WO2023089083A1 - Multispecific binding moieties comprising pd-1 and tgf-brii binding domains - Google Patents

Multispecific binding moieties comprising pd-1 and tgf-brii binding domains Download PDF

Info

Publication number
WO2023089083A1
WO2023089083A1 PCT/EP2022/082377 EP2022082377W WO2023089083A1 WO 2023089083 A1 WO2023089083 A1 WO 2023089083A1 EP 2022082377 W EP2022082377 W EP 2022082377W WO 2023089083 A1 WO2023089083 A1 WO 2023089083A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
heavy chain
amino acid
tgf
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2022/082377
Other languages
English (en)
French (fr)
Inventor
Cecilia Anna Wilhelmina Geuijen
Patrick MAYES
Shaun M. STEWART
Liang-Chuan WANG
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Merus BV
Incyte Corp
Original Assignee
Merus BV
Incyte Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to KR1020247019354A priority Critical patent/KR20240101664A9/ko
Priority to MX2024006018A priority patent/MX2024006018A/es
Priority to IL312214A priority patent/IL312214A/en
Priority to PE2024001077A priority patent/PE20241477A1/es
Priority to CN202411831660.4A priority patent/CN119613560A/zh
Priority to CA3231649A priority patent/CA3231649A1/en
Priority to CN202280076849.XA priority patent/CN118265725A/zh
Priority to JP2024524389A priority patent/JP2024542879A/ja
Priority to EP22818694.6A priority patent/EP4433505A1/en
Priority to CR20240201A priority patent/CR20240201A/es
Application filed by Merus BV, Incyte Corp filed Critical Merus BV
Priority to AU2022389596A priority patent/AU2022389596A1/en
Publication of WO2023089083A1 publication Critical patent/WO2023089083A1/en
Priority to CONC2024/0006325A priority patent/CO2024006325A2/es
Anticipated expiration legal-status Critical
Priority to ECSENADI202439278A priority patent/ECSP24039278A/es
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/35Valency
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/51Complete heavy chain or Fd fragment, i.e. VH + CH1
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/515Complete light chain, i.e. VL + CL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/526CH3 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present disclosure relates to the field of antibodies.
  • it relates to the field of therapeutic antibodies for the treatment of diseases involving aberrant cells. More particularly it relates to multispecific binding moieties comprising a binding domain that binds to PD-1 and a binding domain that binds to TGF-PRII.
  • immune checkpoint blockade in which antibodies are used to block inhibitory immune pathways, has emerged as a promising therapeutic option and has been demonstrated in preclinical and clinical studies to enhance and sustain endogenous immunity against certain cancers.
  • Programmed death 1 (PD-1) and programmed death ligand 1 (PD-L1) are components of an immunosuppressive network that dampens T cell activity in normal physiology but can be exploited by tumors to suppress T cell-mediated antitumor immune responses.
  • Antibodies directed against PD-1 and PD-L1 have effected improvements in responses and survival for some patients suffering from several different cancers.
  • PD-1 and PD-L1 have effected improvements in responses and survival for some patients suffering from several different cancers.
  • only a minority of patients respond to anti-PD-l/PD-Ll therapies, with limited durability. Thus, there is an urgent need to develop new, safe and effective therapies to treat cancer.
  • PD-1 Programmed Cell Death 1 protein
  • PD-1 is a cell surface receptor that belongs to the CD28 family of receptors and is expressed on T cells and pro-B cells.
  • PD-1 is presently known to bind two ligands, PD-L1 and PD-L2.
  • PD-1 functioning as an immune checkpoint, plays an important role in downregulating the immune system by inhibiting the activation of T-cells, which in turn, when present on somatic cells, reduces autoimmunity and promotes self-tolerance.
  • PD-1 The inhibitory effect of PD-1 is thought to be accomplished through a dual mechanism of promoting apoptosis (programmed cell death) in antigen specific T-cells in lymph nodes while simultaneously reducing apoptosis in regulatory T cells (suppressor T cells).
  • PD-1 is also known under a number of different aliases such as PDCD1; Programmed Cell Death 1; Systemic Lupus Erythematosus Susceptibility 2; Protein PD-1; HPD-1; PD1; Programmed Cell Death 1 Protein; CD279 Antigen; CD279; HPD-L; HSLE1; SLEB2; and PD-1.
  • External Ids for PD-1 are HGNC: 8760; Entrez Gene: 5133; Ensembl: ENSG00000188389; OMIM: 600244; and UmProtKB: Q15116.
  • TGF-0 signaling regulates a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis (Massague J. TGF0 signalling in context. Nat Rev Mol Cell Biol. 2012 Oct;13(10):616-30).
  • TGF-0 signaling regulates numerous cancer cell functions, including cell cycle progression, apoptosis, adhesion and differentiation (Liu S et al, Signal Transduction and targeted Therapy, 2021).
  • TGF-0 exhibits a biphasic function such that in normal and premalignant cells, it predominantly has been reported to act as a tumor suppressor, whereas in tumor cells it permits growth promoting functions and epithelial-to- mesenchymal transition, which in turn permits tumor cell migration, invasion, intravasation and extravasation.
  • TGF-PRII is a member of the serine/threonine protein kinase family and the TGFB receptor subfamily. It is known under various synonyms, including TGFBR2, AAT3, FAA3, LDS1B, LDS2, LDS2B, MFS2, RIIC, TAAD2, TGFR-2, TGFbeta-RII, transforming growth factor beta receptor 2, TBR-ii, and TBRII.
  • TGF-PRII forms a heterodimeric complex with another receptor protein, and binds TGF-p. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation.
  • inhibitors targeting the TGF-P pathway are in preclinical and clinical development and inhibit TGF-P at different levels; i.e. at the ligand, ligand-receptor level or intracellular level.
  • the inhibitors include for instance TGF-P-neutralizing monoclonal antibodies, an anti-TGF-PRII antibody, soluble receptors, antibody ligand traps (e.g. anti-PD-Ll-TGF- PRIIECD), antisense oligonucleotides to prevent TGF-P synthesis, a TGF-P2 antisense gene- modified allogeneic cancer cell vaccine, and small molecules targeting the kinase domain of TGF-PRI.
  • TGF-P pathway Targeting of the TGF-P pathway with a monospecific antibody is reported to show antitumor activity in vitro and in vivo, however, poor clinical outcomes persist with low efficacy and unacceptable toxicity, including major cytokine release syndrome (CRS).
  • CRS major cytokine release syndrome
  • TGF-P signaling in activated tumor-specific PD-1 -expressing T cells locally in the tumor microenvironment, in order to promote T cell tumor infiltration, and restore and sustain T cell antitumor effector activity.
  • Such targeting will alleviate immunosuppressive pathways to potently promote CTL function and T cell memory for effective durable cancer elimination while minimizing toxicity associated with systemic TGF-P blockade.
  • One of the objects of the present disclosure is to provide a new pharmaceutical agent for the treatment of human disease, in particular for the treatment of cancer.
  • This object is met by the provision of multispecific binding moieties, for example bispecific antibodies, that bind PD-1 and TGF-PRII.
  • the PD-1 binding domain of the multispecific binding moieties aims at driving the specificity of the multispecific binding moiety to activated/exhausted effector T cells in tumors and tumor-draining lymph nodes, where the TGF-PRII binding domain can locally block TGF-P from binding to TGF-PRII, so as to reduce systemic toxicity of TGF-P inhibition on non- T cells.
  • the multispecific binding moieties alleviate both the PD1- and TGF- - mediated immunosuppressive pathways to promote cytotoxic T lymphocyte activity in the tumor microenvironment.
  • the present disclosure provides a multispecific binding moiety comprising a PD-1 binding domain and a TGF- RII binding domain, wherein the PD-1 binding domain blocks PD-1 mediated signaling and the TGF-PRII binding domain blocks TGF-PRII -mediated signaling.
  • the present disclosure also provides a multispecific binding moiety comprising a PD-1 binding domain and a TGF-PRII binding domain, wherein the PD-1 binding domain comprises a heavy chain variable region comprising CDR1 , CDR2, and CDR3 sequences as described further herein.
  • the present disclosure also provides a multispecific binding moiety comprising a PD-1 binding domain and a TGF-PRII binding domain, wherein the TGF-PRII binding domain comprises a heavy chain variable region comprising CDR1, CDR2, and CDR3 sequences as described further herein.
  • the present disclosure further provides a pharmaceutical composition comprising an effective amount of the multispecific binding moiety as described herein.
  • the present disclosure further provides a multispecific binding moiety as described herein, and a pharmaceutical composition as described herein, for use in therapy.
  • the present disclosure further provides a multispecific binding moiety as described herein, and a pharmaceutical composition as described herein, for use in the treatment of cancer.
  • the present disclosure further provides a method for treating a disease, comprising administering an effective amount of a multispecific binding moiety as described herein, or a pharmaceutical composition as described herein, to an individual in need thereof.
  • the present disclosure further provides a method for treating cancer, comprising administering an effective amount of a multispecific binding moiety as described herein, or a pharmaceutical composition as described herein, to an individual in need thereof.
  • the present disclosure further provides a cell comprising a nucleic acid sequence encoding the heavy chain variable region of a PD-1 binding domain as described herein and a nucleic acid sequence encoding the heavy chain variable region of a TGF-PRII binding domain as described herein.
  • the present disclosure further provides a cell producing a multispecific binding moiety as described herein.
  • the present disclosure provides a multispecific binding moiety comprising a PD-1 binding domain and a TGF-PRII binding domain, wherein the PD-1 binding domain blocks PD-1 mediated signaling and the TGF-PRII binding domain blocks TGF-PRII- mediated signaling.
  • blocking means interfering or modifying the interaction between a ligand and a receptor, or causing a total or partial reduction of the signal transduction cascade.
  • potency in blocking ligand induced PD-1 signaling is determined by using a SHP recruitment assay as described in Example 2 or a NF AT reporter assay as described in Example 3.
  • potency in blocking ligand induced PD-1 signaling is determined by using a SHP recruitment assay as described in Example 2.
  • potency in blocking ligand induced PD-1 signaling is determined by using a NF AT reporter assay as described in Example 3.
  • potency in blocking ligand induced TGF-PRII signaling is determined by using a SMAD assay as described in Example 4 or 5. In certain embodiments, potency in blocking ligand induced TGF-PRII signaling is determined by using a SMAD assay as described in Example 4. In certain embodiments, potency in blocking ligand induced TGF-PRII signaling is determined by using a SMAD assay as described in Example 5.
  • a multispecific binding moiety of the present disclosure binds to human PD-1.
  • the PD-1 binding domain of the multispecific binding moiety of the present disclosure blocks binding of PD-L1 to PD-1, for instance as measured in an assay as described in Example 2 or 3.
  • a multispecific binding moiety of the present disclosure binds to human TGF-PRII.
  • Human TGF-PRII is a transmembrane protein of which there are different isoforms.
  • the amino acid sequence of human TGF-PRII isoform A is provided as SEQ ID NO: 82; the amino acid sequence of the extracellular domain of human TGF-PRII isoform A is provided as SEQ ID NO: 83.
  • Human TGF- 0RII isoform B is a splice variant encoding a longer isoform due to an insertion in the extracellular domain.
  • the amino acid sequence of human TGF- PRII isoform B is provided as SEQ ID NO: 84; the amino acid sequence of the extracellular domain of isoform B of human TGF-PRII is as set forth in SEQ ID NO: 85.
  • a “binding moiety” refers to a proteinaceous molecule and includes for instance all antibody formats available in the art, such as for example a full length IgG antibody, immunoconjugates, diabodies, BiTEs, Fab fragments, scFv, tandem scFv, single domain antibody (like VHH and VH), minibodies, scFab, scFv-zipper, nanobodies, DART molecules, TandAb, Fab-scFv, F(ab)’2, F(ab)’2-scFv2, and intrabodies.
  • the multispecific binding moiety is a multispecific antibody.
  • a multispecific antibody according to the present disclosure is an antibody that comprises at least two binding domains which have specificity for at least two different targets or epitopes.
  • a multispecific antibody of the present disclosure is a bispecific antibody.
  • a multispecific antibody of the present disclosure may further comprise an Fc region or a part thereof.
  • a multispecific binding moiety of the present disclosure is an IgGl antibody. Constant regions of a binding moiety of the present disclosure may comprise one or more variations that modulate properties of the binding moiety other than its binding properties to the target antigens.
  • the constant regions may comprise one or more variations that promote heterodimerization of the PD-1 and TGF- RII heavy chains over homodimerization of two PD-1 heavy chains and/or two TGF- RII heavy chains, and/or the constant regions may comprise one or more variations that reduce or improve effector function, in particular one or more variations that reduce effector function.
  • a “Fab” typically means a binding domain comprising a heavy chain variable region, a light chain variable region, a CHI and a CL region.
  • a multispecific binding moiety of the present disclosure comprises a single Fab domain that binds to PD-1, a single Fab domain that binds to TGF- RII, and an Fc region.
  • a multispecific binding moiety of the present disclosure consists of a single Fab domain that binds to PD-1, a single Fab domain that binds to TGF- RII, and an Fc region.
  • a multispecific binding moiety of the present disclosure consists essentially of a single Fab domain that binds to PD-1, a single Fab domain that binds to TGF- RII, and an Fc region.
  • An “Fc region” typically comprises a hinge, CH2, and CH3 region.
  • a suitable hinge includes, but is not limited to, the hinge of which the amino acid sequence is set forth in SEQ ID NO: 68.
  • Suitable CH2 and CH3 regions include, but are not limited to, the CH2 region of which the amino acid sequence is set forth in SEQ ID NO: 70 or 71, and the CH3 region of which the amino acid sequence is set forth in SEQ ID NO: 72, or 73 and 74.
  • a CL, CHI, CH2, and/or CH3 region may be modified according to methods known in the art in order to obtain favorable antibody characteristics, including for instance to promote heterodimerization of different heavy chains, to improve heavy-light chain pairing, and to enhance or reduce immune cell effector function.
  • the PD-1 binding domain of the multispecific binding moiety blocks PD-1 mediated signaling and the TGF-PRII binding domain of the multispecific binding moiety blocks TGF-PRII -mediated signaling in activated T cells, in particular activated tumorspecific T cells.
  • a multispecific binding moiety of the present disclosure has a higher potency in blocking TGF-PRII -mediated signaling in cells expressing both PD-1 and TGF-PRII than in cells expressing TGF-PRII and no, substantially no, or low levels of, PD-1.
  • the present disclosure therefore also provides a multispecific binding moiety comprising a PD-1 binding domain and a TGF-PRII binding domain, wherein the multispecific binding moiety has a higher potency in blocking TGF-PRII -mediated signaling in cells expressing both PD-1 and TGF-PRII than in cells expressing TGF-PRII and no, substantially no, or low levels of, PD-1.
  • cells expressing both PD-1 and TGF-PRII are Jurkat-PD-1 + cells, such as for instance Jurkat T cells expressing human PD-1 and a luciferase reporter driven by an NF AT response element (NFAT-RE), and the cells expressing TGF-PRII and no PD-1 are Jurkat-PD-l nu11 cells, such as for instance Jurkat-PD-l nu11 cells.
  • Jurkat T cells expressing human PD-1 and a luciferase reporter driven by an NFAT-RE are commercially available, for instance from Promega (cat. no. CS 187105 - part of kit CS 187106 and CS 187107);
  • Jurkat-PD-l nu11 cells are publicly available, for instance from the ATCC (cat. no. TIB-152).
  • cells expressing both PD-1 and TGF-PRII are stimulated CD4 + or CD8 + cells and the cells expressing TGF-PRII and low levels of PD-1 are unstimulated CD4 + or CD8 + cells.
  • the stimulated CD4 + or CD8 + cells are stimulated with recombinant human TGF-pi.
  • cells expressing both PD-1 and TGF-PRII are HEK-BlueTM TGF-P -PD-1 + cells, such as for instance described in Example 7, and the cells expressing TGF- PRII and no PD-1 are HEK-BlueTM TGF-P cells, such as for instance HEK-BlueTM TGF-P cells.
  • HEK-BlueTM TGF-P cells commercially available from for instance Invivogen (cat. no. hkb- tgfb), are stably transfected human embryonic kidney HEK 293 cells comprising the human TGFBRI, Smad3, and Smad4 genes. They further express a Smad3/4-binding elements (SBE)- inducible SEAP reporter gene.
  • no, substantially no, or a low level of PD-1 refers to a level of PD-1 on the cell surface that is undetectable in a suitable assay as set out herein. In certain embodiments, a low level of PD-1 refers to less than 100 PD-1 molecules present on the cell surface. In certain embodiments, the level of PD-1 is measured using quantibrite bead methodology.
  • determining if a multispecific binding moiety has a higher potency in blocking TGF-PRII -mediated signaling in cells expressing both PD-1 and TGF-PRII than in cells expressing TGF-PRII and no, substantially no, or low levels of PD-1 is done by using one of the assays described herein.
  • the potency data of the multispecific binding moieties as provided herein is obtained with the phospho-SMAD2/3 assay as described in Examples 4 and 5 and the isogenic HEK- BLUE -PD-1 TGF-P reporter assay as described in Example 7. Therefore, in certain embodiments, the potency in blocking TGF-PRII -mediated signaling is measured in a phospho- SMAD2/3 assay as described in Example 4 or Example 5.
  • the phospho-SMAD2/3 assay as described in Example 4 is performed using Jurkat-PD-l nu11 and Jurkat-PD-1 + cells cultured in RPMI/10%FBS.
  • Cells are incubated with test or control antibodies in 6-step serial dilutions (100 pg/ml to 0.001 pg/ml) for one hour at 37°C/ 5% CO2.
  • human recombinant TGF-pi is added at a final concentration of 10 ng/ml and the cells are incubated for two more hours at 37°C/ 5% CO2. After incubation, cells are washed gently with PBS.
  • Cell lysates are prepared using lysis buffer containing phosphatase inhibitors and protease inhibitors.
  • PhosphoSMAD2/3 levels are determined using ELISA.
  • the phospho-SMAD2/3 assay as described in Example 5 is performed using PBMCs from healthy donors, which are stimulated with 1 pg/ml anti-CD3 for 48 hours followed by 16 hour serum deprivation in 0.1% FBS. Stimulated and unstimulated PBMCs are incubated with test and control antibodies for 30 minutes at room temperature. Recombinant human TGF- pi is added at a final concentration of 1 ng/ml and the cells are incubated for another 30 minutes. Finally, cells are washed twice with PBS and stained for cell surface markers followed by intracellular phosphoSMAD2 staining. Flow cytometry is performed to gate CD4 + and CD8+ cells. Phospho-SMAD2 signal is measured in geo mean fluorescence intensity (GMFI) on these cells.
  • GMFI geo mean fluorescence intensity
  • the potency in blocking TGF-PRII-mediated signaling is measured in an isogenic HEK-BLUE-PD-1 TGF-P reporter assay as described in Example 7.
  • the HEK-BLUE-PD-1 TGF-P reporter assay is performed using HEK-BlueTM TGF-P cells and HEK-BlueTM TGF-P -PD-U cells at 25000 cells per well. Serial dilutions of test and control antibodies are added and the cells are incubated for one hour at room temperature, followed by the addition of human recombinant TGF-pi at a final concentration of 1 ng/ml. Cells are incubated at 37°C/ 5% CO2 overnight. After incubation, 40 ul of supernatants and 160 ul of re-suspended QU ANTI -BlueTM Solution are incubated at 37°C/ 5% CO2 for 40 minutes. The quantity of SEAP secreted in the supernatant is assessed using QUANH-BlueTM Solution. SEAP levels are determined using a spectrophotometer at 650 nm.
  • a multispecific binding moiety of the present disclosure has a potency in blocking TGF-PRII -mediated signaling in cells expressing both PD-1 and TGF-PRII of at least about 10 fold, preferably between about 10-100000 fold, higher than in cells expressing TGF-PRII and no PD-1. In certain embodiments, a multispecific binding moiety of the present disclosure has a potency in blocking TGF-PRII -mediated signaling in cells expressing both PD-1 and TGF-PRII of at least 10 fold, preferably between 10-100000 fold, higher than in cells expressing TGF-PRII and no PD-1.
  • the potency in blocking TGF-PRII -mediated signaling is determined in IC50 (pg/ml) in a phospho-SMAD2/3 assay or HEK-BLUE-PD-1 TGF-P reporter assay. In certain embodiments, the potency in blocking TGF-PRII -mediated signaling is determined in IC50 (pg/ml) in a phospho-SMAD2/3 assay. In certain embodiments, the potency in blocking TGF-PRII-mediated signaling is determined in IC50 (pg/ml) in a HEK-BLUE-PD-1 TGF-P reporter assay.
  • the potency of a multispecific binding moiety of the present disclosure in blocking TGF-PRII-mediated signaling in cells expressing TGF-PRII and no, substantially no, or low levels of, PD-1 is lower than the potency of a reference anti-TGF-PRII antibody targeting the same cells, and the potency of the multispecific binding moiety in blocking TGF-PRII-mediated signaling in cells expressing both TGF-PRII and PD-1 is higher than the potency of the reference anti-TGF-PRII antibody targeting the same cells, wherein the reference anti-TGF-PRII antibody is a bivalent monospecific antibody comprising a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 76 and a light chain having an amino acid sequence as set forth in SEQ ID NO: 77.
  • cells expressing both PD-1 and TGF-PRII are Jurkat-PD-1 + cells, stimulated CD4 + or CD8 + cells, or HEK-BlueTM TGF-P -PD-1 + cells; the cells expressing TGF-PRII and no, or substantially no, PD-1 are Jurkat-PD-l nu11 cells or are HEK-BlueTM TGF-P cells; and the cells expressing TGF-PRII and low levels of PD-1 are unstimulated CD4 + or CD8 + cells, as described further herein.
  • the potency of a multispecific binding moiety of the present disclosure in blocking TGF-PRII-mediated signaling in cells expressing both TGF-PRII and PD- 1 is at least 10 fold, preferably between 10-100000 fold, higher than the potency of a reference anti-TGF-PRII antibody. In certain embodiments, the potency of a multispecific binding moiety of the present disclosure in blocking TGF-PRII-mediated signaling in cells expressing both TGF- PRII and PD-1 is at least about 10 fold, preferably between about 10-100000 fold, higher than the potency of a reference anti-TGF-PRII antibody.
