6 mg/kg or 30 mg/kg dose.
  • FIG. 25 shows serum Fe measured after either 6 mg/kg or 30 mg/kg given to rats as an intravenous (IV) or subcutaneous (SC) dose.
  • IV intravenous
  • SC subcutaneous
  • FIG. 26 shows hHA-008 pharmacokinetics after IV and SC administrations to cynomolgus monkeys — 0.3, 0.6, 1.0, and 6.0 mg/kg dose levels.
  • FIGs. 27A-27D show serum hepcidin-25 concentrations after IV and SC hHA-008 administrations — 0.3, 0.6, 1.0, and 6.0 mg/kg dose levels.
  • FIG. 28 shows hHA-008 pharmacokinetics after IV and SC administrations to cynomolgus monkeys — 0.3, 0.6, 1.0, and 6.0 mg/kg dose levels.
  • FIGs. 29A-29D show serum Fe concentrations after IV and SC hHA-008 administrations — 0.3, 0.6, 1.0, and 6.0 mg/kg dose levels.
  • FIGs. 30A-30D show transferrin saturation % (TSAT%) after IV and SC hHA-008 administrations — 0.3, 0.6, 1.0, and 6.0 mg/kg dose levels.
  • FIG. 31 is a schematic that shows the design of an in vivo study to evaluate the effects of treatment with a lead anti-hemojuvelin antibody (Anti-HJV Ab) in a rat model of anemia of CKD.
  • Anti-HJV Ab a lead anti-hemojuvelin antibody
  • FIG. 32 shows the metabolic effects of the adenine diet-induced kidney injury and anemia in the CKD rat model, following administration of an empty vehicle.
  • FIG. 33 is a series of line plots showing the variations in levels of HAMP (hepcidin gene) mRNA expression, hepcidin-25 and iron in serum of the rat models following anti-HJV Ab administration. This figure indicates that Anti-HJV Ab decreased hepcidin and increased serum iron levels in CKD rats over the course of the treatment.
  • HAMP hepcidin gene
  • FIG. 34 is a series of line plots showing the effects of Anti-HJV Ab on reticulocyte hemoglobin, mean corpuscular hemoglobin (MCH), hemoglobin (HGB), reticulocyte counts, red blood cell (RBC) counts, and mean corpuscular volume (MCV) over the course of the treatment.
  • MCH mean corpuscular hemoglobin
  • HGB hemoglobin
  • RBC red blood cell
  • MCV mean corpuscular volume
  • the disclosure provides methods of administering an effective amount of a hemojuvelin antagonist that are effective for inhibiting hepcidin function and/or reducing hepcidin expression.
  • these methods are also particularly useful for the treatment of anemia in a subject that is identified as having a level of glomerular filtration rate (GFR) of less than 90 mL/min per 1.73 m 2 .
  • GFR glomerular filtration rate
  • these methods are particularly useful for the treatment of anemia of kidney disease (such as CKD) and/or one or more symptoms or complications thereof. Accordingly, in some embodiments, these methods may be used to treat a subject having kidney disease wherein the disease is chronic or not chronic.
  • the disclosure provides compositions and methods for treating anemias that may be associated with chronic kidney disease.
  • CKD A frequent complication of CKD is anemia caused by insufficient erythropoietin (EPO) production by the damaged kidneys. As EPO production decreases the bone marrow responds by decreasing RBC counts. Other factors in CKD patients that lead to anemia are iron deficiency, blood loss, and shortened red blood cell (RBC) survival.
  • EPO erythropoietin
  • non-anemic > 12/> 13 g/dL hemoglobin (Hb) in women/men
  • anemia grade 1 (10-12/13 g/dL Hb in women/men)
  • grade 2 (8-10 g/dL Hb)
  • grade 3+ ⁇ 8 g/dL Hb
  • the etiology of anemia associated with CKD is multifactorial, arising from any one of the following causes: deficiency of EPO, impaired iron absorption (functional iron deficiency), inability to utilize stored iron, or shortened red blood cell survival.
  • Subjects suffering from anemia associated with CKD typically present with reduced endogenous EPO levels and/or functional iron deficiency.
  • Functional iron deficiency which presents at low transferrin saturation (TSAT) levels often leads to EPO resistance.
  • TSAT transferrin saturation
  • Hepcidin(-25) is a 25-amino acid protein that is filtered from the blood through the kidneys.
  • CKD patients who are not prescribed dialysis are typically conservatively managed.
  • the current standard of care in treating anemia associated with CKD includes erythropoiesis stimulating agents (ESA), iron supplementation, and RBC blood transfusions.
  • ESAs are effective and have generally shown few adverse side effects. Use of ESAs maintains target Hb levels in the majority of patients and reduce the need for blood transfusions.
  • ESAs include recombinant glycoproteins, such as Epoetin alfa (Epogen/Procrit), Darbepoetin alfa (Aranesp), Methoxy polyethylene glycol-epoetin beta (Mircera), Epoetin alfa-epbx (Retacrit); and biosimilars to Epogen/Procrit.
  • ESAs are typically administered intravenously; they may however be administered subcutaneously.
  • Iron supplementation can be in the form of intravenous (IV) iron or oral iron.
  • methods provided herein involve the use of hepicidin antagonists (e.g., hemojuvelin antagonists) in combination with erythropoiesis stimulating agents (ESA), iron supplementation, and/or RBC blood transfusions.
  • ESA erythropoiesis stimulating agents
  • CKD patients who have not been prescribed dialysis are often not in the habit of making frequent hospital visits.
  • ESAs are often administered intravenously
  • prescription of ESAs for patients having a CKD that is non-dialysis dependent often presents a significant burden in that patients must make frequent hospital visits to receive the ESA.
  • patients have reported experiencing pain during subcutaneous administration of ESAs.
  • recent concerns about the safety of ESAs, specifically higher cardiovascular risk, cancer progression and increased mortality have decreased the usage of ESAs worldwide.
  • HIF-PHI drugs a major efficacy concern of ESAs is an overcorrection of hemoglobin levels in serum, which can lead to adverse cardiovascular outcomes.
  • GFR and in turn the stage of CKD
  • ACR ACR
  • calcium levels BMI
  • BMI BMI
  • Patients having GFR values above 15 ml/min are not candidates for dialysis. In contrast, for patients having GFR values below 15 ml/min, dialysis is recommended. Patients having GFR levels below 5 or 6 must be put on dialysis immediately. See Tattersal et al., Nephrol Dial Transplant (2011) 26: 2082-2086, which is herein incorporated by reference.
  • GFR is above 15
  • other markers such as ACR, serum calcium levels, BMI, and presence of uremic symptoms such as nausea, anorexia, insomnia, and fatigue, are considered in the decision to recommend dialysis.
  • Dialysis may not be recommended when ACR is below 300. Conversely, dialysis is typically recommended in patients that present with uremic symptoms such as nausea and anorexia. See Wang et al., Renal Failure 2021 43(31): 216-222, which is herein incorporated by reference.
  • peritoneal dialysis There are two types of dialysis: hemodialysis and peritoneal dialysis.
  • peritoneal dialysis a cleansing fluid flows through a tube (catheter) into part of the abdomen.
  • the lining of the abdomen (peritoneum) acts as a filter and removes waste products from the blood. After a set period of time, the fluid with the filtered waste products flows out of the abdomen and is discarded.
  • Peritoneal dialysis can be administered in outpatient facilities of otherwise in the home by a qualified professional.
  • hemodialysis blood is removed from the body, filtered through an artificial kidney machine, and then returned to the body. Hemodialysis is typically done in hospital.
  • CKD patients on dialysis who suffer from anemia of CKD typically receive high doses of IV EPO and IV iron supplementation.
  • anemic CKD patients who are not on dialysis are treated with oral iron supplementation.
  • This iron supplementation treatment may be suspended by the physician if dialysis is ordered.
  • Oral iron may be administered at home or in an outpatient facility.
  • IV treatments e.g., intravenous antibody
  • IV treatments are burdensome because outpatient facilities are often not equipped for intravenous antibody delivery.
  • the present disclosure provides methods of treating anemia of kidney disease with a hepcidin antagonist, such as a hemojuvelin antagonist (e.g., an anti-hemojuvelin antibody).
  • a hemojuvelin antagonist e.g., an anti-hemojuvelin antibody
  • the present disclosure provides anti-hemojuvelin antibodies that have a demonstrated safety profile. For instance, in some embodiments, methods are provided that involve administration of any of the disclosed antibodies to a subject and that do not cause an overcorrection of hemoglobin levels in serum of the subject. In some embodiments, these antibodies may be formulated for subcutaneous delivery. Further, in some embodiments, the present disclosure is directed to methods for subcutaneous delivery of an anti-hemojuvelin antibody to treat anemia of CKD.
  • the present disclosure is further directed to methods for subcutaneous delivery of a hemojuvelin antagonist (e.g., an anti-hemojuvelin antibody) in the home or an outpatient facility or physician’s office, or the like, to treat anemia of CKD.
  • a hemojuvelin antagonist e.g., an anti-hemojuvelin antibody
  • the presently disclosed methods of subcutaneous administration of a hemojuvelin antagonist may be particularly suitable for CKD patients not on dialysis because subcutaneous administration may be performed in the home.
  • the presently disclosed methods may be particularly suitable for subjects that are not on dialysis, such as CKD patients not on dialysis. These methods may be suitable for CKD-NDD patients. These methods may be suitable for CKD patients on dialysis. These methods may be particularly suitable for the population of anemic CKD patients who are not on dialysis and are candidates for treatment with oral iron supplementation.
  • the presently disclosed methods may be particularly suitable for treating anemia in CKD patients not on dialysis who are identified as lacking a response (non-responsive) to oral iron (or having a CKD that is refractory to oral iron).
  • the presently disclosed methods may be particularly suitable for treating anemia in CKD patients not on dialysis who are identified as non-responsive to IV iron. These methods may be particularly suitable for treating anemia in CKD patients who have not undergone a nephrectomy (kidney removal). These methods may be particularly suitable for treating anemia in CKD patients who are not candidates for IV iron (having TSAT of less than 20% and serum iron levels of less than 20 ng/ml).
  • the disclosed antibodies may be administered to patients where any one of the following is observed: a) elevated hepcidin levels than normal (non-anemic) subjects; b) a nutritional iron deficiency (less than 100 ng/ml serum iron); or c) EPO resistance.
  • the disclosed methods are directed to treating anemia in CKD patients who exhibit a GFR above 15 ml/min. In some embodiments, the disclosed methods are directed to treating anemia in CKD patients who exhibit a GFR above 15 ml/min but below 90 ml/min.
  • the subject to which the hemojuvelin antagonist is administered is identified as having a level of GFR of in the range of 15 to less than 90 mL/min per 1.73 m 2 .
  • the subject may be identified as having a level of GFR of in the range of 15 to less than 60 mE/min per 1.73 m 2 .
  • the subject may have a level of GFR of in the range of 15 to less than 30 mL/min per 1.73 m 2 .
  • the subject may have a level of GFR of in the range of less than 30 mL/min per 1.73 m 2 , less than 15 mL/min per 1.73 m 2 , or less than 7 mL/min per 1.73 m 2 .
  • the chronic kidney disease is classified as being at a stage in the range of stages 1 to 4.
  • the CKD is classified as being at a stage in the range of stages 2 to 4.
  • the CKD is classified as being at stage 4.
  • the disclosed methods are directed to treating anemia in CKD patients who exhibit albuminuria.
  • Albuminuria refers to the presence of albumin in the urine and is determined based on the albumin-to-creatinine (ACR) ratio.
  • ACR albumin-to-creatinine
  • An ACR of less than 30 is categorized as Al albuminuria, while an ACR ranging from 30-300 is categorized as A2, and an ACR above 300 is categorized as A3.
  • the disclosed methods are directed to treating anemia in CKD patients who exhibit a ACR below 300.
  • the disclosed methods are directed to treating anemia in CKD patients who exhibit a ACR between 30 and 300.
  • the disclosed methods are directed to treating anemia in CKD patients who exhibit reduced levels of endogenous EPO. In some embodiments, the disclosed methods are directed to treating anemia in CKD patients who exhibit functional iron deficiency, or nutritional iron deficiency. In some embodiments, the disclosed methods are directed to treating anemia in CKD patients who exhibit shortened red blood cell survival. Subjects suffering from anemia associated with CKD typically present with reduced endogenous EPO levels and/or functional iron deficiency. In some embodiments, the disclosed methods are directed to treating anemia in CKD patients who exhibit reduced hepcidin levels. In some embodiments, the disclosed methods are directed to treating anemia in CKD patients who exhibit non-responsiveness to oral iron or IV iron (such as MonoFerric®).
  • oral iron or IV iron such as MonoFerric®
  • Administering means to provide a complex to a subject in a manner that is physiologically and/or pharmacologically useful (e.g., to treat a condition in the subject).
  • anemia of chronic disease refers to a haematological disorder arising in the context of an illness or condition that elicits an active immune/inflammatory response resulting in a deficiency in the ability of blood to transport oxygen.
  • Chronic conditions e.g., lasting 3 months or longer
  • inflammation may prevent the use of stored iron to product sufficient healthy red blood cells, leading to anemia.
  • ACD is the result of a deficiency in red blood cells, a deficiency in hemoglobin, and/or a deficiency in total blood volume.
  • ACD is associated with an alteration of iron metabolism and diversion of body iron (e.g., via macrophage sequestration), haemophagocytosis, reduction in erythropoiesis, and/or diminished response to erythropoietin stimulation.
  • ACD may be associated with or characterized by one or more of the following: impaired production of erythropoietin (EPO), blunted marrow erythroid response to EPO, iron-restricted erythropoiesis, and a diminished pool of EPO- responsive cells in combination with an associated chronic condition associated with inflammation.
  • EPO erythropoietin
  • ACD is an iron-restricted anemia, which may be characterized by a functional iron deficiency, which may present in a subject as a result of iron accumulation in tissue macrophages.
  • Conditions associated with ACD include diseases which share features of immune activation. Examples of conditions associated with ACD include, without limitation, chronic kidney disease and renal disease (e.g., chronic renal failure).
  • an antibody refers to a polypeptide that includes at least one immunoglobulin variable domain or at least one antigenic determinant, e.g., paratope that specifically binds to an antigen.
  • an antibody is a full- length antibody.
  • an antibody is a chimeric antibody.
  • an antibody is a humanized antibody.
  • an antibody is a Fab fragment, a F(ab')2 fragment, a Fv fragment or a scFv fragment.
  • an antibody is a nanobody derived from a camelid antibody or a nanobody derived from shark antibody.
  • an antibody is a diabody.
  • an antibody comprises a framework having a human germline sequence.
  • an antibody comprises a heavy chain constant domain selected from the group consisting of IgG, IgGl, IgG2, IgG2A, IgG2B, IgG2C, IgG3, IgG4, IgAl, IgA2, IgD, IgM, and IgE constant domains.
  • an antibody comprises a heavy (H) chain variable region (abbreviated herein as VH), and/or a light (E) chain variable region (abbreviated herein as VE).
  • an antibody comprises a constant domain, e.g., an Fc region.
  • an immunoglobulin constant domain refers to a heavy or light chain constant domain.
  • Human IgG heavy chain and light chain constant domain amino acid sequences and their functional variations are known.
  • the heavy chain of an antibody described herein can be an alpha (a), delta (A), epsilon (E), gamma (y) or mu (p) heavy chain.
  • the heavy chain of an antibody described herein can comprise a human alpha (a), delta (A), epsilon (E), gamma (y) or mu (p) heavy chain.
  • an antibody described herein comprises a human gamma 1 CHI, CH2, and/or CH3 domain.
  • the amino acid sequence of the VH domain comprises the amino acid sequence of a human gamma (y) heavy chain constant region, such as any known in the art.
  • a human constant region sequence such as any known in the art.
  • human constant region sequences have been described in the art, e.g., see U.S. Pat. No. 5,693,780 and Kabat E A et al., (1991) supra.
  • the VH domain comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or at least 99% identical to any of the variable chain constant regions provided herein.
  • an antibody is modified, e.g., modified via glycosylation, phosphorylation, sumoylation, and/or methylation.
  • an antibody is a glycosylated antibody, which is conjugated to one or more sugar or carbohydrate molecules.
  • the one or more sugar or carbohydrate molecule are conjugated to the antibody via N-glycosylation, O-glycosylation, C-glycosylation, glypiation (GPI anchor attachment), and/or phosphoglycosylation.
  • the one or more sugar or carbohydrate molecule are monosaccharides, disaccharides, oligosaccharides, or glycans.
  • the one or more sugar or carbohydrate molecule is a branched oligosaccharide or a branched glycan.
  • the one or more sugar or carbohydrate molecule includes a mannose unit, a glucose unit, an N- acetylgluco s amine unit, or a phospholipid unit.
  • an antibody is a construct that comprises a polypeptide comprising one or more antigen binding fragments of the disclosure linked to a linker polypeptide or an immunoglobulin constant domain.
  • Linker polypeptides comprise two or more amino acid residues joined by peptide bonds and are used to link one or more antigen binding portions. Examples of linker polypeptides have been reported (see e.g., Holliger, P, et al. (1993) Proc. Natl. Acad. Sci.
  • an antibody may be part of a larger immunoadhesion molecule, formed by covalent or noncovalent association of the antibody or antibody portion with one or more other proteins or peptides.
  • immunoadhesion molecules include use of the streptavidin core region to make a tetrameric scFv molecule (Kipriyanov, S. M., et al.
  • Affinity Matured Antibody is used herein to refer to an antibody with one or more alterations in one or more CDRs, which result in an improvement in the affinity (i.e. KD, kd or ka) of the antibody for a target antigen compared to a parent antibody, which does not possess the alteration(s).
  • Exemplary affinity matured antibodies will have nanomolar or even picomolar affinities for the target antigen.
  • a variety of procedures for producing affinity matured antibodies are known in the art, including the screening of a combinatory antibody library that has been prepared using bio-display.
  • Chronic kidney disease is defined by abnormalities of kidney structure or function that present in the patient for more than 3 months.
  • GFR glomerular filtration rate
  • a GFR of 60 mL/min/1.73 m 2 or higher is in the normal range.
  • the standard way to estimate GFR is an assay of creatinine levels in a blood sample. Creatinine is a waste product from the digestion of dietary protein and normal breakdown of muscle tissue.
  • a substantially reduced GFR over a duration of more than a week suggests some kidney damage.
  • a substantially reduced GFR for more than 3 months is usually diagnosed as CKD.
  • GFR is expressed in units of ml/min.
  • GFR is expressed in units of ml/min/ 1.73m 2 .
  • Estimated GFR is recommended by clinical practice guidelines for routine evaluation of GFR, whereas measured GFR is recommended as a confirmatory test when a more accurate assessment is required.
  • CKD comprises a group of pathologies that affect kidney function resulting from damage to renal structures.
  • Classification into the categories of glomerular, tubulointerstitial and vascular is based on analysis of pathological-anatomic findings from kidney biopsy or imaging. Nephron loss or fibrosis affecting glomeruli or tubules is classified as either glomerular or tubulointerstitial disease. Lastly, findings from kidney biopsy or imaging revealing alterations to renal vasculature are classified as vascular disease.
  • stage 1 There are 5 stages of CKD: Gl, G2, G3, G4 and G5 (also referred to as stage 1, stage 2, stage 3, stage 4, and stage 5).
  • stage 2 stage 3
  • stage 5 stage 5
  • the G3 stage can be broken further into sub-stages 3a and 3b.
  • the GFR rates that correspond to each stage are provided in Table 13, below:
  • CKD-NDD CKD patients who are not prescribed dialysis may be classified as being “non-dialysis dependent”, or CKD-NDD (or NDD-CKD). These patients are not undergoing dialysis (or dialytic) therapy.
  • Comorbidity refers to one or more conditions or disorders that co-occur with (or are coincident with) a primary condition (such as CKD) in an individual.
  • Albuminuria refers to the presence of albumin in the urine.
  • the albuminuria category is determined based on the albumin-to-creatinine (ACR) ratio.
  • ACR albumin-to-creatinine
  • An ACR of less than 30 is categorized as Al albuminuria, while an ACR ranging from 30-300 is categorized as A2, and an ACR above 300 is categorized as A3.
  • CDR refers to the complementarity determining region within antibody variable sequences.
  • Atypical antibody molecule comprises a heavy chain variable region (VH) and a light chain variable region (VL), which are usually involved in antigen binding.
  • VH and VL regions can be further subdivided into regions of hypervariability, also known as “complementarity determining regions” (“CDR”), interspersed with regions that are more conserved, which are known as “framework regions” (“FR”).
  • CDR complementarity determining regions
  • FR framework regions
  • Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the extent of the framework region and CDRs can be precisely identified using methodology known in the art, for example, by the Kabat definition, the IMGT definition, the Chothia definition, the AbM definition, and/or the contact definition, all of which are well known in the art. See, e.g., Kabat, E.A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; IMGT®, the international ImMunoGeneTics information system® (imgt.org), Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); Ruiz, M.
  • a CDR may refer to the CDR defined by any method known in the art. Two antibodies having the same CDR means that the two antibodies have the same amino acid sequence of that CDR as determined by the same method, for example, the IMGT definition.
  • CDR1 there are three CDRs in each of the variable regions of the heavy chain and the light chain, which are designated CDR1, CDR2 and CDR3, for each of the variable regions.
  • CDR set refers to a group of three CDRs that occur in a single variable region capable of binding the antigen. The exact boundaries of these CDRs have been defined differently according to different systems. The system described by Kabat (Kabat et al., Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987) and (1991)) not only provides an unambiguous residue numbering system applicable to any variable region of an antibody, but also provides precise residue boundaries defining the three CDRs.
  • CDRs may be referred to as Kabat CDRs.
  • Subportions of CDRs may be designated as LI, L2 and L3 or Hl, H2 and H3 where the “L” and the "H” designates the light chain and the heavy chains regions, respectively.
  • These regions may be referred to as Chothia CDRs, which have boundaries that overlap with Kabat CDRs.
  • Other boundaries defining CDRs overlapping with the Kabat CDRs have been described by Padlan (FASEB J. 9:133-139 (1995)) and MacCallum (J Mol Biol 262(5):732-45 (1996)).
  • CDR boundary definitions may not strictly follow one of the above systems, but will nonetheless overlap with the Kabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues or even entire CDRs do not significantly impact antigen binding.
  • the methods used herein may utilize CDRs defined according to any of these systems, although exemplary embodiments use Kabat or Chothia defined CDRs.
  • CDR-grafted antibody refers to antibodies which comprise heavy and light chain variable region sequences from one species but in which the sequences of one or more of the CDR regions of VH and/or VL are replaced with CDR sequences of another species, such as antibodies having murine heavy and light chain variable regions in which one or more of the murine CDRs (e.g., CDR3) has been replaced with human CDR sequences.
  • CDR-grafted antibody refers to antibodies which comprise heavy and light chain variable region sequences from one species but in which the sequences of one or more of the CDR regions of VH and/or VL are replaced with CDR sequences of another species, such as antibodies having murine heavy and light chain variable regions in which one or more of the murine CDRs (e.g., CDR3) has been replaced with human CDR sequences.
  • Chimeric antibody refers to antibodies which comprise heavy and light chain variable region sequences from one species and constant region sequences from another species, such as antibodies having murine heavy and light chain variable regions linked to human constant regions.
  • complementary refers to the capacity for precise pairing between two nucleotides or two sets of nucleotides.
  • complementary is a term that characterizes an extent of hydrogen bond pairing that brings about binding between two nucleotides or two sets of nucleotides. For example, if a base at one position of an oligonucleotide is capable of hydrogen bonding with a base at the corresponding position of a target nucleic acid (e.g., an mRNA), then the bases are considered to be complementary to each other at that position.
  • a target nucleic acid e.g., an mRNA
  • Base pairings may include both canonical Watson-Crick base pairing and non- Watson-Crick base pairing (e.g., Wobble base pairing and Hoogsteen base pairing).
  • adenosine-type bases are complementary to thymidine- type bases (T) or uracil-type bases (U)
  • cytosine-type bases are complementary to guanosine-type bases (G)
