WO2023061985A2 - Compositions comprising modified rna encoding vegf-a and methods of use - Google Patents
Compositions comprising modified rna encoding vegf-a and methods of use Download PDFInfo
- Publication number
- WO2023061985A2 WO2023061985A2 PCT/EP2022/078199 EP2022078199W WO2023061985A2 WO 2023061985 A2 WO2023061985 A2 WO 2023061985A2 EP 2022078199 W EP2022078199 W EP 2022078199W WO 2023061985 A2 WO2023061985 A2 WO 2023061985A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- composition
- patient
- administration
- optionally
- months
- Prior art date
Links
- 239000000203 mixture Substances 0.000 title claims abstract description 218
- 238000000034 method Methods 0.000 title claims abstract description 107
- 102000009524 Vascular Endothelial Growth Factor A Human genes 0.000 title claims abstract description 76
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 title claims abstract description 76
- 230000002861 ventricular Effects 0.000 claims abstract description 44
- 230000033001 locomotion Effects 0.000 claims abstract description 18
- 108091032973 (ribonucleotides)n+m Proteins 0.000 claims description 104
- 230000017531 blood circulation Effects 0.000 claims description 63
- 230000002107 myocardial effect Effects 0.000 claims description 63
- 230000001965 increasing effect Effects 0.000 claims description 60
- 238000011282 treatment Methods 0.000 claims description 45
- 108020004999 messenger RNA Proteins 0.000 claims description 41
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 claims description 37
- 210000002216 heart Anatomy 0.000 claims description 32
- 238000002347 injection Methods 0.000 claims description 27
- 239000007924 injection Substances 0.000 claims description 27
- 230000000302 ischemic effect Effects 0.000 claims description 25
- 125000003729 nucleotide group Chemical group 0.000 claims description 25
- 208000010125 myocardial infarction Diseases 0.000 claims description 24
- 239000002773 nucleotide Substances 0.000 claims description 24
- 238000001356 surgical procedure Methods 0.000 claims description 24
- 239000000902 placebo Substances 0.000 claims description 23
- 229940068196 placebo Drugs 0.000 claims description 23
- 230000000747 cardiac effect Effects 0.000 claims description 18
- 238000002592 echocardiography Methods 0.000 claims description 17
- 210000004165 myocardium Anatomy 0.000 claims description 17
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 claims description 16
- 230000000284 resting effect Effects 0.000 claims description 16
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 claims description 13
- 206010019280 Heart failures Diseases 0.000 claims description 13
- 208000038002 heart failure with reduced ejection fraction Diseases 0.000 claims description 13
- 230000003483 hypokinetic effect Effects 0.000 claims description 13
- 239000011780 sodium chloride Substances 0.000 claims description 13
- 239000000872 buffer Substances 0.000 claims description 12
- 230000004064 dysfunction Effects 0.000 claims description 12
- 208000031225 myocardial ischemia Diseases 0.000 claims description 12
- 108700026244 Open Reading Frames Proteins 0.000 claims description 11
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 11
- 230000000694 effects Effects 0.000 claims description 11
- 210000004351 coronary vessel Anatomy 0.000 claims description 9
- 208000038003 heart failure with preserved ejection fraction Diseases 0.000 claims description 7
- 210000005240 left ventricle Anatomy 0.000 claims description 6
- 230000006872 improvement Effects 0.000 claims description 5
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 4
- 238000013184 cardiac magnetic resonance imaging Methods 0.000 claims description 4