  • the reference TGF- PRII antibody is a bivalent monospecific antibody comprising a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 76 and a light chain having an amino acid sequence as set forth in SEQ ID NO: 77.
  • the potency in blocking TGF-PRII- mediated signaling is determined in IC50 (pg/ml) in a phospho- SMAD2/3 assay.
  • a multispecific binding moiety of the present disclosure has a higher activity in reducing tumor volume than a combination of reference antibodies.
  • the combination of reference antibodies are two bivalent monospecific antibodies targeting PD-1 and TGF-PRII, wherein the bivalent monospecific antibody targeting PD-1 comprises a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 78 and a light chain having an amino acid sequence as set forth in SEQ ID NO: 79 and the bivalent monospecific antibody targeting anti-TGF-PRII comprises a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 76 and a light chain having an amino acid sequence as set forth in SEQ ID NO: 77.
  • the present disclosure therefore also provides a multispecific binding moiety comprising a PD-1 binding domain and a TGF-PRII binding domain, wherein the multispecific binding moiety has a higher activity in reducing tumor volume than a combination of reference antibodies.
  • the multispecific binding moiety is dosed with a two-fold lower to up to twenty -fold lower number of PD-1 and TGF-PRII binding domains than each of the bivalent monospecific antibodies of the combination of reference antibodies.
  • a multispecific binding moiety which is monovalent for binding to PD-1 and monovalent for binding to TGF-PRII, when dosed at 1 mg/kg has a higher activity in reducing tumor volume than a combination of reference antibodies, each of which is bivalent for binding to PD-1 or TGF-PRII and each of which is dosed at 10 mg/kg.
  • a multispecific binding moiety which is monovalent for binding to PD-1 and monovalent for binding to TGF-PRII, when dosed at 10 mg/kg has a higher activity in reducing tumor volume than a combination of reference antibodies, each of which is bivalent for binding to PD-1 or TGF-PRII and each of which is dosed at 10 mg/kg.
  • the combination of reference antibodies are two bivalent monospecific antibodies targeting PD-1 and TGF-PRII, wherein the bivalent monospecific antibody targeting PD-1 comprises a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 78 and a light chain having an amino acid sequence as set forth in SEQ ID NO: 79, and wherein the bivalent monospecific antibody targeting TGF-PRII comprises a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 76 and a light chain having an amino acid sequence as set forth in SEQ ID NO: 77.
  • the activity in reducing tumor volume is determined by measuring tumor volume reduction in an in vivo mouse study, in particular in an in vivo mouse study using MDA-MB-231 xenograft huCD34 NSG mice.
  • a multispecific binding moiety of the present disclosure has a tumor volume reduction that is at least 1.5 fold, preferably between 1.5-100 fold or 2-80 fold or 5-80 fold or 10-80 fold or 15-80 fold or 20-80 fold or 30-80 fold or 40-80 fold or 50-80 fold or 2-60 fold or 5-60 fold or 10-60 fold or 15-60 fold or 20-60 fold or 30-60 fold or 40-60 fold, of the tumor volume reduction of a combination of reference antibodies.
  • a multispecific binding moiety of the present disclosure has a tumor volume reduction that is at least about 1.5 fold, preferably about between 1.5-100 fold or 2-80 fold or 5-80 fold or 10-80 fold or 15-80 fold or 20-80 fold or 30-80 fold or 40-80 fold or 50-80 fold or 2-60 fold or 5-60 fold or 10-60 fold or 15-60 fold or 20-60 fold or 30-60 fold or 40-60 fold, of the tumor volume reduction of a combination of reference antibodies.
  • the multispecific binding moiety of the present disclosure provides a greater reduction in tumor volume than the combination of reference antibodies.
  • the combination of reference antibodies are two bivalent monospecific antibodies targeting PD-1 and TGF-PRII, wherein the bivalent monospecific antibody targeting PD-1 comprises a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 78 and a light chain having an amino acid sequence as set forth in SEQ ID NO: 79, and the bivalent monospecific antibody targeting TGF-PRII comprises a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 76 and a light chain having an amino acid sequence as set forth in SEQ ID NO: 77.
  • a multispecific binding moiety of the present disclosure reduces tumor volume when administered as a single agent.
  • the present disclosure therefore also provides a multispecific binding moiety comprising a PD-1 binding domain and a TGF-PRII binding domain, wherein the multispecific binding moiety induces tumor volume reduction as a single agent.
  • the present disclosure provides several PD-lxTGF-PRII bispecific antibodies as exemplary multispecific binding moieties, the PD-1 binding domains of which comprise a heavy chain variable region having an amino acid sequence selected from SEQ ID NO: 1; 5; 9; 13; 14; 18 and 19, the TGF-PRII binding domains of which comprise a heavy chain variable region having an amino acid sequence selected from SEQ ID NO: 23; 27; 31; 35; 39; 43; 47; 88; and 89, and both the PD-1 and TGF-PRII binding domains comprising the same light chain.
  • the PD-1 binding domain of a multispecific binding moiety of the present disclosure comprises a heavy chain variable region comprising: a) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 2, SEQ ID NO: 3, and SEQ ID NO: 4, respectively; b) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 6, SEQ ID NO: 7, and SEQ ID NO: 8, respectively; c) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, respectively; d) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (
  • the heavy chain variable regions of the PD-1 binding domains of a multispecific binding moiety of the present disclosure may comprise a limited number, such as for instance one, two, three, four, five, six, seven, eight, nine, or ten, non-conservative amino acid substitutions, or an unlimited number of conservative amino acid substitutions.
  • the PD-1 binding domain of a multispecific binding moiety of the present disclosure also includes PD-1 binding domain variants thereof, wherein each of the HCDRs may comprise at most three, two, or one amino acid variations. In certain embodiments, only one or two HCDRs may comprise at most three, two, or one non-conservative amino acid variations. In certain embodiments, such variants do not comprise amino acid variations in HCDR3. In certain embodiments, the amino acid variation is a conservative amino acid substitution.
  • a conservative amino acid substitution involves a variation of an amino acid with a homologous amino acid residue, which is a residue that shares similar characteristics or properties.
  • Homologous amino acids are known in the art, as are routine methods for making amino acid substitutions in antibody binding domains without significantly impacting binding or function of the antibody, see for instance handbooks like Lehninger (Nelson, David L., and Michael M. Cox. 2017. Lehninger Principles of Biochemistry. 7th ed. New York, NY: W.H. Freeman) or Stryer (Berg, J., Tymoczko, J., Stryer, L. and Stryer, L., 2007. Biochemistry. New York: W.H. Freeman), incorporated herein in its entirety.
  • an assessment may typically be made of factors such as, but not limited to, (a) the structure of the polypeptide backbone in the area of the substitution, for example, a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, and/or (c) the bulk of the side chain(s). If a residue can be substituted with a residue which has common characteristics, such as a similar side chain or similar charge or hydrophobicity, then such a residue is preferred as a substitute.
  • the following groups can be determined: (1) non-polar: Ala (A), Gly (G), Vai (V), Leu (L), He (I), Pro (P), Phe (F), Trp (W), Met (M); (2) uncharged polar: Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gin (Q); (3) acidic: Asp (D), Glu (E); and (4) basic: Lys (K), Arg (R), His (H).
  • amino acids may be grouped as follows: (1) aromatic: Phe (F), Trp (W), Tyr (Y); (2) apolar: Leu (L), Vai (V), He (I), Ala (A), Met (M); (3) aliphatic: Ala (A), Vai (V), Leu (L), He (I); (4) acidic: Asp (D), Glu (E); (5) basic: His (H), Lys (K), Arg (R); and (6) polar: Gin (Q), Asn (N), Ser (S), Thr (T), Tyr (Y).
  • amino acid residues may be divided into groups based on common side-chain properties: (1) hydrophobic: Met (M), Ala (A), Vai (V), Leu (L), He (I); (2) neutral hydrophilic: Cys (C), Ser (S), Thr (T), Asn (N), Gin (Q); (3) acidic: Asp (D), Glu (E); (4) basic: His (H), Lys (K), Arg R); (5) residues that influence chain orientation: Gly (G), Pro (P); and (6) aromatic: Trp (W), Tyr (Y), Phe (F).
  • substitution of an amino acid residue with another present in the same group would be preferred. Accordingly, conservative amino acid substitution can involve exchanging a member of one of these classes for another member of that same class. Typically, the variation results in no, or substantially no, loss in binding specificity of the binding domain to its intended target.
  • PD-1 binding variants encompassed by the present disclosure include somatically hypermutated or affinity matured heavy chain variable regions, which are heavy chain variable regions derived from the same VH gene segments as the heavy chain variable regions described by sequence herein, the variants having amino acid variations, including non-conservative and/or conservative amino acid substitutions in one, two, or all three HCDRs.
  • Routine methods for affinity maturing antibody binding domains are widely known in the art, see for instance Tabasinezhad M, et al. (Trends in therapeutic antibody affinity maturation: From in-vitro towards next-generation sequencing approaches. Immunol Lett. 2019 Aug;212:106-113).
  • suitable positions for introducing an amino acid variation include, but are not limited to, the first, second, and/or fourth amino acid of HCDR1; the third, seventh, eighth, ninth, tenth, eleventh, thirteenth, fourteenth, and/or sixteenth amino acid of HCDR2; and/or the sixth and/or thirteenth amino acid of HCDR3.
  • the present disclosure thus also provides a multispecific binding moiety, the PD-1 binding domain of which comprising:
  • Xi can be F, Y, T, or H
  • X2 can be Y, Q, E, H, or D;
  • X3 can be W, or Y;
  • HCDR2 having amino acid sequence YIX1YSGX2X3X4X5X6PX7X8KX9, wherein
  • Xi can be Y, V, or I
  • X2 can be S, or G
  • X 3 can be T, Y, S, H, N, W, L, or Q;
  • X4 can be S, or N;
  • X5 can be F, V, or L
  • Xe can be N, or S
  • X7 can be S or A
  • Xs can be F or L
  • X9 can be S, T, G, D, R, or N;
  • HCDR3 having amino acid sequence GGYTGX1GGDWFDX2, wherein
  • Xi can be Y, H, V, or A
  • X 2 can be P, V, Y, W, F, T, Q, H, or S.
  • Other suitable positions for introducing an amino acid variation include, but are not limited to, the second, third, fourth, and/or fifth amino acid of HCDR1; the third, fourth, fifth, sixth, eighth, ninth, tenth, eleventh, twelfth, thirteenth, fourteenth, fifteenth, sixteenth and/or seventeenth amino acid of HCDR2; and/or the first, second, sixth, seventh, ninth, tenth, fourteenth, fifteenth, sixteenth and/or eighteenth amino acid of HCDR3.
  • the present disclosure thus also provides a multispecific binding moiety, the PD-1 binding domain of which comprising:
  • HCDR1 having amino acid sequence RX1X2X3X4, wherein
  • Xi can be F, or Y
  • X2 can be T, A, or V;
  • X3 can be M, L, or V;
  • X4 can be S, H, N, V, or T;
  • HCDR2 having amino acid sequence WIX1X2X3X4GX5X6X7X8X9X10X11X12X13X14, wherein
  • Xi can be N, or D
  • X2 can be P, S, or T;
  • X3 can be N, or Q
  • X4 can be T, or D
  • X 5 can be N, S, T, K, L, or E;
  • Xe can be P, Y, A, H, or F;
  • X7 can be T, or S
  • Xs can be Y, F, or H
  • X9 can be A, G, V, or F
  • X10 can be Q, R, N, L, T, or S;
  • Xu can be D, A, G, or S;
  • X12 can be F, V, or A
  • X13 can be T, K, H, G;
  • X14 can be G, N, E, or D; and/or - HCDR3 having amino acid sequence XIX2GYCX3X 4 DX 5 CYPNX6X 7 X 8 DX9, wherein
  • Xi can be I, S, or V
  • X2 can be L, Q, or N;
  • X3 can be N, G, S, or D;
  • X4 can be T, S, P, N, or E;
  • X5 can be N, or I
  • X 6 can be W, G, Q, H, W, A, or L;
  • X 7 can be I, V, or L
  • X 8 can be F, L, or I
  • X 9 can be Y, S, N, I, R, H, V, T, K, A, or L.
  • a PD-1 binding domain of a multispecific binding moiety of the present disclosure comprises a heavy chain variable region having an amino acid sequence as set forth in any one of SEQ ID NO: 1; 5; 9; 13; 14; 18; 19, or a variant thereof.
  • a PD-1 binding domain of a multispecific binding moiety of the present disclosure comprises a heavy chain variable region having an amino acid sequence as set forth in any one of SEQ ID NO: 1; 5; 9; 13; 14; 18; 19, or a variant having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto.
  • Percent (%) identity as referring to nucleic acid or amino acid sequences herein is defined as the percentage of residues in a candidate sequence that are identical with the residues in a selected sequence, after aligning the sequences for optimal comparison purposes. In order to optimize the alignment between the two sequences gaps may be introduced in any of the two sequences that are compared. Such alignment can be carried out over the full length of the sequences being compared. Alternatively, the alignment may be carried out over a shorter length, for example over about 20, about 50, about 100 or more nucleic acids/based or amino acids. The sequence identity is the percentage of identical matches between the two sequences over the reported aligned region.
  • a comparison of sequences and determination of percentage of sequence identity between two sequences can be accomplished using a mathematical algorithm.
  • the skilled person will be aware of the fact that several different computer programs are available to align two sequences and determine the identity between two sequences (Kruskal, J. B. (1983) An overview of sequence comparison In D. Sankoff and J. B. Kruskal, (ed.), Time warps, string edits and macromolecules: the theory and practice of sequence comparison, pp. 1 -44 Addison Wesley).
  • the percent sequence identity between two amino acid sequences or nucleic acid sequences may be determined using the Needleman and Wunsch algorithm for the alignment of two sequences. (Needleman, S. B. and Wunsch, C. D. (1970) J. Mol. Biol.
  • the Needleman- Wunsch algorithm has been implemented in the computer program NEEDLE.
  • the NEEDLE program from the EMBOSS package is used to determine percent identity of amino acid and nucleic acid sequences (version 2.8.0, EMBOSS: The European Molecular Biology Open Software Suite (2000) Rice, P. LongdenJ. and Bleasby, A. Trends in Genetics 16, (6) pp276 — 277, http://emboss.bioinformatics.nl/).
  • EBLOSUM62 is used for the substitution matrix.
  • DNAFULL is used for DNA sequences. The parameters used are a gap-open penalty of 10 and a gap extension penalty of 0.5.
  • the percentage of sequence identity between a query sequence and a sequence of the invention is calculated as follows: Number of corresponding positions in the alignment showing an identical amino acid or identical nucleotide in both sequences divided by the total length of the alignment after subtraction of the total number of gaps in the alignment.
  • a PD-1 binding domain of a multispecific binding moiety of the present disclosure also comprises PD-1 binding domain variants, which, in addition to the variations in the HCDRs referred to above, comprise one or more variations in the framework regions.
  • a variation can be any type of amino acid variation described herein, such as for instance a conservative amino acid substitution or non-conservative amino acid substitution resulting from somatic hypermutation or affinity maturation.
  • a PD-1 binding domain variant of a multispecific binding moiety of the present disclosure comprises no variations in the CDR regions but comprises one or more variations in the framework regions.
  • a PD-1 binding domain of a multispecific binding moiety of the present disclosure comprises: - a heavy chain variable region having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence as set forth in SEQ ID NO: 1, which heavy chain variable region comprises a HCDR1 amino acid sequence as set forth in SEQ ID NO: 2; a HCDR2 amino acid sequence as set forth in SEQ ID NO: 3; and a HCDR3 amino acid sequence as set forth in SEQ ID NO: 4;
  • heavy chain variable region having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence as set forth in SEQ ID NO: 5, which heavy chain variable region comprises a HCDR1 amino acid sequence as set forth in SEQ ID NO: 6; a HCDR2 amino acid sequence as set forth in SEQ ID NO: 7; and a HCDR3 amino acid sequence as set forth in SEQ ID NO: 8;
  • heavy chain variable region having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence as set forth in SEQ ID NO: 9, which heavy chain variable region comprises a HCDR1 amino acid sequence as set forth in SEQ ID NO: 10; a HCDR2 amino acid sequence as set forth in SEQ ID NO: 11 ; and a HCDR3 amino acid sequence as set forth in SEQ ID NO: 12;
  • heavy chain variable region having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence as set forth in SEQ ID NO: 13, which heavy chain variable region comprises a HCDR1 amino acid sequence as set forth in SEQ ID NO: 10; a HCDR2 amino acid sequence as set forth in SEQ ID NO: 11 ; and a HCDR3 amino acid sequence as set forth in SEQ ID NO: 12;
  • heavy chain variable region having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence as set forth in SEQ ID NO: 14, which heavy chain variable region comprises a HCDR1 amino acid sequence as set forth in SEQ ID NO: 15; a HCDR2 amino acid sequence as set forth in SEQ ID NO: 16; and a HCDR3 amino acid sequence as set forth in SEQ ID NO: 17;
  • the binding domains of a multispecific binding moiety of the present disclosure have been generated with a common light chain, in particular with a common light chain referred to as VK1-39/JK1.
  • the binding domains of a multispecific binding moiety of the present disclosure can comprise any suitable light chain, including but not limited to common light chains known in the art.
  • the binding domains of a multispecific binding moiety of the present disclosure comprise common light chain VK1-39/JK1, or a variant thereof harboring a limited number, such as for instance one, two, or three, non-conservative amino acid substitutions, or an unlimited number of conservative amino acid substitutions.
  • a PD-1 binding domain of a multispecific binding moiety of the present disclosure comprises a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 48, or a variant thereof. In certain embodiments, a PD-1 binding domain of a multispecific binding moiety of the present disclosure comprises a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 48, or a variant having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto.
  • a PD-1 binding domain of a multispecific binding moiety of the present disclosure comprises a light chain variable region comprising light chain CDR1 (LCDR1), light chain CDR2 (LCDR2), and light chain CDR3 (LCDR3), having an amino acid sequence as set forth in SEQ ID NO: 49, SEQ ID NO: 50, and SEQ ID NO: 51.
  • the light chain variable region of a PD-1 binding domain of a multispecific binding moiety of the present disclosure also includes variants thereof, wherein each of the LCDRs may comprise at most three, two, or one amino acid variations.
  • the amino acid variation is a conservative amino acid substitution.
  • a PD-1 binding domain of a multispecific binding moiety of the present disclosure also includes PD-1 binding domain variants, which, in addition to the variations in the LCDRs referred to above, comprise one or more variations in the framework regions.
  • a variation is preferably a conservative amino acid substitution.
  • a PD-1 binding domain variant of a multispecific binding moiety of the present disclosure comprises no variations in the LCDR regions but comprises one or more variations in the framework regions. Such variants have at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the sequences disclosed herein.
  • a PD-1 binding domain of a multispecific binding moiety of the present disclosure comprises:
  • a light chain variable region having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence as set forth in SEQ ID NO: 48, which light chain variable region comprises a LCDR1 amino acid sequence as set forth in SEQ ID NO: 49; a LCDR2 amino acid sequence as set forth in SEQ ID NO: 50; and a LCDR3 amino acid sequence as set forth in SEQ ID NO: 51.
  • a light chain or light chain variable region comprising these LCDRs and/or light chain variable region can be, for example, the light chain referred to in the art as VK1-39/JK1.
  • This is a common light chain.
  • the term ‘common light chain’ according to the present disclosure refers to a light chain that is capable of pairing with multiple different heavy chains, such as for instance heavy chains having different antigen or epitope binding specificities.
  • a common light chain is particularly useful in the generation of, for instance, bispecific or multispecific antibodies, where antibody production is more efficient when all binding domains comprise the same light chain.
  • the term “common light chain” encompasses light chains that are identical or have some amino acid sequence differences while the binding specificity of the full length antibody is not affected.
  • common light chains comprising the LCDRs and/or light chain variable region referred to above
  • other common light chains known in the art may be used.
  • common light chains include, but are not limited to: VK1-39/JK5, comprising a light chain variable region comprising a light chain CDR1 (LCDR1), light chain CDR2 (LCDR2), and light chain CDR3 (LCDR3), of a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 52.
  • the light chain comprises a light chain variable region comprising a light chain CDR1 (LCDR1), light chain CDR2 (LCDR2), and light chain CDR3 (LCDR3), of a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 52, wherein each of the LCDRs may comprise at most three, two, or one amino acid variations, for example substitutions.
  • the light chain comprises a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 52, or having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto.
  • the light chain comprises a light chain CDR1 (LCDR1 ), light chain CDR2 (LCDR2), and light chain CDR3 (LCDR3) having an amino acid sequence as set forth in SEQ ID NO: 53, SEQ ID NO: 54, and SEQ ID NO: 55; VK3-15/JK1, comprising a light chain variable region comprising a light chain CDR1 (LCDR1), light chain CDR2 (LCDR2), and light chain CDR3 (LCDR3), of a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 56.
  • LCDR1 light chain CDR1
  • LCDR2 light chain CDR2
  • LCDR3 light chain CDR3
  • the light chain comprises a light chain variable region comprising a light chain CDR1 (LCDR1), light chain CDR2 (LCDR2), and light chain CDR3 (LCDR3), of a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 56, wherein each of the LCDRs may comprise at most three, two, or one amino acid variations, for example substitutions.
  • the light chain comprises a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 56, or having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto.