  • universal bases such as 3 -nitropyrrole or 5-nitroindole can hybridize to and are considered complementary to any A, C, U, or T.
  • Inosine (I) has also been considered in the art to be a universal base and is considered complementary to any A, C, U or T.
  • a “conservative amino acid substitution” refers to an amino acid substitution that does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made.
  • Variants can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references which compile such methods, e.g. Molecular Cloning: A Laboratory Manual, J. Sambrook, et al., eds., Fourth Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 2012, or Current Protocols in Molecular Biology, F.M. Ausubel, et al., eds., John Wiley & Sons, Inc., New York.
  • amino acids include substitutions made amongst amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D.
  • Cross-reactive As used herein and in the context of a targeting agent (e.g., antibody), the term “cross-reactive,” refers to a property of the agent being capable of specifically binding to more than one antigen of a similar type or class (e.g., antigens of multiple homologs, paralogs, or orthologs) with similar affinity or avidity.
  • an antibody that is cross-reactive against human and non-human primate antigens of a similar type or class e.g., a human hemojuvelin and non-human primate hemojuvelin
  • an antibody is cross-reactive against a human antigen and a rodent antigen of a similar type or class. In some embodiments, an antibody is cross -reactive against a rodent antigen and a non-human primate antigen of a similar type or class. In some embodiments, an antibody is cross -reactive against a human antigen, a non-human primate antigen, and a rodent antigen of a similar type or class.
  • an effective amount refers to the amount of each active agent (e.g., hepcidin antagonist, anti-HJV antibody) required to confer therapeutic effect on the subject (such as in treating anemia associated with CKD, or anemia in a subject having a certain level of GFR), either alone or in combination with one or more other active agents.
  • the therapeutic effect is reduced hepcidin level or activity, increased level of transferrin saturation (TSAT%), decreased level of circulating transferrin level, and/or alleviated disease conditions (e.g., reduced anemia).
  • Framework refers to the remaining sequences of a variable region minus the CDRs. Because the exact definition of a CDR sequence can be determined by different systems, the meaning of a framework sequence is subject to correspondingly different interpretations.
  • the six CDRs also divide the framework regions on the light chain and the heavy chain into four sub-regions (FR1, FR2, FR3 and FR4) on each chain, in which CDR1 is positioned between FR1 and FR2, CDR2 between FR2 and FR3, and CDR3 between FR3 and FR4.
  • a framework region represents the combined FRs within the variable region of a single, naturally occurring immunoglobulin chain.
  • a FR represents one of the four sub-regions, and FRs represents two or more of the four sub-regions constituting a framework region.
  • Human heavy chain and light chain acceptor sequences are known in the art. In one embodiment, the acceptor sequences known in the art may be used in the antibodies disclosed herein.
  • an exemplary method for calculating estimated GFR (eGFR) in patients is the mean of urea and creatinine clearance (CC), as calculated from a 24-hour urine collection and normalized to a human body surface area of 1.73m 2 . See Tattersal et al., Nephrol Dial Transplant (2011) 26: 2082-2086, herein incorporated by reference.
  • CC creatinine clearance
  • glomerular filtration rate refers to estimated GFR (eGFR).
  • glomerular filtration rate refers to measured GFR.
  • Hemojuvelin As used herein, the term “hemojuvelin (HJV)” (also known as repulsive guidance molecule C (RGMc) or hemochromatosis type 2 protein (HFE2)) refers to a membrane -bound and soluble form protein that regulates hepcidin production through the BMP/SMAD signaling pathway.
  • the HFE2 gene encodes two known classes of GPI- anchored and glycosylated HJV molecules, which are targeted to the membrane and undergo distinct fates. HJV exists in multiple isoforms, including two soluble isoforms and two membrane- associated isoforms.
  • a predominant membrane-associated isoform is a disulfide-linked two-chain form composed of N- and C-terminal fragments.
  • a full-length single-chain isoform associates with the membrane, but is released from the cell surface and accumulates in extracellular fluid.
  • HJV may be of human (NCBI Gene ID 148738), non-human primate (e.g., NCBI Gene ID 698805), or rodent (e.g., NCBI Gene ID 69585 or NCBI Gene ID 310681) origin.
  • the repulsive guidance molecule family includes repulsive guidance molecule A (RGMa) and repulsive guidance molecule B (RGMb).
  • RGMa and RGMb are expressed in the central nervous system during development and are thought to be involved in controlling axonal patterning and neuronal survival, while HJV is produced in the liver and in cardiac and skeletal muscle.
  • Hepcidin refers to an iron-regulating peptide hormone primarily made in the liver that is encoded by the HAMP gene.
  • hepcidin controls the delivery of iron to blood plasma from intestinal cells absorbing iron, from erythrocyte-recycling macrophages, and from iron-storing hepatocytes.
  • hepcidin inhibits iron transport by binding to the iron export channel ferroportin which is located on the basolateral surface of gut enterocytes and the plasma membrane of reticuloendothelial cells (macrophages).
  • inhibiting ferroportin prevents iron from being exported and the iron is sequestered in the cells.
  • hepcidin prevents enterocytes from allowing iron into the hepatic portal system, thereby reducing dietary iron absorption.
  • Hepcidin expression involves multiple aspects, including, for example, transcription of the HAMP gene, translation of the transcribed mRNA, and the posttranslational processing of the hepcidin precursor into the bioactive hepcidin-25 peptide (DTHFPICIFCCGCCHRSKCGMCCKT (SEQ ID NO: 129)).
  • hepcidin expression is modulated via the hemojuvelin-induced BMP signaling pathway.
  • hepcidin expression is modulated via the IL-6-JAK-STAT signaling pathway.
  • Hepcidin Antagonist refers to an agent that reduces hepcidin expression and/or hepcidin activity (directly or indirectly).
  • a hepcidin antagonist inhibits hepcidin-induced ferroportin degradation.
  • a hepcidin antagonist targets hepcidin function indirectly through the hepcidin stimulatory pathway to decrease hepcidin expression.
  • a hepcidin antagonist targets hepcidin function directly, e.g., by binding the hepcidin peptide to sequester free hepcidin or by binding ferroportin to inhibit the hepcidin- ferroportin binding interaction, thereby decreasing hepcidin-induced ferroportin degradation.
  • a hepcidin antagonist is a ferroportin inhibitor that disrupts ferroportin-hepcidin interactions, such as, for example, as disclosed in Ross SL, et al., Identification of Antibody and Small Molecule Antagonists of Ferroportin-Hepcidin Interaction. Front Pharmacol.
  • Hemojuvelin antagonist refers to a molecule that reduces expression of hemojuvelin or inhibits hemojuvelin, e.g., by binding to hemojuvelin.
  • the hemojuvelin antagonist is an antisense oligonucleotide (see, e.g., U.S. Patent No. 7,534,764; U.S. Patent Publication No. US 2014/127325; and International Publication No. WO 2016/180784, which are incorporated herein by reference).
  • the hemojuvelin antagonist is an antibody.
  • the hemojuvelin antagonist is a small molecule compound that inhibits hemojuvelin, e.g., by competitive binding and/or chemical modification of hemojuvelin.
  • HJV-induced BMP signaling refers to signaling through BMP receptors that is induced by Hemojuvelin (HJV), which is a membrane bound co-receptor for bone morphogenetic protein (BMP) signaling.
  • HJV Hemojuvelin
  • BMP bone morphogenetic protein
  • HJV binds to BMP2, BMP4, BMP5, or BMP6 to induce BMP signaling, e.g., to positively regulate hepcidin levels in hepatocytes.
  • cleavage of HJV by matripatase-2 reduces the amount of cell surface HJV available to participate in BMP signaling.
  • induction of BMP signaling by HJV is independent of neogenin.
  • neogenin facilitates induction of BMP signaling by HJV, as discussed in Zhao et al, Neogenin Facilitates the Induction of Hepcidin Expression by Hemojuvelin in the Liver, J Biol Chem.
  • BMP6 is responsible for irondependent activation of the Smad signaling.
  • BMP6 is secreted from liver sinusoidal endothelial cells and binds to a BMP receptor (BMPR) on hepatocytes and thereby activates the SMAD signaling cascade.
  • BMPR BMP receptor
  • HJV serves as a coreceptor for such BMP6, e.g., to positively regulate hepcidin levels in hepatocytes.
  • BMPs transduce signals by binding to one or a combination of type I and II serine/threonine kinase receptors.
  • BMP type II receptors include BMPRII, ActRIIA, and ActRIIB.
  • BMP type I receptors include ALK3, ALK6, and ALK2.
  • constitutively active type II receptors phosphorylate type I receptors, and type I receptors then phosphorylate intracellular receptor-activated Smads (R-Smads), namely Smad 1, Smad 5 and/or Smad 8.
  • R-Smads intracellular receptor-activated Smads
  • activated R-Smads complex with the common partner Smad4 and translocate to the nucleus to regulate gene transcription, e.g., induction of hepcidin expression.
  • Human antibody is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences.
  • the human antibodies of the disclosure may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3.
  • the term “human antibody”, as used herein is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences (e.g., CDRs grafted in a heterologous framework).
  • Humanized antibody refers to antibodies which comprise heavy and light chain variable region sequences from a non-human species (e.g., a mouse) but in which at least a portion of the VH and/or VL sequence has been altered to be more “human-like”, i.e., more similar to human germline variable sequences.
  • a non-human species e.g., a mouse
  • humanized antibody is a CDR-grafted antibody, in which human CDR sequences are introduced into non-human VH and VL sequences to replace the corresponding nonhuman CDR sequences.
  • humanized anti-hemojuvelin antibodies and antigen binding portions are provided.
  • Such antibodies may be generated by obtaining murine anti- hemojuvelin monoclonal antibodies using traditional hybridoma technology followed by humanization using in vitro genetic engineering, such as those disclosed in Kasaian et al PCT publication No. WO 2005/123126 A2.
  • Kabat numbering The terms “Kabat numbering”, “Kabat definitions and “Kabat labeling” are used interchangeably herein. These terms, which are recognized in the art, refer to a system of numbering amino acid residues which are more variable (i.e. hypervariable) than other amino acid residues in the heavy and light chain variable regions of an antibody, or an antigen binding portion thereof (Kabat et al. (1971) Ann. NY Acad, Sci. 190:382-391 and, Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
  • the hypervariable region ranges from amino acid positions 31 to 35 for CDR1, amino acid positions 50 to 65 for CDR2, and amino acid positions 95 to 102 for CDR3.
  • the hypervariable region ranges from amino acid positions 24 to 34 for CDR1, amino acid positions 50 to 56 for CDR2, and amino acid positions 89 to 97 for CDR3.
  • Kidney damage refers to structural or functional abnormalities of the kidney, with or without a decreased estimated or measured glomerular filtration rate (GFR), that manifests as pathological abnormalities or markers of kidney disease, including abnormalities in the composition of blood or urine or abnormalities in imaging tests.
  • GFR estimated or measured glomerular filtration rate
  • Oligonucleotide refers to an oligomeric nucleic acid compound of up to 200 nucleotides in length.
  • oligonucleotides include, but are not limited to, RNAi oligonucleotides (e.g., siRNAs, shRNAs), microRNAs, gapmers, mixmers, phosphorodiamidite morpholinos, peptide nucleic acids, aptamers, guide nucleic acids (e.g., Cas9 guide RNAs), etc.
  • Oligonucleotides may be single- stranded or double-stranded.
  • an oligonucleotide may comprise one or more modified nucleotides (e.g. 2'-O-methyl sugar modifications, purine or pyrimidine modifications).
  • an oligonucleotide may comprise one or more modified intemucleotide linkage.
  • an oligonucleotide may comprise one or more phosphorothioate linkages, which may be in the Rp or Sp stereochemical conformation.
  • Nephrectomy As used herein, the term “nephrectomy” refers to the removal of part or all of one or more kidneys.
  • Recombinant antibody The term “recombinant human antibody”, as used herein, is intended to include all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies expressed using a recombinant expression vector transfected into a host cell (described in more details in this disclosure), antibodies isolated from a recombinant, combinatorial human antibody library (Hoogenboom H. R., (1997) TIB Tech. 15:62-70; Azzazy H., and Highsmith W. E., (2002) Clin. Biochem. 35:425-445;
  • Selective refers to the ability of a molecule to produce an effect in relation to its target molecule compared to a reference molecule.
  • a molecule that selectively inhibits its target molecule means that this molecule is capable of inhibiting its target molecule with a degree that is distinguishable from a reference molecule in an inhibition assay or other inhibitory context.
  • inhibitor solution e.g., solution containing the selective inhibitor to be tested
  • kinase substrate is mixed with target molecule solution (e.g., ALK2) or reference molecule solution (e.g., JAK1 or JAK2), and incubated under room temperature for 1 hour. Once the reaction is terminated, the signal produced by enzymatic activity on the substrate can be measured. The half maximal inhibitor concentration for the target molecule and the reference molecule can be calculated.
  • a molecule described herein selectively binds to a target molecule.
  • a molecule described herein selectively inhibits to a target molecule. In some embodiments, a molecule described herein selectively antagonizes to a target molecule. In some embodiments, a molecule described herein selectively neutralizes to a target molecule.
  • the term “specifically binds” refers to the ability of a molecule to bind to a binding partner with a degree of affinity or avidity that enables the molecule to be used to distinguish the binding partner from an appropriate control in a binding assay or other binding context.
  • the term, “specifically binds”, refers to the ability of the antibody to bind to a specific antigen with a degree of affinity or avidity, compared with an appropriate reference antigen or antigens, that enables the antibody to be used to distinguish the specific antigen from others, e.g., to an extent that permits preferential targeting to certain cells, e.g., muscle cells, through binding to the antigen, as described herein.
  • Subject refers to a mammal.
  • a subject is non-human primate, or rodent.
  • a subject is a human.
  • a subject is a patient, e.g., a human patient that has or is suspected of having a disease.
  • the subject is a human patient who has or is suspected of having anemia associated with kidney disease and/or one or more conditions which are associated with, or may give rise to, anemia associated with kidney disease and/or a functional iron deficiency.
  • treating refers to the application or administration of a composition including one or more active agents to a subject, who has a target disease or disorder (such as anemia of CKD), a symptom of the disease/disorder, or a predisposition toward the disease/disorder, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disorder, the symptom of the disease, or the predisposition toward the disease or disorder.
  • a target disease or disorder such as anemia of CKD
  • a symptom of the disease/disorder or a predisposition toward the disease/disorder
  • Alleviating a target disease/disorder includes delaying or preventing the development or progression of the disease, or reducing disease severity.
  • the hemojuvelin antagonist binds to one or more proteins of the repulsive guidance molecule (RGM) family, including RGMa, RGMb, and RGMc (HJV). In some embodiments, the hemojuvelin antagonist selectively binds hemojuvelin (RGMc) over RGMa and RGMb. In some embodiments, the hemojuvelin antagonist is an antisense oligonucleotide that reduces expression of hemojuvelin (see, e.g., U.S. Patent No. 7,534,764; U.S. Patent Publication No. US 2014/127325; and International Publication No. WO 2016/180784, which are incorporated herein by reference). In some embodiments, the hemojuvelin antagonist is a small molecule compound that inhibits hemojuvelin, e.g., by competitive binding and/or chemical modification of hemojuvelin.
  • the hemojuvelin antagonist is an antibody (e.g., HA001- HA012) specific for hemojuvelin and/or one or more proteins of the RGM protein family (e.g., RGMa, RGMb).
  • Appropriate antibodies specific for hemojuvelin and/or one or more RGM proteins that may be useful in certain methods provided herein are provided for example, in U.S. Patent Nos. 10,118,958; and 8,507,435; U.S. Patent Publication Nos. US 2013/330343; US 2015/166672; and US 2017/029499; and International Publication Nos. WO 2015/171691; and WO 2018/009624, which are incorporated herein by reference.
  • the anti-HJV antibody described herein specifically binds to an epitope on human HJV.
  • Human HJV is a 426 amino acid protein with a predicted N- terminal signal peptide of 31 amino acids and a C-terminal GPI- attachment signal of 45 amino acids.
  • An exemplary human HJV amino acid sequence is set forth in SEQ ID NO: 128: MGEPGQSPSPRSSHGSPPTLSTLTLLLLLCGHAHSQCKILRCNAEYVSSTLSLRGGGSSGAL RGGGGGGRGGGVGSGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGP TAPPPPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFHTCR VQGAWPLLDNDFLFVQATSSPMALGANATATRKLTI IFKNMQECIDQKVYQAEVDNLPVAFE DGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTI I IRQTAGQLSFSIKVAEDVAMAFSA EQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPN FTVAAQAALEDARAFLPDLEKLHLFPSDAGVPLSSATLLAPLLSGLFVLWLC
  • the anti-HJV antibody described herein binds to different epitopes within a human HJV or a human HJV fragment.
  • the anti-HJV antibody interacts with an epitope within amino acids 160-190 of SEQ ID NO: 123. In some embodiments, the anti-HJV antibody interacts with an epitope having an amino acid sequence of amino acids 170-183 of SEQ ID NO: 123. In some embodiments, the anti-HJV antibody interacts with an epitope having the amino acid sequence of SSPMALGANATATR (SEQ ID NO: 121). In some embodiments, the anti-HJV antibody interacts with different segments within SSPMALGANATATR (SEQ ID NO: 121).
  • the anti-HJV antibody interacts with amino acids 170- 171, amino acids 171-180, amino acids 180-182, and amino acids 182-183 of SEQ ID NO: 123. In some embodiments, the antibody interacts with amino acids 170 (S), 171(S), 180 (T), 182 (T) and 183 I of SEQ ID NO: 123. In some embodiments, hHA-008 interacts with the epitope SSPMALGANATATR (SEQ ID NO: 121). In some embodiments, hHA-008 interacts with amino acids 170 (S), 171(S), 180 (T), 182 (T) and 183 (R) of SEQ ID NO: 123.
  • the anti-HJV antibody interacts with an epitope within amino acids 160-190 of SEQ ID NO: 123 and/or amino acids 280-310 of SEQ ID NO: 123. In some embodiments, the anti-HJV antibody interacts with an epitope within amino acids 169-182 of SEQ ID NO: 123 and/or amino acids 289-300 of SEQ ID NO: 123. In some embodiments, the anti-HJV antibody interacts with an epitope within amino acids 169-182 of SEQ ID NO: 123 and amino acids 289-300 of SEQ ID NO: 123.
  • the anti-HJV antibody interacts with an epitope having the amino acid sequence of TSSPMALGANATAT (SEQ ID NO: 122) and amino acid sequence SQRLSRSERNRR (SEQ ID NO: 127). In some embodiments, the anti-HJV antibody interacts with different segments within TSSPMALGANATAT (SEQ ID NO: 122) and SQRLSRSERNRR (SEQ ID NO: 127).
  • the anti-HJV antibody interacts with amino acids 169-171, amino acids 171-180, and amino acids 180-182 of SEQ ID NO: 123, and amino acids 289- 293, amino acids 293-294, amino acids 294-295, amino acids 295-297 and amino acids 297- 300 of SEQ ID NO: 123.
  • the antibody interacts with amino acids 169 (T), 170 (S), 171(S), 180 (T), 182 (T), 289 (S), 293 (S), 294 (R), 295(S), 297(R), and 300 (R) of SEQ ID NO: 123.
  • hHA-008-QL interacts with different segments within TSSPMALGANATAT (SEQ ID NO: 122) and SQRLSRSERNRR (SEQ ID NO: 127). In some embodiments, hHA-008-QL interacts with amino acids 169 (T), 170 (S), 171(S), 180 (T), 182 (T), 289 (S), 293 (S), 294 (R), 295(S), 297(R), and 300 (R) of SEQ ID NO: 123.
  • the anti-HJV antibodies described herein are affinity matured clones.
  • an anti- HJV antibody specifically binds a HJV (e.g., a human or non-human primate HJV) with binding affinity (e.g., as indicated by KD) of at least about IO -4 M, 10’ 5 M, 10’ 6 M, 10’ 7 M, 10’ 8 M, 10’ 9 M, 10’ 10 M, 10’ 11 M, 10 12 M, 10’ 13 M, or less.
  • the anti-HJV antibodies of the present disclosure can bind to a hemojuvelin protein e.g., human hemojuvelin) with an affinity between 5 pM and 500 nM, e.g., between 50 pM and 100 nM, e.g., between 500 pM and 50 nM.
  • the disclosure also includes antibodies that compete with any of the antibodies described herein for binding to a hemojuvelin protein (e.g., human hemojuvelin) and that have an affinity of 100 nM or lower (e.g., 80 nM or lower, 50 nM or lower, 20 nM or lower, 10 nM or lower, 500 pM or lower, 50 pM or lower, or 5 pM or lower).
  • the affinity and binding kinetics of the anti-HJV antibody can be tested using any suitable method including but not limited to biosensor technology (e.g., OCTET or BIACORE).
  • the anti- HJV antibodies described herein binds to HJV with a KD of sub-nanomolar range.
  • the anti- HJV antibodies described herein selectively binds to RGMc, but not RGMa or RGMb.
  • the heavy chain (HC) and light chain (LC) sequences, heavy chain variable domain (VH) and light chain variable domain (VL), CDR sequences, and heavy chain and light chain constant region sequences of non-limiting examples of anti-HJV antibodies are provided in Table 1.
  • the N-terminal of the heavy chain of the anti-HJV antibody described herein is glutamic acid (E).
  • the glutamic acid can cyclize spontaneously to pyroglutamic acid by post-translational modification. Spontaneous cyclization of glutamic acid to pyroglutamic acid has been previously described, e.g., Chelius et al., Formation of Pyroglutamic Acid From N-terminal Glutamic Acid in Immunoglobulin Gamma Antibodies, Anal Chem. 2006;78(7):2370-2376.
  • the N- terminal of the heavy chain of the anti-HJV antibody described herein is a pyroglutamic acid.
  • the anti-HJV antibodies having N-terminal pyroglutamic acid are impurities in the population of anti-HJV antibodies (e.g., less than 5%, less than 4%, less than 3%, less than 2%, less than 1%, less than 0.5%, less than 0.1%, less than 0.05%, or less than 0.01%) in the population of anti-HJV antibody.
  • the population of the anti-HJV antibodies comprises a mixture of anti-HJV antibodies having glutamic acid or pyroglutamic acid at the N-terminal of the heavy chain.
  • the anti-HJV antibodies of the present disclosure comprises one or more of the HC CDRs (e.g., HC CDR1, HC CDR2, or HC CDR3) amino acid sequences from any one of the anti-HJV antibodies selected from Table 1.
  • the anti-HJV antibodies of the present disclosure comprise the HC CDR1, HC CDR2, and HC CDR3 as provided for any one of the antibodies elected from Table 1.
  • the anti-HJV antibodies of the present disclosure comprises one or more of the EC CDRs (e.g., LC CDR1, LC CDR2, or LC CDR3) amino acid sequences from any one of the anti-HJV antibodies selected from Table 1.
  • the anti-HJV antibodies of the present disclosure comprise the LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-HJV antibodies selected from Table 1.
  • the anti-HJV antibodies of the present disclosure comprises the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-HJV antibodies selected from Table 1.
  • antibody heavy and light chain CDR3 domains may play a particularly important role in the binding specificity/affinity of an antibody for an antigen.
  • the anti-HJV antibodies of the disclosure may include at least the heavy and/or light chain CDR3s of any one of the anti- HJV antibodies selected from Table 1.
  • the isolated anti-HJV antibody comprises a heavy chain variable region that comprises a heavy chain CDR1 (HC CDR1), a heavy chain CDR2 (HC CDR2), and a heavy chain CDR3 (HC CDR3).
  • the HC CDR1 may comprise the amino acid sequence of XiYGMN (SEQ ID NO: 105), in which Xi can be N or Y.
  • the HC CDR2 may comprise the amino acid sequence of MIYYDSSX2KHYADSVKG (SEQ ID NO: 106), in which X 2 can be E or D.
  • the HC CDR3 may comprise the amino acid sequence of GX3TPDX4 (SEQ ID NO: 107), in which X3 can be T or S, and X4 can be Y, V, or K.
  • the anti-HJV antibody may comprise a light chain variable region that comprises a light chain CDR1 (LC CDR1), a light chain CDR2 (LC CDR2), and a light chain CDR3 (LC CDR3).
  • the LC CDR1 may comprise the amino acid sequence of RSSQSLXsXeSDGXyTFLXs (SEQ ID NO: 108), in which X5 can be A or E, Xe can be T, S, E, or D, X7 can be D, Y, or G, and Xs can be E or H.
  • the LC CDR2 may comprise the amino acid sequence of X9VSX10RFS (SEQ ID NO: 109), in which X9 can be E, D or A, and X10 can be N, S, T, E or H.
  • the LC CDR3 may comprise the amino acid sequence of X11QX12TX13DPX14X15 (SEQ ID NO: 110), in which Xu can be F or M, X12 can be V or A, X13 can be H or Y, X14 can be M, L or V, and X15 can be T or S.
  • a functional variant may contain one or more amino acid residue variations in the VH and/or VL, or in one or more of the HC CDRs and/or one or more of the LC CDRs as relative to the reference antibody, while retaining substantially similar binding and biological activities (e.g., substantially similar binding affinity, binding specificity, inhibitory activity, anti-inflammatory activity, or a combination thereof) as the reference antibody.
  • any of the anti-HJV antibodies of the disclosure have one or more CDRs (e.g., HC CDR or LC CDR) sequences substantially similar to any of the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and/or LC CDR3 sequences from one of the anti-HJV antibodies selected from Table 1.