- 206010003119 arrhythmia Diseases 0.000 claims description 3
- 238000002583 angiography Methods 0.000 claims description 2
- 208000019622 heart disease Diseases 0.000 abstract description 5
- 238000002560 therapeutic procedure Methods 0.000 abstract description 5
- MWUXSHHQAYIFBG-UHFFFAOYSA-N Nitric oxide Chemical compound O=[N] MWUXSHHQAYIFBG-UHFFFAOYSA-N 0.000 description 40
- 238000002600 positron emission tomography Methods 0.000 description 35
- 230000035882 stress Effects 0.000 description 35
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 30
- 206010002383 Angina Pectoris Diseases 0.000 description 21
- 230000004048 modification Effects 0.000 description 19
- 238000012986 modification Methods 0.000 description 19
- 201000010099 disease Diseases 0.000 description 18
- 108090000765 processed proteins & peptides Proteins 0.000 description 18
- 230000002411 adverse Effects 0.000 description 15
- 239000013317 conjugated microporous polymer Substances 0.000 description 15
- 102000004196 processed proteins & peptides Human genes 0.000 description 15
- 238000011194 good manufacturing practice Methods 0.000 description 14
- 229920001184 polypeptide Polymers 0.000 description 14
- 239000003814 drug Substances 0.000 description 13
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 12
- IERHLVCPSMICTF-XVFCMESISA-N CMP group Chemical group P(=O)(O)(O)OC[C@@H]1[C@H]([C@H]([C@@H](O1)N1C(=O)N=C(N)C=C1)O)O IERHLVCPSMICTF-XVFCMESISA-N 0.000 description 12
- 208000035475 disorder Diseases 0.000 description 12
- 229920006227 ethylene-grafted-maleic anhydride Polymers 0.000 description 12
- 210000003643 myeloid progenitor cell Anatomy 0.000 description 12
- 229940079593 drug Drugs 0.000 description 11
- 230000008859 change Effects 0.000 description 10
- 210000001519 tissue Anatomy 0.000 description 10
- 239000003795 chemical substances by application Substances 0.000 description 9
- 230000010412 perfusion Effects 0.000 description 9
- 208000031229 Cardiomyopathies Diseases 0.000 description 8
- 108090000623 proteins and genes Proteins 0.000 description 8
- 102000004169 proteins and genes Human genes 0.000 description 8
- 208000024891 symptom Diseases 0.000 description 8
- 210000004027 cell Anatomy 0.000 description 7
- 102000040430 polynucleotide Human genes 0.000 description 7
- 108091033319 polynucleotide Proteins 0.000 description 7
- 239000002157 polynucleotide Substances 0.000 description 7
- 108091036407 Polyadenylation Proteins 0.000 description 6
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 6
- 150000001875 compounds Chemical class 0.000 description 6
- 238000002565 electrocardiography Methods 0.000 description 6
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 6
- 150000007523 nucleic acids Chemical class 0.000 description 6
- 229920000642 polymer Polymers 0.000 description 6
- 108020005345 3' Untranslated Regions Proteins 0.000 description 5
- 108020003589 5' Untranslated Regions Proteins 0.000 description 5
- 241000282414 Homo sapiens Species 0.000 description 5
- 108010029485 Protein Isoforms Proteins 0.000 description 5
- 102000001708 Protein Isoforms Human genes 0.000 description 5
- 208000026935 allergic disease Diseases 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 238000003384 imaging method Methods 0.000 description 5
- 229910052816 inorganic phosphate Inorganic materials 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 238000005259 measurement Methods 0.000 description 5
- 102000039446 nucleic acids Human genes 0.000 description 5
- 108020004707 nucleic acids Proteins 0.000 description 5
- GJTBSTBJLVYKAU-XVFCMESISA-N 2-thiouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=S)NC(=O)C=C1 GJTBSTBJLVYKAU-XVFCMESISA-N 0.000 description 4