  • the light chain comprises a light chain CDR1 (LCDR1), light chain CDR2 (LCDR2), and light chain CDR3 (LCDR3) having an amino acid sequence as set forth in SEQ ID NO: 57, SEQ ID NO: 58, and SEQ ID NO: 59; VK3-20/JK1, comprising a light chain variable region comprising a light chain CDR1 (LCDR1), light chain CDR2 (LCDR2), and light chain CDR3 (LCDR3), of a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 60.
  • LCDR1 light chain CDR1
  • LCDR2 light chain CDR2
  • LCDR3 light chain CDR3
  • the light chain comprises a light chain variable region comprising a light chain CDR1 (LCDR1), light chain CDR2 (LCDR2), and light chain CDR3 (LCDR3), of a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 60, wherein each of the LCDRs may comprise at most three, two, or one amino acid variations, for example substitutions.
  • the light chain comprises a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 60, or having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto.
  • the light chain comprises a light chain CDR1 (LCDR1 ), light chain CDR2 (LCDR2), and light chain CDR3 (LCDR3) having an amino acid sequence as set forth in SEQ ID NO: 61, SEQ ID NO: 62, and SEQ ID NO: 63; and VL3-21/JL3, comprising a light chain variable region comprising a light chain CDR1 (LCDR1), light chain CDR2 (LCDR2), and light chain CDR3 (LCDR3), of a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 64.
  • LCDR1 light chain CDR1
  • LCDR2 light chain CDR2
  • LCDR3 light chain CDR3
  • the light chain comprises a light chain variable region comprising a light chain CDR1 (LCDR1), light chain CDR2 (LCDR2), and light chain CDR3 (LCDR3), of a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 64, wherein each of the LCDRs may comprise at most three, two, or one amino acid variations, for example substitutions.
  • the light chain comprises a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 64, or having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto.
  • the light chain comprises a light chain CDR1 (LCDR1 ), light chain CDR2 (LCDR2), and light chain CDR3 (LCDR3) having an amino acid sequence as set forth in SEQ ID NO: 65, SEQ ID NO: 66, and SEQ ID NO: 67.
  • LCDR1 light chain CDR1
  • LCDR2 light chain CDR2
  • LCDR3 light chain CDR3
  • VK1-39 is short for Immunoglobulin Variable Kappa 1-39 Gene.
  • the gene is also known as Immunoglobulin Kappa Variable 1-39; IGKV139; IGKV1-39; IgVKl-39.
  • External Ids for the gene are HGNC: 5740; Entrez Gene: 28930; Ensembl: ENSG00000242371.
  • An amino acid sequence for VK1-39 is given as SEQ ID NO: 93. This is the sequence of the V-region.
  • the V- region can be combined with one of five J-regions.
  • VK1-39/JK1 SEQ ID NO: 94
  • VK1-39/JK5 SEQ ID NO: 95
  • alternative names are IgVKl-39*01/IGJKl*01 or IgVKl-39*01/IGJK5*01 (nomenclature according to the IMGT database worldwide web at imgt.org). These names are exemplary and encompass allelic variants of the gene segments.
  • VK3-15 is short for Immunoglobulin Variable Kappa 3-15 Gene.
  • the gene is also known as Immunoglobulin Kappa Variable 3-15; IGKV315; IGKV3-15; IgVK3-15.
  • External Ids for the gene are HGNC: 5816; Entrez Gene: 28913; Ensembl: ENSG00000244437.
  • An amino acid sequence for VK3-15 is given as SEQ ID NO: 98. This is the sequence of the V-region. The V- region can be combined with one of five J-regions.
  • VK3-15/JK1 SEQ ID NO: 99
  • alternative name is VK3-15*01/1 GJKI *01 (nomenclature according to the IMGT database worldwide web at imgt.org).
  • VK3-20 is short for Immunoglobulin Variable Kappa 3-20 Gene.
  • the gene is also known as Immunoglobulin Kappa Variable 3-20; IGKV320; IGKV3-20; IgVK3-20.
  • External Ids for the gene are HGNC: 5817; Entrez Gene: 28912; Ensembl: ENSG00000239951.
  • VK3-20 An amino acid sequence for VK3-20 is indicated as SEQ ID NO: 100. This is the sequence of the V-region. The V-region can be combined with one of five J-regions.
  • a suitable VJ-region sequence is indicated as VK3-20/JK1 (SEQ ID NO: 101); alternative name is IgVK3-20*01/IGJKl*01 (nomenclature according to the IMGT database worldwide web at imgt.org). This name is exemplary and encompasses allelic variants of the gene segments.
  • VL3-21 is short for Immunoglobulin Variable Lambda 3-21 Gene.
  • the gene is also known as Immunoglobulin Lambda Variable 3-21; IGLV321; IGLV3-21; IgVX.3-21.
  • External Ids for the gene are HGNC: 5905; Entrez Gene: 28796; Ensembl: ENSG00000211662.2.
  • An amino acid sequence for VL3-21 is given as SEQ ID NO: 102. This is the sequence of the V- region.
  • the V-region can be combined with one of five J-regions.
  • VJ-region sequence is indicated as VL3-21/JL3 (SEQ ID NO: 103); alternative name is IgVA3-2 l/IGJA3 (nomenclature according to the IMGT database worldwide web at imgt.org). This name is exemplary and encompasses allelic variants of the gene segments.
  • any light chain variable region of a PD-1 antibody available in the art may be used, as may any other light chain variable region that can readily be obtained, such as from, for instance, an antibody display library by showing antigen binding activity when paired with a PD- 1 binding domain of a multispecific binding moiety of the present disclosure.
  • a PD-1 binding domain of a multispecific binding moiety of the present disclosure may further comprise a CHI and CL region.
  • Any CHI domain may be used, in particular a human CHI domain.
  • An example of a suitable CHI domain is provided by the amino acid sequence provided as SEQ ID NO: 69.
  • Any CL domain may be used, in particular a human CL.
  • An example of a suitable CL domain is provided by the amino acid sequence provided as SEQ ID NO: 75.
  • the TGF-PRII binding domain of a multispecific binding moiety of the present disclosure comprises a heavy chain variable region comprising: a) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 24, SEQ ID NO: 25, and SEQ ID NO: 26, respectively; b) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 28, SEQ ID NO: 29, and SEQ ID NO: 30, respectively; c) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 32, SEQ ID NO: 33, and SEQ ID NO: 34, respectively; d) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3
  • the heavy chain variable regions of the TGF-PRII binding domains of a multispecific binding moiety of the present disclosure may comprise a limited number, such as for instance one, two, or three, non-conservative amino acid substitutions, or an unlimited number of conservative amino acid substitutions.
  • the TGF-PRII binding domain of a multispecific binding moiety of the present disclosure also includes TGF-PRII binding domain variants thereof, wherein each of the HCDRs may comprise at most three, two, or one amino acid variations. In certain embodiments, only one or two HCDRs may comprise at most three, two, or one amino acid variations. In certain embodiments, such variants do not comprise amino acid variations in HCDR3. In certain embodiments, the amino acid variation is a conservative amino acid substitution. A conservative amino acid substitution is as described further herein.
  • TGF-PRII binding variants encompassed by the present disclosure include somatically hypermutated or affinity matured heavy chain variable regions, which are heavy chain variable regions derived from the same VH gene segment as the heavy chain variable regions described by sequence herein, the variants having amino acid variations, including non-conservative and/or conservative amino acid substitutions in one, two, or all three HCDRs.
  • a TGF-PRII binding domain of a multispecific binding moiety of the present disclosure comprises a heavy chain variable region having an amino acid sequence as set forth in any one of SEQ ID NO: 23; 27; 31; 35; 39; 43; 47; 88; 89, or a variant thereof.
  • a TGF-PRII binding domain of a multispecific binding moiety of the present disclosure comprises a heavy chain variable region having an amino acid sequence as set forth in any one of SEQ ID NO: 23; 27; 31; 35; 39; 43; 47; 88; 89, or having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto.
  • a TGF-PRII binding domain of a multispecific binding moiety of the present disclosure also includes TGF-PRII binding domain variants, which, in addition to the variations in the HCDRs referred to above, comprise one or more variations in the framework regions.
  • a variation can be any type of amino acid variation described herein, such as for instance a conservative amino acid substitution or non-conservative amino acid substitution resulting from somatic hypermutation or affinity maturation.
  • a TGF- PRII binding domain variant of a multispecific binding moiety of the present disclosure comprises no variations in the CDR regions but comprises one or more variations in the framework regions.
  • a TGF-PRII binding domain of a multispecific binding moiety of the present disclosure comprises:
  • heavy chain variable region having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence as set forth in SEQ ID NO: 23, which heavy chain variable region comprises a HCDR1 amino acid sequence as set forth in SEQ ID NO: 24; a HCDR2 amino acid sequence as set forth in SEQ ID NO: 25; and a HCDR3 amino acid sequence as set forth in SEQ ID NO: 26;
  • heavy chain variable region having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence as set forth in SEQ ID NO: 27, which heavy chain variable region comprises a HCDR1 amino acid sequence as set forth in SEQ ID NO: 28; a HCDR2 amino acid sequence as set forth in SEQ ID NO: 29; and a HCDR3 amino acid sequence as set forth in SEQ ID NO: 30;
  • heavy chain variable region having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence as set forth in SEQ ID NO: 31, which heavy chain variable region comprises a HCDR1 amino acid sequence as set forth in SEQ ID NO: 32; a HCDR2 amino acid sequence as set forth in SEQ ID NO: 33; and a HCDR3 amino acid sequence as set forth in SEQ ID NO: 34;
  • heavy chain variable region having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence as set forth in SEQ ID NO: 35, which heavy chain variable region comprises a HCDR1 amino acid sequence as set forth in SEQ ID NO: 36; a HCDR2 amino acid sequence as set forth in SEQ ID NO: 37; and a HCDR3 amino acid sequence as set forth in SEQ ID NO: 38;
  • heavy chain variable region having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence as set forth in SEQ ID NO: 39, which heavy chain variable region comprises a HCDR1 amino acid sequence as set forth in SEQ ID NO: 40; a HCDR2 amino acid sequence as set forth in SEQ ID NO: 41 ; and a HCDR3 amino acid sequence as set forth in SEQ ID NO: 42;
  • heavy chain variable region having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence as set forth in SEQ ID NO: 43, which heavy chain variable region comprises a HCDR1 amino acid sequence as set forth in SEQ ID NO: 44; a HCDR2 amino acid sequence as set forth in SEQ ID NO: 45; and a HCDR3 amino acid sequence as set forth in SEQ ID NO: 46;
  • heavy chain variable region having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence as set forth in SEQ ID NO: 47, which heavy chain variable region comprises a HCDR1 amino acid sequence as set forth in SEQ ID NO: 90; a HCDR2 amino acid sequence as set forth in SEQ ID NO: 91; and a HCDR3 amino acid sequence as set forth in SEQ ID NO: 92;
  • heavy chain variable region having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence as set forth in SEQ ID NO: 88, which heavy chain variable region comprises a HCDR1 amino acid sequence as set forth in SEQ ID NO: 44; a HCDR2 amino acid sequence as set forth in SEQ ID NO: 45; and a HCDR3 amino acid sequence as set forth in SEQ ID NO: 46; or
  • heavy chain variable region having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence as set forth in SEQ ID NO: 89, which heavy chain variable region comprises a HCDR1 amino acid sequence as set forth in SEQ ID NO: 90; a HCDR2 amino acid sequence as set forth in SEQ ID NO: 91; and a HCDR3 amino acid sequence as set forth in SEQ ID NO: 92.
  • any light chain variable region of a TGF-PRII antibody available in the art may be used, for example as described herein, as may any other light chain variable region that can readily be obtained, such as from, for instance, an antibody display library by showing antigen binding activity when paired with a TGF-PRII binding domain of a multispecific binding moiety of the present disclosure.
  • the TGF-PRII binding domain of a multispecific binding moiety of the present disclosure comprises the same or substantially the same light chain as the PD-1 binding domain.
  • the TGF-PRII binding domain of a multispecific binding moiety of the present disclosure comprises a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 48, or a variant thereof. In certain embodiments, the TGF-PRII binding domain of a multispecific binding moiety of the present disclosure comprises a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 48, or a variant having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto.
  • the TGF-PRII binding domain of a multispecific binding moiety of the present disclosure comprises a light chain variable region comprising light chain CDR1 (LCDR1), light chain CDR2 (LCDR2), and light chain CDR3 (LCDR3), having an amino acid sequence as set forth in SEQ ID NO: 49, SEQ ID NO: 50, and SEQ ID NO: 51, respectively.
  • the light chain variable region of a TGF-PRII binding domain of a multispecific binding moiety of the present disclosure also includes variants thereof, wherein each of the LCDRs may comprise at most three, two, or one conservative or non-conservative amino acid variations.
  • the amino acid variation is a conservative amino acid substitution.
  • a TGF-PRII binding domain of a multispecific binding moiety of the present disclosure may further comprise a CHI and CL region.
  • Any CHI domain may be used, in particular a human CHI domain.
  • An example of a suitable CHI domain is provided by the amino acid sequence provided as SEQ ID NO: 69.
  • Any CL domain may be used, in particular a human CL.
  • An example of a suitable CL domain is provided by the amino acid sequence provided as SEQ ID NO: 75.
  • the present invention thus also provides a multispecific binding moiety comprising a PD- 1 binding domain and a TGF-PRII binding domain, wherein the PD-1 binding domain comprises a heavy chain variable region, and optionally a light chain variable region and CHI and CL regions, as described herein.
  • the multispecific binding moiety further comprises a TGF-PRII binding domain that comprises a heavy chain variable region, and optionally a light chain variable region and CHI and CL regions, as described herein.
  • the present invention thus also provides a multispecific binding moiety comprising a PD- 1 binding domain and a TGL-PRII binding domain, wherein the TGF-PRII binding domain comprises a heavy chain variable region, and optionally a light chain variable region and CHI and CL regions, as described herein.
  • the multispecific binding moiety further comprises a PD-1 binding domain that comprises a heavy chain variable region, and optionally a light chain variable region and CHI and CL regions, as described herein.
  • any PD-1 binding domain disclosed herein can be combined with any TGF-PRII binding domain disclosed herein to produce a multispecific binding moiety of the present disclosure.
  • the present disclosure thus provides exemplary multispecific binding moieties PB1-PB18, as presented in Table 1.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, respectively; and
  • HCDR1 heavy chain CDR1
  • HCDR2 heavy chain CDR2
  • HCDR3 heavy chain CDR3
  • each of the HCDRs may comprise at most three, two, or one amino acid variations, for example substitutions.
  • the HCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 15, SEQ ID NO: 16, and SEQ ID NO: 17, respectively; and
  • HCDR1 heavy chain CDR1
  • HCDR2 heavy chain CDR2
  • HCDR3 heavy chain CDR3
  • each of the HCDRs may comprise at most three, two, or one amino acid variations, for example substitutions.
  • the HCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 20, SEQ ID NO: 21, and SEQ ID NO: 22, respectively; and
  • HCDR1 heavy chain CDR1
  • HCDR2 heavy chain CDR2
  • HCDR3 heavy chain CDR3
  • each of the HCDRs may comprise at most three, two, or one amino acid variations, for example substitutions.
  • the HCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising: - a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 15, SEQ ID NO: 16, and SEQ ID NO: 17, respectively; and
  • HCDR1 heavy chain CDR1
  • HCDR2 heavy chain CDR2
  • HCDR3 heavy chain CDR3
  • each of the HCDRs may comprise at most three, two, or one amino acid variations, for example substitutions.
  • the HCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, respectively; and
  • HCDR1 heavy chain CDR1
  • HCDR2 heavy chain CDR2
  • HCDR3 heavy chain CDR3
  • each of the HCDRs may comprise at most three, two, or one amino acid variations, for example substitutions.
  • the HCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, respectively; and
  • HCDR1 heavy chain CDR1
  • HCDR2 heavy chain CDR2
  • HCDR3 heavy chain CDR3
  • each of the HCDRs may comprise at most three, two, or one amino acid variations, for example, substitutions.
  • the HCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 15, SEQ ID NO: 16, and SEQ ID NO: 17, respectively; and
  • HCDR1 heavy chain CDR1
  • HCDR2 heavy chain CDR2
  • HCDR3 heavy chain CDR3
  • each of the HCDRs may comprise at most three, two, or one amino acid variations, for example substitutions.
  • the HCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 20, SEQ ID NO: 21, and SEQ ID NO: 22, respectively; and
  • HCDR1 heavy chain CDR1
  • HCDR2 heavy chain CDR2
  • HCDR3 heavy chain CDR3
  • each of the HCDRs may comprise at most three, two, or one amino acid variations, for example substitutions.
  • the HCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising: - a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, respectively; and
  • HCDR1 heavy chain CDR1
  • HCDR2 heavy chain CDR2
  • HCDR3 heavy chain CDR3
  • each of the HCDRs may comprise at most three, two, or one amino acid variations, for example substitutions.
  • the HCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, respectively; and
  • HCDR1 heavy chain CDR1
  • HCDR2 heavy chain CDR2
  • HCDR3 heavy chain CDR3
  • each of the HCDRs may comprise at most three, two, or one amino acid variations, for example substitutions.
  • the HCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 20, SEQ ID NO: 21, and SEQ ID NO: 22, respectively; and
  • HCDR1 heavy chain CDR1
  • HCDR2 heavy chain CDR2
  • HCDR3 heavy chain CDR3
  • each of the HCDRs may comprise at most three, two, or one amino acid variations, for example substitutions.
  • the HCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, respectively; and
  • a TGF-PRII binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 24, SEQ ID NO: 25, and SEQ ID NO: 26, respectively, wherein the PD-1 binding domain and TGF-PRII binding domain comprise a light chain CDR1 (LCDR1) having an amino acid sequence as set forth in SEQ ID NO: 49, light chain CDR2 (LCDR2) having an amino acid sequence as set forth in SEQ ID NO: 50, and light chain CDR3 (LCDR3) having an amino acid sequence as set forth in SEQ ID NO: 51, and wherein each of the HCDRs and/or LCDRs may comprise at most three, two, or one amino acid variations, for example substitutions. In certain embodiments, the HCDRs and/or LCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 15, SEQ ID NO: 16, and SEQ ID NO: 17, respectively; and
  • a TGF-PRII binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 24, SEQ ID NO: 25, and SEQ ID NO: 26, respectively, wherein the PD-1 binding domain and TGF-PRII binding domain comprise a light chain CDR1 (LCDR1) having an amino acid sequence as set forth in SEQ ID NO: 49, light chain CDR2 (LCDR2) having an amino acid sequence as set forth in SEQ ID NO: 50, and light chain CDR3 (LCDR3) having an amino acid sequence as set forth in SEQ ID NO: 51, and wherein each of the HCDRs and/or LCDRs may comprise at most three, two, or one amino acid variations, for example substitutions. In certain embodiments, the HCDRs and/or LCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 20, SEQ ID NO: 21, and SEQ ID NO: 22, respectively; and
  • TGF-PRII binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 24, SEQ ID NO: 25, and SEQ ID NO: 26, respectively, wherein the PD-1 binding domain and TGF-PRII binding domain comprise a light chain CDR1 (LCDR1) having an amino acid sequence as set forth in SEQ ID NO: 49, light chain
  • CDR2 (LCDR2) having an amino acid sequence as set forth in SEQ ID NO: 50, and light chain
  • CDR3 having an amino acid sequence as set forth in SEQ ID NO: 51, and wherein each of the HCDRs and/or LCDRs may comprise at most three, two, or one amino acid variations, for example substitutions. In certain embodiments, the HCDRs and/or LCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 15, SEQ ID NO: 16, and SEQ ID NO: 17, respectively; and
  • a TGF-PRII binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 32, SEQ ID NO: 33, and SEQ ID NO: 34, respectively, wherein the PD-1 binding domain and TGF-PRII binding domain comprise a light chain CDR1 (LCDR1) having an amino acid sequence as set forth in SEQ ID NO: 49, light chain CDR2 (LCDR2) having an amino acid sequence as set forth in SEQ ID NO: 50, and light chain CDR3 (LCDR3) having an amino acid sequence as set forth in SEQ ID NO: 51, and wherein each of the HCDRs and/or LCDRs may comprise at most three, two, or one amino acid variations, for example substitutions. In certain embodiments, the HCDRs and/or LCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, respectively; and
  • a TGF-PRII binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 40, SEQ ID NO: 41, and SEQ ID NO: 42, respectively, wherein the PD-1 binding domain and TGF-PRII binding domain comprise a light chain CDR1 (LCDR1) having an amino acid sequence as set forth in SEQ ID NO: 49, light chain CDR2 (LCDR2) having an amino acid sequence as set forth in SEQ ID NO: 50, and light chain CDR3 (LCDR3) having an amino acid sequence as set forth in SEQ ID NO: 51, and wherein each of the HCDRs and/or LCDRs may comprise at most three, two, or one amino acid variations, for example substitutions. In certain embodiments, the HCDRs and/or LCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, respectively; and
  • TGF-PRII binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 36, SEQ ID NO: 37, and SEQ ID NO: 38, respectively, wherein the PD-1 binding domain and TGF-PRII binding domain comprise a light chain CDR1 (LCDR1) having an amino acid sequence as set forth in SEQ ID NO: 49, light chain
  • CDR2 (LCDR2) having an amino acid sequence as set forth in SEQ ID NO: 50, and light chain
  • CDR3 having an amino acid sequence as set forth in SEQ ID NO: 51, and wherein each of the HCDRs and/or LCDRs may comprise at most three, two, or one amino acid variations, for example substitutions. In certain embodiments, the HCDRs and/or LCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 15, SEQ ID NO: 16, and SEQ ID NO: 17, respectively; and
  • TGF-PRII binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 36, SEQ ID NO: 37, and SEQ ID NO: 38, respectively, wherein the PD-1 binding domain and TGF-PRII binding domain comprise a light chain CDR1 (LCDR1) having an amino acid sequence as set forth in SEQ ID NO: 49, light chain