  • CDRs e.g., HC CDR or LC CDR sequences substantially similar to any of the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and/or LC CDR3 sequences from one of the anti-HJV antibodies selected from Table 1.
  • the position of one or more CDRs along the VH (e.g., HC CDR1, HC CDR2, or HC CDR3) and/or VL (e.g., LC CDR1, LC CDR2, or LC CDR3) region of an antibody described herein can vary by one, two, three, four, five, or six amino acid positions so long as immuno specific binding to hemojuvelin (e.g., human hemojuvelin) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived).
  • hemojuvelin e.g., human hemojuvelin
  • the position defining a CDR of any antibody described herein can vary by shifting the N-terminal and/or C-terminal boundary of the CDR by one, two, three, four, five, or six amino acids, relative to the CDR position of any one of the antibodies described herein, so long as immuno specific binding to hemojuvelin (e.g., human hemojuvelin) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived).
  • hemojuvelin e.g., human hemojuvelin
  • the length of one or more CDRs along the VH (e.g., HC CDR1, HC CDR2, or HC CDR3) and/or VL (e.g., LC CDR1, LC CDR2, or LC CDR3) region of an antibody described herein can vary (e.g., be shorter or longer) by one, two, three, four, five, or more amino acids, so long as immuno specific binding to hemojuvelin (e.g., human hemojuvelin) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived).
  • hemojuvelin e.g., human hemojuvelin
  • a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and/or LC CDR3 described herein may be one, two, three, four, five or more amino acids shorter than one or more of the CDRs described herein (e.g., CDRS from any of the anti-HJV antibodies selected from Table 1) so long as immuno specific binding to hemojuvelin (e.g., human hemojuvelin) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived).
  • hemojuvelin e.g., human hemojuvelin
  • a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and/or LC CDR3 described herein may be one, two, three, four, five or more amino acids longer than one or more of the CDRs described herein (e.g., CDRS from any of the anti-HJV antibodies selected from Table 1) so long as immuno specific binding to hemojuvelin (e.g., human hemojuvelin) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived).
  • hemojuvelin e.g., human hemojuvelin
  • the amino portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and/or LC CDR3 described herein can be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-HJV antibodies selected from Table 1) so long as immuno specific binding to hemojuvelin (e.g., human hemojuvelin) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived).
  • hemojuvelin e.g., human hemojuvelin
  • the carboxy portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and/or LC CDR3 described herein can be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-HJV antibodies selected from Table 1) so long as immuno specific binding to hemojuvelin (e.g., human hemojuvelin) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived).
  • hemojuvelin e.g., human hemojuvelin
  • the amino portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and/or LC CDR3 described herein can be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-HJV antibodies selected from Table 1) so long as immuno specific binding to hemojuvelin (e.g., human hemojuvelin) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived).
  • hemojuvelin e.g., human hemojuvelin
  • the carboxy portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and/or LC CDR3 described herein can be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-HJV antibodies selected from Table 1) so long as immuno specific binding to hemojuvelin (e.g., human hemojuvelin) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived).
  • hemojuvelin e.g., human hemojuvelin
  • any method can be used to ascertain whether immuno specific binding to hemojuvelin (e.g., human hemojuvelin) is maintained, for example, using binding assays and conditions described in the art.
  • hemojuvelin e.g., human hemojuvelin
  • any of the anti-HJV antibodies of the disclosure have one or more CDR (e.g., HC CDR or LC CDR) sequences substantially similar to any one of the anti- HJV antibodies selected from Table 1.
  • the antibodies may include one or more CDR sequence(s) from any of the anti-HJV antibodies selected from Table 1 containing up to 5, 4, 3, 2, or 1 amino acid residue variations as compared to the corresponding CDR region in any one of the CDRs provided herein (e.g., CDRs from any of the anti-HJV antibodies selected from Table 1) so long as immuno specific binding to hemojuvelin (e.g., human hemojuvelin) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived).
  • hemojuvelin e.g., human hemojuvelin
  • any of the amino acid variations in any of the CDRs provided herein may be conservative variations.
  • any of the VH domains provided herein include one or more of the HC CDR sequences (e.g., HC CDR1, HC CDR2, and HC CDR3) provided herein, for example, any of the CDR-H sequences provided in any one of the anti-HJV selected from Table 1.
  • any of the VL domains provided herein include one or more of the CDR-L sequences (e.g., LC CDR1, LC CDR2, and LC CDR3) provided herein, for example, any of the LC CDR sequences provided in any one of the anti-HJV antibodies selected from Table 1.
  • CDR-L sequences e.g., LC CDR1, LC CDR2, and LC CDR3
  • the anti-HJV antibodies of the disclosure include any antibody that includes a heavy chain variable domain and/or a light chain variable domain of any one of the anti-HJV antibodies selected from Table 1, and variants thereof. In some embodiments, anti-HJV antibodies of the disclosure include any antibody that includes the heavy chain variable and light chain variable pairs of any anti-HJV antibodies selected from Table 1.
  • anti-HJV antibodies having a heavy chain variable (VH) and/or a light chain variable (VL) domain amino acid sequence homologous to any of those described herein.
  • the anti-HJV antibody comprises a heavy chain variable sequence or a light chain variable sequence that is at least 75% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the heavy chain variable sequence and/ or any light chain variable sequence of any one of the anti-HJV antibodies selected from Table 1.
  • the homologous heavy chain variable and/or a light chain variable amino acid sequences do not vary within any of the CDR sequences provided herein.
  • the degree of sequence variation may occur within a heavy chain variable and/or a light chain variable sequence excluding any of the CDR sequences provided herein.
  • any of the anti-HJV antibodies provided herein comprise a heavy chain variable sequence and a light chain variable sequence that comprises a framework sequence that is at least 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the framework sequence of any anti-HJV antibodies selected from Table 1.
  • the anti-HJV antibody of the present disclosure is a humanized antibody (e.g., a humanized variant containing one or more CDRs of Table 1).
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, a HC CDR3, a LC CDR1, a LC CDR2, and a LC CDR3 that are the same as the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and LC CDR3 shown in Table 1, and comprises a humanized heavy chain variable region and/or a humanized light chain variable region.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
  • the humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region or domain
  • Antibodies may have Fc regions modified as described in WO 99/58572.
  • Other forms of humanized antibodies have one or more CDRs (one, two, three, four, five, six) which are altered with respect to the original antibody, which are also termed one or more CDRs derived from one or more CDRs from the original antibody. Humanized antibodies may also involve affinity maturation.
  • humanization is achieved by grafting the CDRs (e.g., as shown in Table 1) into the human variable domains (e.g., IGKVl-NLl*01 and IGHVl-3*01 human variable domain).
  • the anti-HJV antibody of the present disclosure is a humanized variant comprising one or more amino acid substitutions (e.g., in the VH framework region) as compared with any one of the VHs listed in Table 1, and/or one or more amino acid substitutions (e.g., in the VL framework region) as compared with any one of the VLs listed in Table 1.
  • the anti-HJV antibody of the present disclosure is a humanized antibody comprising a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH of any of the anti-HJV antibodies listed in Table 1.
  • the anti-HJV antibody of the present disclosure is a humanized antibody comprising a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL of any one of the anti-HJV antibodies listed in Table 1.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 8.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, a HC CDR3 having the amino acid sequence of SEQ ID NO: 3, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 6.
  • anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 6.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 6.
  • the anti-HJV antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 2; and/or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • a HC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and/or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 6.
  • the anti-HJV antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 8.
  • the anti-HJV antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 8.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 30.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, a HC CDR3 having the amino acid sequence of SEQ ID NO: 3, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 49, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 24.
  • anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 49, and LC CDR3 having the amino acid sequence of SEQ ID NO: 24.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 49, and LC CDR3 having the amino acid sequence of SEQ ID NO: 24.
  • the anti-HJV antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 2; and/or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • a HC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 49; and/or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 24.
  • a LC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 30.
  • the anti-HJV antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 30.
  • the anti-HJV antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 30.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 31.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, a HC CDR3 having the amino acid sequence of SEQ ID NO: 3, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 18, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 25.
  • anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 18, and LC CDR3 having the amino acid sequence of SEQ ID NO: 25.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 18, and LC CDR3 having the amino acid sequence of SEQ ID NO: 25.
  • the anti-HJV antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 2; and/or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • a HC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 18; and/or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 25
  • the anti-HJV antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 31
  • the anti-HJV antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 31
  • the anti-HJV antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 31.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 32.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, a HC CDR3 having the amino acid sequence of SEQ ID NO: 3, a LC CDR1 having the amino acid sequence of SEQ ID NO: 14, a LC CDR2 having the amino acid sequence of SEQ ID NO: 19, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 25.
  • anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 14, LC CDR2 having the amino acid sequence of SEQ ID NO: 19, and LC CDR3 having the amino acid sequence of SEQ ID NO: 25.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 14, LC CDR2 having the amino acid sequence of SEQ ID NO: 19, and LC CDR3 having the amino acid sequence of SEQ ID NO: 25.
  • the anti-HJV antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 2; and/or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • a HC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 14; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 19; and/or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 25.
  • a LC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 32.
  • the anti-HJV antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 32.
  • the anti-HJV antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 32.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 33.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, a HC CDR3 having the amino acid sequence of SEQ ID NO: 3, a LC CDR1 having the amino acid sequence of SEQ ID NO: 15, a LC CDR2 having the amino acid sequence of SEQ ID NO: 20, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 26.
  • anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 15, LC CDR2 having the amino acid sequence of SEQ ID NO: 20, and LC CDR3 having the amino acid sequence of SEQ ID NO: 26.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 15, LC CDR2 having the amino acid sequence of SEQ ID NO: 20, and LC CDR3 having the amino acid sequence of SEQ ID NO: 26.
  • the anti-HJV antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 2; and/or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • a HC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 15; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 20; and/or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 26.
  • a LC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 33.
  • the anti-HJV antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 7.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 33.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 34.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 35.
  • anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 9, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 16, LC CDR2 having the amino acid sequence of SEQ ID NO: 21, and LC CDR3 having the amino acid sequence of SEQ ID NO: 27.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 9, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 16, LC CDR2 having the amino acid sequence of SEQ ID NO: 21, and LC CDR3 having the amino acid sequence of SEQ ID NO: 27.
  • the anti-HJV antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 9; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 2; and/or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • a HC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 16; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 21; and/or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 27.
  • a LC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 34.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 35.
  • the anti-HJV antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 34.
  • the anti-HJV antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 35.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 36.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 37.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 10, a HC CDR3 having the amino acid sequence of SEQ ID NO: 11, a LC CDR1 having the amino acid sequence of SEQ ID NO: 17, a LC CDR2 having the amino acid sequence of SEQ ID NO: 18, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 28.
  • anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 10, and HC CDR3 having the amino acid sequence of SEQ ID NO: 11.
  • “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 17, LC CDR2 having the amino acid sequence of SEQ ID NO: 18, and LC CDR3 having the amino acid sequence of SEQ ID NO: 28.
  • the anti- HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 17, LC CDR2 having the amino acid sequence of SEQ ID NO: 18, and LC CDR3 having the amino acid sequence of SEQ ID NO: 28.
  • the anti-HJV antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 10; and/or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 11.
  • a HC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 17; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 18; and/or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 28.
  • a LC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 36.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 37.
  • the anti-HJV antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 36.
  • the anti-HJV antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 37.
  • the anti-HJV antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 36.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 37.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 38.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 39.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, a HC CDR3 having the amino acid sequence of SEQ ID NO: 3, a LC CDR1 having the amino acid sequence of SEQ ID NO: 17, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 27.
  • anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 17, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 27.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 17, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 27.
  • the anti-HJV antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 2; and/or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • a HC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 17; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and/or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 27.
  • a LC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 38.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 39.
  • the anti-HJV antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 38.
  • the anti-HJV antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 39.
  • the anti-HJV antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 38.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 39.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 38.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 41.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, a HC CDR3 having the amino acid sequence of SEQ ID NO: 3, a LC CDR1 having the amino acid sequence of SEQ ID NO: 50, a LC CDR2 having the amino acid sequence of SEQ ID NO: 22, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 28.
  • anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 50, LC CDR2 having the amino acid sequence of SEQ ID NO: 22, and LC CDR3 having the amino acid sequence of SEQ ID NO: 28.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 50, LC CDR2 having the amino acid sequence of SEQ ID NO: 22, and LC CDR3 having the amino acid sequence of SEQ ID NO: 28.
  • the anti-HJV antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 2; and/or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 3.
  • a HC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 50; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 22; and/or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 28.
  • a LC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 38.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 41.
  • the anti-HJV antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 38.
  • the anti-HJV antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 41.
  • the anti-HJV antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 38.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 41.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 42.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 43.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, a HC CDR3 having the amino acid sequence of SEQ ID NO: 12, a LC CDR1 having the amino acid sequence of SEQ ID NO: 15, a LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 27.
  • anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 12.
  • “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 15, LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and LC CDR3 having the amino acid sequence of SEQ ID NO: 27.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 12.
  • the anti- HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 15, LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and LC CDR3 having the amino acid sequence of SEQ ID NO: 27.
  • the anti-HJV antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 2; and/or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 12.
  • a HC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 15; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 23; and/or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 27.
  • a LC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 42.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 43.
  • the anti-HJV antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 42.
  • the anti-HJV antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 43.
  • the anti-HJV antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 42.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 43.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 44.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 45.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, a HC CDR3 having the amino acid sequence of SEQ ID NO: 13, a LC CDR1 having the amino acid sequence of SEQ ID NO: 16, a LC CDR2 having the amino acid sequence of SEQ ID NO: 21, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 29.
  • anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 13.
  • “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range.
  • the anti-HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 16, LC CDR2 having the amino acid sequence of SEQ ID NO: 21, and LC CDR3 having the amino acid sequence of SEQ ID NO: 29.
  • the anti-HJV antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 13.
  • the anti- HJV antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 16, LC CDR2 having the amino acid sequence of SEQ ID NO: 21, and LC CDR3 having the amino acid sequence of SEQ ID NO: 29.
  • the anti-HJV antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 2; and/or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 13.
  • a HC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 16; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 21; and/or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 29.
  • a LC CDR1 having no more than 3 amino acid variations e.g., no more than 3, 2, or 1 amino acid variation
  • the anti-HJV antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 44.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 45.
  • the anti-HJV antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 44.
  • the anti-HJV antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 45.
  • the anti-HJV antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 44.
  • the anti-HJV antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 45.
  • the CDRs of an antibody may have different amino acid sequences when different definition systems are used (e.g., the IMGT definition, the Kabat definition, or the Chothia definition).
  • a definition system annotates each amino acid in a given antibody sequence (e.g., VH or VL sequence) with a number, and numbers corresponding to the heavy chain and light chain CDRs are provided in Table 2.
  • the CDRs listed in Table 1 are defined in accordance with the Kabat definition.
  • One skilled in the art is able to derive the CDR sequences using the different numbering systems for the anti-HJV antibodies provided in Table 2.
  • the anti-HJV antibody of the present disclosure is a chimeric antibody, which can include a heavy constant region and a light constant region from a human antibody.
  • Chimeric antibodies refer to antibodies having a variable region or part of variable region from a first species and a constant region from a second species.
  • the variable region of both light and heavy chains mimics the variable regions of antibodies derived from one species of mammals (e.g., a non-human mammal such as mouse, rabbit, and rat), while the constant portions are homologous to the sequences in antibodies derived from another mammal such as human.
  • the anti-HJV antibody described herein is a chimeric antibody, which can include a heavy constant region and a light constant region from a human antibody.
  • Chimeric antibodies refer to antibodies having a variable region or part of variable region from a first species and a constant region from a second species.
  • the variable region of both light and heavy chains mimics the variable regions of antibodies derived from one species of mammals (e.g., a non-human mammal such as mouse, rabbit, and rat), while the constant portions are homologous to the sequences in antibodies derived from another mammal such as human.
  • the anti-HJV antibody of the present disclosure comprises a VL domain and/or VH domain of any one of the anti-HJV antibodies selected from Table 1, and comprises a constant region comprising the amino acid sequences of the constant regions of an IgG, IgE, IgM, IgD, IgA or IgY immunoglobulin molecule, any class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2), or any subclass (e.g., IgG2a and IgG2b) of immunoglobulin molecule.
  • any class e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2
  • subclass e.g., IgG2a and IgG2b
  • Non-limiting examples of human constant regions are described in the art, e.g., see Kabat E A et al., (1991) supra.
  • the human IgGl constant region sequences below e.g., SEQ ID NO: 48, SEQ ID NO: 112, SEQ ID NO: 113, and SEQ ID NO: 130
  • SEQ ID NO: 48, SEQ ID NO: 112, SEQ ID NO: 113, and SEQ ID NO: 130 are variants of (e.g., having between 1 and 5 amino acids that differ from) the heavy chain constant region sequence set forth in SEQ ID NO: 46.
  • An example of a human IgGl constant region is given below:
  • the heavy chain of any of the anti-HJV antibodies described herein comprises a mutant human IgGl constant region.
  • LALA mutations a mutant derived from mAb bl2 that has been mutated to replace the lower hinge residues Leu234 Leu235 with Ala234 and Ala235
  • the mutant human IgGl constant region is provided below (mutations bonded and underlined):
  • the heavy chain of any of the anti-HJV antibodies described herein further comprises mutations in human IgGl constant region.