- 206010020751 Hypersensitivity Diseases 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 4
- 206010047281 Ventricular arrhythmia Diseases 0.000 description 4
- 150000001413 amino acids Chemical class 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- FPUGCISOLXNPPC-IOSLPCCCSA-N cordysinin B Chemical compound CO[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(N)=C2N=C1 FPUGCISOLXNPPC-IOSLPCCCSA-N 0.000 description 4
- 208000029078 coronary artery disease Diseases 0.000 description 4
- 230000002526 effect on cardiovascular system Effects 0.000 description 4
- 230000000670 limiting effect Effects 0.000 description 4
- 239000002777 nucleoside Substances 0.000 description 4
- 150000003833 nucleoside derivatives Chemical class 0.000 description 4
- 239000000546 pharmaceutical excipient Substances 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- OGHAROSJZRTIOK-KQYNXXCUSA-O 7-methylguanosine Chemical compound C1=2N=C(N)NC(=O)C=2[N+](C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OGHAROSJZRTIOK-KQYNXXCUSA-O 0.000 description 3
- 206010003658 Atrial Fibrillation Diseases 0.000 description 3
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 3
- 101000808011 Homo sapiens Vascular endothelial growth factor A Proteins 0.000 description 3
- 230000004913 activation Effects 0.000 description 3
- 229960005305 adenosine Drugs 0.000 description 3
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 230000015788 innate immune response Effects 0.000 description 3
- 238000002483 medication Methods 0.000 description 3
- 229910052760 oxygen Inorganic materials 0.000 description 3
- 239000001301 oxygen Substances 0.000 description 3
- 230000037361 pathway Effects 0.000 description 3
- 239000008194 pharmaceutical composition Substances 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- GRYSXUXXBDSYRT-WOUKDFQISA-N (2r,3r,4r,5r)-2-(hydroxymethyl)-4-methoxy-5-[6-(methylamino)purin-9-yl]oxolan-3-ol Chemical compound C1=NC=2C(NC)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1OC GRYSXUXXBDSYRT-WOUKDFQISA-N 0.000 description 2
- OTFGHFBGGZEXEU-PEBGCTIMSA-N 1-[(2r,3r,4r,5r)-4-hydroxy-5-(hydroxymethyl)-3-methoxyoxolan-2-yl]-3-methylpyrimidine-2,4-dione Chemical compound CO[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)N(C)C(=O)C=C1 OTFGHFBGGZEXEU-PEBGCTIMSA-N 0.000 description 2
- QPHRQMAYYMYWFW-FJGDRVTGSA-N 1-[(2r,3s,4r,5r)-3-fluoro-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]pyrimidine-2,4-dione Chemical compound O[C@]1(F)[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 QPHRQMAYYMYWFW-FJGDRVTGSA-N 0.000 description 2
- UHDGCWIWMRVCDJ-UHFFFAOYSA-N 1-beta-D-Xylofuranosyl-NH-Cytosine Natural products O=C1N=C(N)C=CN1C1C(O)C(O)C(CO)O1 UHDGCWIWMRVCDJ-UHFFFAOYSA-N 0.000 description 2
- FPUGCISOLXNPPC-UHFFFAOYSA-N 2'-O-Methyladenosine Natural products COC1C(O)C(CO)OC1N1C2=NC=NC(N)=C2N=C1 FPUGCISOLXNPPC-UHFFFAOYSA-N 0.000 description 2
- RFCQJGFZUQFYRF-ZOQUXTDFSA-N 2'-O-methylcytidine Chemical compound CO[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)N=C(N)C=C1 RFCQJGFZUQFYRF-ZOQUXTDFSA-N 0.000 description 2
- SXUXMRMBWZCMEN-ZOQUXTDFSA-N 2'-O-methyluridine Chemical compound CO[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 SXUXMRMBWZCMEN-ZOQUXTDFSA-N 0.000 description 2
- MXHRCPNRJAMMIM-BBVRLYRLSA-N 2'-deoxyuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 MXHRCPNRJAMMIM-BBVRLYRLSA-N 0.000 description 2
- ZLOIGESWDJYCTF-UHFFFAOYSA-N 4-Thiouridine Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=S)C=C1 ZLOIGESWDJYCTF-UHFFFAOYSA-N 0.000 description 2
- ZLOIGESWDJYCTF-XVFCMESISA-N 4-thiouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=S)C=C1 ZLOIGESWDJYCTF-XVFCMESISA-N 0.000 description 2