  • CDR2 (LCDR2) having an amino acid sequence as set forth in SEQ ID NO: 50, and light chain
  • CDR3 having an amino acid sequence as set forth in SEQ ID NO: 51, and wherein each of the HCDRs and/or LCDRs may comprise at most three, two, or one amino acid variations, for example substitutions. In certain embodiments, the HCDRs and/or LCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 20, SEQ ID NO: 21, and SEQ ID NO: 22, respectively; and - a TGF-PRII binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 36, SEQ ID NO: 37, and SEQ ID NO: 38, respectively, wherein the PD-1 binding domain and TGF-PRII binding domain comprise a light chain CDR1 (LCDR1) having an amino acid sequence as set forth in SEQ ID NO: 49, light chain
  • CDR2 (LCDR2) having an amino acid sequence as set forth in SEQ ID NO: 50, and light chain
  • CDR3 having an amino acid sequence as set forth in SEQ ID NO: 51, and wherein each of the HCDRs and/or LCDRs may comprise at most three, two, or one amino acid variations, for example substitutions. In certain embodiments, the HCDRs and/or LCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, respectively; and
  • TGF-PRII binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 28, SEQ ID NO: 29, and SEQ ID NO: 30, respectively, wherein the PD-1 binding domain and TGF-PRII binding domain comprise a light chain CDR1 (LCDR1) having an amino acid sequence as set forth in SEQ ID NO: 49, light chain
  • CDR2 (LCDR2) having an amino acid sequence as set forth in SEQ ID NO: 50, and light chain
  • CDR3 having an amino acid sequence as set forth in SEQ ID NO: 51, and wherein each of the HCDRs and/or LCDRs may comprise at most three, two, or one amino acid variations, for example substitutions. In certain embodiments, the HCDRs and/or LCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising: - a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, respectively; and
  • a TGF-PRII binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 90, SEQ ID NO: 91, and SEQ ID NO: 92, respectively, wherein the PD-1 binding domain and TGF-PRII binding domain comprise a light chain CDR1 (LCDR1) having an amino acid sequence as set forth in SEQ ID NO: 49, light chain CDR2 (LCDR2) having an amino acid sequence as set forth in SEQ ID NO: 50, and light chain CDR3 (LCDR3) having an amino acid sequence as set forth in SEQ ID NO: 51, and wherein each of the HCDRs and/or LCDRs may comprise at most three, two, or one amino acid variations, for example substitutions. In certain embodiments, the HCDRs and/or LCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 20, SEQ ID NO: 21, and SEQ ID NO: 22, respectively; and
  • a TGF-PRII binding domain as described herein comprising a heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 44, SEQ ID NO: 45, and SEQ ID NO: 46, respectively, wherein the PD-1 binding domain and TGF-PRII binding domain comprise a light chain CDR1 (LCDR1) having an amino acid sequence as set forth in SEQ ID NO: 49, light chain CDR2 (LCDR2) having an amino acid sequence as set forth in SEQ ID NO: 50, and light chain CDR3 (LCDR3) having an amino acid sequence as set forth in SEQ ID NO: 51, and wherein each of the HCDRs and/or LCDRs may comprise at most three, two, or one amino acid variations, for example substitutions. In certain embodiments, the HCDRs and/or LCDRs do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 9, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto;
  • each of the heavy chain variable regions comprise HCDRs that do not comprise amino acid variations. In certain embodiments, each of the heavy chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 18, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto;
  • each of the heavy chain variable regions comprise HCDRs that do not comprise amino acid variations. In certain embodiments, each of the heavy chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 19, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto;
  • each of the heavy chain variable regions comprise HCDRs that do not comprise amino acid variations. In certain embodiments, each of the heavy chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 14, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto;
  • each of the heavy chain variable regions comprise HCDRs that do not comprise amino acid variations. In certain embodiments, each of the heavy chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 9, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto;
  • each of the heavy chain variable regions comprise HCDRs that do not comprise amino acid variations. In certain embodiments, each of the heavy chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 9, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto;
  • each of the heavy chain variable regions comprise HCDRs that do not comprise amino acid variations. In certain embodiments, each of the heavy chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 14, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto;
  • each of the heavy chain variable regions comprise HCDRs that do not comprise amino acid variations. In certain embodiments, each of the heavy chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 19, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto;
  • each of the heavy chain variable regions comprise HCDRs that do not comprise amino acid variations. In certain embodiments, each of the heavy chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • each of the heavy chain variable regions comprise HCDRs that do not comprise amino acid variations. In certain embodiments, each of the heavy chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 13, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto;
  • each of the heavy chain variable regions comprise HCDRs that do not comprise amino acid variations. In certain embodiments, each of the heavy chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 19, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto;
  • each of the heavy chain variable regions comprise HCDRs that do not comprise amino acid variations. In certain embodiments, each of the heavy chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising: - a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 9, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto; and
  • each of the heavy chain variable regions and light chain variable regions comprise HCDRs and LCDRs, respectively, that do not comprise amino acid variations.
  • the each of the heavy chain variable regions and light chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 18, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto;
  • each of the heavy chain variable regions and light chain variable regions comprise HCDRs and LCDRs, respectively, that do not comprise amino acid variations.
  • the each of the heavy chain variable regions and light chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising: - a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 19, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto; and
  • each of the heavy chain variable regions and light chain variable regions comprise HCDRs and LCDRs, respectively, that do not comprise amino acid variations.
  • the each of the heavy chain variable regions and light chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 14, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto;
  • each of the heavy chain variable regions and light chain variable regions comprise HCDRs and LCDRs, respectively, that do not comprise amino acid variations.
  • the each of the heavy chain variable regions and light chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising: - a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 9, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto; and
  • each of the heavy chain variable regions and light chain variable regions comprise HCDRs and LCDRs, respectively, that do not comprise amino acid variations.
  • the each of the heavy chain variable regions and light chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 9, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto;
  • each of the heavy chain variable regions and light chain variable regions comprise HCDRs and LCDRs, respectively, that do not comprise amino acid variations.
  • the each of the heavy chain variable regions and light chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising: - a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 14, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto; and
  • each of the heavy chain variable regions and light chain variable regions comprise HCDRs and LCDRs, respectively, that do not comprise amino acid variations.
  • the each of the heavy chain variable regions and light chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 19, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto;
  • each of the heavy chain variable regions and light chain variable regions comprise HCDRs and LCDRs, respectively, that do not comprise amino acid variations.
  • the each of the heavy chain variable regions and light chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising: - a PD-1 binding domain as described herein comprising a heavy variable region having an amino acid sequence as set forth in SEQ ID NO: 9, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto; and
  • each of the heavy chain variable regions and light chain variable regions comprise HCDRs and LCDRs, respectively, that do not comprise amino acid variations.
  • the each of the heavy chain variable regions and light chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising:
  • a PD-1 binding domain as described herein comprising a heavy variable region having an amino acid sequence as set forth in SEQ ID NO: 13, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto;
  • each of the heavy chain variable regions and light chain variable regions comprise HCDRs and LCDRs, respectively, that do not comprise amino acid variations.
  • the each of the heavy chain variable regions and light chain variable regions do not comprise amino acid variations.
  • the present disclosure provides a multispecific binding moiety comprising: - a PD-1 binding domain as described herein comprising a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 19, or a heavy chain variable region that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity thereto; and
  • each of the heavy chain variable regions and light chain variable regions comprise HCDRs and LCDRs, respectively, that do not comprise amino acid variations.
  • the each of the heavy chain variable regions and light chain variable regions do not comprise amino acid variations.
  • nucleic acids useful for producing a multispecific binding moiety of the present disclosure comprise a nucleic acid sequence encoding the heavy chain variable region of a PD-1 binding domain as described herein and a nucleic acid sequence encoding the heavy chain variable region of a TGF-PRII binding domain as described herein.
  • a nucleic acid of the present disclosure may further comprise a nucleic acid sequence encoding a CHI region and preferably a hinge, CH2 and CH3 region.
  • a nucleic acid of the present disclosure may further comprise at least one nucleic acid sequence encoding a light chain variable region, and preferably a CL region.
  • the light chain variable region can be a common light chain variable region as described herein.
  • vectors comprising nucleic acids of the present disclosure useful for producing a multispecific binding moiety of the present disclosure.
  • such vectors comprise a nucleic acid sequence encoding the heavy chain variable region of a PD-1 binding domain as described herein and a nucleic acid sequence encoding the heavy chain variable region of a TGF-PRII binding domain as described herein.
  • a vector of the present disclosure may further comprise a nucleic acid sequence encoding a CHI region and preferably a hinge, CH2 and CH3 region.
  • a vector of the present disclosure may further comprise at least one nucleic acid sequence encoding a light chain variable region, and preferably a CL region.
  • the light chain variable region can be a common light chain variable region as described herein.
  • the present disclosure also provides a cell comprising a nucleic acid sequence, for example a vector, encoding the heavy chain variable region of a PD-1 binding domain as described herein and a nucleic acid sequence encoding the heavy chain variable region of a TGF- RII binding domain as described herein.
  • a cell of the present disclosure may further comprise a nucleic acid sequence, for example a vector, encoding a CHI region and preferably a hinge, CH2 and CH3 region.
  • a cell of the present disclosure may further comprise at least one nucleic acid sequence, for example a vector, encoding a light chain variable region, and preferably a CL region.
  • the light chain variable region can be a common light chain variable region as described herein.
  • a cell producing a multispecific binding moiety as described herein.
  • such cell can be a recombinant cell, which has been transformed with nucleic acid, for example a vector, of the present disclosure.
  • a cell of the present disclosure comprises a nucleic acid sequence, for example a vector, encoding the heavy chain variable region of a PD-1 binding domain as described herein and a nucleic acid sequence encoding the heavy chain variable region of a TGF- RII binding domain as described herein.
  • a cell of the present disclosure further comprises a nucleic acid sequence, for example a vector, encoding a CHI region and preferably a hinge, CH2 and CH3 region.
  • a cell of the present disclosure further comprises at least one nucleic acid sequence, for example a vector, encoding a light chain variable region, in particular a light chain variable region as described herein, and preferably a CL region.
  • the present disclosure further provides a cell producing a multispecific binding moiety as described herein.
  • the present disclosure provides a pharmaceutical composition comprising an effective amount of a multispecific binding moiety as described herein, and optionally a pharmaceutically acceptable carrier.
  • the present disclosure provides a multispecific binding moiety as described herein, and a pharmaceutical composition as described herein, for use in therapy. In certain embodiments, the present disclosure provides a multispecific binding moiety as described herein, or the pharmaceutical composition as described herein, for use in the treatment of cancer.
  • the present disclosure provides a method for treating a disease, comprising administering an effective amount of a multispecific binding moiety as described herein, or the pharmaceutical composition as described herein, to an individual in need thereof.
  • the present disclosure provides a method for treating cancer, comprising administering an effective amount of a multispecific binding moiety as described herein, or the pharmaceutical composition as described herein, to an individual in need thereof.
  • the terms “individual”, “subject” and “patient” are used interchangeably and refer to a mammal such as a human, mouse, rat, hamster, guinea pig, rabbit, cat, dog, monkey, cow, horse, pig and the like, and in particular to a human subject having cancer.
  • treat refers to any type of intervention or process performed on or administering an active agent or combination of active agents to a subject with the objective of curing or improving a disease or symptom thereof or which produces a positive therapeutic response.
  • positive therapeutic response refers to a treatment producing a beneficial effect, e.g.
  • a beneficial effect can take the form of an improvement over baseline, including an improvement over a measurement or observation made prior to initiation of therapy according to the method.
  • a beneficial effect can take the form of slowing, stabilizing, stopping or reversing the progression of a cancer in a subject at any clinical stage, as evidenced by a decrease or elimination of a clinical or diagnostic symptom of the disease, or of a marker of cancer.
  • Effective treatment may, for example, decrease in tumor size, decrease in the presence of circulating tumor cells, reduce or prevent metastases of a tumor, slow or arrest tumor growth and/or prevent or delay tumor recurrence or relapse.
  • a therapeutic amount refers to an amount of an agent or combination of agents that treats a disease, such as cancer. In some embodiments, a therapeutic amount is an amount sufficient to delay tumor development. In some embodiments, a therapeutic amount is an amount sufficient to prevent or delay tumor recurrence.
  • an effective amount of the agent or composition is one that, for example, may: (i) reduce the number of cancer cells; (ii) reduce tumor size; (iii) inhibit, retard, slow to some extent and may stop cancer cell infiltration into peripheral organs; (iv) inhibit tumor metastasis; (v) inhibit tumor growth; (vi) prevent or delay occurrence and/or recurrence of tumor; and/or (vii) relieve to some extent one or more of the symptoms associated with the cancer.
  • An effective amount may vary according to factors such as the disease state, age, sex, and weight of the individual to be treated, and the ability of the agent or combination of agents to elicit a desired response in the individual, which can be readily evaluated by the ordinarily skilled physician or other health care worker.
  • An effective amount can be administered to a subject in one or more administrations.
  • An effective amount can also include an amount that balances any toxic or detrimental effects of the agent or combination of agents and the beneficial effects.
  • agent refers to a therapeutically active substance, in the present case a multispecific binding moiety of the present disclosure, or a pharmaceutical composition of the present disclosure.
  • amino acid positions assigned to CDRs and frameworks in a variable region of an antibody or antibody fragment are specified according to Kabat's numbering (see Sequences of Proteins of Immunological Interest (National Institute of Health, Bethesda, Md., 1987 and 1991)). Amino acids in the constant regions are indicated according to the EU numbering system.
  • Accession numbers are primarily given to provide a further method of identification of a target, the actual sequence of the protein bound may vary, for instance because of a mutation in the encoding gene such as those occurring in some cancers or the like.
  • An antigen binding site of a multispecific binding moieties of the disclosure can bind the antigen and a variety of variants thereof, such as those expressed by some antigen positive immune or tumor cells.
  • HGNC stands for the HUGO Gene nomenclature committee. The number following the abbreviation is the accession number with which information on the gene and protein encoded by the gene can be retrieved from the HGNC database.
  • Entrez Gene provides the accession number or gene ID with which information on the gene or protein encoded by the gene can be retrieved from the NCBI (National Center for Biotechnology Information) database.
  • Ensembl provides the accession number with which information on the gene or protein encoded by the gene can be obtained from the Ensembl database.
  • Ensembl is a joint project between EMBL-EBI and the Wellcome Trust Sanger Institute to develop a software system which produces and maintains automatic annotation on selected eukaryotic genomes.
  • the reference is preferably to the human form of the gene or protein.
  • reference is made both to the natural gene or protein and to variant forms of the gene or protein as can be detected in tumors, cancers and the like, preferably as can be detected in human tumors, cancers and the like.
  • a multispecific binding moiety comprising a PD-1 binding domain and a TGF-PRII binding domain, wherein the PD-1 binding domain blocks PD-1 mediated signaling and the TGF-PRII binding domain blocks TGF-PRII-mediated signaling.
  • a multispecific binding moiety comprising a Fab domain that specifically binds to PD- 1 and a Fab domain that specifically binds to TGF-PRII.
  • multispecific binding moiety according to any one of the preceding clauses, wherein the multispecific binding moiety consists of a single Fab domain that specifically binds to PD-1, a single Fab domain that specifically binds to TGF-PRII, and an Fc region.
  • a multispecific binding moiety comprising a PD-1 binding domain and a TGF-PRII binding domain, wherein the multispecific binding moiety has a higher potency in blocking TGF-PRII -mediated signaling in cells expressing both PD-1 and TGF-PRII than in cells expressing TGF-PRII and no, substantially no, or low levels of PD-1.
  • a multispecific binding moiety comprising a PD-1 binding domain and a TGF-PRII binding domain, wherein the multispecific binding moiety has a higher activity in reducing tumor volume than a combination of reference antibodies, wherein the combination of reference antibodies are two bivalent monospecific antibodies targeting PD-1 and TGF-PRII, wherein the bivalent monospecific antibody targeting PD-1 comprises a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 78 and a light chain having an amino acid sequence as set forth in SEQ ID NO: 79, and the bivalent monospecific antibody targeting TGF-PRII comprises a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 76 and a light chain having an amino acid sequence as set forth in SEQ ID NO: 77.
  • a higher activity in reducing tumor volume is a tumor volume reduction of at least about 1.5 fold, preferably between about 1.5-100 fold, of the tumor volume reduction of the combination of reference antibodies.
  • the multispecific binding moiety according to any one of the preceding clauses wherein the cells expressing both PD-1 and TGF-PRII are HEK-Blue TGF-P -PD-1 + cells and the cells expressing TGF-PRII and no, substantially no, or low levels of PD-1 are HEK-Blue TGF-P cells. 16. The multispecific binding moiety according to any one of the preceding clauses, wherein the potency in blocking TGF-PRII-mediated signaling is measured in a phospho- SMAD2/3 assay.
  • the potency in blocking TGF-PRII-mediated signaling in cells expressing both PD-1 and TGF-PRII is at least about 200 fold or 500 fold or 1000 fold or 5000 fold or 10000 fold or 15000 fold or 20000 fold or 30000 fold, or between about 200-30000 fold or 500-30000 fold or 1000- 30000 fold or 5000-30000 fold or 10000-30000 fold or 200-20000 fold or 200-15000 fold, higher than in cells expressing TGF-PRII and no, or substantially, or low levels of PD-1.
  • the multispecific binding moiety according to any one of the preceding clauses, wherein the potency of the multispecific binding moiety in blocking TGF-PRII-mediated signaling in cells expressing both TGF-PRII and PD-1 is at least about 100 fold or 200 fold, preferably between about 100-20000 fold or 100-15000 fold or 100-12000 fold or 200-20000 fold or 200-15000 fold or 200-12000 fold, higher than the potency of the reference anti-TGF- RII antibody.
  • the PD-1 binding domain and TGF- RII binding domain each comprise a light chain comprising a light chain variable region of a light chain that is capable of pairing with multiple heavy chains having different epitope specificities.
  • the PD-1 binding domain comprises a heavy chain variable region comprising: a) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 2, SEQ ID NO: 3, and SEQ ID NO: 4, respectively; b) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 6, SEQ ID NO: 7, and SEQ ID NO: 8, respectively; c) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, respectively; d) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain variable region comprising: a) heavy chain CDR1 (HCDR1), heavy chain