  • human IgGl constant region For example, the introduction of T250Q and M248L substitutions. In some embodiments, such substitution may affect FcRn binding and serum half-life (W02005047307 and W02013063110).
  • An exemplary IgGl constant region comprising the LALA mutation and the QL mutation is provided below (mutations bonded and underlined):
  • a human IgGl constant region within a secreted antibody can be: ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF LFPPKPKDTLMI SRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRW SVLTVLHQDWLNGKEYKCKVSNKALPAP IEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK
  • a mutant human IgGl comprising the LALA mutations in a secreted antibody can be: ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVF LFPPKPKDTLMI SRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRW SVLTVLHQDWLNGKEYKCKVSNKALPAP IEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSPG (SEQ ID NO: 112)
  • a mutant human IgGl comprising the LALA mutations and the QL mutations can be: ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVF LFPPKPKDQLMI SRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRW SVLTVLHQDWLNGKEYKCKVSNKALPAP IEKTI SKAKGQPREPQVYTLPPSREEMTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV LHEALHNHYTQKSLSPG (SEQ ID NO: 113)
  • the light chain of any of the anti-HJV antibodies described herein may further comprise a light chain constant region (CL), which can be any CL known in the art.
  • CL is a kappa light chain.
  • the CL is a lambda light chain.
  • the CL is a kappa light chain, the sequence of which is provided below: RTVAAPSVFIFPPSDEQLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 47)
  • the anti-HJV antibody described herein comprises a heavy chain comprising any one of the VH as listed in Table 1 or any variants thereof and a heavy chain constant region that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 112, SEQ ID NO: 113, or SEQ ID NO: 130.
  • the anti-HJV antibody described herein comprises a heavy chain comprising any one of the VH as listed in Table 1 or any variants thereof and a heavy chain constant region that contains no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 112, SEQ ID NO: 113, or SEQ ID NO: 130.
  • the anti-HJV antibody described herein comprises a heavy chain comprising any one of the VH as listed in Table 1 or any variants thereof and a heavy chain constant region as set forth in SEQ ID NO: 46.
  • the anti-HJV antibody described herein comprises heavy chain comprising any one of the VH as listed in Table 1 or any variants thereof and a heavy chain constant region as set forth in SEQ ID NO: 48. In some embodiments, the anti-HJV antibody described herein comprises heavy chain comprising any one of the VH as listed in Table 1 or any variants thereof and a heavy chain constant region as set forth in SEQ ID NO: 112. In some embodiments, the anti-HJV antibody described herein comprises heavy chain comprising any one of the VH as listed in Table 1 or any variants thereof and a heavy chain constant region as set forth in SEQ ID NO: 113. In some embodiments, the anti-HJV antibody described herein comprises heavy chain comprising any one of the VH as listed in Table 1 or any variants thereof and a heavy chain constant region as set forth in SEQ ID NO: 130.
  • the anti-HJV antibody described herein comprises a light chain comprising any one of the VL as listed in Table 1 or any variants thereof and a light chain constant region that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to SEQ ID NO: 47.
  • the anti-HJV antibody described herein comprises a light chain comprising any one of the VL as listed in Table 1 or any variants thereof and a light chain constant region contains no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with SEQ ID NO: 47.
  • the anti- HJV antibody described herein comprises a light chain comprising any one of the VL as listed in Table 1 or any variants thereof and a light chain constant region set forth in SEQ ID NO: 47.
  • the anti-HJV antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in any one of SEQ ID NOs: 51, 57, 59, 61, 63, 66, 68, 114, 115, 116, 117, 118, 119 or 120.
  • the anti-HJV antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in any one of SEQ ID NOs: 52, 53, 54, 55, 56, 58, 60, 62, 65, 67 or 69.
  • 20 amino acid variations e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation
  • the anti-HJV antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 51, 57, 59, 61, 63, 66, 68, 114, 115, 116, 117, 118, 119 or 120.
  • the anti-HJV antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 52, 53, 54, 55, 56, 58, 60, 62, 65, 67 or 69.
  • the anti-HJV antibody described herein comprises a heavy chain comprising the amino acid sequence of any one of SEQ ID NOs: 51, 57, 59, 61, 63, 66, 68, 114, 115, 116, 117, 118, 119 or 120.
  • the anti-HJV antibody described herein comprises a light chain comprising the amino acid sequence of any one of SEQ ID NOs: 52, 53, 54, 55, 56, 58, 60, 62, 65, 67 or 69.
  • the anti-HJV antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in any one of SEQ ID NOs: 51 or 114.
  • the anti-HJV antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in any one of SEQ ID NOs: 52.
  • the anti-HJV antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 51 or 114.
  • the anti-HJV antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 52.
  • the anti-HJV antibody described herein comprises a heavy chain comprising the amino acid sequence of any one of SEQ ID NOs: 51 or 114.
  • the anti-HJV antibody described herein comprises a light chain comprising the amino acid sequence of any one of SEQ ID NOs: 52.
  • the anti-HJV antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in any one of SEQ ID NOs: 51 or 114.
  • the anti-HJV antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in any one of SEQ ID NOs: 53.
  • the anti-HJV antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 51 or 114.
  • the anti-HJV antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 53.
  • the anti-HJV antibody described herein comprises a heavy chain comprising the amino acid sequence of any one of SEQ ID NOs: 51 or 114.
  • the anti-HJV antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in any one of SEQ ID NOs: 54.
  • the anti-HJV antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 51 or 114.
  • the anti-HJV antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 54.
  • the anti-HJV antibody described herein comprises a heavy chain comprising the amino acid sequence of any one of SEQ ID NOs: 51 or 114.
  • the anti-HJV antibody described herein comprises a light chain comprising the amino acid sequence of any one of SEQ ID NOs: 54.
  • the anti-HJV antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in any one of SEQ ID NOs: 51 or 114.
  • the anti-HJV antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in any one of SEQ ID NOs: 55.
  • the anti-HJV antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 51 or 114.
  • the anti-HJV antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 55.
  • the anti-HJV antibody described herein comprises a heavy chain comprising the amino acid sequence of any one of SEQ ID NOs: 51 or 114.
  • the anti-HJV antibody described herein comprises a light chain comprising the amino acid sequence of any one of SEQ ID NOs: 55.
  • the anti-HJV antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in any one of SEQ ID NOs: 51 or 114.
  • the anti-HJV antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in any one of SEQ ID NOs: 56.
  • the anti-HJV antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 51 or 114.
  • the anti-HJV antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 56.
  • the anti-HJV antibody described herein comprises a heavy chain comprising the amino acid sequence of any one of SEQ ID NOs: 51 or 114.
  • the anti-HJV antibody described herein comprises a light chain comprising the amino acid sequence of any one of SEQ ID NOs: 56.
  • the anti-HJV antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in any one of SEQ ID NOs: 57 or 115.
  • the anti-HJV antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in any one of SEQ ID NOs: 58.
  • the anti-HJV antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 57 or 115.
  • the anti-HJV antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 58.
  • the anti-HJV antibody described herein comprises a heavy chain comprising the amino acid sequence of any one of SEQ ID NOs: 57 or 115.
  • the anti-HJV antibody described herein comprises a light chain comprising the amino acid sequence of any one of SEQ ID NOs: 58.
  • the anti-HJV antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in any one of SEQ ID NOs: 59 or 116.
  • the anti-HJV antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in any one of SEQ ID NOs: 60.
  • the anti-HJV antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 59 or 116.
  • the anti-HJV antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 60.
  • the anti-HJV antibody described herein comprises a heavy chain comprising the amino acid sequence of any one of SEQ ID NOs: 59 or 116.
  • the anti-HJV antibody described herein comprises a light chain comprising the amino acid sequence of any one of SEQ ID NOs: 60.
  • the anti-HJV antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in any one of SEQ ID NOs: 61 or 117.
  • the anti-HJV antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in any one of SEQ ID NOs: 62.
  • the anti-HJV antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 61 or 117.
  • the anti-HJV antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 62.
  • the anti-HJV antibody described herein comprises a heavy chain comprising the amino acid sequence of any one of SEQ ID NOs: 61 or 117.
  • the anti-HJV antibody described herein comprises a light chain comprising the amino acid sequence of any one of SEQ ID NOs: 62.
  • the anti-HJV antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in any one of SEQ ID NOs: 63 or 118.
  • the anti-HJV antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in any one of SEQ ID NOs: 62.
  • the anti-HJV antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 63 or 118.
  • the anti-HJV antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 62.
  • the anti-HJV antibody described herein comprises a heavy chain comprising the amino acid sequence of any one of SEQ ID NOs: 63 or 118.
  • the anti-HJV antibody described herein comprises a light chain comprising the amino acid sequence of any one of SEQ ID NOs: 62.
  • the anti-HJV antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in any one of SEQ ID NOs: 61 or 117.
  • the anti-HJV antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in any one of SEQ ID NOs: 65.
  • the anti-HJV antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 61 or 117.
  • the anti-HJV antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in any one of SEQ ID NOs: 66 or 119.
  • the anti-HJV antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in any one of SEQ ID NOs: 67.
  • the anti-HJV antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 66 or 119.
  • the anti-HJV antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 67.
  • the anti-HJV antibody described herein comprises a heavy chain comprising the amino acid sequence of any one of SEQ ID NOs: 66 or 119.
  • the anti-HJV antibody described herein comprises a light chain comprising the amino acid sequence of any one of SEQ ID NOs: 67.
  • the anti-HJV antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in any one of SEQ ID NOs: 68 or 120.
  • the anti-HJV antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in any one of SEQ ID NOs: 69.
  • the anti-HJV antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 68 or 120.
  • the anti-HJV antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 69.
  • the anti-HJV antibody described herein comprises a heavy chain comprising the amino acid sequence of any one of SEQ ID NOs: 68 or 120.
  • the anti-HJV antibody described herein comprises a light chain comprising the amino acid sequence of any one of SEQ ID NOs: 69.
  • the anti-HJV antibodies described herein can be in any antibody form, including, but not limited to, intact (i.e., full-length) antibodies, antigen-binding fragments thereof (such as Fab, F’ab'), F’ab')2, Fv), single chain antibodies, bi-specific antibodies, or nanobodies.
  • the anti-HJV antibody described herein is a scFv.
  • the anti-HJV antibody described herein is a scFv-Fab (e.g., scFv fused to a portion of a constant region).
  • conservative mutations can be introduced into antibody sequences (e.g., CDRs or framework sequences) at positions where the residues are not likely to be involved in interacting with a target antigen (e.g., hemojuvelin), for example, as determined based on a crystal structure.
  • a target antigen e.g., hemojuvelin
  • one, two or more mutations are introduced into the Fc region of an anti-HJV antibody described herein (e.g., in a CH2 domain (residues 231-340 of human IgGl) and/or CH3 domain (residues 341-447 of human IgGl) and/or the hinge region, with numbering according to the Kabat numbering system (e.g., the EU index in Kabat)) to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding and/or antigen-dependent cellular cytotoxicity.
  • Kabat numbering system e.g., the EU index in Kabat
  • one, two or more mutations are introduced into the hinge region of the Fc region (CHI domain) such that the number of cysteine residues in the hinge region are altered (e.g., increased or decreased) as described in, e.g., U.S. Pat. No. 5,677,425.
  • the number of cysteine residues in the hinge region of the CHI domain can be altered to, e.g., facilitate assembly of the light and heavy chains, or to alter (e.g., increase or decrease) the stability of the antibody or to facilitate linker conjugation.
  • one, two or more mutations are introduced into the Fc region of a muscle-targeting antibody described herein (e.g., in a CH2 domain (residues 231-340 of human IgGl) and/or CH3 domain (residues 341-447 of human IgGl) and/or the hinge region, with numbering according to the Kabat numbering system (e.g., the EU index in Kabat)) to increase or decrease the affinity of the antibody for an Fc receptor (e.g., an activated Fc receptor) on the surface of an effector cell.
  • an Fc receptor e.g., an activated Fc receptor
  • Mutations in the Fc region of an antibody that decrease or increase the affinity of an antibody for an Fc receptor and techniques for introducing such mutations into the Fc receptor or fragment thereof are known to one of skill in the art. Examples of mutations in the Fc receptor of an antibody that can be made to alter the affinity of the antibody for an Fc receptor are described in, e.g., Smith P et al., (2012) PNAS 109: 6181-6186, U.S. Pat. No. 6,737,056, and International Publication Nos. WO 02/060919; WO 98/23289; and WO 97/34631, which are incorporated herein by reference.
  • one, two or more amino acid mutations are introduced into an IgG constant domain, or FcRn-binding fragment thereof (e.g., an Fc or hinge-Fc domain fragment) to alter (e.g., decrease or increase) half-life of the antibody in vivo.
  • an IgG constant domain, or FcRn-binding fragment thereof e.g., an Fc or hinge-Fc domain fragment
  • alter e.g., decrease or increase
  • half-life of the antibody in vivo See, e.g., International Publication Nos. WO 02/060919; WO 98/23289; and WO 97/34631; and U.S. Pat. Nos. 5,869,046, 6,121,022, 6,277,375 and 6,165,745 for examples of mutations that will alter e.g., decrease or increase) the half-life of an antibody in vivo.
  • one, two or more amino acid mutations are introduced into an IgG constant domain, or FcRn-binding fragment thereof (e.g., an Fc or hinge-Fc domain fragment) to decrease the half-life of the anti-HJV antibody in vivo.
  • one, two or more amino acid mutations are introduced into an IgG constant domain, or FcRn-binding fragment thereof (e.g., an Fc or hinge-Fc domain fragment) to increase the half-life of the antibody in vivo.
  • the antibodies can have one or more amino acid mutations (e.g., substitutions) in the second constant (CH2) domain (residues 231-340 of human IgGl) and/or the third constant (CH3) domain (residues 341-447 of human IgGl), with numbering according to the EU index in Kabat (Kabat E A et al., (1991) supra).
  • substitutions e.g., substitutions in the second constant (CH2) domain
  • CH3 domain residues 341-447 of human IgGl
  • the constant region of the IgGl of an antibody described herein comprises a methionine (M) to tyrosine (Y) substitution in position 252, a serine (S) to threonine (T) substitution in position 254, and a threonine (T) to glutamic acid (E) substitution in position 256, numbered according to the EU index as in Kabat. See U.S. Pat. No. 7,658,921, which is incorporated herein by reference.
  • an antibody comprises an IgG constant domain comprising one, two, three or more amino acid substitutions of amino acid residues at positions 251-257, 285-290, 308-314, 385-389, and 428-436, numbered according to the EU index as in Kabat. [00267] In some embodiments, one, two or more amino acid substitutions are introduced into an IgG constant domain Fc region to alter the effector function(s) of the anti-HJV antibody.
  • the effector ligand to which affinity is altered can be, for example, an Fc receptor or the Cl component of complement. This approach is described in further detail in U.S. Pat. Nos. 5,624,821 and 5,648,260.
  • the deletion or inactivation (through point mutations or other means) of a constant region domain can reduce Fc receptor binding of the circulating antibody thereby increasing tumor localization. See, e.g., U.S. Pat. Nos. 5,585,097 and 8,591,886 for a description of mutations that delete or inactivate the constant domain and thereby increase tumor localization.
  • one or more amino acid substitutions may be introduced into the Fc region of an antibody described herein to remove potential glycosylation sites on Fc region, which may reduce Fc receptor binding (see, e.g., Shields R L et al., (2001) J Biol Chem 276: 6591-604).
  • one or more amino in the constant region of an anti-HJV antibody described herein can be replaced with a different amino acid residue such that the antibody has altered Clq binding and/or reduced or abolished complement dependent cytotoxicity (CDC).
  • CDC complement dependent cytotoxicity
  • one or more amino acid residues in the N-terminal region of the CH2 domain of an antibody described herein are altered to thereby alter the ability of the antibody to fix complement. This approach is described further in International Publication No. WO 94/29351.
  • the Fc region of an antibody described herein is modified to increase the ability of the antibody to mediate antibody dependent cellular cytotoxicity (ADCC) and/or to increase the affinity of the antibody for an Fey receptor.
  • ADCC antibody dependent cellular cytotoxicity
  • the heavy and/or light chain variable domain(s) sequence(s) of the antibodies provided herein can be used to generate, for example, CDR-grafted, chimeric, humanized, or composite human antibodies or antigen-binding fragments, as described elsewhere herein.
  • any variant, CDR-grafted, chimeric, humanized, or composite antibodies derived from any of the antibodies provided herein may be useful in the compositions and methods described herein and will maintain the ability to specifically bind hemojuvelin, such that the variant, CDR- grafted, chimeric, humanized, or composite antibody has at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% or more binding to hemojuvelin relative to the original antibody from which it is derived.
  • the antibodies provided herein comprise mutations that confer desirable properties to the antibodies.
  • the antibodies provided herein may comprise a stabilizing ‘Adair’ mutation (Angal S., et al., “A single amino acid substitution abolishes the heterogeneity of chimeric mouse/human (IgG4) antibody,” Mol Immunol 30, 105-108; 1993), where serine 228 (EU numbering; residue 241 Kabat numbering) is converted to proline resulting in an IgGl-like hinge sequence.
  • any of the antibodies may include a stabilizing ‘Adair’ mutation.
  • an antibody is modified, e.g., modified via glycosylation, phosphorylation, sumoylation, and/or methylation.
  • an antibody is a glycosylated antibody, which is conjugated to one or more sugar or carbohydrate molecules.
  • the one or more sugar or carbohydrate molecule are conjugated to the antibody via N-glycosylation, O-glycosylation, C-glycosylation, glypiation (GPI anchor attachment), and/or phosphoglycosylation.
  • the one or more sugar or carbohydrate molecules are monosaccharides, disaccharides, oligosaccharides, or glycans.
  • the one or more sugar or carbohydrate molecule is a branched oligosaccharide or a branched glycan.
  • the one or more sugar or carbohydrate molecule includes a mannose unit, a glucose unit, an N-acetylglucosamine unit, an N-acetylgalactosamine unit, a galactose unit, a fucose unit, or a phospholipid unit.
  • a glycosylated antibody is fully or partially glycosylated.
  • any one of the anti-HJV antibodies described herein may comprise a signal peptide in the heavy and/or light chain sequence (e.g., a N-terminal signal peptide).
  • the anti-HJV antibody described herein comprises any one of the VH and VL sequences, any one of the IgG heavy chain and light chain sequences, or any one of the F’ab') heavy chain and light chain sequences described herein, and further comprises a signal peptide (e.g., a N-terminal signal peptide).
  • the signal peptide comprises the amino acid sequence of MEFGLSWLFLVAILKGVQC (SEQ ID NO: 104).
  • Antibodies capable of binding hemojuvelin as described herein can be made by any method known in the art. See, for example, Harlow and Lane, (1998) Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York.
  • antibodies specific to a target antigen can be made by the conventional hybridoma technology.
  • the full-length target antigen or a fragment thereof, optionally coupled to a carrier protein such as KLH, can be used to immunize a host animal for generating antibodies binding to that antigen.
  • the route and schedule of immunization of the host animal are generally in keeping with established and conventional techniques for antibody stimulation and production, as further described herein.
  • General techniques for production of mouse, humanized, and human antibodies are known in the art and are described herein. It is contemplated that any mammalian subject including humans or antibody producing cells therefrom can be manipulated to serve as the basis for production of mammalian, including human hybridoma cell lines.
  • the host animal is inoculated intraperitoneally, intramuscularly, orally, subcutaneously, intraplantar, and/or intradermally with an amount of immunogen, including as described herein.
  • an antibody (monoclonal or polyclonal) of interest may be sequenced and the polynucleotide sequence may then be cloned into a vector for expression or propagation.
  • the sequence encoding the antibody of interest may be maintained in vector in a host cell and the host cell can then be expanded and frozen for future use.
  • the polynucleotide sequence may be used for genetic manipulation to “humanize” the antibody or to improve the affinity (affinity maturation), or other characteristics of the antibody.
  • the constant region may be engineered to more resemble human constant regions to avoid immune response if the antibody is used in clinical trials and treatments in humans.
  • F(ab')2 fragments can be produced by pepsin digestion of an antibody molecule, and Fab fragments that can be generated by reducing the disulfide bridges of F(ab')2 fragments.
  • Genetically engineered antibodies such as humanized antibodies, chimeric antibodies, single-chain antibodies, and bi-specific antibodies, can be produced via, e.g., conventional recombinant technology.
  • DNA encoding a monoclonal antibodies specific to a target antigen can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies).
  • the hybridoma cells serve as an exemplary source of such DNA.
  • the DNA may be placed into one or more expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, human HEK293 cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. See, e.g., PCT Publication No. WO 87/04462.
  • the DNA can then be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences, Morrison et al., (1984) Proc. Nat.
  • genetically engineered antibodies such as “chimeric” or “hybrid” antibodies; can be prepared that have the binding specificity of a target antigen.
  • a single-chain antibody can be prepared via recombinant technology by linking a nucleotide sequence coding for a heavy chain variable region and a nucleotide sequence coding for a light chain variable region.
  • a flexible linker is incorporated between the two variable regions.
  • Antibodies obtained following a method known in the art and described herein can be characterized using methods well known in the art. For example, one method is to identify the epitope to which the antigen binds, or “epitope mapping.” There are many methods known in the art for mapping and characterizing the location of epitopes on proteins, including solving the crystal structure of an antibody-antigen complex, competition assays, gene fragment expression assays, and synthetic peptide-based assays, as described, for example, in Chapter 11 of Harlow and Lane, Using Antibodies, a Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1999.
  • epitope mapping can be accomplished use H/D-Ex (hydrogen deuterium exchange) coupled with proteolysis and mass spectrometry.
  • epitope mapping can be used to determine the sequence to which an antibody binds.
  • the epitope can be a linear epitope, i.e., contained in a single stretch of amino acids, or a conformational epitope formed by a three- dimensional interaction of amino acids that may not necessarily be contained in a single stretch (primary structure linear sequence).
  • Peptides of varying lengths e.g., at least 4-6 amino acids long
  • the epitope to which the antibody binds can be determined in a systematic screening by using overlapping peptides derived from the target antigen sequence and determining binding by the antibody.
  • the gene fragment expression assays the open reading frame encoding the target antigen is fragmented either randomly or by specific genetic constructions and the reactivity of the expressed fragments of the antigen with the antibody to be tested is determined.