  • the TGF-PRII binding domain comprises a heavy chain variable region comprising: a) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 24, SEQ ID NO: 25, and SEQ ID NO: 26, respectively; b) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 28, SEQ ID NO: 29, and SEQ ID NO: 30, respectively; c) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 32, SEQ ID NO: 33, and SEQ ID NO: 34, respectively; d) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 32, SEQ
  • a multispecific binding moiety comprising a PD-1 binding domain and a TGF-PRII binding domain, wherein the PD-1 binding domain comprises a heavy chain variable region comprising: a) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 2, SEQ ID NO: 3, and SEQ ID NO: 4, respectively; b) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 6, SEQ ID NO: 7, and SEQ ID NO: 8, respectively; c) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, respectively; d) heavy chain CDR1 (HCDR1), heavy chain CDR1
  • a multispecific binding moiety comprising a PD-1 binding domain and a TGF-PRII binding domain, wherein the TGF-PRII binding domain comprises a heavy chain variable region comprising: a) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 24, SEQ ID NO: 25, and SEQ ID NO: 26, respectively; b) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 28, SEQ ID NO: 29, and SEQ ID NO: 30, respectively; c) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 32, SEQ ID NO: 33, and SEQ ID NO: 34, respectively; d) heavy chain CDR1 (HCDR1)
  • the PD-1 binding domain comprises a heavy chain variable region having an amino acid sequence as set forth in any one of SEQ ID NO: 1; 5; 9; 13; 14; 18; 19, or having at least 80%, preferably 85%, more preferably 90%, or most preferably 95% sequence identity thereto.
  • the PD-1 binding domain comprises a light chain variable region comprising light chain CDR1 (LCDR1), light chain CDR2 (LCDR2), and light chain CDR3 (LCDR3), having an amino acid sequence as set forth in SEQ ID NO: 49, SEQ ID NO: 50, and SEQ ID NO: 51, respectively, wherein each of the LCDRs may comprise at most three, two, or one amino acid variations.
  • LCDR1 light chain CDR1
  • LCDR2 light chain CDR2
  • LCDR3 light chain CDR3
  • the PD-1 binding domain comprises a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 48, or having at least 80%, preferably 85%, more preferably 90%, or most preferably 95% sequence identity thereto.
  • the TGF-PRII binding domain comprises a heavy chain variable region comprising: a) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 24, SEQ ID NO: 25, and SEQ ID NO: 26, respectively; b) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 28, SEQ ID NO: 29, and SEQ ID NO: 30, respectively; c) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR2), and heavy chain CDR3 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 32, SEQ ID NO: 33, and SEQ ID NO: 34, respectively; d) heavy chain CDR1 (HCDR1), heavy chain CDR2 (HCDR3), having an amino acid sequence as set forth in SEQ ID NO: 32, SEQ
  • TGF-PRII binding domain comprises a heavy chain variable region having an amino acid sequence as set forth in any one of SEQ ID NO: 23; 27; 31; 35; 39; 43; 47; 88; 89, or having at least 80%, preferably 85%, more preferably 90%, or most preferably 95% sequence identity thereto.
  • the TGF-PRII binding domain comprises a light chain variable region comprising light chain CDR1 (LCDR1), light chain CDR2 (LCDR2), and light chain CDR3 (LCDR3), having an amino acid sequence as set forth in SEQ ID NO: 49, SEQ ID NO: 50, and SEQ ID NO: 51, respectively, wherein each of the LCDRs may comprise at most three, two, or one amino acid variations.
  • LCDR1 light chain CDR1
  • LCDR2 light chain CDR2
  • LCDR3 light chain CDR3
  • TGF-PRII binding domain comprises a light chain variable region having an amino acid sequence as set forth in SEQ ID NO: 48, or having at least 80%, preferably 85%, more preferably 90%, or most preferably 95% sequence identity thereto.
  • a multispecific binding moiety comprising a PD-1 binding domain and a TGF-PRII binding domain that competes with a multispecific binding moiety of any one of the preceding clauses for binding to PD-1 and/or TGF-PRII.
  • a pharmaceutical composition comprising an effective amount of the multispecific binding moiety according to any one of the preceding clauses, and a pharmaceutically acceptable carrier.
  • a method for treating a disease comprising administering an effective amount of a multispecific binding moiety according to any one of clauses 1-37, or the pharmaceutical composition according to clause 38, to a human subject in need thereof.
  • a method for treating a disease associated with a suppressed immune system comprising administering an effective amount of a multispecific binding moiety according to any one of clauses 1-37, or the pharmaceutical composition according to clause 38, to a human subject in need thereof.
  • a method for treating cancer comprising administering an effective amount of a multispecific binding moiety according to any one of clauses 1-37, or the pharmaceutical composition according to clause 38, to a human subject in need thereof.
  • a cell comprising a nucleic acid sequence encoding the heavy chain variable region of a PD-1 binding domain as defined in clause 28 or 30 and a nucleic acid sequence encoding the heavy chain variable region of a TGF-PRII binding domain as defined in clause 29 or 34.
  • cell according to clause 47 wherein the cell further comprises a nucleic acid sequence encoding a CHI region and preferably a hinge, CH2 and CH3 region.
  • bivalent monospecific antibodies are indicated in the format SEQ ID NO: A/SEQ ID NO: B, where SEQ ID NO: A refers to the heavy chain of both binding domains and SEQ ID NO: B refers to the light chain of both binding domains.
  • Bivalent bispecific antibodies are indicated in the format SEQ ID NO: A x SEQ ID NO: B, where both SEQ ID NO: A and B refer to heavy chain variable sequences. Each binding domain of the bispecific antibodies comprises the same light chain.
  • Bivalent monospecific reference antibodies pembrolizumab, nivolumab, and TGF1 analog are indicated in the format SEQ ID NO: A/SEQ ID NO: B, where SEQ ID NO: A refers to the respective heavy chain sequence and SEQ ID NO: B refers to the respective light chain sequence.
  • a combination of pembrolizumab and TGF1 analog is indicated in the format SEQ ID NO: A/SEQ ID NO: B + SEQ ID NO: C/SEQ ID NO: D, where SEQ ID NO: A refers to the heavy chain sequence and SEQ ID NO: B refers to the light chain sequence of either pembrolizumab or TGF1 analog, and SEQ ID NO: C to the heavy chain sequence and SEQ ID NO: D to the light chain sequence of the other.
  • Reference PD-L1-TGF- TRAP molecule analog which is an analog of Bintrafusp alfa, is indicated in the format SEQ ID NO: A/SEQ ID NO: B, where SEQ ID NO: A refers to the heavy chain sequence including a (G4S)4G linker and extracellular domain of TGF-PRII, and SEQ ID NO: B refers to the light chain sequence.
  • the reference PD-L1-TGF-P TRAP molecule analog comprises two PD-L1 binding domains and two TGF-PRII extracellular domains.
  • Bispecific antibodies are: SEQ ID NO: 39xSEQ ID NO: 9 and SEQ ID NO: 35xSEQ ID NO: 5.
  • Control antibodies are: pembrolizumab analog - SEQ ID NO: 78/SEQ ID NO: 79; PD-L1-TGF-P TRAP molecule analog - SEQ ID NO: 80/SEQ ID NO: 81, and TGF1 analog - SEQ ID NO: 76/SEQ ID NO: 77.
  • Bispecific antibodies are: SEQ ID NO: 23xSEQ ID NO: 18; SEQ ID NO: 47xSEQ ID NO: 13; SEQ ID NO: 88xSEQ ID NO: 13 ; SEQ ID NO: 89xSEQ ID NO: 13 ; SEQ ID NO: 23xSEQ ID NO: 14; and SEQ ID NO: 43xSEQ ID NO: 9.
  • Control antibodies are: pembrolizumab analog - SEQ ID NO: 78/SEQ ID NO: 79; and RSV IgGl - SEQ ID NO: 86/SEQ ID NO: 87.
  • Bispecific antibodies are: SEQ ID NO: 39xSEQ ID NO: 9 and SEQ ID NO: 35xSEQ ID NO: 5.
  • Control antibodies are: pembrolizumab analog - SEQ ID NO: 78/SEQ ID NO: 79; PD-L1-TGF-P TRAP molecule analog - SEQ ID NO: 80/SEQ ID NO: 81, and TGF1 analog - SEQ ID NO: 76/SEQ ID NO: 77.
  • Bispecific antibodies are: SEQ ID NO: 47xSEQ ID NO: 13; SEQ ID NO: 88xSEQ ID NO: 13; and SEQ ID NO: 89xSEQ ID NO: 13.
  • Control antibodies are: pembrolizumab analog - SEQ ID NO: 78/SEQ ID NO: 79; and RSV IgGl - SEQ ID NO: 86/SEQ ID NO: 87.
  • C) Bispecific antibodies are: SEQ ID NO: 23xSEQ ID NO: 18; SEQ ID NO: 23xSEQ ID NO: 14; and SEQ ID NO: 43xSEQ ID NO: 9.
  • Control antibodies are: pembrolizumab analog - SEQ ID NO: 78/SEQ ID NO: 79; and RSV IgGl - SEQ ID NO: 86/SEQ ID NO: 87.
  • FIG. 3 Inhibition of phosphoSMAD2/3 by bispecific antibodies and control antibodies in Jurkat-PD-l nu11 (A-G) cells and Jurkat-PD-1 + cells (H-N). These graphs show phosphoSMAD2/3 levels in lysates of Jurkat-PD-l nu11 cells and Jurkat-PD-1 + cells incubated with bispecific antibodies or control antibodies. “No TGF-pi” indicates the background phosphoSMAD2/3 level when no TGF- ligand is added as measured in the absence of bispecific antibodies; “10 ng/ml TGF-pi” indicates the maximum phosphoSMAD2/3 level when 10 ng/ml TGF-P ligand is added in the absence of bispecific antibodies.
  • Control antibodies are: RSV IgGl - SEQ ID NO: 86/SEQ ID NO: 87; TGF1 analog - SEQ ID NO: 76/SEQ ID NO: 77; and TGF-PRIIxRSV antibodies comprising a TGF-PRII binding domain comprising a heavy chain variable region amino acid sequence as set forth in SEQ ID NO: 23, 31, 39, 27, 35, or 43; a RSV binding domain comprising a heavy chain variable region amino acid sequence as set forth in SEQ ID NO: 86; and a common light chain comprising a light chain variable region amino acid sequence as set forth in SEQ ID NO: 48 and a light chain constant region amino acid sequence as set forth in SEQ ID NO: 75.
  • Each data point represents the mean absorbance of corresponding duplicates.
  • a and H bispecific antibodies comprising a PD-1 binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 1, 5, 9, 14, or 19, and a TGF-PRII binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 23;
  • B and I bispecific antibodies comprising a PD-1 binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 1, 5, 9, 14, or 19, and a TGF-PRII binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 31;
  • C and J bispecific antibodies comprising a PD-1 binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 1, 5, 9, 14, or 19, and a TGF-PRII binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 39;
  • D and K bispecific antibodies comprising a PD-1 binding domain with a heavy chain variable region having
  • Control antibodies are: RSV IgGl - SEQ ID NO: 86/SEQ ID NO: 87; TGF1 analog - SEQ ID NO: 76/SEQ ID NO: 77; and pembrolizumab - SEQ ID NO: 78/SEQ ID NO: 79.
  • FIG. 4 Intracellular phosphoSMAD2 measurement by Flow Cytometry. These graphs show intracellular phosphoSMAD2 levels of stimulated and unstimulated CD4 + and CD8 + T cells incubated with bispecific antibodies or control antibodies.
  • Bispecific antibodies are: SEQ ID NO: 23 x SEQ ID NO: 18 and SEQ ID NO: 47 x SEQ ID NO: 13.
  • Control antibodies are: RSV IgGl - SEQ ID NO: 86/SEQ ID NO: 87; TGF1 analog - SEQ ID NO: 76/SEQ ID NO: 77; and pembrolizumab - SEQ ID NO: 78/SEQ ID NO: 79.
  • A donor A stimulated CD4 + T cells
  • B donor A stimulated CD8 + T cells
  • C donor A unstimulated CD4 + T cells
  • D donor A unstimulated CD8 + T cells
  • E donor B stimulated CD4 + T cells
  • F donor B stimulated CD8 + T cells
  • G donor B unstimulated CD4 + T cells
  • H donor B unstimulated CD8 + T cells.
  • FIG. 5 Measurement of cytokine production induced by bispecific antibodies or control antibodies in an exhausted MLR assay.
  • Bispecific antibodies tested are: SEQ ID NO: 23 x SEQ ID NO: 9; SEQ ID NO: 23 x SEQ ID NO: 14; SEQ ID NO: 23 x SEQ ID NO: 19; SEQ ID NO: 31 x SEQ ID NO: 14; SEQ ID NO: 39 x SEQ ID NO: 9; SEQ ID NO: 35 x SEQ ID NO: 9; SEQ ID NO: 35 x SEQ ID NO: 14; SEQ ID NO: 35 x SEQ ID NO: 19; SEQ ID NO: 27 x SEQ ID NO: 9; SEQ ID NO: 43 x SEQ ID NO: 9; SEQ ID NO: 43 x SEQ ID NO: 19; SEQ ID NO: 23 x SEQ ID NO: 13; SEQ ID NO: 23 x SEQ ID NO: 18; SEQ ID NO: 47 x SEQ ID NO: 13; SEQ ID NO: 88
  • Control antibodies are: RSV IgGl - SEQ ID NO: 86/SEQ ID NO: 87; TGF1 analog - SEQ ID NO: 76/SEQ ID NO: 77; a combination of pembrolizumab and TGF1 analog - SEQ ID NO: 78/SEQ ID NO: 79 + SEQ ID NO: 76/SEQ ID NO: 77; PD-L1-TGF-P TRAP molecule analog - SEQ ID NO: 80/SEQ ID NO: 81; and pembrolizumab - SEQ ID NO: 78/SEQ ID NO: 79.
  • B This graph shows the induction of IFN-y cytokine secretion by exhausted T cells of one representative donor.
  • C This graph shows the induction of IL-2 cytokine secretion by exhausted T cells in one representative donor.
  • D This graph shows the induction of TNF-a cytokine secretion by exhausted T cells in one representative donor.
  • E This graph shows the induction of TNF-a cytokine secretion by exhausted T cells in one representative donor.
  • Bispecific antibodies are: SEQ ID NO: 23 x SEQ ID NO: 14; SEQ ID NO: 23 x SEQ ID NO: 19; SEQ ID NO: 39 x SEQ ID NO: 9; SEQ ID NO: 35 x SEQ ID NO: 9; SEQ ID NO: 35 x SEQ ID NO: 14; SEQ ID NO: 35 x SEQ ID NO: 19; SEQ ID NO: 27 x SEQ ID NO: 9; SEQ ID NO: 43 x SEQ ID NO: 9; and SEQ ID NO: 43 x SEQ ID NO: 19.
  • Control antibodies are: RSV IgGl - SEQ ID NO: 86/SEQ ID NO: 87; TGF1 analog - SEQ ID NO: 76/SEQ ID NO: 77; and pembrohzumab - SEQ ID NO: 78/SEQ ID NO: 79.
  • a and B These graphs show the inhibition of TGF-0 signaling by bispecific antibodies or control antibodies in HEK-BlueTM TGF-0 Cells.
  • C and D These graphs show the inhibition of TGF-0R signaling by bispecific antibodies or control antibodies in HEK-BlueTM TGF-0 -PD-1 + cells.
  • Bispecific antibodies are: SEQ ID NO: 23 x SEQ ID NO: 14; SEQ ID NO: 23 x SEQ ID NO: 19; SEQ ID NO: 31 x SEQ ID NO: 14; SEQ ID NO: 39 x SEQ ID NO: 9; SEQ ID NO: 35 x SEQ ID NO: 9; SEQ ID NO: 35 x SEQ ID NO: 14; SEQ ID NO: 35 x SEQ ID NO: 19; SEQ ID NO: 27 x SEQ ID NO: 9; SEQ ID NO: 43 x SEQ ID NO: 9; and SEQ ID NO: 43 x SEQ ID NO: 19.
  • Control antibodies are: RSV IgGl - SEQ ID NO: 86/SEQ ID NO: 87; TGF1 analog - SEQ ID NO: 76/SEQ ID NO: 77; a combination of pembrohzumab and TGF1 analog - SEQ ID NO: 78/SEQ ID NO: 79 + SEQ ID NO: 76/SEQ ID NO: 77; and pembrolizumab - SEQ ID NO: 78/SEQ ID NO: 79.
  • B This graph shows the induction of TNF-a cytokine secretion in a coculture of Tregs with PBMCs of one representative donor.
  • Bispecific antibodies are: SEQ ID NO: 35 x SEQ ID NO: 9; SEQ ID NO: 23 x SEQ ID NO: 14; SEQ ID NO: 23 x SEQ ID NO: 19; SEQ ID NO: 43 x SEQ ID NO: 9; SEQ ID NO: 39 x SEQ ID NO: 9; SEQ ID NO: 43 x SEQ ID NO: 19; SEQ ID NO: 35 x SEQ ID NO: 14; SEQ ID NO: 35 x SEQ ID NO: 19; SEQ ID NO: 31 x SEQ ID NO: 14, and SEQ ID NO: 27 x SEQ ID NO: 9.
  • Control antibodies are: RSV IgGl - SEQ ID NO: 86/ SEQ ID NO: 87; TGF1 analog - SEQ ID NO: 76/SEQ ID NO: 77; Opdivo; LILRB2; PD-L1-TGF-P TRAP molecule analog - SEQ ID NO: 80/SEQ ID NO: 81; pembrolizumab - SEQ ID NO: 78/SEQ ID NO: 79; and mvolumab analog - SEQ ID NO: 96/SEQ ID NO: 97.
  • A show the expression of CD 163, CD209, CD206 and CD86 on M2 macrophages obtained from PBMC’s from three different donors.
  • B show the induction of IFN-y cytokine secretion by CD4 + T cells in the presence of M2 macrophages obtained from PBMC’s from three different donors.
  • FIG. 9 In vivo efficacy of bispecific antibodies.
  • A This graph shows the tumor volume reduction in mm 3 induced by control and reference antibodies.
  • B-E These graphs show the tumor volume reduction in mm 3 induced by the bispecific antibodies as compared to control and reference antibodies.
  • Bispecific antibodies are: SEQ ID NO: 43 x SEQ ID NO: 9; SEQ ID NO: 43 x SEQ ID NO: 19; SEQ ID NO: 23 x SEQ ID NO: 14; SEQ ID NO: 23 x SEQ ID NO: 19; SEQ ID NO: 39 x SEQ ID NO: 9; SEQ ID NO: 27 x SEQ ID NO: 9; SEQ ID NO: 23 x SEQ ID NO: 18; and SEQ ID NO: 47 x SEQ ID NO: 13.
  • Control antibodies are: RSV IgGl - SEQ ID NO: 86/SEQ ID NO: 87; TGF1 analog - SEQ ID NO: 76/SEQ ID NO: 77; pembrolizumab - SEQ ID NO: 78/SEQ ID NO: 79; PD-L1-TGF-P TRAP molecule analog - SEQ ID NO: 80/SEQ ID NO: 81; and a combination of pembrolizumab and TGF1 analog - SEQ ID NO: 78/SEQ ID NO: 79 + SEQ ID NO: 76/SEQ ID NO: 77.
  • Bispecific antibodies were dosed at 1 mg/kg (1) and/or 10 mg/kg (10) (A-C) and at 10 mg/kg only (D-F).
  • F The left graph shows the TGF-PRII receptor occupancy and the right graph the PD-1 receptor occupancy after treatment with the bispecific or control antibodies.
  • FIG 11 In vivo efficacy of bispecific antibodies.
  • This graph shows the tumor volume reduction in mm 3 induced by an exemplary bispecific antibody at two different dose levels: 1 mg/kg and 10 mg/kg, as compared to a control antibody at 10 mg/kg.
  • the bispecific antibody is: SEQ ID NO: 23 x SEQ ID NO: 18, and the control antibody is: SEQ ID NO: 86/SEQ ID NO: 87.
  • each binding domain of the bispecific antibodies comprises a light chain variable region variable region having an amino acid sequence as set forth in SEQ ID NO: 48 and a light chain constant region having an amino acid sequence as set forth in SEQ ID NO: 75.
  • the bispecific antibodies preferably are IgGl antibodies comprising a CHI, hinge, CH2, and CH3.
  • bispecific antibodies were screened in IgGl format, wherein the PD-1 binding heavy chain comprises a CHI having an amino acid sequence as set forth in SEQ ID NO: 69, a CH2 having an amino acid sequence as set forth in SEQ ID NO: 71, and a CH3 having an amino acid sequence as set forth in SEQ ID NO: 73; and the TGF-PRII binding heavy chain comprises a CHI having an amino acid sequence as set forth in SEQ ID NO: 69, a CH2 having an amino acid sequence as set forth in SEQ ID NO: 71, and a CH3 having an amino acid sequence as set forth in SEQ ID NO: 74.
  • Reference antibodies and molecules, and control antibodies used in the Examples include:
  • Reference PD-1 antibody pembrolizumab analog which is a bivalent monospecific antibody comprising two heavy chains having an amino acid sequence as set forth in SEQ ID NO: 78 and two light chains having an amino acid sequence as set forth in SEQ ID NO: 79.
  • TGF-PRII antibody TGF1 which is a bivalent monospecific analog of TGF1 and comprises two heavy chains having an amino acid sequence as set forth in SEQ ID NO: 76 and two light chains having an amino acid sequence as set forth in SEQ ID NO: 77.
  • PD-L1-TGF-P TRAP molecule which is an analog of Bintrafusp alfa bivalent monospecific for binding to PD-L1 and comprises two heavy chains having an amino acid sequence as set forth in SEQ ID NO: 80 and two light chains having an amino acid sequence as set forth in SEQ ID NO: 81, with an extracellular domain of TGF-PRII having an amino acid sequence as set forth in SEQ ID NO: 104 linked to the C-terminus of each heavy chain through a (G 4 S) 4 G linker.
  • V-G Negative control IgGl antibody
  • RSV-G is a bivalent monospecific antibody comprising two heavy chains having an amino acid sequence as set forth in SEQ ID NO: 86 and two light chains having an amino acid sequence as set forth in SEQ ID NO: 87.
  • TGF-PRIIxRSV antibodies which are bivalent bispecific antibodies comprising a TGF-PRII binding domain comprising a heavy chain variable region amino acid sequence as set forth in SEQ ID NO: 23, 31, 39, 27, 35, or 43; a RSV binding domain comprising a heavy chain variable region amino acid sequence as set forth in SEQ ID NO: 86; and a common light chain comprising a light chain variable region amino acid sequence as set forth in SEQ ID NO: 48 and a light chain constant region amino acid sequence as set forth in SEQ ID NO: 75.
  • Binding domains, antibodies and heavy chain variable regions with binding specificity to human PD-1 and heavy chain variable regions with binding specificity to human TGF-PRII were obtained by immunizing transgenic mice comprising a common IGKV1-39 light chain (MeMo® mice) with human PD-1 or TGF-PRII antigenic moieties, including the use of different forms of DNA, protein and cell-based antigen delivery.
  • the binding domain sequences herein, once characterized and sequenced through the techniques provided herein, can be subsequently obtained by any method known in the art.
  • Bispecific IgG antibodies were generated by transient co-transfection of two plasmid vectors: one encoding an IgG heavy chain with a PD-1 binding VH region and the other encoding an IgG heavy chain with a TGF-PRII binding VH region.
  • CH3 engineering technology as described in WO 2013/157954 and WO 2013/157953 was employed to ensure efficient hetero-dimerization and formation of bispecific antibodies.
  • Both vectors further encode a common light chain comprising the IGKVl-39/Jkl light chain variable region. Cell transfection, cell culture, and the harvesting and purification of antibodies was performed by methods known in the art.
  • EXAMPLE 2 - PD-1 -SHP recruitment Assay Bispecific antibodies were characterized in a PD-1 -SHP recruitment assay to determine their ability to block ligand binding to PD-1 and thereby inhibit PD-1/PD-L1 signaling in T cells
  • a PD-1 -SHP recruitment assay involves a two cell system comprising U20S cells engineered to express an Enzyme Donor (ED)-tagged PD-1 receptor (e.g. PD-L1 or PD-L2) and Jurkat T cells expressing PD-1 and engineered to express Enzyme Acceptor (EA)-fused SHP1.
  • ED Enzyme Donor
  • EA Enzyme Acceptor
  • Ligand or agonistic antibody-induced PD-1 activation of the Jurkat T cells results in SHP1 recruitment, forcing ED and EA interaction and of reconstitution of an active 0-gal enzyme.
  • Reconstituted 0- gal produces a chemiluminescent signal in the presence of substrate.
  • Antibody samples included several bispecific antibodies, negative control IgGl antibody (RSV), reference PD-1 antibody pembrolizumab analog, an analog of reference TGF-0RII antibody TGF1, and an analog of reference PD-L1 -TGF-0 TRAP molecule.
  • RSV negative control IgGl antibody
  • reference PD-1 antibody pembrolizumab analog an analog of reference TGF-0RII antibody TGF1
  • TGF-L1 -TGF-0 TRAP molecule included several bispecific antibodies, negative control IgGl antibody (RSV), reference PD-1 antibody pembrolizumab analog, an analog of reference TGF-0RII antibody TGF1, and an analog of reference PD-L1 -TGF-0 TRAP molecule.
  • U2OS/PD-L1 cells were maintained in McCoy’s 5A medium (Thermo Fisher Scientific) with addition of 10% FBS + 0.25 pg/ml Puromycin (Thermo Fisher Scientific).
  • Jurkat-PD-l-SHP cells Src homology region 2 domain-containing phosphatase; DiscoveRx Corporation
  • RPMI1640 medium Thermo Fisher Scientific
  • U2OS/PD-L1 and Jurkat-PD-l-SHP cells were first centrifuged in a conical tube to remove the culture media, and then washed, and resuspended with assay medium (RPMI1640 medium with 1% FBS) before cell plating.
  • assay medium RPMI1640 medium with 1% FBS
  • the U2OS/PD-L1 cells were added in a 384-well black clear bottom assay plate (CELLCOAT® Tissue Culture Plates, Greiner Bio-One) at 5000 cells per well in 20 pL assay medium.
  • Antibody samples were prepared by serial dilution in phosphate buffered saline (PBS) with 1% FBS, and 5 pL/well was transferred to the cell plate and incubated at 37°C, 5 % CO2 for one hour.
  • Jurkat- PD-l-SHP cells were subsequently added to the cell plate at 5000 cells per well in 20 pL assay medium and incubated at 37°C, 5 % CO2 for two hours before the addition of 2.5 pL PathHunter reagent 1 (DiscoveRx Corporation) in each well.