  • the gene fragments may, for example, be produced by PCR and then transcribed and translated into protein in vitro, in the presence of radioactive amino acids. The binding of the antibody to the radioactively labeled antigen fragments is then determined by immunoprecipitation and gel electrophoresis.
  • Certain epitopes can also be identified by using large libraries of random peptide sequences displayed on the surface of phage particles (phage libraries). Alternatively, a defined library of overlapping peptide fragments can be tested for binding to the test antibody in simple binding assays. In an additional example, mutagenesis of an antigen binding domain, domain swapping experiments and alanine scanning mutagenesis can be performed to identify residues required, sufficient, and/or necessary for epitope binding. Alternatively, competition assays can be performed using other antibodies known to bind to the same antigen to determine whether an antibody binds to the same epitope as the other antibodies. Competition assays are well known to those of skill in the art.
  • an anti-HJV antibody is prepared by recombinant technology as exemplified below.
  • Nucleic acids encoding the heavy and light chain of an anti-HJV antibody as described herein can be cloned into one expression vector, each nucleotide sequence being in operable linkage to a suitable promoter.
  • each of the nucleotide sequences encoding the heavy chain and light chain is in operable linkage to a distinct promoter.
  • the nucleotide sequences encoding the heavy chain and the light chain can be in operable linkage with a single promoter, such that both heavy and light chains are expressed from the same promoter.
  • an internal ribosomal entry site IRS
  • the nucleotide sequences encoding the two chains of the antibody are cloned into two vectors, which can be introduced into the same or different cells.
  • the two chains are expressed in different cells, each of them can be isolated from the host cells expressing such and the isolated heavy chains and light chains can be mixed and incubated under suitable conditions allowing for the formation of the antibody.
  • a nucleic acid sequence encoding one or all chains of an antibody can be cloned into a suitable expression vector in operable linkage with a suitable promoter using methods known in the art.
  • the nucleotide sequence and vector can be contacted, under suitable conditions, with a restriction enzyme to create complementary ends on each molecule that can pair with each other and be joined together with a ligase.
  • synthetic nucleic acid linkers can be ligated to the termini of a gene. These synthetic linkers contain nucleic acid sequences that correspond to a particular restriction site in the vector. The selection of expression vectors/promoter would depend on the type of host cells for use in producing the antibodies.
  • a variety of promoters can be used for expression of the antibodies described herein, including, but not limited to, cytomegalovirus (CMV) intermediate early promoter, a viral LTR such as the Rous sarcoma virus LTR, HIV-LTR, HTLV-1 LTR, the simian virus 40 (SV40) early promoter, E. coli lac UV promoter, and the herpes simplex tk virus promoter.
  • CMV cytomegalovirus
  • a viral LTR such as the Rous sarcoma virus LTR, HIV-LTR, HTLV-1 LTR
  • SV40 simian virus 40
  • E. coli lac UV promoter E. coli lac UV promoter
  • herpes simplex tk virus promoter the herpes simplex tk virus promoter.
  • Regulatable promoters can also be used.
  • Such regulatable promoters include those using the lac repressor from E. coli as a transcription modulator to regulate transcription from lac operator bearing mammalian cell promoters [Brown, M. et al., Cell, 49:603-612 (1987)], those using the tetracycline repressor (tetR) [Gossen, M., and Bujard, H., Proc. Natl. Acad. Sci. USA 89:5547-555115 (1992); Yao, F. et al., Human Gene Therapy, 9:1939-1950 (1998); Shockelt, P., et al., Proc. Natl. Acad. Sci.
  • Regulatable promoters that include a repressor with the operon can be used.
  • the lac repressor from E. coli can function as a transcriptional modulator to regulate transcription from lac operator-bearing mammalian cell promoters [M. Brown et al., Cell, 49:603-612 (1987)]; Gossen and Bujard (1992); [M. Gossen et al., Natl. Acad. Sci.
  • tetracycline repressor tetR
  • VP 16 transcription activator
  • tetO bearing minimal promoter derived from the human cytomegalovirus (hCMV) promoter to create a tetR-tet operator system to control gene expression in mammalian cells.
  • hCMV human cytomegalovirus
  • a tetracycline inducible switch is used.
  • the tetracycline repressor (tetR) alone, rather than the tetR-mammalian cell transcription factor fusion derivatives can function as potent trans-modulator to regulate gene expression in mammalian cells when the tetracycline operator is properly positioned downstream for the TATA element of the CMVIE promoter (Yao et al., Human Gene Therapy).
  • tetracycline inducible switch is that it does not require the use of a tetracycline repressor-mammalian cells transactivator or repressor fusion protein, which in some instances can be toxic to cells (Gossen et al., Natl. Acad. Sci. USA, 89:5547-5551 (1992); Shockett et al., Proc. Natl. Acad. Sci. USA, 92:6522-6526 (1995)), to achieve its regulatable effects.
  • the vector can contain, for example, some or all of the following: a selectable marker gene, such as the neomycin gene for selection of stable or transient transfectants in mammalian cells; enhancer/promoter sequences from the immediate early gene of human CMV for high levels of transcription; transcription termination and RNA processing signals from SV40 for mRNA stability; SV40 polyoma origins of replication and ColEl for proper episomal replication; internal ribosome binding sites (IRESes), versatile multiple cloning sites; and T7 and SP6 RNA promoters for in vitro transcription of sense and antisense RNA.
  • a selectable marker gene such as the neomycin gene for selection of stable or transient transfectants in mammalian cells
  • enhancer/promoter sequences from the immediate early gene of human CMV for high levels of transcription
  • transcription termination and RNA processing signals from SV40 for mRNA stability SV40 polyoma origins of replication and ColEl for proper episomal replication
  • One or more vectors comprising nucleic acids encoding any of the antibodies (e.g., the nucleic acid coding sequence listed in Table 3) may be introduced into suitable host cells for producing the antibodies.
  • Non-limiting examples of the host cells include Chinese hamster ovary (CHO) cells, dhfr- CHO cell, human embryonic kidney (HEK)-293 cells, verda reno (VERO) cells, nonsecreting null (NS0) cells, human embryonic retinal (PER.C6) cells, Sp2/0 cells, baby hamster kidney (BHK) cells, Madin- Darby Canine Kidney (MDCK) cells, Madin-Darby Bovine Kidney (MDBK) cells, and monkey kidney CV1 line transformed by SV40 (COS) cells.
  • the host cell expressing the anti-HJV antibodies are CHO cells.
  • the host cells can be cultured under suitable conditions for expression of the antibody or any polypeptide chain thereof.
  • the host cell comprises the nucleic acid encoding the heavy chain of the anti-HJV antibody. In some embodiments, the host cell comprises the nucleic acid encoding the light chain of the anti-HJV antibody. In some embodiments, the host cell comprises the nucleic acid encoding the heavy chain and the nucleic acid encoding the light chain.
  • methods for preparing an antibody described herein involve a recombinant expression vector that encodes both the heavy chain and the light chain of an anti-HJV antibody, as also described herein.
  • the recombinant expression vector can be introduced into a suitable host cell (e.g., a dhfr- CHO cell) by a conventional method, e.g., calcium phosphate mediated transfection.
  • a suitable host cell e.g., a dhfr- CHO cell
  • Positive transformant host cells can be selected and cultured under suitable conditions allowing for the expression of the two polypeptide chains that form the antibody, which can be recovered from the cells or from the culture medium.
  • the two chains recovered from the host cells can be incubated under suitable conditions allowing for the formation of the antibody.
  • two recombinant expression vectors are provided, one encoding the heavy chain of the anti-HJV antibody and the other encoding the light chain of the anti-HJV antibody.
  • Both of the two recombinant expression vectors can be introduced into a suitable host cell (e.g., dhfr- CHO cell) by a conventional method, e.g., calcium phosphate-mediated transfection.
  • each of the expression vectors can be introduced into a suitable host cells. Positive transformants can be selected and cultured under suitable conditions allowing for the expression of the polypeptide chains of the antibody.
  • the antibody produced therein can be recovered from the host cells or from the culture medium. If necessary, the polypeptide chains can be recovered from the host cells or from the culture medium and then incubated under suitable conditions allowing for formation of the antibody.
  • each of them can be recovered from the corresponding host cells or from the corresponding culture media. The two polypeptide chains can then be incubated under suitable conditions for formation of the antibody.
  • Standard molecular biology techniques are used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recovery of the antibodies from the culture medium.
  • some antibodies can be isolated by affinity chromatography with a Protein A or Protein G coupled matrix.
  • nucleic acids encoding the heavy chain, the light chain, or both of an anti-HJV antibody as described herein e.g., as provided in Table 3
  • vectors e.g., expression vectors
  • host cells comprising the vectors
  • the anti-HJV described herein is produced by expressing (i) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 71, and/or (ii) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 73.
  • the anti-HJV described herein is produced by expressing (i) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 71, and/or (ii) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 75.
  • a nucleic acid at least 60% e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • the anti-HJV described herein is produced by expressing (i) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 71, and/or (ii) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 77.
  • a nucleic acid at least 60% e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • the anti-HJV described herein is produced by expressing (i) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 71, and/or (ii) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 79.
  • a nucleic acid at least 60% e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • the anti-HJV described herein is produced by expressing (i) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 71, and/or (ii) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 81.
  • the anti-HJV described herein is produced by expressing (i) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 84, and/or (ii) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 85.
  • a nucleic acid at least 60% e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • the anti-HJV described herein is produced by expressing (i) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 88, and/or (ii) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 89.
  • a nucleic acid at least 60% e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • the anti-HJV described herein is produced by expressing (i) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 92, and/or (ii) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 93.
  • the anti-HJV described herein is produced by expressing (i) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 94, and/or (ii) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 93.
  • the anti-HJV described herein is produced by expressing (i) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 92, and/or (ii) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 96.
  • a nucleic acid at least 60% e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • the anti-HJV described herein is produced by expressing (i) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 99, and/or (ii) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 100.
  • the anti-HJV described herein is produced by expressing (i) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 40, and/or (ii) a nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 64.
  • the anti-HJV antibodies described herein can be used for delivering a molecular payload to a target cell or a target tissue (e.g., a cell or tissue that expresses HJV). Accordingly, the anti-HJV antibody described herein can be linked to a molecular payload.
  • the complexes described herein may be used in various applications, e.g., diagnostic or therapeutic applications.
  • the complex described herein is used to modulate the activity or function of at least one gene, protein, and/or nucleic acid.
  • the molecular payload is responsible for the modulation of a gene, protein, and/or nucleic acids.
  • a molecular pay load may be a small molecule, protein, nucleic acid, oligonucleotide, or any molecular entity capable of modulating the activity or function of a gene, protein, and/or nucleic acid in a cell.
  • a molecular payload is an oligonucleotide that targets a disease-associated repeat in muscle cells.
  • the antibodies, as well as the encoding nucleic acids or nucleic acid sets, vectors comprising such, or host cells comprising the vectors, as described herein can be mixed with a pharmaceutically acceptable carrier (excipient) to form a pharmaceutical composition for use in treating a target disease.
  • a pharmaceutically acceptable carrier excipient
  • “Acceptable” means that the carrier must be compatible with the active ingredient of the composition (and preferably, capable of stabilizing the active ingredient) and not deleterious to the subject to be treated.
  • the anti-HJV antibody containing pharmaceutical composition disclosed herein may further comprise a suitable buffer agent.
  • a buffer agent is a weak acid or base used to maintain the pH of a solution near a chosen value after the addition of another acid or base.
  • the buffer agent disclosed herein can be a buffer agent capable of maintaining physiological pH despite changes in carbon dioxide concentration (produced by cellular respiration).
  • Exemplary buffer agents include, but are not limited to a HEPES (4-(2- hydroxyethyl)-l -piperazineethanesulfonic acid) buffer, Dulbeco’s phosphate-buffered saline (DPBS) buffer, or Phosphate-buffered Saline (PBS) buffer.
  • DPBS Dulbeco’s phosphate-buffered saline
  • PBS Phosphate-buffered Saline
  • Such buffers may comprise disodium hydrogen phosphate and sodium chloride, or potassium dihydrogen phosphate and potassium chloride.
  • the buffer agent in the pharmaceutical composition described herein may maintain a pH value of about 5-8.
  • the pH of the pharmaceutical composition can be about 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, or 8.0.
  • the pharmaceutical composition may have a pH value lower than 7, for example, about 7, 6.8, 6.5, 6.3, 6, 5.8, 5.5, 5.3, or 5.
  • the pharmaceutical composition described herein comprises one or more suitable salts.
  • a salt is an ionic compound that can be formed by the neutralization reaction of an acid and a base. (Skoog, D.A; West, D.M.; Holler, J.F.; Crouch, S.R. (2004). “chapters 14-16”. Fundamentals of Analytical Chemistry (8th ed.)). Salts are composed of related numbers of cations (positively charged ions) and anions (negative ions) so that the product is electrically neutral (without a net charge).
  • the pharmaceutical compositions can comprise pharmaceutically acceptable carriers, excipients, or stabilizers in the form of lyophilized formulations or aqueous solutions.
  • the pharmaceutical composition can be formulated for intravenous injection.
  • the pharmaceutical composition can be formulated for subcutaneous injection.
  • the pharmaceutical compositions to be used for in vivo administration must be sterile. This is readily accomplished by, for example, filtration through sterile filtration membranes.
  • Therapeutic antibody compositions are generally placed into a container having a sterile access port, for example, an intravenous or subcutaneous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
  • an immunomodulatory agent or erythropoietin stimulating agent provided herein for the treatment of anemia, e.g., as associated with chronic kidney disease.
  • agents include erythropoietin stimulating agents (ESAs).
  • ESAs erythropoietin stimulating agents
  • EPO erythropoietin
  • the EPO is selected from Epoetin alfa (Epogen/Procrit), Darbepoetin alfa (Aranesp), Methoxy polyethylene glycol-epoetin beta (Mircera), Epoetin alfa-epbx (Retacrit); and biosimilars to Epogen/Procrit.
  • any of the disclosed hemojuvelin antagonists may be administered in a combination therapy with a therapeutic agent selected from a growth differentiation factor (GDF) trap, oral iron, IV iron, a HIF-PHI, and a red blood cell transfusion.
  • a therapeutic agent selected from a growth differentiation factor (GDF) trap, oral iron, IV iron, a HIF-PHI, and a red blood cell transfusion.
  • GDF traps include sotatercept and luspatercept.
  • the additional therapeutic agent is an IV iron therapy, such as Iron Isomaltoside (MonoFerric®).
  • IV iron therapies include, but are not limited to, Iron Sucrose (Venofer®), Ferric Carboylmaltose (Ferrinject® or Injectofer®), Ferumoxytol (Ferraheme®), Iron Dextran (Imferon®), and sodium ferric gluconate in iron sucrose solution (Ferrlecit®).
  • the additional therapeutic agent is an oral iron therapy.
  • the hemojuvelin antagonists provided herein may be combined with oral iron therapy to facilitate restoration of iron levels and/or treat anemic subjects who are experiencing intolerance to oral iron or an unsatisfactory response to oral iron.
  • a combination therapy of anti-hemojuvelin antibody and oral iron is administered to a subject that presents with serum ferritin levels lower than 100 ng/ml and a TSAT lower than 30%.
  • oral iron therapies include, but are not limited to, ferrous sulfate, ferric maltol (Accrufer®), ferrous gluconate, ferrous succinate, iron polymaltose, polysaccharide-iron complex, and ferrous sulfate.
  • iron may be administered intramuscularly (e.g., as iron sorbitol citrate).
  • the immunomodulatory agents are advantageous in that they have beneficial effects in reducing inflammation and in promoting erythropoiesis.
  • Danazol for example, is a steroid compound having hematopoietic stimulatory and immunomodulatory effects.
  • danazol has antagonistic effects on glucocorticoid receptors, resulting in upregulating effects on erythropoiesis (see, e.g., Chai KY, et al., Danazol: An Effective and Underutilized Treatment Option in Diamond-Blackfan Anaemia. Case Reports in Hematology. Volume 2019, Article ID 4684156.).
  • Other useful immunomodulatory agents include thalidomide and derivatives or analogs thereof, such as lenalidomide, and pomalidomide.
  • aspects of the disclosure relate to methods for treating anemia of kidney disease and/or one or more conditions arising as a result of anemia of kidney disease in a subject.
  • Particular aspects of the disclosure relate to methods for treating anemia of CKD.
  • Additional aspects of the disclosure relate to methods for treating anemia in a subject is identified as having a level of glomerular filtration rate (GFR) of less than 90 mL/min per 1.73 m 2 , less than 60 mL/min per 1.73 m 2 , less than 30 mL/min per 1.73 m 2 , less than 15 mL/min per 1.73 m 2 , or less than 7 mL/min per 1.73 m 2 In some embodiments, the subject has a GFR level between 15 and 59 ml/min. Additional aspects relate to methods for treating anemia from iron deficiency associated with, or coincident with, CKD.
  • methods provided herein are useful for treating subjects having anemia associated with kidney disease so as to decrease hepcidin levels or activity.
  • the subject may experience an improvement in iron uptake from the gastrointestinal system (z.e., from diet).
  • the subject may experience a restoration, either partial or complete, of iron levels.
  • the subject may have had an unsatisfactory response to oral iron treatment.
  • the subject may have a CKD that is non-dialysis dependent (CKD-NDD).
  • the subject has a non-hemodialysis dependent chronic kidney disease.
  • the subject has a transferrin saturation (TSAT) level less than 50%, less than 40%, less than 30%, or less than 20%.
  • TSAT transferrin saturation
  • the subject has been identified as having hemoglobin levels in the range of 1.5 to 2.0 g/dL or 2.0 to 4.0 g/dL or more below normal hemoglobin levels.
  • the subject presents with a serum hemoglobin level of less than 11 g/dL, 10 g/dL, 9 g/dL, or 8 g/dL.
  • the subject has serum ferritin levels lower than 300 ng/mL, 200 ng/mL or 100 ng/mL.
  • the subject presents with serum ferritin levels lower than 100 ng/ml and a TSAT lower than 30%.
  • the administration of the hepcidin antagonist increases hemoglobin (HGB) levels at least Ig/dL from baseline.
  • the administration of the hepcidin antagonist increases hemoglobin level in a subject by at least Ig/dL relative to an untreated subject.
  • any of the disclosed methods of administration of the hepcidin antagonist results in an increase in hemoglobin levels in a subject at least 2, 4, 6, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more than 20 g/dL relative to an untreated subject.
  • any of the disclosed methods result in increased hemoglobin levels of about 17 g/dL (or 170 g/L).
  • any of the disclosed methods result in increased hemoglobin levels of about 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20% relative to an untreated subject.
  • These increased HGB levels may be observed within 10, 20, 30, 40, or more than 40 days of treatment. In particular, these increased HGB levels may be observed after about 42 days of treatment.
  • the administration of the hepcidin antagonist increases reticulocyte hemoglobin (Ret-HGB) levels in a subject by at least 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.75, 0.8, 0.85, 0.9, 0.95, 1.0, or more than 1.0 pg relative to an untreated subject.
  • Ret-HGB is a measure of cellular hemoglobinization.
  • any of the disclosed methods result in increased Ret-HGB levels of about 0.85 pg.
  • any of the disclosed methods result in increased hemoglobin levels of about 1%, 1.5%, 2%, 2.5%, 3%, 3.5%, 4%, 4.5%, 5%, or more than 5% relative to an untreated subject.
  • These increased Ret-HGB levels may be observed within 10, 20, 30, 40, or more than 40 days of treatment. In particular, these increased Ret-HGB levels may be observed after about 42 days of treatment.
  • the disclosure relates to compositions and methods for treating CKD in a subject.
  • a subject to be treated in accordance with the disclosure may be identified based on an appropriate diagnostic methodology, as described, for example, in National Kidney Foundation, K/DOQI clinical practice guidelines for chronic kidney disease: Evaluation, classification, and stratification, Am. J. Kidney Dis. 2002: 39 (Suppl 1): S1-S266; Cullis, JO, Diagnosis and management of anaemia of chronic disease: current status British Journal of Haematology, Volume 154, Issue 3, August 2011 pages 289- 300; and Madua AJ and Ughasoro MD, Anaemia of Chronic Disease: An In-Depth Review Med Prine Pract. 2017 Jan; 26(1): 1-9, the contents of each of which are incorporated herein by reference.
  • diagnosis of anemia involves an evaluation of signs and symptoms of the underlying chronic condition combined with an assessment of indicia of anemia and/or defects in iron metabolism, including, for example, through an analysis of complete blood count (CBC), serum iron, ferritin, transferrin, reticulocyte count, and other markers.
  • CBC complete blood count
  • serum iron serum iron
  • ferritin ferritin
  • transferrin transferrin
  • reticulocyte count and other markers.
  • a subject in need of treatment in accordance with the disclosure may be identified based on a reduced EPO production.
  • levels of EPO are inversely correlated with hemoglobin levels and tissue oxygenation, but in chronic inflammatory conditions the EPO response is blunted, leading to inadequate levels of EPO for the degree of anemia, and this is thought to be mediated via inflammatory cytokines such as IL-1 and tumor necrosis factor-a (TNF-a).
  • a blunted EPO response may be diagnostic of anemia of chronic disease (ACD), such as anemia of chronic kidney disease, in a subject.
  • ACD anemia of chronic disease
  • a subject in need of treatment in accordance with the disclosure may be identified based on a reduced erythroid responsiveness.
  • anemia may be characterized by a reduced proliferation and differentiation of erythroid progenitor cells. It has been shown that macrophages from patients with anemia suppress colony formation in vitro due to inhibitory effects of inflammatory cytokines (e.g., interferon- y) on growth of erythroid burst-forming units (BFU-E) and erythroid colony-forming units (CFU-E), and that this effect could be overcome by addition of high concentrations of EPO to the culture systems.
  • inflammatory cytokines e.g., interferon- y
  • a reduced erythroid responsiveness in a subject can be identified using these or similar such assays for evaluating erythroid responsiveness.
  • a subject in need of treatment in accordance with the disclosure may be identified based on an anemic state that is mild to moderate and/or normochromic and normocytic (although anemia may become microcytic as disease progresses).
  • a subject is identified based on a low reticulocyte count. Inflammation in a subject may be inferred from other features of the blood count, such as neutrophilia, monocytosis or thrombocytosis, and through measurement of non-specific inflammatory markers, such as C-reactive protein (CRP) or erythrocyte sedimentation rate (ESR).
  • CRP C-reactive protein
  • ESR erythrocyte sedimentation rate
  • a subject is identified by determining a ratio of serum transferrin receptor (sTFR) to ferritin.
  • sTFR serum transferrin receptor