  • the assay plate was then shaken for 1 min at 350 rpm and kept in the dark for 15 minutes at room temperature followed by addition of 10 pL PathHunter reagent 2 (DiscoveRx Corporation).
  • Chemiluminescent signal was recorded with TopCount reader (Perkin Elmer) after incubation at room temperature for one hour. Wells with PBS only served as the positive controls and wells containing no cells were used as negative controls. IC50 determination was performed by fitting the curve of percent control activity versus the log of the compound concentration using the GraphPad Prism 7.0 software.
  • results are shown in Table 2 and Figure 1. All bispecific antibodies inhibited PD-1- mediated SHP recruitment. A number of bispecific antibodies, that are monovalent for PD-1 binding, are equipotent to bivalent monospecific reference PD-1 antibody pembrolizumab analog and reference PD-L1-TGF- TRAP molecule, which is bivalent for PD-L1 binding, in the PD-1- SHP Recruitment Assay.
  • Bispecific antibodies were characterized in a PD-l-NFAT Reporter Assay to determine their ability to block PD-1/PD-L1 signaling in activated T cells.
  • a PD-l-NFAT Reporter Assay involves a two transgenic cell line system with PD-L1 + aAPC/CHO-Kl cells co-expressing a TCR cognate protein and PD-1 + effector Jurkat T cells driving luciferase reporter under control of a NFAT-RE cis element. Effector Jurkat T cells activate TCR signaling in an antigenindependent manner.
  • PD-1/PD-L1 interaction inhibits TCR-mediated luminescence. Blockade of the PD-1/PD-L1 interaction allows TCR signaling, thereby inducing luminescence detectable by adding substrate.
  • Antibody samples included several bispecific antibodies, negative control IgGl antibody (RSV), reference PD-1 antibody pembrolizumab analog, an analog of reference TGF-PRII antibody TGF1, and an analog of reference PD-L1-TGF-P TRAP molecule.
  • RSV negative control IgGl antibody
  • reference PD-1 antibody pembrolizumab analog an analog of reference TGF-PRII antibody TGF1
  • an analog of reference PD-L1-TGF-P TRAP molecule included several bispecific antibodies, negative control IgGl antibody (RSV), reference PD-1 antibody pembrolizumab analog, an analog of reference TGF-PRII antibody TGF1, and an analog of reference PD-L1-TGF-P TRAP molecule.
  • PD-L1 aAPC/CHO-Kl cells artificial Antigen Presenting Cell
  • CHO Chonese Hamster Ovary
  • F-12 medium Thermo Fisher Scientific
  • FBS 10% FBS
  • Hygromycin B Thermo Fisher Scientific
  • G418 Thermo Fisher Scientific
  • Jurkat-PD-l-NFAT effector cells (Nuclear Factor of Activated T cells; Promega) were cultured in RPMI 1640 medium (Thermo Fisher Scientific) supplemented with 10% FBS, 100 pg/mL Hygromycin B (Thermo Fisher Scientific), and 500 pg/mL G418 (Thermo Fisher Scientific). Both PD-L1 aAPC/CHO-Kl cells and Jurkat-PD-1- NF AT effector cells were centrifuged first to remove the culture media, then washed and resuspended with assay medium (RPMI1640 medium with 1% FBS) before cell plating.
  • assay medium RPMI1640 medium with 1% FBS
  • the PD- L1 aAPC/CHO-Kl cells were added to a 384-well white clear-bottom assay plate (CELLCOAT® Tissue Culture Plates, Greiner Bio-One) at 8000 cells per well in 10 pL assay medium.
  • Antibody samples were prepared by serial dilution in phosphate buffered saline (PBS) with 1% FBS and 5 pL/well was transferred to the cell plate.
  • Jurkat-PD-l-NFAT effector cells were then dispensed into each well at 10,000 cells per well in 5 pL assay medium. The assay plate was incubated at 37°C, 5% CO2 for 24 hours.
  • results are shown in Table 3 and Figure 2. All bispecific antibodies inhibited PD-1- mediated T cell inhibition. A number of bispecific antibodies, that are monovalent for PD-1 binding, are equipotent to bivalent monospecific reference PD-1 antibody pembrolizumab analog in the PD-l-NFAT Reporter Assay.
  • Bispecific antibodies were characterized in a Jurkat phospho SMAD2/3 Assay to determine their ability to block TGF-PRII signaling in T cells.
  • the Jurkat phosphoSMAD2/3 Assay involved a comparison of the activity of the bispecific antibodies on Jurkat-PD-l nu11 cells and Jurkat-PD-1 + cells to determine if the bispecific antibodies inhibit TGF-P-induced SMAD2/3 phosphorylation in a PD-1 correlated manner.
  • TGF-PRII antibody TGF1 An analog of reference TGF-PRII antibody TGF1, a TGF-PRIIxRSV bispecific antibody, and a negative control bivalent monospecific IgGl antibody comprising a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 86 and a light chain having an amino acid sequence as set forth in SEQ ID NO: 87 were included as control antibodies.
  • Jurkat-PD-l nu11 ATCC Cat. no. TIB-152
  • Jurkat-PD-1 + cells Promega Cat. no. CS187105
  • RPMI/10%FBS RPMI/10%FBS
  • PD-1 expression was undetectable for the Jurkat-PD-l nu11 cells; the number of PD-1 molecules on the Jurkat-PD-1 + cells was determined at about 4000, using quantibrite bead methodology.
  • Bispecific and control antibodies were added in 6-step serial dilutions (100 pg/ml to 0.001 pg/ml), and the cells were incubated for one hour at 37°C/ 5% CO2. After one hour, human recombinant TGF-pi (R&D Systems Cat.
  • Table 6 shows the fold difference in potency in inhibiting TGF-PRII signaling in Jurkat-PD-l nu11 versus Jurkat-PD-1 + cells of 10 bispecific antibodies.
  • the fold difference of the bispecific antibodies is between 200-11000 fold higher than that of the analog of reference antibody TGF1 in this assay.
  • All bispecific antibodies inhibited TGF- RII signaling in both Jurkat-PD-l nu11 cells and Jurkat-PD-1 + cells.
  • the bispecific antibodies are more potent in inhibiting TGF-PRII signaling in Jurkat-PD-1 + cells than in Jurkat-PD-l nu11 cells, indicating that they inhibit TGF-P-induced SMAD2/3 phosphorylation in a manner correlated to PD-1 expression.
  • All bispecific antibodies require a higher concentration to inhibit TGF-PRII signaling in Jurkat-PD-l nu11 cells than the analog of reference TGF-PRII antibody TGF1.
  • Many bispecific antibodies, that are monovalent for binding to TGF-PRII are superior to the bivalent monospecific analog of reference TGF- PRII antibody TGF1 in inhibiting TGF-PRII signaling in Jurkat-PD-1 + cells.
  • Bispecific antibodies were characterized in a phosphoSMAD2 assay to determine their specificity in blocking TGF-PRII signaling in PD-1 positive T cells.
  • the phosphoSMAD2 assay involved a comparison of the activity of the bispecific antibodies on unstimulated T cells, expressing low levels of PD-1, and stimulated T cells, expressing high levels of PD-1, to determine if the bispecific antibodies inhibit TGF-P-induced SMAD2 phosphorylation in a manner correlated to PD-1 expression.
  • TGF-PRII antibody TGF1 An analog of reference TGF-PRII antibody TGF1, reference PD-1 antibody pembrolizumab, and a negative control bivalent monospecific IgGl antibody comprising a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 86 and a light chain having an amino acid sequence as set forth in SEQ ID NO: 87, were included as positive controls and a negative control, respectively.
  • PBMCs from healthy donors were stimulated with 1 pg/ml anti-CD3 antibody (BD Biosciences# 555336) for 48 hours followed by 16 hour serum deprivation (0.1% FBS).
  • the number of PD-1 molecules on activated CD4 + and CD8 + T cells was determined at about 1000- 2000, using quantibrite bead methodology.
  • Stimulated and unstimulated PBMCs were then incubated with bispecific and control antibodies for 30 min at room temperature.
  • Recombinant human TGF-01 (Cell Signaling #7754-BH) was added at a final concentration of 1 ng/ml and the cells were incubated for another 30 min. Finally, cells were washed twice with PBS and stained for cell surface markers followed by intracellular phosphoSMAD2 staining.
  • the following antibodies were used in staining for flow cytometry: antibodies against human CD45 (clone: HI30; cat557748, BD Biosciences), human GDI lb (clone: MI/70; cat# 563015, BD Biosciences), human CD3 (Clone: UCHT1; cat# 565491, BD Biosciences), human CD4 (Clone: SK3; cat# 563550, BD Biosciences), human CD8 (clone#SKl, cat# 344714, Biolegend) and human phospho-SMAD2 (cat#56532, Cell Signaling). Viability dye (Biolegend # 423114) was used to exclude dead cells during analysis. Cell acquisition was performed under FACSymphony A3 using DIVA software.
  • PBMCs were gated based on size and granularity using FSC-A vs SSC-A to exclude debris. Dead cells were then excluded using fixable viability dye.
  • CD45 positive cells were selected followed by a CD1 lb negative and CD3 positive T cell selection. Finally, CD4 and CD8 positive subsets were gated and phospho-SMAD2 signal was measured in geo mean fluorescence intensity (GMFI) on these subsets. Data analysis was performed using FlowJo software and GrapPad Prism (8.2.0) was used to plot the graphs.
  • Results are shown in Figure 4. All bispecific antibodies inhibited TGF- RII signaling in stimulated CD4 + and CD8 + T cells. In one donor (donor B), the bispecific antibodies did not inhibit TGF- RII signaling in unstimulated CD4 + and CD8 + T cells.
  • bispecific antibody comprising a PD-1 heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 18 and a TGF- RII heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 23 did not inhibit TGF- RII signaling in unstimulated CD4 + and CD8 + T cells and bispecific antibody comprising a PD-1 heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 13 and a TGF- RII heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 47 inhibited TGF- RII signaling in unstimulated CD4 + and CD8 + T cells significantly less potent than in stimulated CD4 + and CD8 + T cells.
  • MLR Mixed Lymphocyte Reaction
  • Bispecific antibodies were characterized in an Exhausted Mixed Lymphocyte Reaction (MLR) Assay to determine their potency in inducing cytokine production by exhausted T cells.
  • MLR Exhausted Mixed Lymphocyte Reaction
  • Antibody samples included several bispecific antibodies, negative control IgGl antibody (RSV), reference PD-1 antibody pembrolizumab, an analog of reference TGF-PRII antibody TGF1, and a combination of reference PD-1 antibody pembrolizumab and an analog of reference TGF-pRII antibody TGF1.
  • RSV negative control IgGl antibody
  • reference PD-1 antibody pembrolizumab an analog of reference TGF-PRII antibody TGF1
  • TGF-PRII antibody TGF1 an analog of reference TGF-PRII antibody TGF1
  • T cell isolation kit (StemCell Technologies, cat# 17951) according to manufacturer’s instructions.
  • T cells were mixed with dendritic cells (DC) from different donors at 10: 1 T cell DC ratio in 96-well U bottom plates.
  • Serial dilutions of antibody samples were added and the plates were incubated for six more days at 37°C/5% CO2. After six days, IFN-y, IL-2, or TNF-a cytokine level in the supernatant was measured using custom MSD kit. GraphPad Prism (8.2.0) was used to plot the graphs.
  • Fig. 5A, C, and D Representative results from two experiments with five donors each are shown in Fig. 5A, C, and D. Results from a further experiment with three donors are shown in Fig. 5B and E.
  • Most of the bispecific antibodies induced similar levels of IFN-y, IL-2, or TNF-a as reference PD-1 antibody pembrolizumab, an analog of reference PD-L1-TGF-P TRAP molecule, or a combination of reference PD-1 antibody pembrolizumab and reference TGF-PRII antibody TGF1.
  • IC50 values of a number of bispecific antibodies from the initial study are shown in Table 7.
  • Bispecific antibodies were characterized in an HEK-BLUE-PD-1 TGF-P Reporter Assay to determine their potency in inhibiting TGF-P-induced signaling in T cells. Stimulation of HEK- BlueTM TGF-P cells or HEK-BlueTM TGF-P -PD-U cells with TGF-P induces the activation of the TGF-p/Smad signaling pathway, leading to the formation of a Smad3/Smad4 complex inducing the production of SEAP.
  • Reagents used Recombinant Human TGF-beta 1 (Human Cell-expressed) Protein, R&D, Cat# 7754-BH.
  • Growth Medium DMEM, 4.5 g/1 glucose, 2 mM L-glutamine, 10% heat- inactivated fetal bovine serum (FBS; 30 min at 56 °C), 100 pg/ml NormocinTM , Pen-Strep (100 U/ml-100 pg/ml).
  • Test Medium DMEM 4.5 g/1 glucose, 2 mM L-glutamine, 0.1% heat-inactivated FBS, Pen-Strep (100 U/ml-100 pg/ml) without NormocinTM, Blasticidin, Hygromycin B, and ZeocinTM.
  • a stable PD-1 -expressing HEK-BlueTM TGF-P cell line was generated as follows: the full length cds for PD-1 was inserted into the mammalian expression vector pD2529-EFM (ATUM) which contains the gene for puromycin resistance. The promoter is a modified EFla. The vector construction was done by ATUM and the sequence was confirmed. See Fig. 10 for the vector map.
  • HEK-BlueTM TGF-P cells Invivogen), in which PD-1 expression was undetectable, were transfected using TransIT-293 transfection reagent (Mirus Bio) following manufacturer’s protocols. Stably transfected cells were selected in HEK-BlueTM TGF- 0 media containing 0.4 ug/ml puromycin.
  • Clones were isolated by limiting dilution and were characterized for PD-1 expression by western blot. One clone was selected based on 1) its stable and homogeneous surface PD-1 expression (one peak in the histogram plot); 2) having similar surface TGF-0RII expression as compared to the parental HEK-BlueTM cell line; and 3) having a similar EC50 as reference antibody TGF1 in a reporter assay.
  • the GMFI of PD-1 in the selected clone was 3272 compared to 5 for the parental cell line and 8 for the isotype control. The number of PD-1 molecules on these cells was determined at about 20000, using quantibrite bead methodology.
  • Antibody samples included several bispecific antibodies, negative control IgGl antibody (RSV), reference PD-1 antibody pembrolizumab, and an analog of reference TGF-0RII antibody TGF1.
  • RSV negative control IgGl antibody
  • PD-1 antibody pembrolizumab reference PD-1 antibody pembrolizumab
  • TGF-0RII antibody TGF1 an analog of reference TGF-0RII antibody TGF1.
  • HEK-BlueTM TGF-0 cells (Invivogen, Catalog code: hkb-tgfb), expressing TGF-0RII, or HEK-BlueTM TGF-0 -PD-1 + cells were seeded in a 96-well flat-bottom plate, 25000 cells per well in test medium. Serial dilutions of antibody samples were added and the cells were incubated for one hour at room temperature; followed by the addition of human recombinant TGF-01 at a final concentration of 1 ng/ml. Cells were incubated at 37°C/ 5% CO2 overnight.
  • Results are shown in Fig. 6 and Table 8.
  • a number of bispecific antibodies demonstrate potent inhibition of TGF-0-induced signaling in a manner correlated to PD-1 expression.
  • Bispecific antibodies were characterized in a Treg Suppression Assay to determine their capability to eliminate or reduce the suppressive effect of regulatory T cells and thereby to induce cytokine production by T cells.
  • Antibody samples included several bispecific antibodies, negative control IgGl antibody (RSV), reference PD-1 antibody pembrolizumab, an analog of reference TGF-PRII antibody TGF1, and a combination of reference PD-1 antibody pembrolizumab and an analog of reference TGF-pRII antibody TGF1.
  • RSV negative control IgGl antibody
  • reference PD-1 antibody pembrolizumab an analog of reference TGF-PRII antibody TGF1
  • TGF-PRII antibody TGF1 an analog of reference TGF-PRII antibody TGF1
  • PBMCs Human PBMCs were isolated from healthy donors by Ficoll-Paque gradient centrifugation. Tregs were isolated using EasySep treg isolation kit (StemCell Technologies, # 18063) according to manufacturer’s instructions. Tregs were mixed with PBMCs from the same donor. Anti-CD3 ab (BD Biosciences # 555336) and anti-CD28 an (BD Biosciences, # 555725) were added to the coculture. Finally, serial dilutions of bispecific antibodies were added and the plates were incubated for three days at 37°C/5% CO2. After three days of incubation, IFN-y and TNF-a cytokine levels in the supernatant were measured using MSD kit (Mesoscale).
  • GraphPad Prism (8.2.0) was used to plot the graphs. Results are shown in Fig. 7 and Table 9. Most of the bispecific antibodies induced similar levels of IFN-y or TNF-a as reference PD-1 antibody pembrolizumab, or a combination of reference PD-1 antibody pembrolizumab and the analog of reference TGF-PRII antibody TGF1.
  • Tumor-associated macrophages of the M2 phenotype inhibit T cell proliferation and cytokine production.
  • Bispecific antibodies were characterized in an M2 macrophage suppression assay to test if they can reverse the inhibitory effect of M2 macrophages on T cell proliferation and IFN-y production.
  • Bispecific antibodies were tested along with negative control IgGl antibody (RSV), an analog of reference TGF-PRII antibody TGF1, an analog of reference PD-L1-TGF-P TRAP molecule, an analog of reference PD-1 antibody nivolumab, commercial reference PD-1 antibody Opdivo (BMS), positive control antibody anti-LILRB2 (Biolegend), rat IgG2a isotype control (Biolegend) and huIgG4 isotype control (Biolegend).
  • RSV negative control IgGl antibody
  • TGF1 an analog of reference PD-L1-TGF-P TRAP molecule
  • BMS commercial reference PD-1 antibody Opdivo
  • positive control antibody anti-LILRB2 Biolegend
  • rat IgG2a isotype control Biolegend
  • huIgG4 isotype control Biolegend
  • PBMC-isolated monocytes from three different healthy donors were differentiated into macrophages with M-CSF for six days and polarized using a specific cocktail of the cytokines IL-4 (20 ng/ml), IL-10 (20 ng/ml) and TGF-0 (20 ng/ml) (+ M-CSF) to obtain M2 macrophages.
  • IL-4 20 ng/ml
  • IL-10 20 ng/ml
  • TGF-0 20 ng/ml
  • the M2 macrophages were activated with LPS (100 ng/ml) for 4 hours.
  • the macrophages were harvested, washed, and seeded in 5-plicates in 96-well plates with autologous CD4 + activated T cells (activated by CD3/CD28 ImmunoCultTM from StemCell technologies) in a 1:5 ratio in the presence of the test or control antibodies at 10 pg/ml concentration.
  • the concentration of secreted IFN-y was measured by ELISA (LEGEND MAXTM Human IFN-y ELISA Kit, Biolegend). Data was analyzed in GraphPad Prism 7.0 using multi-way ANOVA.
  • Results are shown in Fig. 8.
  • a number of bispecific antibodies induced similar or greater levels of IFN-y as compared to the analog of reference PD-1 antibody nivolumab, the analog of reference TGF-PRII antibody TGF1, or the analog of reference PD-L1-TGF-P TRAP molecule.
  • Bispecific antibodies were characterized in vivo in a humanized NSG MDA-MB-231 mouse model to determine their potency in reducing tumor volume.
  • This mouse model was validated using 10 mg/kg of a negative control bivalent monospecific IgGl antibody comprising a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 86 and a light chain having an amino acid sequence as set forth in SEQ ID NO: 87; an analog of reference TGF-PRII antibody TGF1 (10 mg/kg); reference PD-1 antibody pembrolizumab (10 mg/kg); a combination of analog of reference TGF-PRII antibody TGF1 (10 mg/kg) and reference PD-1 antibody pembrolizumab (10 mg/kg); and an analog of reference PD-L1-TGF-P TRAP molecule (10 mg/kg). Results are shown in Fig. 9A.
  • mice Humanized CD34 NSG mice were inoculated subcutaneously with a total of 3 x 10 6 MDA-MB-231 tumor cells suspended in 100 pl of serum-free culture medium and matrigel matrix (Corning) in equal volumes. After tumors were established (80-100 mm 3 ), the mice were randomized into the following treatment groups:
  • Negative control bivalent monospecific IgGl antibody comprising a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 86 and a light chain having an amino acid sequence as set forth in SEQ ID NO: 87 (10 mg/kg);
  • Bispecific antibody comprising a TGF-PRII binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 43 and a PD-1 binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 9 (1 mg/kg);
  • Bispecific antibody comprising a TGF-PRII binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 43 and a PD-1 binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 9 (10 mg/kg);
  • Bispecific antibody comprising a TGF-PRII binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO:43 and a PD-1 binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 19 (1 mg/kg);
  • Bispecific antibody comprising a TGF-PRII binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 43 and a PD-1 binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 19 (10 mg/kg);
  • Bispecific antibody comprising a TGF-PRII binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 23 and a PD-1 binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 14 (1 mg/kg);
  • Bispecific antibody comprising a TGF-PRII binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 23 and a PD-1 binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 14 (10 mg/kg);
  • Bispecific antibody comprising a TGF-PRII binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 23 and a PD-1 binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 19 (1 mg/kg);
  • Bispecific antibody comprising a TGF-PRII binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 23 and a PD-1 binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 19 (10 mg/kg);
  • Bispecific antibody comprising a TGF-PRII binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 39 and a PD-1 binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 9 (10 mg/kg);
  • Bispecific antibody comprising a TGF-PRII binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 27 and a PD-1 binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 9 (10 mg/kg);
  • Bispecific antibody comprising a TGF-PRII binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 23 and a PD-1 binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 18 (10 mg/kg);
  • Bispecific antibody comprising a TGF-PRII binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 47 and a PD-1 binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 13 (10 mg/kg).
  • Bispecific antibody comprising a TGF-PRII binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 23 and a PD-1 binding domain with a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO: 18 was characterized at two different dose levels, 1 mg/kg and 10 mg/kg, in vivo in a humanized NSG MDA-MB-231 mouse model, as described in Example 10.
  • Negative control bivalent monospecific IgGl antibody comprising a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 86 and a light chain having an amino acid sequence as set forth in SEQ ID NO: 87 was included at 10 mg/kg.
  • Results are shown in Fig. 11.
  • the bispecific antibody induced a significant anti-tumor response at both dose levels.
  • SEQ ID NO: 78 Heavy chain reference PD-1 antibody pembrolizumab
  • SEQ ID NO: 80 Heavy chain reference PD-L1-TGF-P TRAP molecule analog EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMWVRQAPGKGLEWVSSIYPSGGITF YADTVI ⁇ GRFTISRDNSI ⁇ NTLYLQMNSLRAEDTAVYYCARII ⁇ LGTVTTVDYWGQGTLVT VS SAS TKGPS VFPL APS SKS TSGGTA ALGCLVKD YFPEPVTVS WN SG A ETSG VHTFP A VL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPI ⁇ PI ⁇ DTLMISRTPEVTCVVVDVSHEDPEVI ⁇ FNWYVDGVEVHNAI ⁇ TI ⁇ PRE EQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSRE
  • SEQ ID NO: 85 extracellular domain of isoform B of human TGF-PRII
  • GVHTFPAVLQS GLYSLS S VVTVPS S SLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
  • DIQMTQ SPS SLS AS VGDRVTITCRAS QSIS S YLNWYQQKPGKAPKLLIYAAS SLQSGVPSR FSGSGTDFTLTISSLQPEDFATYYCQQSYSTPPTFGQGTKVEIKRTVAAPSVFIFPPSDE QLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS KADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
  • SEQ ID NO: 96 Heavy chain reference nivolumab analog antibody