  • the transferrin receptor is found on virtually all cells in the body, but is present at high levels on erythroid progenitors. sTFR levels increase in IDA as the availability of iron for erythropoiesis decreases, whereas in anemia levels may not differ from steady state because transferrin receptor expression is negatively affected by inflammatory cytokines.
  • the ratio of sTFR to the log of the serum ferritin may be used in the diagnosis of anemia in a subject, and in some cases may be used for differentiating anemia from IDA.
  • a ratio of less than 1 makes anemia likely, whereas ratios of greater than 2 suggest that iron stores are deficient, with or without anemia.
  • a subject in need of treatment in accordance with the disclosure may be identified using red cell indices.
  • the reticulocyte hemoglobin content (CHr) and the percentage hypochromic red cells (%HYPO) can provide information about iron supply to the erythron, and may be useful in guiding the management of anemia (e.g., ACD (e.g., anemic of chronic kidney disease)).
  • CHr is a measure of hemoglobin in the most recently formed erythrocytes
  • the %HYPO indicates the percentage of cells with hemoglobin content of ⁇ 280 g/1.
  • a subject has previously received an erythropoietin stimulating agent.
  • the erythropoietin stimulating agent is selected from the group consisting of danazol, prednisone, thalidomide, lenalidomide, and pomalidomide.
  • dosages for a HJV antagonist as described herein may be determined empirically in individuals who have been given one or more administration(s) of the antibody. Individuals are given incremental dosages of the antagonist. To assess efficacy of the antagonist, an indicator of the disease/disorder can be followed.
  • Dosing frequencies may vary in accordance with the claimed methods.
  • a composition will be administered once.
  • a treatment will be administered on multiple occasions.
  • dosing frequency is every week, every 2 weeks, every 3 weeks, every 4 weeks, every 5 weeks, every 6 weeks, every 7 weeks, every 8 weeks, every 9 weeks, or every 10 weeks; or once every month, every 2 months, or every 3 months, or longer.
  • a composition will be administered daily, biweekly, weekly, bimonthly, monthly, semi-monthly, quarterly, or at any time interval that provide suitable (e.g., maximal) efficacy while minimizing safety risks to the subject.
  • dosing frequency is over a period of about 45 days, 50 days, 55, days, 60 days, or 65 days. In some embodiments, the dosing period is between 40 and 60 days, 40 and 55 days, 50 and 60 days, or 50 and 55 days. In some embodiments, the dosing period is between 50 and 55 days. Generally, the efficacy and the treatment and safety risks may be monitored throughout the course of treatment. In some embodiments, the hemojuvelin antagonist is administered once monthly. In some embodiments, the hemojuvelin antagonist is administered once quarterly.
  • administration of HJV antagonist results in a decrease in serum hepcidin-25 concentration and/or increase serum TSAT%, and in some embodiments, these effects persist for a period of time (e.g., one month or more).
  • timing and frequency of administration of HJV antagonist can be determined by monitoring one or more biomarkers, e.g., criteria to assess iron availability or flag possible iron overload.
  • HJV antagonist is administered intermittently or in accordance with the level of a particular biomarker such as serum hepcidin-25 levels or transferrin saturation percentage (TSAT%).
  • a biomarker level described herein can be used to determine whether a subject is a candidate for treatment. However, in some embodiments, a biomarker may be used to determine whether to continue treatment or to resume a treatment or to halt a treatment, e.g., with a HJV antagonist.
  • administering results in a decrease in urine hepcidin concentration and/or an increase in serum TSAT%.
  • a subject may be considered as not being a candidate for treatment if TSAT% of the subject is at or above 70%, at or above 75%, at or above 80%, at or above 85%, at or above 90%, or at or above 95%.
  • TSAT% of the subject is at or above 70%, at or above 75%, at or above 80%, at or above 85%, at or above 90%, or at or above 95%
  • an ongoing treatment with a HJV antagonist may be stopped or temporarily stopped, e.g., to prevent iron overload.
  • administration of an anti-HJV antibody may be performed when a TSAT% of a subject is at or below 95%, at or below 90%, at or below 80%, at or below 70 %, at or below 65%, at or below 60%, at or below 55%, at or below 50%, at or below 45%, at or below 40%, at or below 35%, or at or below 30%.
  • TSAT% of a subject can be monitored, e.g., continuously or periodically, while a patient is receiving a treatment or under care of a treating physician, e.g., for anemia, to prevent iron overload or otherwise to assess whether further treatments are appropriate.
  • dosage and dosage frequency including, for example, ferritin levels, serum iron levels, creatinine levels, etc.
  • a subject may be administered a composition weekly, biweekly, monthly or semi-monthly for three months, and optionally then the administration is stopped for nine months.
  • a composition weekly, biweekly, monthly or semi-monthly for four months may be administered, and optionally then the administration is stopped for eight months.
  • the administration is stopped for seven months.
  • the administration is stopped for six months.
  • a subject may be administered a composition weekly, biweekly, monthly or semi-monthly for seven months and then the administration is stopped for five months.
  • a composition weekly, biweekly, monthly or semi-monthly for eight months may be administered a composition weekly, biweekly, monthly or semi-monthly for eight months and then the administration is stopped for four months.
  • a composition weekly, biweekly, monthly or semi-monthly for nine months may be administered during the course of a year a subject.
  • a composition weekly, biweekly, monthly or semimonthly for ten months and then the administration is stopped for two months.
  • a subject may be administered a composition weekly, biweekly, monthly or semi-monthly for two months on, two months off; or for three months on, three months off; or for four months on, four months off.
  • a subject may be administered a composition quarterly for the entire duration of the year (i.e., four times).
  • a subject may be administered a composition quarterly twice, or three times, but not four times.
  • a dose may be about 0.01 mg/kg, 0.05 mg/kg.
  • the dosage the anti-HJV antibody is up to 0.01 mg/kg, up to 0.05 mg/kg, up to 0.1 mg/kg, up to 0.2 mg/kg, up to 0.3 mg/kg, up to 0.4 mg/kg, up to 0.5 mg/kg, up to 0.6 mg/kg, up to 0.8 mg/kg, up to 1 mg/kg, mg/kg, up to 2 mg/kg, up to 3 mg/kg, up to 4 mg/kg, up to 5 g/kg, up to 6 mg/kg, up to 7 mg/kg, up to 8 mg/kg, up to 9 mg/kg, up to 10 mg/kg, up to 20 mg/kg, up to 30 mg/kg, up to 40 mg/kg, up to 50 mg/kg, up to 60 mg/kg, up to 70 mg/kg, 80 mg/kg, up to 90 mg/kg, up to 100 mg/kg or more.
  • the dose of the anti-HJV antibody can be in a range of 0.01 mg/kg to 100 mg/kg, 0.01 mg/kg to 10 mg/kg, 0.5 mg/kg to 15 mg/kg, 0.6 mg/kg to 15 mg/kg, 0.8 mg/kg to 15 mg/kg, 1 mg/kg to 15 mg/kg, 5 mg/kg to 25 mg/kg, 10 mg/kg to 30 mg/kg, 20 mg/kg to 40 mg/kg, 30 mg/kg to 50 mg/kg, 40 mg/kg to 60 mg/kg, 50 mg/kg to 75 mg/kg, or 50 mg/kg to 100 mg/kg.
  • the antibodies described herein are administered to a subject in need of the treatment at an amount sufficient to inhibit the activity of the target antigen (e.g., an amount sufficient to inhibit HJV-induced BMP signaling) by at least 20% (e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater) in vivo.
  • the antibody is administered in an amount effective in reducing the activity level of a target antigen by at least 20% (e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater).
  • an antibody can be administered parenterally.
  • a parenterally administered composition may be administered by subcutaneous, intracutaneous, intravenous, intraperitoneal, intratumor, intramuscular, intraarticular, intraarterial, or infusion techniques.
  • it can be administered to the subject via injectable depot routes of administration such as using 1-, 3-, or 6-month depot injectable or biodegradable materials and methods.
  • an antibody e.g., an anti-HJV antibody
  • an antibody e.g., an anti-HJV antibody
  • an antibody is administered subcutaneously.
  • subcutaneous administration of an ani- HJV antibody results in similar bioavailability compared to intravenous administration of the same antibody at the same dose.
  • subcutaneous administration of the anti-HJV antibody yields comparable pharmacodynamics effects (e.g., decreased circulating hepcidin-25 levels, increased TSAT%, and/or increased serum iron levels) at lower maximum concentrations (Cmax) of the anti-HJV antibody compared to intravenous administration of the same antibody.
  • Cmax is the maximum (or peak) serum concentration that a drug (e.g., an anti-HJV antibody) after the drug has been administered and before the administration of a second dose.
  • achieving a low Cmax within a short period of time (e.g., within 12 hours, within 24 hours, etc) after administration of an anti-HJV antibody minimizes undesirable increases in serum iron response, and/or minimizes chances of off-target effects of the antibody (e.g., binding to RGMa).
  • blunting Cmax by subcutaneous administration of an anti-HJV antibody avoids an undesirably sharp increase in serum iron response.
  • blunting Cmax by subcutaneous administration of an anti-HJV antibody reduces the off-target effects of the antibody.
  • the Cmax reached by subcutaneous administration is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% lower than the Cmax reached by intravenous administration of an anti-HJV antibody.
  • any of the disclosed methods result in increased serum iron levels in the subject, relative to an untreated subject, of about 25, 27.5 30, 32.5, 35, 38.5, 40, or 45 pmol/L.
  • any of the disclosed methods result in increased serum iron levels of about 35 pmol/L.
  • any of the disclosed methods result in increased serum iron levels of about 95%, 97.5%, 100%, 102.5%, 105%, 110%, 115%, or 120% relative to an untreated subject.
  • any of the disclosed methods result in increased serum iron levels of about 100-110%, and in particular about 109% or 119% on average. These increased serum levels may be observed within 10, 20, 30, 40, or more than 40 days of treatment. In particular, these increased serum levels may be observed after about 42 days of treatment.
  • any of the disclosed methods result in increased red blood cell (RBC) counts e.g., counts of mature RBCs) in the subject, relative to an untreated subject, of about 1, 2, 2.5, 3, 4, 5, 6, 7, 7.5, 8, 9, or 10 x 10 5 cells/pL.
  • RBC red blood cell
  • any of the disclosed methods result in increased RBC counts of about 4 or 5 x 10 5 cells/pL.
  • any of the disclosed methods result in increased RBC counts of about 5%, 6%, 6.5%, 7%, 7.25%, 7.5%, 7.75%, 8%, 8.5%, 9%, 9.25%, 9.5%, 10%, or more than 10% relative to an untreated subject.
  • any of the disclosed methods result in decreased reticulocyte (Ret) counts in the subject, relative to an untreated subject, of about 90, 100, 100, 120 or 125 x 10 9 cells/L.
  • Ret reticulocyte
  • any of the disclosed methods result in decreased Ret counts of about 100 x 10 9 cells/pL.
  • any of the disclosed methods result in decreased Ret counts of about 45%, 50%, or 55% relative to an untreated subject. These decreased Ret counts may be observed within 10, 20, 30, 40, or more than 40 days of treatment. In particular, these Ret counts may be observed after about 42 days of treatment.
  • water soluble antibodies can be administered by the drip method, whereby a pharmaceutical formulation containing the antibody and a physiologically acceptable excipient is infused.
  • Physiologically acceptable excipients may include, for example, 5% dextrose, 0.9% saline. Ringer’s solution or other suitable excipients.
  • Other injectable compositions may contain various carriers such as vegetable oils, dimethylactamide, dimethyformamide, ethyl lactate, ethyl carbonate, isopropyl myristate, ethanol, and polyols (glycerol, propylene glycol, liquid polyethylene glycol, and the like).
  • preparations e.g., a sterile formulation of a suitable soluble salt form of the antibody
  • a pharmaceutical excipient such as Water-for- Injection, 0.9% saline, or 5% glucose solution.
  • an antibody is administered via site- specific or targeted local delivery techniques.
  • site- specific or targeted local delivery techniques include various implantable depot sources of the antibody or local delivery catheters, such as infusion catheters, an indwelling catheter, or a needle catheter, synthetic grafts, adventitial wraps, shunts and stents or other implantable devices, site specific carriers, direct injection, or direct application. See, e.g., PCT Publication No. WO 2000/53211 and U.S. Pat. No. 5,981,568.
  • more than one antibody, or a combination of an antibody and another suitable therapeutic agent may be administered to a subject in need of the treatment.
  • the antibody can also be used in conjunction with other agents that serve to enhance and/or complement the effectiveness of the agents.
  • Treatment efficacy for a target disease/disorder can be assessed by methods well-known in the art.
  • anti-HJV antibody and treatment methods involving such as described in the present disclosure may be utilized in combination with other types of therapy for the target disease or disorder disclosed herein.
  • an antibody composition and a therapeutic agent may be given either simultaneously or sequentially. Examples include chemotherapy, immune therapy (e.g. therapies involving other HJV antagonists), surgery, radiation, gene therapy, and so forth, or anti-infection therapy.
  • Such therapies can be administered simultaneously or sequentially (in any order) with the treatment according to the present disclosure.
  • the combination therapy can include the anti-HJV antibody and pharmaceutical composition described herein, co-formulated with and/or co-administered with, at least one additional therapeutic agent described herein.
  • Such combination therapies may advantageously utilize lower dosages of the administered therapeutic agents, thus preventing possible toxicities or complications associated with the various monotherapies.
  • the additional therapeutic agents disclosed herein may act on pathways in addition to or distinct from the hepcidin/BMP pathway, and thus may enhance and/or synergize with the effects of the anti-HJV antibodies.
  • a subject has previously received an erythropoietin stimulating agent.
  • the erythropoietin stimulating agent is selected from the group consisting of danazol, prednisone, thalidomide, lenalidomide, and pomalidomide.
  • a subject has previously received a JAK-STAT pathway inhibitor.
  • the JAK-STAT pathway inhibitor is a JAK inhibitor or a STAT inhibitor.
  • the JAK inhibitor is selective for one or both of subtypes JAK1 and JAK2 (e.g., a JAK1/2 inhibitor).
  • the STAT inhibitor is a STAT3 inhibitor.
  • the JAK1/2 or STAT3 inhibitor is selected from the group consisting of ruxolitinib, fedratinib, momelotinib, pacritinib, INCB039110, AG490, and PpYLKTK (where “pY” represents a phosphorylated tyrosine (Y) residue (PY*LKTK); SEQ ID NO: 131).
  • a subject has previously received a growth factor ligand trap.
  • the growth factor ligand trap is a transforming growth factor beta (TGF-P) ligand trap.
  • TGF-P ligand trap is a GDF trap such as sotatercept or luspatercept. See US Patent No. 8,216,997, the contents of each of which are herein incorporated by reference.
  • a subject has previously received an anti-fibrotic agent.
  • the anti-fibrotic agent is PRM-151.
  • a subject in need of treatment in accordance with the disclosure continues to receive a therapeutic treatment for a hematologic disorder.
  • the disclosure therefore provides, in some aspects, compositions and methods for treating anemia (e.g., ACD (e.g., anemic of chronic kidney disease)) and/or one or more conditions arising as a result of the anemia by administering to a subject in need thereof an anti-HJV antibody in combination with one or more therapeutic treatments for a hematologic disorder.
  • anemia e.g., ACD (e.g., anemic of chronic kidney disease)
  • an anti-HJV antibody e.g., anemic of chronic kidney disease
  • the anemia is characterized based on Reticulocyte Hemoglobin Content (RET-He or CHr).
  • Reticulocyte hemoglobin content measures the amount of hemoglobin in reticulocytes.
  • a normal range of CHr is about 28 to 36 pg/cell.
  • the subject has a CHr lower than the normal range.
  • the subject has a CHr less than 36 pg/cell, less than 35 pg/cell, less than 34 pg/cell, less than 33 pg/cell.
  • TSAT% serum iron levels
  • TIBC total iron binding capacity
  • ferritin levels ferritin levels
  • hemoglobin levels hepatic iron content
  • hepcidin levels hepcidin levels
  • IL-6 levels creatinine levels
  • the anemia is characterized by hepatic iron levels.
  • a normal range of hepatic iron level is 200-2,400 J-tg/g dry weight in males and 400-1,600 J-tg/g dry weight in female.
  • the subject has a higher than normal of hepatic iron level.
  • the patient has hepatic iron levels higher than 1000 J-tg/g dry weight (e.g., between about 1000 J-tg/g to 1200 J-tg/g dry weight, between about 1000 J-tg/g to 1500 J-tg/g dry weight, or between about 1200 J-tg/g to 1500 J-tg/g dry weight), higher than 1500 J-tg/g dry weight (e.g., between about 1500 J-tg/g to 1800 J-tg/g dry weight, between about 1500 J-tg/g to 2000 J-tg/g dry weight, or between about 1800 J-tg/g to 2000 J-tg/g dry weight), higher than 2000 J-tg/g dry weight (e.g., between about 2000 J-tg/g to 2200 J-tg/g dry weight, between about 2000 J-tg/g to 2500 J-tg/g dry weight, or between about 2200 J-tg/g to 2500 J-tg/g dry weight), higher
  • the anemia is characterized by low Total Iron Binding Capacity (TIBC).
  • TIBC Total Iron Binding Capacity
  • normal range of TIBC is 250-400 pg/dL.
  • the subject has a lower than normal TIBC.
  • the subject has a TIBC of less than 400 pg/dL, less than 350 pg/dL, less than 300 pg/dL, less than 250 pg/dL, less than 200 pg/dL, less than 150 pg/dL, less than 100 pg/dL, less than 90 pg/dL, less than 80 pg/dL, less than 70 pg/dL, less than 60 pg/dL, less than 50 pg/dL, less than 40 pg/dL, less than 30 pg/dL less than 20 pg/dL, or less than 10 pg/dL.
  • a subject is administered a hemojuvelin antagonist (e.g., anti-HJV antibodies and compositions thereof) in combination with an erythropoietin stimulating agent.
  • a hemojuvelin antagonist e.g., anti-HJV antibodies and compositions thereof
  • an erythropoietin stimulating agent is EPO.
  • the erythropoietin stimulating agent is selected from an immunomodulatory agend selected from the group consisting of danazol, prednisone, thalidomide, lenalidomide, and pomalidomide.
  • a subject is administered a hemojuvelin antagonist (e.g., anti-HJV antibodies and compositions thereof) in combination with a JAK-STAT pathway inhibitor.
  • the JAK-STAT pathway inhibitor is a JAK inhibitor or a STAT inhibitor.
  • the JAK inhibitor is selective for one or both of subtypes JAK1 and JAK2 (e.g., a JAK1/2 inhibitor).
  • the STAT inhibitor is a STAT3 inhibitor.
  • the JAK1/2 or STAT3 inhibitor is selected from the group consisting of ruxolitinib, fedratinib, momelotinib, pacritinib, INCB039110, AG490, and PpYLKTK (SEQ ID NO: 131).
  • a subject is administered a hemojuvelin antagonist (e.g., anti-HJV antibodies and compositions thereof) in combination with ruxolitinib.
  • the hemojuvelin antagonist reduces the extent to which a subject exhibits an anemic response to the JAK-STAT pathway inhibitor.
  • a subject treated with a JAK-STAT pathway inhibitor as a monotherapy may be characterized as having a deficiency in the ability of blood to transport oxygen as compared to the subject’s pretreatment state, a deficiency in red blood cells as compared to the subject’s pretreatment state, a deficiency in hemoglobin as compared to the subject’s pretreatment state, an/or a deficiency in total blood volume as compared to the subject’s pretreatment state.
  • the hemojuvelin antagonist reduces the extent to which a subject exhibits an anemic response to a JAK-STAT pathway inhibitor selected from the group consisting of ruxolitinib, fedratinib, momelotinib, pacritinib, INCB039110, AG490, and PpYLKTK (SEQ ID NO: 131).
  • the hemojuvelin antagonist e.g., anti-HJV antibodies and compositions thereof
  • a subject is administered a hemojuvelin antagonist (e.g., anti-HJV antibodies and compositions thereof) in combination with a growth factor ligand trap.
  • the growth factor ligand trap is a transforming growth factor beta (TGF-P) ligand trap.
  • TGF-P ligand trap is sotatercept or luspatercept.
  • a subject is administered a hemojuvelin antagonist (e.g., anti-HJV antibodies and compositions thereof) in combination with an anti-fibrotic agent.
  • the anti-fibrotic agent is PRM-151.
  • HJV antagonist e.g., anti-HJV antibodies and compositions thereof
  • treatment is evaluated based on hepcidin (e.g., circulating hepcidin-25 levels) levels in a subject.
  • a subject is successfully treated where a HJV antagonist (e.g., anti-HJV antibodies and compositions thereof) decreases hepcidin (e.g., circulating hepcidin-25 levels) levels in the subject by between about 1 ng/mE and about 300 ng/mL.
  • a HJV antagonist e.g., anti-HJV antibodies and compositions thereof
  • hepcidin e.g., circulating hepcidin-25 levels
  • the HJV antagonist decreases hepcidin (e.g., circulating hepcidin-25 levels) levels in a subject by between about 1 ng/mL and about 200 ng/mL, between about 1 ng/mL and about 100 ng/mL, between about 1 ng/mL and about 50 ng/mL, between about 1 ng/mL and about 10 ng/mL, between about 10 ng/mL and about 100 ng/mL, or between about 10 ng/mL and about 50 ng/mL.
  • hepcidin e.g., circulating hepcidin-25 levels
  • the present disclosure provides a method for reducing hepcidin (e.g., circulating hepcidin-25 levels) in a subject having anemia (e.g., ACD (e.g., anemia of chronic kidney disease)).
  • anemia e.g., ACD (e.g., anemia of chronic kidney disease)
  • the disclosed methods of administration reduce hepcidin-25 within 4 hours, 6 hours, 8 hours, 12 hours, 28 hours, 24 hours, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, or two weeks of administration.
  • the disclosed methods of administration reduce hepcidin (e.g., circulating hepcidin-25 levels) by at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 99%, or 100% of hepcidin compared to the hepcidin (e.g., circulating hepcidin-25 levels) level in the subject prior to administration. In some embodiments, the disclosed methods of administration reduce hepcidin levels by about 96%.
  • the present disclosure provides methods for reducing hepcidin expression (e.g., Hamp gene expression) in the liver of a subject having anemia (e.g., ACD (e.g., anemia of chronic kidney disease)).
  • the disclosed methods of administration reduce Hamp mRNA expression within 4 hours, 6 hours, 8 hours, 12 hours, 28 hours, 24 hours, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, or two weeks of administration.
  • the disclosed methods of administration reduce Hamp mRNA expression within 7, 10, 14, 20-21, 24, 28, 30, 35, 40, or 42 days of administration.
  • HJV antagonist e.g., anti-HJV antibodies and compositions thereof
  • treatment is evaluated based on serum ferritin levels in a subject.
  • baseline serum ferritin levels in a subject are determined (e.g., before treatment with a HJV antagonist (e.g., anti-HJV antibodies and compositions thereof) or otherwise in absence of HJV antagonist (e.g., anti-HJV antibodies and compositions thereof) treatment at the time of determining) and compared to post-treatment serum ferritin levels in the subject.
  • a subject is successfully treated where a HJV antagonist (e.g., anti-HJV antibodies and compositions thereof) decreases serum ferritin levels in the subject by between about 1 ng/mL and about 200 ng/mL.
  • a HJV antagonist e.g., anti-HJV antibodies and compositions thereof
  • HJV antagonist e.g., anti-HJV antibodies and compositions thereof
  • treatment is evaluated based on serum hemoglobin levels in a subject.
  • baseline serum hemoglobin levels in a subject are determined (e.g., before treatment with a HJV antagonist (e.g., anti-HJV antibodies and compositions thereof) or otherwise in absence of HJV antagonist (e.g., anti-HJV antibodies and compositions thereof) treatment at the time of determining) and compared to post-treatment serum hemoglobin levels in the subject.
  • a subject is successfully treated where a HJV antagonist (e.g., anti-HJV antibodies and compositions thereof) increases serum hemoglobin levels in the subject by between about 0.01 g/dL and about 5 g/dL.
  • a HJV antagonist e.g., anti-HJV antibodies and compositions thereof
  • the HJV antagonist decreases serum ferritin levels in a subject by between about 0.01 g/dL and about 1 g/dL, between about 0.1 g/dL and about 5 g/dL, between about 1 g/dL and about 5 g/dL, between about 0.01 g/dL and about 0.1 g/dL, between about 0.5 g/dL and about 2.5 g/dL, or between about 0.1 g/dL and about 1 g/dL.
  • the disclosed methods may be particularly suitable for CKD patients who exhibit a comorbidity of CKD.
  • these methods may be useful for treating an anemia of CKD in a subject having any of the following comorbidities: diabetes, hypertension, autoimmune disease (such as lupus or another autoimmune condition), complications due to certain medications such as non-steroidal anti-inflammatory drugs (NSAIDs), or congenital heart failure.
  • NSAIDs non-steroidal anti-inflammatory drugs
  • congenital heart failure may be a major consideration for physicians when advising patients for or against dialysis.
  • These methods may be useful for treating an anemia of CKD in a subject having certain other comorbidities or risk factors, such as a birth defect, fatigue, nausea, insomnia, anorexia, or a high BMI; or where the kidney damage is associated with polycystic kidney disease or a glomerular disease, such as acute glomerulonephritis.
  • CKD CKD Several rare diseases and birth defects are coincident with CKD including: Diabetes (such as Type II diabetes), bacterial endocarditis, granulomatosis with polyangiitis, hepatitis B and C, human immunodeficiency virus (HIV) infection, hyperkalemia, light-chain deposition disease, mixed connective tissue disease, mixed cryoglobulinemia, neoplasia, non-alcoholic fatty liver disease (NAFLD), parasitic infection, reflux nephropathy, rheumatoid arthritis, scleroderma, Shiga-toxin- or Streptococcus pneumoniae-related HUS, some cancers, systemic lupus erythematosus, syphilis, thrombotic thrombocytopenic purpura (TTP).