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Veterinary Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/EP2022/082377 2021-11-19 2022-11-18 Multispecific binding moieties comprising pd-1 and tgf-brii binding domains Ceased WO2023089083A1 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
EP22818694.6A EP4433505A1 (en) 2021-11-19 2022-11-18 Multispecific binding moieties comprising pd-1 and tgf-brii binding domains
IL312214A IL312214A (en) 2021-11-19 2022-11-18 Multispecific binding moieties comprising pd-1 and tgf-brii binding domains
PE2024001077A PE20241477A1 (es) 2021-11-19 2022-11-18 Unidades de union multiespecificas que comprenden los dominios de union a pd-1 y tgf-brii
CN202411831660.4A CN119613560A (zh) 2021-11-19 2022-11-18 包含PD-1和TGF-βRII结合域的多特异性结合部分
CA3231649A CA3231649A1 (en) 2021-11-19 2022-11-18 Multispecific binding moieties comprising pd-1 and tgf-brii binding domains
CN202280076849.XA CN118265725A (zh) 2021-11-19 2022-11-18 包含PD-1和TGF-βRII结合域的多特异性结合部分
JP2024524389A JP2024542879A (ja) 2021-11-19 2022-11-18 Pd-1およびtgf-brii結合ドメインを含む多重特異性結合部位
KR1020247019354A KR20240101664A9 (ko) 2021-11-19 2022-11-18 Pd-1 및 tgf-brii 결합 도메인을 포함하는 다중특이성 결합 모이어티
MX2024006018A MX2024006018A (es) 2021-11-19 2022-11-18 Unidades de union multiespecificas que comprenden los dominios de union a pd-1 y tgf-brii.
CR20240201A CR20240201A (es) 2021-11-19 2022-11-18 Unidades de unión multiespecíficas que comprenden los dominios de unión a pd-1 y tgf-brii
AU2022389596A AU2022389596A1 (en) 2021-11-19 2022-11-18 Multispecific binding moieties comprising pd-1 and tgf-brii binding domains
CONC2024/0006325A CO2024006325A2 (es) 2021-11-19 2024-05-17 Unidades de unión multiespecíficas que comprenden los dominios de unión a pd-1 y tgf-brii
ECSENADI202439278A ECSP24039278A (es) 2021-11-19 2024-05-21 Unidades de unión multiespecíficas que comprenden los dominios de unión a pd-1 y tgf-brii

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
NL2029844 2021-11-19
NL2029844 2021-11-19

Publications (1)

Publication Number Publication Date
WO2023089083A1 true WO2023089083A1 (en) 2023-05-25

Family

ID=80625531

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2022/082377 Ceased WO2023089083A1 (en) 2021-11-19 2022-11-18 Multispecific binding moieties comprising pd-1 and tgf-brii binding domains

Country Status (18)

Country Link
US (1) US20230159645A1 (https=)
EP (1) EP4433505A1 (https=)
JP (1) JP2024542879A (https=)
KR (1) KR20240101664A9 (https=)
CN (2) CN118265725A (https=)
AR (1) AR127714A1 (https=)
AU (1) AU2022389596A1 (https=)
CA (1) CA3231649A1 (https=)
CL (1) CL2024001410A1 (https=)
CO (1) CO2024006325A2 (https=)
CR (1) CR20240201A (https=)
EC (1) ECSP24039278A (https=)
IL (1) IL312214A (https=)
MX (1) MX2024006018A (https=)
PE (1) PE20241477A1 (https=)
TW (1) TW202328180A (https=)
UY (1) UY40028A (https=)
WO (1) WO2023089083A1 (https=)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024215978A1 (en) * 2023-04-14 2024-10-17 Incyte Corporation Use of an anti-tgfbetar2/pd-1 bispecific antibody to treat cancer

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013157954A1 (en) 2012-04-20 2013-10-24 Merus B.V. Methods and means for the production of ig-like molecules
WO2019009727A1 (en) * 2017-07-06 2019-01-10 Merus N.V. ANTI-PD1 ANTI-TIM3 BISPECIFIC ANTIBODIES
US20190330375A1 (en) * 2017-01-07 2019-10-31 Merck Patent Gmbh Dosing regimens and dosage forms for targeted tgf-b inhibition
WO2021133167A1 (en) * 2019-12-24 2021-07-01 Merus N.V. Tgf-beta-rii binding proteins
WO2021218684A1 (zh) * 2020-04-29 2021-11-04 三生国健药业(上海)股份有限公司 四价双特异性抗体、其制备方法和用途
WO2022099090A1 (en) * 2020-11-06 2022-05-12 Xencor, Inc. Heterodimeric antibodies that bind tgfbrii

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2018296067B2 (en) * 2017-07-06 2021-06-10 Merus B.V. Binding molecules that modulate a biological activity expressed by a cell

Patent Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013157954A1 (en) 2012-04-20 2013-10-24 Merus B.V. Methods and means for the production of ig-like molecules
WO2013157953A1 (en) 2012-04-20 2013-10-24 Merus B.V. Methods and means for the production of ig-like molecules
US20190330375A1 (en) * 2017-01-07 2019-10-31 Merck Patent Gmbh Dosing regimens and dosage forms for targeted tgf-b inhibition
WO2019009727A1 (en) * 2017-07-06 2019-01-10 Merus N.V. ANTI-PD1 ANTI-TIM3 BISPECIFIC ANTIBODIES
WO2021133167A1 (en) * 2019-12-24 2021-07-01 Merus N.V. Tgf-beta-rii binding proteins
WO2021218684A1 (zh) * 2020-04-29 2021-11-04 三生国健药业(上海)股份有限公司 四价双特异性抗体、其制备方法和用途
WO2022099090A1 (en) * 2020-11-06 2022-05-12 Xencor, Inc. Heterodimeric antibodies that bind tgfbrii

Non-Patent Citations (11)

* Cited by examiner, † Cited by third party
Title
"Sequences of Proteins of Immunological Interest", 1987, NATIONAL INSTITUTE OF HEALTH
BERG, J.TYMOCZKO, J.STRYER, L.STRYER, L.: "Biochemistry", 2007, W.H. FREEMAN
KRUSKAL, J. B.: "Time warps, string edits and macromolecules: the theory and practice of sequence comparison", 1983, ADDISON WESLEY, article "An overview of sequence comparison", pages: 1 - 44
LIU LIQIN ET AL: "Abstract 693: ASKG843, a bifunctional fusion protein of PD1/TGF-[beta]RII, demonstrates potent in vitro/in vivo activities, and excellent pharmacokinetic properties in non-human primates (NHPs) with good safety profiles", vol. 81(13_Suppl), 1 July 2021 (2021-07-01), Philadelphia (PA), XP055937572, Retrieved from the Internet <URL:https://aacrjournals.org/cancerres/article/81/13_Supplement/693/669454/Abstract-693-ASKG843-a-bifunctional-fusion-protein> *
LIU S ET AL., SIGNAL TRANSDUCTION AND TARGETED THERAPY, 2021
MASSAGUE J: "TGFØ signalling in context", NAT REV MOL CELL BIOL., vol. 13, no. 10, October 2012 (2012-10-01), pages 616 - 30
NEEDLEMAN, S. B.WUNSCH, C. D., J. MOL. BIOL., vol. 48, 1970, pages 443 - 453
NELSON, DAVID L.MICHAEL M. COX.: "Lehninger Principles of Biochemistry", 2017, W.H. FREEMAN
RIBAS A. ET AL.: "Association of Pembrolizumab With Tumor Response and Survival Among Patients With Advanced Melanoma", JAMA, vol. 315, no. 15, 19 April 2016 (2016-04-19), pages 1600 - 9
RICE, PLONGDENJBLEASBY, A: "EMBOSS: The European Molecular Biology Open Software Suite", TRENDS IN GENETICS, vol. 16, no. 6, 2000, pages 276,277, XP004200114, Retrieved from the Internet <URL:http://emboss.bioinformatics.nl> DOI: 10.1016/S0168-9525(00)02024-2
TABASINEZHAD M ET AL.: "Trends in therapeutic antibody affinity maturation: From in-vitro towards next-generation sequencing approaches", IMMUNOL LETT, vol. 212, August 2019 (2019-08-01), pages 106 - 113, XP085738142, DOI: 10.1016/j.imlet.2019.06.009

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024215978A1 (en) * 2023-04-14 2024-10-17 Incyte Corporation Use of an anti-tgfbetar2/pd-1 bispecific antibody to treat cancer

Also Published As

Publication number Publication date
CO2024006325A2 (es) 2024-06-27
CL2024001410A1 (es) 2024-08-30
US20230159645A1 (en) 2023-05-25
UY40028A (es) 2023-05-31
AU2022389596A1 (en) 2024-05-30
CN118265725A (zh) 2024-06-28
PE20241477A1 (es) 2024-07-17
ECSP24039278A (es) 2024-07-31
KR20240101664A (ko) 2024-07-02
JP2024542879A (ja) 2024-11-18
MX2024006018A (es) 2024-07-29
EP4433505A1 (en) 2024-09-25
AR127714A1 (es) 2024-02-21
IL312214A (en) 2024-06-01
CN119613560A (zh) 2025-03-14
TW202328180A (zh) 2023-07-16
CR20240201A (es) 2024-07-15
CA3231649A1 (en) 2023-05-25
KR20240101664A9 (ko) 2025-12-10

Similar Documents

Publication Publication Date Title
JP7092317B2 (ja) 抗ガレクチン-9抗体及びその使用
KR102309950B1 (ko) 체크포인트 억제제 이중특이적 항체
JP6827415B2 (ja) 疾患の処置のための併用療法
US10975155B2 (en) CD40L-Fc fusion polypeptides and methods of use thereof
JP6847037B2 (ja) 抗cd73抗体とa2a受容体阻害薬とを含む併用治療薬及びその使用
JP6649941B2 (ja) Fstl1を利用した抗がん剤・転移抑制剤およびその併用剤
TW201833135A (zh) 抗-TGF-β抗體及其用途
JP2021524282A (ja) ホスファターゼ動員による受容体の阻害
TW201625270A (zh) 用於治療贅瘤形成的治療組合及方法
CA3059447A1 (en) Anti-pd-l1 antibody and use thereof
US20190284262A1 (en) T cell receptor-like antibodies specific for foxp3-derived peptides
EP4332116A1 (en) Anti-cntn4-specific antibodies and use thereof
CN118715242A (zh) 包含b7-h3结合多肽的组合物和方法
CN110343180B (zh) 抗ctla-4抗体及其应用
US20230132385A9 (en) Antibodies specific to ctla-4 and uses thereof
JP2024534795A (ja) 二重特異性抗体およびその使用
CN110662764B (zh) 抗程序性死亡配体1(pd-l1)抗体及其治疗用途
US20230159645A1 (en) Multispecific binding moieties comprising pd-1 and tgf-brii binding domains
EP4549572A1 (en) Fusion protein
US20210260159A1 (en) CD40L-Fc FUSION POLYPEPTIDES AND METHODS OF USE THEREOF
KR102568885B1 (ko) 항-tgf-베타 항체 및 이의 용도
CA3218832A1 (en) Combined therapy using anti-cd300c antibody
HK40082759B (zh) 抗半乳凝素-9抗体及其用途
HK40110611A (zh) 癌症的组合治疗中针对cd40和cd137的多特异性结合剂

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22818694

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 3231649

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 312214

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2024524389

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2401002780

Country of ref document: TH

WWE Wipo information: entry into national phase

Ref document number: 001077-2024

Country of ref document: PE

Ref document number: 2022389596

Country of ref document: AU

Ref document number: AU2022389596

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: NC2024/0006325

Country of ref document: CO

Ref document number: 12024551172

Country of ref document: PH

Ref document number: 202280076849.X

Country of ref document: CN

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112024009800

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2022389596

Country of ref document: AU

Date of ref document: 20221118

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 11202402666S

Country of ref document: SG

WWE Wipo information: entry into national phase

Ref document number: 1020247019354

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 202437044966

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2022818694

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022818694

Country of ref document: EP

Effective date: 20240619

WWP Wipo information: published in national office

Ref document number: NC2024/0006325

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 112024009800

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20240517