  • Diabetes such as Type II diabetes
  • bacterial endocarditis bacterial endocarditis
  • granulomatosis with polyangiitis hepatitis B
  • anemia of a chronic kidney disease that is associated with one or more of the following comorbidities: diabetes, hypertension, an autoimmune disease, such as lupus, congenital heart failure, complications related to administration of one or more NSAIDs (such as Aleve, Tylenol, Advil or Motrin), a rare disease, and a birth defect.
  • an autoimmune disease such as lupus
  • congenital heart failure such as congenital heart failure
  • complications related to administration of one or more NSAIDs such as Aleve, Tylenol, Advil or Motrin
  • CKD that has been previously administered, or is currently administered, a Type II diabetes therapy.
  • methods for treating anemia in a subject having CKD that has been previously administered, or is currently administered, a hypertension medication such as an ACE inhibitor are provided herein.
  • Binding affinities of the anti-HJV antibodies to soluble human RGMa, Rat RGMa and human RGMc were measured by BIAcore analysis.
  • Table 14 shows the affinity of the anti-hemojuvelin antibodies to human RGMa.
  • Table 15 shows the affinity of the anti- hemojuvelin antibodies to rat RGMa.
  • Table 16 shows the affinity of the anti-hemojuvelin antibodies to human RGMc.
  • hHA-004, hHA-008, hHA-009 and hHA-011 showed strong binding to human RGMc, and were selected for further testing.
  • Sensorgrams by BIAcore analysis of antibodies HA, hHA-004, hHA-008, hHA-009 and hHA-011 are shown in FIGs. 1B-1G.
  • hHA-008 was further tested for its binding affinity to human RGMa, Cyno RGMa, Rat RGMa, human RGMc, Cyno RGMc, Rat RGMc, and human RGMb, and the respective binding affinity is shown in Table 7.
  • hHA-008 showed high affinity binding to human RGMa and RGMc with strong cross -reactivity to cyno and rodent species.
  • the RGMc (HJV) BMP reporter gene assay was used for screening and characterization potency of anti-HJV antibodies in blocking membrane-bound RGMc induced BMP/Smadl/5/8 signaling.
  • the assay is directly related to the mechanism of action of the anti-HJV mAbs in inhibiting RGMc/BMP/Smadl/5/8 signaling pathway that is responsible for induction of iron hormone hepcidin gene expression.
  • the principle of HJV BMP reporter assay is illustrated in FIG. 2A.
  • the BRE-Luc reporter gene vector initially described by Korchynskyi and Dijke was used to transiently transfect porcine kidney epithelial cell line LLC-PK1 with or without co-transfection of an RGMa expression vector by Babbit et al (J. Biol. Chem. 2005; 280:29820) to determine if RGMa expression modulates BMP signaling.
  • RGMa was demonstrated to enhance BMP signaling through the Smad 1/5/8 signaling pathway, consistent with a role for RGMa as a BMP co-receptor.
  • RGMa, RGMb, and RGMc act as BMP co-receptor and enhance BMP signaling.
  • the BRE-Luc reporter vector was constructed and established the RGM BMP reporter gene assay in HEK293 cells. Human RGMc expression vector used in the assay was pcDNA-hRGMc.
  • HEK293 cells were cultured in growth media (base media DMEM (Invitrogen catalog #11965-092) containing 10% fetal bovine serum (Gibco #10438-026) and 1% sodium pyruvate (Invitrogen, catalog # 11360-070)). To prepare cells for transfection, 9 x 10 6 cells HEK293 cells were plated in 10 cm dishes and incubated at 37°C, 5% CO2 for 6 hours.
  • base media DMEM Invitrogen catalog #11965-092
  • fetal bovine serum Gibco #10438-026
  • sodium pyruvate Invitrogen, catalog # 11360-070
  • the cells were then transfected using PolyJet (pL): DNA (pg) ratio of 2:1, specifically 20 pl PolyJet (SignaGen, cat # SL100688) with 5 pg pGL[/nc2P/BRE/Hygro] DNA (Abbvie) and 5 pg pcDNA-hRGMc (Abbvie) for 16 hours at 37 °C, 5% CO2. The media was replaced with fresh HEK293 growth media for 6 hours. The cells were then trypsinized with TrpLE (ThermoFisher, cat # 12605010), counted, and plated in 96-well white assay plates (Thermo Scientific Nunclon delta F96, cat #136102) at 1 x 10 5 cells per well.
  • TrpLE ThermoFisher, cat # 12605010
  • Table 18 IC50 of the anti-HJV antibodies in BMP reporter assay for RGMc.
  • the anti-HJV antibodies were tested for their ability to inhibit RGMa signaling in BMP reporter assays.
  • the hHA-004 and hHA-011 showed potent inhibition on membrane-bound human RGMa in RGMa BMP reporter gene assay, whereas hHA-008 and hHA-009 showed no to minimal inhibition on RGMa activity.
  • the hHA antibody showed no inhibition to membrane bound RGMa.
  • the rat mAb HA showed inhibition on RGMa but to much less extent as compared to hHA-004 and hHA-011.
  • FIG. 2C The IC50 (nM) of each of the antibodies tested in inhibiting RGMa signaling in BMP reporter assay are shown in Table 9.
  • the antibodies including hHA, hHA-004, hHA-008, hHA-008-QL, hHA-009, and hHA-011 were tested for non-specific cell binding to HEK293 cells by FACS analysis.
  • the data showed hHA and its hHA-008, hHA-008-QL and hHA-011 showed no to minimal nonspecific cell binding on HEK293 cells at cone, up to 100 ug/ml.
  • hHA-004 and hHA-009 showed some non-specific cell binding at higher concentrations, but to a much less extent compared to positive control IgGs (FIG. 3).
  • hHA-008-QL was developed to prolong IgG serum half-line (ti/2). Previous studies have shown that neonatal Fc receptor (FcRn) protects IgG from catabolism, thereby increasing IgG serum half-life. Accordingly, the Fc portion of hHA-008-QL was engineered to have T250Q and M428L mutations (QL mutations) such that it has enhanced binding to FcRn.
  • FIGs. 4A and 4B illustrates the structure of hHA-008 and hHA-008-QL respectively. A further illustration of hHA-008 and hHA-008-QL is shown in FIG. 4C.
  • hHA-008-QL was tested for its RGMa and RGMc binding capabilities, and the data showed that hHA-008-QL had binding affinities to RGMa and RGMc comparable to that of hHA-008 (Table 21).
  • FcyR binding was tested for hHA-008 and hHA-008-QL as another parameter for immunogenicity.
  • the control group wild-type irrelevant IgGl had significant binding to both the high and low affinity Fc gamma receptors.
  • the binding of the wild-type irrelevant IgG4 is significantly lower than that of wild-type irrelevant IgGl.
  • Binding to the high affinity and low affinity receptors is significantly reduced for both hHA- 008 and hHA-008-QL compared to wild-type IgGl, suggesting low immunogenicity for both antibodies.
  • TSAT% transferrin saturation
  • this male cyno had a lower baseline TSAT% and serum iron level than other cynos in the group: two days before the injection, it had a baseline TSAT% level at 18% and a serum iron level at 77 pg/dL; one day before the injection, it had a baseline TSAT% level at 14% and a serum iron level at 61 pg/dL.
  • TSAT% determined as serum iron over total iron binding capacity
  • plasma hepcidin-25 concentration and plasma hHA- 008 concentrations were tested for each animal and time point.
  • One of the animals had a drastic decline of TSAT% around day 34 (FIG. 7A) , which was consistent with the declining of plasma hHA-008 concentration around that time.
  • Plasma hepcidin-25 concentration correlated inversely with the concentrations of hHA-008, in that hepcidin-25 was undetectable after antibody injection, and for the animal which had the drastic decline of TSAT%, hepcidin-25 level increased around the same time (FIG. 7B).
  • hHA-008 had a plasma ti/2 of about 5 days.
  • the animal showed decline of TSAT% and increased hepcidin-25 levels at approximately day 34, which correlated well with the decrease of hHA- 008 from plasma (FIG. 7C).
  • T1/2 of -7 days in Cyno supports at least one/month dosing frequency in human.
  • hHA-008 had showed robust PK/PD correlation of PK (plasma antibody concentration) to TSAT% and plasma hepcidin-25 concentrations.
  • the results of each tested Cyno are shown in FIG. 7D (Cyno 1), FIG. 7E (Cyno 2), and FIG. 7F (Cyno 3).
  • hHA-008 showed a ti/2 of 10.3 days in Cyno 1, ti/2 of 8.8 days in Cyno 2, and ti/2of 5.1 days in Cyno 3.
  • Hepcidin-25 level drops to undetectable ( ⁇ 2ng/ml) after hHA-008 treatment.
  • return of hepcidin-25 level to circulation was well correlated with the ti/2 of hHA-008 in Cyno 3 (FIG. 7F).
  • hHA-008 antibody modulates TSAT% in a dose-dependent manner.
  • the resulting concentrations of hHA-008 and the corresponding TSAT% response are presented in FIG. 8A, FIG. 8B and FIG. 8C for the 0.6, 3 and 60 mpk treatments respectively, all plotted vs the vehicle control. Cynos were dosed every 14 days. Dotted lines represent dose day.
  • TSAT% increased after dosing, and the percent modulation was consistent with the dose levels: at 0.6 mpk, TSAT reached -60%, and at 3 mpk and 60 mpk, TSAT% was saturated, indicating that hHA-008 modulates TSAT% in a dose dependent manner. Further, after the first dose at 0.6 mpk, TSAT% levels were maintained at -60%, while at higher dose levels, TSAT% reached 100%, suggesting that TSAT can be modulated by selection of appropriate dose-level/regimen (FIGs. 8A-8C).
  • hHA-008-QL confers longer serum half-life and takes longer time to reach maximal effect compared to hHA-008
  • pro-inflammatory cytokines that induce hepcidin synthesis such as IL-6 and oncostatin-M
  • IL-6 and oncostatin-M pro-inflammatory cytokines that induce hepcidin synthesis
  • IL-6 and oncostatin-M pro-inflammatory cytokines that induce hepcidin synthesis
  • macrophage iron loading as well as myeloid proliferation and macrophage activation.
  • IL-6 indeed increases hepcidin expression and whether anti-HJV antibody is capable of inhibiting hepcidin expression induced by IL-6 in non-human primates
  • cynos were challenged with IL-6 on day 1, and divided into three groups.
  • cynos in Group 1 received vehicle control
  • cynos in Group 2 received hHA-008 antibody at 0.6 mg/kg
  • cynos in Group 3 received hHA-008 antibody at 6.0 mg/kg.
  • cynos in all three groups were challenged with IL-6 again, and plasma hepcidin-25 in all cynos was measured.
  • IL-6 challenge increased plasma hepcidin-25 concentrations on Day 1, compared to pre-challenge baseline (BL) in all three groups of cynos.
  • cynos in group 1 showed an increase in plasma hepcidin-25 similar to that observed on Day 1.
  • Epitope mapping was performed on hHA-008 and hHA-008-QL, using 3720-RG- 050 (Hemojuvelin (HJV) fragment, SEQ ID NO: 123).
  • 3720-RG-050/ hHA-008 and 3720-RG-050/ hHA-008-QL complexes were incubated with deuterated cross-linkers and subjected to multi-enzymatic cleavage. After enrichment of the cross-linked peptides, the samples were analyzed by high resolution mass spectrometry (nLC-LTQ-Orbitrap MS) and the data generated were analyzed using XQuest and Stavrox software.
  • FIG. 14 shows hHA-008 interacts with amino acids 170-183
  • FIG. 15 shows the interaction of 3720-RG-050 and hHA-008.
  • a 3720-RG-050 PDB structure was generated by homology using Swiss Model software.
  • 3720-RG-050 amino acids 170-183 (SSPMALGANATATR (SEQ ID NO: 121)) of 3720-RG-050 sequence are shown in FIG. 15: ribbon/surface representation of front view (A); back view (B), side view 1 (C), side view 2 (D) and top view (E).
  • F, G, H, I, J ribbon representation of front view (F); back view (G), side view 1 (H), side view 2 (I) and top view (J).
  • MS/MS analysis detected 16 cross-linked peptides between 3720-RG-050 and hHA-008-QL.
  • Table 24 Cross-linked peptides detected between 3720-RG-050 and HA-008-QL.
  • FIG. 16 shows hHA-008-QL interacts with amino acids 169-182 (TSSPMALGANATAT (SEQ ID NO: 122)) and 289-300 (SQRLSRSERNRR (SEQ ID NO: 127)) of 3720-RG-050. The interaction happens on amino acids 169, 171, 180, 182; 289, 293, 294, 295, 297, 300 on 3720-RG-050.
  • FIG. 17 shows the interaction 3720-RG-050/hHA-008- QL.
  • a 3720-RG-050 PDB structure was generated by homology using Swiss Model software.
  • 3720-RG-050 amino acids 169-182 TSSPMALGANATAT (SEQ ID NO: 122) and 289-291 (SQR) are shown as FIG. 17: ribbon/surface representation of front view (A); back view (B), side view 1 (C), side view 2 (D) and top view (E).
  • F, G, H, I, J ribbon representation of front view (F); back view (G), side view 1 (H), side view 2 (I) and top view (J).
  • Example 8 hHA-008-QL Decreases Circulating Transferrin Level
  • Circulating transferrin level can be used as an indicator of the iron level in the body along with other markers (e.g., total iron binding capacity, serum ferritin level, etc.).
  • Circulating transferrin is an iron-transport protein that reflects both protein and iron status. Transferrin increases with iron deficiency and decreases when iron status improves (see, e.g., Litchford et al., NUTRITIONAL ISSUES IN THE PATIENT WITH DIABETES AND FOOT ULCERS, Levin and O'Neal's The Diabetic Foot (Seventh Edition), 2008; Ogun et al., Biochemistry, Transferrin, Treasure Island (FL): StatPearls Publishing; 2021 Jan).
  • Table 25 Circulating transferrin levels and changes over baseline in cynos treated with hHA- 008-QL.
  • Example 9 hHA-008 Prevents Inflammation-induced (IL-6) Iron Suppression in Cynomolgus macaque
  • Example 10 Subcutaneous Injection of hHA-008 in Sprague-Dawley Rats
  • Example 11 Subcutaneous Dose Administration in Cynomolgus Monkeys [00419] PK/PD of subcutaneous hHA-008 treatment were also evaluated in Cynomolgus (cynos). Cynos were injected with hHA-008 subcutaneously at 0.3 mpk, 0.6 mpk, 1 mpk and 6 mpk.
  • each group included 3 male cynos that received a single subcutaneous injection of hHA-008. Blood samples were collected for 27 days. Cynos received the same dose of hHA-008 by IV were used for comparison for each group.
  • the PD response after SC dose was variable between animals, relatively proportional to the dose-level, and similar to the PD response observed after IV dosing at 0.1 mpk, 0.6 mpk, and 1.0 mpk.
  • the PD response was functionally maximal (TSAT >80% and hepcidin-25 ⁇ LOQ) between 1 -2 days after dosing.
  • the return of the PD markers e.g., serum iron
  • serum iron concentrations in both SC injected group and IV injected group were too saturated to reflect the change (data not shown).
  • Example 12 Comparison of Intravenous and Subcutaneous Administration Pharmacokinetics and Pharmacodynamics:
  • hHA-008 is defined by an antibody having a VH region comprising an amino acid sequence of SEQ ID NO: 38, and a VL region comprising an amino acid sequence of SEQ ID NO: 39.
  • eligibility of healthy volunteers may be separated by sex (on average, healhy women exhibit hemoglobin levels of 1 g/dL lower than healthy men, ⁇ 10.5 g/dL and ⁇ 11.5g/dL, respectively). Subjects may be eligible if their serum hepcidin or urin hepcidin levels are greater than the median of healthy volunteers.
  • a nonclinical IV safety program was completed following recommendations and guidance to support IV dosing in initial clinical trials.
  • a single dose tolerability and PKPD study was completed in rats. Since the toxicologic profile of hHA-008 following IV administration was well defined, and systemic SC exposure was known to be similar to IV dosing based on previous PKPD studies (including those of Examples 10 and 11, above), it was determined that local tolerance following SC administration was the only additional data required prior to implementing subcutaneous dosing in healthy volunteers in the hHA-008-101 study.
  • ALP Alkaline Phosphatase
  • ALT Alanine aminotransferase
  • AST Aspartate aminotransferase
  • ALP Alkaline Phosphatase
  • ALT Alanine aminotransferase
  • AST Aspartate aminotransferase
  • Serum iron levels were increased to near maximal levels in the PKPD phase at 6 and 30 mg/kg at 24 hours postdose, and remained elevated at those levels for 28 days.
  • serum iron was increased to near maximal levels at 400 mg/kg at 24 hours postdose; on Day 28, serum iron remained near maximal levels in females but was slightly lower than maximal levels in males (FIGs. 27A-27D).
  • Serum TSAT were increased in the PKPD phase in both sexes at 6 and 30 mg/kg at 24 hours postdose and remained elevated at these levels through Day 28 except in females at 30 mg/kg, where TSAT was similar to controls at 24 hours postdose.
  • TSAT was increased at 24 hours postdose in both sexes at 400 mg/kg and in females on Day 28. Partial or complete recovery noted in most males at 400 mg/kg on Day 28.
  • hHA-008-related microscopic findings involving pigment were present in the liver and spleen of males and females receiving 400 mg/kg at 48 hours post-dose and on Day 28 (Table 7).
  • Liver pigment (iron based on the Prussian Blue sections) was minimally to markedly increased in affected animals compared to controls. Pigment was primarily periportal and stain intensity varied between and within the two liver lobes evaluated. The overall incidence and average severity grade of liver pigment were greater in the Day 28 animals than in the 48 hours post-dose animals. The magnitude (intensity) of splenic pigment (iron based on the Prussian Blue sections) was markedly decreased in affected animals compared to controls. No hHA-008-related changes in Prussian Blue stained sections of heart were observed.
  • HHA-008 toxicokinetic parameters were similar in males and females and increased with increasing dose at 6 and 30 mg/kg (Table 9). Limited sampling at 400 mg/kg precluded calculation of toxicokinetic parameters, but concentrations at the sampling times included in this study were similar to comparable timepoints in a previous 1-month IV study.
  • AUCo-648h Area under the concentration-time curve from time 0 to 648 hours postdose
  • HHA-008 To support a clinical development program, the PK and PD of HHA-008 were characterized in Sprague-Dawley rats and cynomolgus monkeys following IV and SC administration.
  • Cmax maximum concentration
  • T m ax time after dose of Cmax occurrence
  • AUC?d area under the curve, from time of dosing to 7 days hence
  • AUCinf area under the curve from time of dosing to infinity
  • Half-life half-life.
  • Cited Cmax, AUC, and half-life values represent mean values from male and female rats combined, with the exception of one study, which only dosed female rats.
  • T m ax values are medians. All values represent 3 significant digits except half-life, which is accurate to one decimal place.
  • FIGs. 29A-29D shows the serum Fe response for both the 6 mg/kg and 30 mg/kg doses given as either a SC or IV dose. Eike the PK, the serum Fe response appeared to be nearly identical between the SC and IV administrations for each dose level.
  • FIGs. 3OA-3OD shows comparisons between the SC and IV pharmacokinetics across all doses on both linear and log-linear axes. Note that after absorption is complete from SC administration serum hHA-008 concentrations are comparable between the IV and SC administrations at all dose levels.
  • Table 12 provides a comparison of pertinent PK parameters between the IV and SC dose administrations. Except for Cmax and T m ax, the results suggest comparable AUCo-iast and AUCinf values for the 0.6, 1.0, and 6.0 mg/kg dose levels.
  • Tmax value represents an average across animals.
  • the Cmax and t m ax values for the SC dose should be reduced and prolonged, respectively, compared to IV, but the hHA-008 concentrations beyond Cmax are not expected to differ between the two routes. Thus, no difference should be expected between dose selection and dosing frequency for SC and IV hHA-008 administration.
  • healthy volunteers received a 7 mg IV dose in the 1 st cohort.
  • hHA- 008 single SC dose in HVs will begin at the next planned dose of 14 mg, providing that the safety profiles from the 7 mg IV dose cohort in this study supports continued dose escalation.
  • Hepcidin-induced iron restriction results from a variety of inflammatory stimuli and can cause anemia of inflammation.
  • Hemojuvelin HJV
  • HJV is glycosylphosphatidylinositol- anchored membrane protein expressed in iron-loading tissues (liver, heart, muscle) that binds bone morphogenetic protein (BMP) family receptors as a central regulator of hepcidin expression.
  • BMP bone morphogenetic protein
  • hHA-008 decreased Hamp mRNA in a mouse model of heat-killed Brucella abortus-triggered inflammation and improved hemoglobin in a rat model of peptidoglycan-polysaccharide 10- induced anemia of inflammation. hHA-008 also showed dose-proportional decreases in circulating hepcidin-25 and increase in serum iron in a non-human primate model of IL-6- induced hypoferremia.
  • Eligible subjects are healthy females of non-reproductive potential and males 18-65 years old, without known hemochromatosis risk factors and with normal baseline red blood cell parameters, normal serum iron, normal total iron binding capacity (TIBC), morning transferrin saturation (TSAT) ⁇ 30% (or ⁇ 25%), and serum ferritin >30 ng/mL.
  • normal serum iron normal total iron binding capacity (TIBC)
  • TIBC normal total iron binding capacity
  • TSAT morning transferrin saturation
  • serum ferritin >30 ng/mL.
  • Subjects were randomly allocated in each cohort 6:2, hHA-008 :placebo in a blinded fashion. Unblinding of treatment allocation occured after an assessment of each cohort, prior to initiating the next dose level.
  • the starting dose level was 7 mg total dose (0.1 mg/kg), and the escalation planned to follow a 2-fold increase.
  • Escalation may be up to a 42 mg total dose (0.6 mg/kg).
  • Escalation may be up to a 56 mg total dose (0.8 mg/kg).
  • Escalation may be up to a 60 mg or a 90 mg total dose. Any of these doses may be administered monthly or semimonthly. Subjects were evaluated for a minimum of 28 days and then until circulating hHA- 008 was no longer detectable or 10 weeks, whichever was sooner.
  • a lead anti-hemojuvelin antibody identified as Anti-HJV Ab
  • HJV is a humanized monoclonal antibody that is currently in Phase I clinical studies.
  • HJV is a pathway- specific coreceptor for bone morphogenetic protein (BMP) signaling that regulates hepcidin expression and iron metabolism that is encoded by the HFE2 gene.
  • BMP bone morphogenetic protein
  • Loss of function mutations in HFE2 in humans cause profound reductions in hepcidin synthesis and severe iron overload. Consequently, it is hypothesized that pharmacological reduction of HJV activity will lead to reduction of hepcidin synthesis and increased iron availability. This hypothesis has been confirmed in studies of Anti-HJV Ab in rodents, non-human primates and healthy human volunteers.
  • anemia is a common complication in patients with CKD and has been associated with multiple adverse outcomes in this population.
  • CKD hepcidin is increased because of both reduced renal clearance and increased synthesis. This increase is believed to be a central contributor to the development of anemia by reducing the availability of iron from systemic iron stores and by reducing dietary iron absorption.
  • the following studies were conducted to evaluate the effects of Anti-HJV Ab in an animal model of CKD anemia.
  • Rats were euthanized on Day 42. Blood was collected on Days 0, 7, 21, 35, and 42 for evaluation of hematology parameters, as well as serum iron, hepcidin and complete blood count (CBC). Serum was further analyzed for creatinine, urea nitrogen, TIBC, and erythropoietin (EPO) levels. Liver tissue was also collected on Day 43 for evaluation of hepcidin gene (HAMP) mRNA expression level. A schematic of this study design is shown in FIG. 31.
  • Anti-HJV Ab reduced HAMP gene expression in the liver as measured at the end the study, which led to reduced serum hepcidin-25 and increased serum iron concentration (FIG. 33).
  • Anti-HJV Ab treatment improved anemia in CKD rats.
  • Cellular hemoglobinization measured as reticulocyte hemoglobin (RET-He) was increased.
  • the invention encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, and descriptive terms from one or more of the listed claims is introduced into another claim.
  • any claim that is dependent on another claim can be modified to include one or more limitations found in any other claim that is dependent on the same base claim.
  • elements are presented as lists, e.g., in Markush group format, each subgroup of the elements is also disclosed, and any element(s) can be removed from the group.
  • the invention, or aspects of the invention is/are referred to as comprising particular elements and/or features, certain embodiments of the invention or aspects of the invention consist, or consist essentially of, such elements and/or features. For purposes of simplicity, those embodiments have not been specifically set forth in haec verba herein.
  • a reference to “A and/or B”, when used in conjunction with open-ended language such as “comprising” can refer, in one embodiment, to A only (optionally including elements other than B); in another embodiment, to B only (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc.
  • “at least one of A and B” can refer, in one embodiment, to at least one, optionally including more than one, A, with no B present (and optionally including elements other than B); in another embodiment, to at least one, optionally including more than one, B, with no A present (and optionally including elements other than A); in yet another embodiment, to at least one, optionally including more than one, A, and at least one, optionally including more than one, B (and optionally including other elements); etc.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biophysics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Diabetes (AREA)
  • Hematology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/US2022/079987 2021-11-17 2022-11-16 Methods for treating anemia of kidney disease Ceased WO2023091968A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
CN202280082955.9A CN118715023A (zh) 2021-11-17 2022-11-16 用于治疗肾病性贫血的方法
EP22840844.9A EP4433160A1 (en) 2021-11-17 2022-11-16 Methods for treating anemia of kidney disease
US18/710,958 US20240417458A1 (en) 2021-11-17 2022-11-16 Methods for treating anemia of kidney disease
JP2024529330A JP2024540480A (ja) 2021-11-17 2022-11-16 腎臓疾患の貧血を処置する方法
MX2024006006A MX2024006006A (es) 2021-11-17 2022-11-16 Metodos para tratar anemia de enfermedad renal.
KR1020247019664A KR20240101681A9 (ko) 2021-11-17 2022-11-16 신장 질환에 의한 빈혈을 치료하는 방법
AU2022394462A AU2022394462A1 (en) 2021-11-17 2022-11-16 Methods for treating anemia of kidney disease
CA3235096A CA3235096A1 (en) 2021-11-17 2022-11-16 Methods for treating anemia of kidney disease

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202163280594P 2021-11-17 2021-11-17
US63/280,594 2021-11-17
US202263419648P 2022-10-26 2022-10-26
US63/419,648 2022-10-26

Publications (1)

Publication Number Publication Date
WO2023091968A1 true WO2023091968A1 (en) 2023-05-25

Family

ID=84923162

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/079987 Ceased WO2023091968A1 (en) 2021-11-17 2022-11-16 Methods for treating anemia of kidney disease

Country Status (8)

Country Link
US (1) US20240417458A1 (https=)
EP (1) EP4433160A1 (https=)
JP (1) JP2024540480A (https=)
KR (1) KR20240101681A9 (https=)
AU (1) AU2022394462A1 (https=)
CA (1) CA3235096A1 (https=)
MX (1) MX2024006006A (https=)
WO (1) WO2023091968A1 (https=)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12098189B2 (en) 2011-12-14 2024-09-24 AbbVie Deutschland GmbH & Co. KG Composition and method for the diagnosis and treatment of iron-related disorders
US12365729B2 (en) 2020-05-13 2025-07-22 Disc Medicine, Inc. Anti-hemojuvelin (HJV) antibodies for treating myelofibrosis

Citations (46)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1987004462A1 (en) 1986-01-23 1987-07-30 Celltech Limited Recombinant dna sequences, vectors containing them and method for the use thereof
US4704692A (en) 1986-09-02 1987-11-03 Ladner Robert C Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US5580717A (en) 1990-05-01 1996-12-03 Affymax Technologies N.V. Recombinant library screening methods
US5585097A (en) 1992-03-24 1996-12-17 British Technology Group Limited Humanized anti-CD3 specific antibodies
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
WO1997034631A1 (en) 1996-03-18 1997-09-25 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
US5677425A (en) 1987-09-04 1997-10-14 Celltech Therapeutics Limited Recombinant antibody
US5693780A (en) 1991-07-25 1997-12-02 Idec Pharmaceuticals Corporation Recombinant antibodies for human therapy
US5733743A (en) 1992-03-24 1998-03-31 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1998023289A1 (en) 1996-11-27 1998-06-04 The General Hospital Corporation MODULATION OF IgG BINDING TO FcRn
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US5981568A (en) 1993-01-28 1999-11-09 Neorx Corporation Therapeutic inhibitor of vascular smooth muscle cells
WO1999058572A1 (en) 1998-05-08 1999-11-18 Cambridge University Technical Services Limited Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis
WO2000042072A2 (en) 1999-01-15 2000-07-20 Genentech, Inc. Polypeptide variants with altered effector function
WO2000053211A2 (en) 1999-03-09 2000-09-14 University Of Southern California Method of promoting myocyte proliferation and myocardial tissue repair
US6121022A (en) 1995-04-14 2000-09-19 Genentech, Inc. Altered polypeptides with increased half-life
US6165745A (en) 1992-04-24 2000-12-26 Board Of Regents, The University Of Texas System Recombinant production of immunoglobulin-like domains in prokaryotic cells
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
US6265150B1 (en) 1995-06-07 2001-07-24 Becton Dickinson & Company Phage antibodies
US6277375B1 (en) 1997-03-03 2001-08-21 Board Of Regents, The University Of Texas System Immunoglobulin-like domains with increased half-lives
WO2002060919A2 (en) 2000-12-12 2002-08-08 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
WO2005007699A2 (en) 2003-07-15 2005-01-27 Cambridge Antibody Technology Limited Human antibody molecules for il-13
WO2005047307A2 (en) 2003-11-12 2005-05-26 Abbott Laboratories Il-18 binding proteins
US6914128B1 (en) 1999-03-25 2005-07-05 Abbott Gmbh & Co. Kg Human antibodies that bind human IL-12 and methods for producing
WO2005123126A2 (en) 2004-06-09 2005-12-29 Wyeth Antibodies against human interleukin-13 and uses therefor
US7534764B2 (en) 2005-06-29 2009-05-19 The Regents Of The University Of California Competitive regulation of hepcidin mRNA by soluble and cell-associated hemojuvelin
US7658921B2 (en) 2000-12-12 2010-02-09 Medimmune, Llc Molecules with extended half-lives, compositions and uses thereof
US8216997B2 (en) 2008-08-14 2012-07-10 Acceleron Pharma, Inc. Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators
WO2013063110A1 (en) 2011-10-24 2013-05-02 Abbvie Inc. Bispecific immunobinders directed against tnf and il-17
WO2013090633A2 (en) * 2011-12-14 2013-06-20 AbbVie Deutschland GmbH & Co. KG Composition and method for the diagnosis and treatment of iron-related disorders
WO2013090635A2 (en) * 2011-12-14 2013-06-20 AbbVie Deutschland GmbH & Co. KG Composition and method for the diagnosis and treatment of iron-related disorders
US8507435B2 (en) 2003-04-15 2013-08-13 Xenon Pharmaceuticals, Inc. Juvenile hemochromatosis gene (HFE2A) cleavage products and uses thereof
US8591886B2 (en) 2007-07-12 2013-11-26 Gitr, Inc. Combination therapies employing GITR binding molecules
WO2014065661A1 (en) 2012-10-23 2014-05-01 Synaffix B.V. Modified antibody, antibody-conjugate and process for the preparation thereof
US20140127325A1 (en) 2011-06-21 2014-05-08 Brian Bettencourt Compositions and Method for Inhibiting Hepcidin Antimicrobial Peptide (HAMP) or HAMP-Related Gene Expression
US20150166672A1 (en) 2013-12-17 2015-06-18 Kymab Limited Precision Medicine By Targeting Rare Human PCSK9 Variants for Cholesterol Treatment
WO2015171691A2 (en) 2014-05-06 2015-11-12 Scholar Rock, Inc. Compositions and methods for growth factor modulation
WO2016180784A1 (en) 2015-05-08 2016-11-17 Proqr Therapeutics Ii B.V. Improved treatments using oligonucleotides
US20170029499A1 (en) 2015-07-31 2017-02-02 Astrazeneca Pharmaceuticals Lp Methods for treating hepcidin-mediated disorders
WO2018009624A1 (en) 2016-07-07 2018-01-11 Acceleron Pharma Inc. Tgf-beta superfamily heteromultimers and uses thereof
WO2020086736A1 (en) * 2018-10-23 2020-04-30 Scholar Rock, Inc. Rgmc-selective inhibitors and use thereof
WO2021231800A2 (en) * 2020-05-13 2021-11-18 Disc Medicine, Inc. Anti-hemojuvelin (hjv) antibodies for treating anemia of chronic disease

Patent Citations (49)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1987004462A1 (en) 1986-01-23 1987-07-30 Celltech Limited Recombinant dna sequences, vectors containing them and method for the use thereof
US4704692A (en) 1986-09-02 1987-11-03 Ladner Robert C Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5648260A (en) 1987-03-18 1997-07-15 Scotgen Biopharmaceuticals Incorporated DNA encoding antibodies with altered effector functions
US5677425A (en) 1987-09-04 1997-10-14 Celltech Therapeutics Limited Recombinant antibody
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US5580717A (en) 1990-05-01 1996-12-03 Affymax Technologies N.V. Recombinant library screening methods
US5693780A (en) 1991-07-25 1997-12-02 Idec Pharmaceuticals Corporation Recombinant antibodies for human therapy
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US5733743A (en) 1992-03-24 1998-03-31 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5585097A (en) 1992-03-24 1996-12-17 British Technology Group Limited Humanized anti-CD3 specific antibodies
US6165745A (en) 1992-04-24 2000-12-26 Board Of Regents, The University Of Texas System Recombinant production of immunoglobulin-like domains in prokaryotic cells
US5981568A (en) 1993-01-28 1999-11-09 Neorx Corporation Therapeutic inhibitor of vascular smooth muscle cells
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
US6121022A (en) 1995-04-14 2000-09-19 Genentech, Inc. Altered polypeptides with increased half-life
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US6265150B1 (en) 1995-06-07 2001-07-24 Becton Dickinson & Company Phage antibodies
WO1997034631A1 (en) 1996-03-18 1997-09-25 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
WO1998023289A1 (en) 1996-11-27 1998-06-04 The General Hospital Corporation MODULATION OF IgG BINDING TO FcRn
US6277375B1 (en) 1997-03-03 2001-08-21 Board Of Regents, The University Of Texas System Immunoglobulin-like domains with increased half-lives
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
WO1999058572A1 (en) 1998-05-08 1999-11-18 Cambridge University Technical Services Limited Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis
WO2000042072A2 (en) 1999-01-15 2000-07-20 Genentech, Inc. Polypeptide variants with altered effector function
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
WO2000053211A2 (en) 1999-03-09 2000-09-14 University Of Southern California Method of promoting myocyte proliferation and myocardial tissue repair
US6914128B1 (en) 1999-03-25 2005-07-05 Abbott Gmbh & Co. Kg Human antibodies that bind human IL-12 and methods for producing
WO2002060919A2 (en) 2000-12-12 2002-08-08 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
US7658921B2 (en) 2000-12-12 2010-02-09 Medimmune, Llc Molecules with extended half-lives, compositions and uses thereof
US8507435B2 (en) 2003-04-15 2013-08-13 Xenon Pharmaceuticals, Inc. Juvenile hemochromatosis gene (HFE2A) cleavage products and uses thereof
WO2005007699A2 (en) 2003-07-15 2005-01-27 Cambridge Antibody Technology Limited Human antibody molecules for il-13
WO2005047307A2 (en) 2003-11-12 2005-05-26 Abbott Laboratories Il-18 binding proteins
WO2005123126A2 (en) 2004-06-09 2005-12-29 Wyeth Antibodies against human interleukin-13 and uses therefor
US7534764B2 (en) 2005-06-29 2009-05-19 The Regents Of The University Of California Competitive regulation of hepcidin mRNA by soluble and cell-associated hemojuvelin
US8591886B2 (en) 2007-07-12 2013-11-26 Gitr, Inc. Combination therapies employing GITR binding molecules
US8216997B2 (en) 2008-08-14 2012-07-10 Acceleron Pharma, Inc. Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators
US20140127325A1 (en) 2011-06-21 2014-05-08 Brian Bettencourt Compositions and Method for Inhibiting Hepcidin Antimicrobial Peptide (HAMP) or HAMP-Related Gene Expression
WO2013063110A1 (en) 2011-10-24 2013-05-02 Abbvie Inc. Bispecific immunobinders directed against tnf and il-17
US10118958B2 (en) 2011-12-14 2018-11-06 AbbVie Deutschland GmbH & Co. KG Composition and method for the diagnosis and treatment of iron-related disorders
WO2013090633A2 (en) * 2011-12-14 2013-06-20 AbbVie Deutschland GmbH & Co. KG Composition and method for the diagnosis and treatment of iron-related disorders
US20130330343A1 (en) 2011-12-14 2013-12-12 Abbvie Inc. Composition and method for the diagnosis and treatment of iron-related disorders
WO2013090635A2 (en) * 2011-12-14 2013-06-20 AbbVie Deutschland GmbH & Co. KG Composition and method for the diagnosis and treatment of iron-related disorders
WO2014065661A1 (en) 2012-10-23 2014-05-01 Synaffix B.V. Modified antibody, antibody-conjugate and process for the preparation thereof
US20150166672A1 (en) 2013-12-17 2015-06-18 Kymab Limited Precision Medicine By Targeting Rare Human PCSK9 Variants for Cholesterol Treatment
WO2015171691A2 (en) 2014-05-06 2015-11-12 Scholar Rock, Inc. Compositions and methods for growth factor modulation
WO2016180784A1 (en) 2015-05-08 2016-11-17 Proqr Therapeutics Ii B.V. Improved treatments using oligonucleotides
US20170029499A1 (en) 2015-07-31 2017-02-02 Astrazeneca Pharmaceuticals Lp Methods for treating hepcidin-mediated disorders
WO2018009624A1 (en) 2016-07-07 2018-01-11 Acceleron Pharma Inc. Tgf-beta superfamily heteromultimers and uses thereof
WO2020086736A1 (en) * 2018-10-23 2020-04-30 Scholar Rock, Inc. Rgmc-selective inhibitors and use thereof
WO2021231800A2 (en) * 2020-05-13 2021-11-18 Disc Medicine, Inc. Anti-hemojuvelin (hjv) antibodies for treating anemia of chronic disease

Non-Patent Citations (67)

* Cited by examiner, † Cited by third party
Title
"Remington: The Science and Practice of Pharmacy", 2000, LIPPINCOTT WILLIAMS AND WILKINS
AL-LAZIKANI ET AL., J. MOLEC. BIOL., vol. 273, 1997, pages 927 - 948
ALMAGRO, J. MOL. RECOGNIT., vol. 17, 2004, pages 132 - 143
ALWAHAIBI NY ET AL., SAUDI J KIDNEY DIS TRANSPL., vol. 29, no. 6, November 2018 (2018-11-01), pages 1256 - 1266
AM. J. KIDNEY DIS, vol. 39, 2002, pages S1 - S266
ANGAL S. ET AL.: "A single amino acid substitution abolishes the heterogeneity of chimeric mouse/human (IgG4) antibody", MOL IMMUNOL, vol. 30, 1993, pages 105 - 108, XP023683005, DOI: 10.1016/0161-5890(93)90432-B
ANGELIKI KATSAROUKOSTAS PANTOPOULOS: "Hepcidin Therapeutics", PHARMACEUTICALS (BASEL, vol. 11, no. 4, December 2018 (2018-12-01), pages 127, XP055691940, DOI: 10.3390/ph11040127
ASSHOFF, M. ET AL.: "Momelotinib inhibits ACVR1/ALK2, decreases hepcidin production, and ameliorates anemia of chronic disease in rodents", BLOOD, vol. 129, no. 13, 30 March 2017 (2017-03-30), pages 1823 - 1830
AZZAZY H.HIGHSMITH W. E., CLIN. BIOCHEM., vol. 35, 2002, pages 425 - 445
BABBIT ET AL., J. BIOL. CHEM., vol. 280, 2005, pages 29820
BARBAS ET AL., PROC. NAT. ACAD. SCI. USA, vol. 91, 1994, pages 3809 - 3813
BROWN, M. ET AL., CELL, vol. 49, 1987, pages 603 - 612
CHAI KY ET AL.: "Danazol: An Effective and Underutilized Treatment Option in Diamond-Blackfan Anaemia", CASE REPORTS IN HEMATOLOGY, vol. 2019
CHELIUS ET AL.: "Formation of Pyroglutamic Acid From N-terminal Glutamic Acid in Immunoglobulin Gamma Antibodies", ANAL CHEM., vol. 78, no. 7, 2006, pages 2370 - 2376, XP002453344, DOI: 10.1021/ac051827k
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 877
CHOTHIA, C. ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CULLIS, JO: "Diagnosis and management of anaemia of chronic disease: current status", BRITISH JOURNAL OF HAEMATOLOGY, vol. 154, August 2011 (2011-08-01), pages 289 - 300, XP071161649, DOI: 10.1111/j.1365-2141.2011.08741.x
D'LL'ACQUA W F ET AL., J BIOL CHEM, vol. 281, 2006, pages 23514 - 24
FUNG E. ET AL.: "High-Throughput Screening of Small Molecules Identifies Hepcidin Antagonists", MOLECULAR PHARMACOLOGY, vol. 83, no. 3, 2013, pages 681 - 690, XP055188941, DOI: 10.1124/mol.112.083428
GAVILONDO J. VLARRICK J. W., BIOTECHNIQUES, vol. 29, 2002, pages 128 - 145
GOSSEN, M.BUJARD, H., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 5547 - 555115
HARLOWLANE: "Using Antibodies, a Laboratory Manual", 1999, COLD SPRING HARBOR LABORATORY PRESS
HAWKINS ET AL., J. MOL. BIOL., vol. 226, 1992, pages 889 - 896
HOLLIGER, P. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448
HOOGENBOOM H. R., TIB TECH., vol. 15, 1997, pages 62 - 70
HOOGENBOOM H.CHAMES P, IMMUNOLOGY TODAY, vol. 21, 2000, pages 364 - 370
JACKSON ET AL., J. IMMUNOL., vol. 154, no. 7, 1995, pages 3310 - 3319
KABAT ET AL., ANN. NY ACAD, SCI., vol. 190, 1971, pages 382 - 391
KABAT, E. A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH
KELLERMANN S-A.GREEN L. L, CURRENT OPINION IN BIOTECHNOLOGY, vol. 13, 2002, pages 593 - 597
KIPRIYANOV, S. M. ET AL., HUMAN ANTIBODIES AND HYBRIDOMAS, vol. 6, 1995, pages 93 - 101
KIPRIYANOV, S. M. ET AL., MOL. IMMUNOL., vol. 31, 1994, pages 1047 - 1058
KORCHYNSKYIDIJKE, J. BIOL. CHEM., vol. 277, 2002
LEFRANC, M.-P. ET AL., NUCLEIC ACIDS RES., vol. 27, 1999, pages 209 - 212
LEFRANC, M.-P. ET AL., NUCLEIC ACIDS RES., vol. 37, 2009, pages D1006 - 1012
LEFRANC, M.-P. ET AL., NUCLEIC ACIDS RES., vol. 43, 2015, pages D413 - 422
LEFRANC, M.-P., NUCLEIC ACIDS RES., vol. 29, 2001, pages 207 - 209
LEFRANC, M.-P., NUCLEIC ACIDS RES., vol. 31, 2003, pages 307 - 310
M. GOSSEN ET AL., NATL. ACAD. SCI. USA, vol. 89, 1992, pages 5547 - 5551
MACCALLUM, J MOL BIOL, vol. 262, no. 5, 1996, pages 732 - 45
MADUA AJUGHASORO MD: "Anaemia of Chronic Disease: An In-Depth Review", MED PRINC PRACT., vol. 26, no. 1, January 2017 (2017-01-01), pages 1 - 9
MARKS ET AL., BIOTECHNOLOGY, vol. 10, 1992, pages 779 - 783
MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 553
MORRISON ET AL., PROC. NAT. ACAD. SCI., vol. 81, 1984, pages 6851
MURTAGH ET AL., NEPHROL DIAL TRANSPLANT, vol. 22, 2007, pages 1955 - 1962
PADLAN, FASEB J, vol. 9, 1995, pages 133 - 139
POLJAK R.J., STRUCTURE, vol. 2, 1994, pages 1121 - 1123
PREETHNE BÖSER ET AL: "Anti-repulsive Guidance Molecule C (RGMc) Antibodies Increases Serum Iron in Rats and Cynomolgus Monkeys by Hepcidin Downregulation", THE AAPS JOURNAL, vol. 17, no. 4, 22 April 2015 (2015-04-22), pages 930 - 938, XP055210634, DOI: 10.1208/s12248-015-9770-4 *
ROSS SL ET AL.: "Identification of Antibody and Small Molecule Antagonists of Ferroportin-Hepcidin Interaction", FRONT PHARMACOL, vol. 8, 21 November 2017 (2017-11-21), pages 838
RUIZ, M. ET AL., NUCLEIC ACIDS RES., vol. 28, 2000, pages 219 - 221
SCHIER ET AL., GENE, vol. 169, 1995, pages 147 - 155
SHEETZ ET AL., BR J CLIN PHARMACOL., vol. 85, 2019, pages 935 - 948
SHIELDS R L ET AL., J BIOL CHEM, vol. 276, 2001, pages 6591 - 604
SHOCKELT, P. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 92, 1995, pages 6522 - 6526
SKOOG, D.AWEST, D.M.HOLLER, J.F.CROUCH, S.R., FUNDAMENTALS OF ANALYTICAL CHEMISTRY, 2004
SMITH P ET AL., PNAS, vol. 109, 2012, pages 6181 - 6186
SUN ET AL., NEPHROL DIAL TRANSPLANT, vol. 28, 2013, pages 1733 - 1743
TATTERSAL ET AL., NEPHROL DIAL TRANSPLANT, vol. 26, 2011, pages 2082 - 2086
TAYLOR, L. D., NUCL. ACIDS RES., vol. 20, 1992, pages 6287 - 6295
TOFT ET AL., J NEPHROL, vol. 33, no. 1, February 2020 (2020-02-01), pages 147 - 156
WANG ET AL., RENAL FAILURE, vol. 43, no. 31, 2021, pages 216 - 222
WEBSTER ANGELA C ET AL: "Chronic Kidney Disease", THE LANCET, vol. 389, no. 10075, 1 March 2017 (2017-03-01), AMSTERDAM, NL, pages 1238 - 1252, XP093024700, ISSN: 0140-6736, DOI: 10.1016/S0140-6736(16)32064-5 *
WINTER ET AL., ANNU. REV. IMMUNOL., vol. 12, 1994, pages 433 - 455
XIA Y ET AL.: "Hemojuvelin regulates hepcidin expression via a selective subset of BMP ligands and receptors independently of neogenin", BLOOD, vol. 111, no. 10, 15 May 2008 (2008-05-15), pages 5195 - 5204, XP008147144, DOI: 10.1182/blood-2007-09-111567
YAO, F. ET AL., HUMAN GENE THERAPY, vol. 9, 1998, pages 1939 - 1950
ZHAO ET AL.: "Neogenin Facilitates the Induction of Hepcidin Expression by Hemojuvelin in the Liver", J BIOL CHEM., vol. 291, no. 23, 3 June 2016 (2016-06-03), pages 12322 - 12335
ZIPFEL PF ET AL., FRONT IMMUNOL, vol. 10, 2019, pages 2166

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12098189B2 (en) 2011-12-14 2024-09-24 AbbVie Deutschland GmbH & Co. KG Composition and method for the diagnosis and treatment of iron-related disorders
US12098192B2 (en) 2011-12-14 2024-09-24 AbbVie Deutschland GmbH & Co. KG Composition and method for the diagnosis and treatment of iron-related disorders
US12365729B2 (en) 2020-05-13 2025-07-22 Disc Medicine, Inc. Anti-hemojuvelin (HJV) antibodies for treating myelofibrosis
US12497452B2 (en) 2020-05-13 2025-12-16 Disc Medicine, Inc. Anti-hemojuvelin (HJV) antibodies for treating myelofibrosis

Also Published As

Publication number Publication date
JP2024540480A (ja) 2024-10-31
EP4433160A1 (en) 2024-09-25
CA3235096A1 (en) 2023-05-25
AU2022394462A1 (en) 2024-05-02
US20240417458A1 (en) 2024-12-19
MX2024006006A (es) 2024-08-27
KR20240101681A9 (ko) 2025-12-10
KR20240101681A (ko) 2024-07-02

Similar Documents

Publication Publication Date Title
US20230183339A1 (en) Anti-hemojuvelin (hjv) antibodies for treating anemia of chronic disease
US12365729B2 (en) Anti-hemojuvelin (HJV) antibodies for treating myelofibrosis
US12522653B2 (en) Antibody that binds to VEGF-A and ANG2 and methods of use
US20240417458A1 (en) Methods for treating anemia of kidney disease
US20250297019A1 (en) Methods of treating cancer with anti-c-c motif chemokine receptor 8 (ccr8) antibodies
IL297485A (en) Compounds and their pharmaceutical uses
CN118715023A (zh) 用于治疗肾病性贫血的方法
HK40117078A (zh) 用於治疗肾病性贫血的方法
WO2026092724A1 (en) Anti-igf-1r/tshr antibody constructs and uses thereof
WO2026092728A1 (en) Anti-igf-1r antibody constructs and uses thereof
HK40089636A (zh) 用於治疗慢性病性贫血的抗血幼素(hjv)抗体
HK40089084A (zh) 用於治疗骨髓纤维化的抗血幼素(hjv)抗体
WO2024211404A2 (en) Anti-tmprss6 antibodies and uses thereof
AU2024331270A1 (en) Anti-tslp antibody constructs and uses thereof
CN119173529A (zh) 与vegf-a和il6结合的抗体及使用方法

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22840844

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: AU2022394462

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 3235096

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022394462

Country of ref document: AU

Date of ref document: 20221116

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2024529330

Country of ref document: JP

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112024009490

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 1020247019664

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 202280082955.9

Country of ref document: CN

WWE Wipo information: entry into national phase

Ref document number: 2022840844

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2022840844

Country of ref document: EP

Effective date: 20240617

ENP Entry into the national phase

Ref document number: 112024009490

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20240514