- ZAYHVCMSTBRABG-UHFFFAOYSA-N 5-Methylcytidine Natural products O=C1N=C(N)C(C)=CN1C1C(O)C(O)C(CO)O1 ZAYHVCMSTBRABG-UHFFFAOYSA-N 0.000 description 2
- IPRQAJTUSRLECG-UHFFFAOYSA-N 5-[6-(dimethylamino)purin-9-yl]-2-(hydroxymethyl)-4-methoxyoxolan-3-ol Chemical compound COC1C(O)C(CO)OC1N1C2=NC=NC(N(C)C)=C2N=C1 IPRQAJTUSRLECG-UHFFFAOYSA-N 0.000 description 2
- ZAYHVCMSTBRABG-JXOAFFINSA-N 5-methylcytidine Chemical compound O=C1N=C(N)C(C)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 ZAYHVCMSTBRABG-JXOAFFINSA-N 0.000 description 2
- AOKQNZVJJXPUQA-KQYNXXCUSA-M 7-methylguanosine 5'-phosphate(1-) Chemical compound C1=2N=C(N)NC(=O)C=2[N+](C)=CN1[C@@H]1O[C@H](COP([O-])([O-])=O)[C@@H](O)[C@H]1O AOKQNZVJJXPUQA-KQYNXXCUSA-M 0.000 description 2
- 206010002388 Angina unstable Diseases 0.000 description 2
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 206010015856 Extrasystoles Diseases 0.000 description 2
- 102000012673 Follicle Stimulating Hormone Human genes 0.000 description 2
- 108010079345 Follicle Stimulating Hormone Proteins 0.000 description 2
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 description 2
- 241000700721 Hepatitis B virus Species 0.000 description 2
- 206010020565 Hyperaemia Diseases 0.000 description 2
- 206010020772 Hypertension Diseases 0.000 description 2
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 2
- IYYIBFCJILKPCO-WOUKDFQISA-O N(2),N(2),N(7)-trimethylguanosine Chemical compound C1=2NC(N(C)C)=NC(=O)C=2N(C)C=[N+]1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O IYYIBFCJILKPCO-WOUKDFQISA-O 0.000 description 2
- ZBYRSRLCXTUFLJ-IOSLPCCCSA-O N(2),N(7)-dimethylguanosine Chemical compound CNC=1NC(C=2[N+](=CN([C@H]3[C@H](O)[C@H](O)[C@@H](CO)O3)C=2N=1)C)=O ZBYRSRLCXTUFLJ-IOSLPCCCSA-O 0.000 description 2
- VQAYFKKCNSOZKM-IOSLPCCCSA-N N(6)-methyladenosine Chemical compound C1=NC=2C(NC)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O VQAYFKKCNSOZKM-IOSLPCCCSA-N 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 208000005228 Pericardial Effusion Diseases 0.000 description 2
- 206010034476 Pericardial haemorrhage Diseases 0.000 description 2
- 229930185560 Pseudouridine Natural products 0.000 description 2
- PTJWIQPHWPFNBW-UHFFFAOYSA-N Pseudouridine C Natural products OC1C(O)C(CO)OC1C1=CNC(=O)NC1=O PTJWIQPHWPFNBW-UHFFFAOYSA-N 0.000 description 2
- 108091030071 RNAI Proteins 0.000 description 2
- 241000282887 Suidae Species 0.000 description 2
- 108091023045 Untranslated Region Proteins 0.000 description 2
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 2
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 2
- 230000007815 allergy Effects 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- QGZKDVFQNNGYKY-BJUDXGSMSA-N ammonia-(13)N Chemical compound [13NH3] QGZKDVFQNNGYKY-BJUDXGSMSA-N 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 230000006793 arrhythmia Effects 0.000 description 2
- 210000001367 artery Anatomy 0.000 description 2
- 230000027746 artery morphogenesis Effects 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- WGDUUQDYDIIBKT-UHFFFAOYSA-N beta-Pseudouridine Natural products OC1OC(CN2C=CC(=O)NC2=O)C(O)C1O WGDUUQDYDIIBKT-UHFFFAOYSA-N 0.000 description 2
- 230000002146 bilateral effect Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 230000036772 blood pressure Effects 0.000 description 2
- 230000036770 blood supply Effects 0.000 description 2
- 238000009534 blood test Methods 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- 238000007385 chemical modification Methods 0.000 description 2
- 238000002586 coronary angiography Methods 0.000 description 2
- 210000003748 coronary sinus Anatomy 0.000 description 2
- DDRJAANPRJIHGJ-UHFFFAOYSA-N creatinine Chemical compound CN1CC(=O)NC1=N DDRJAANPRJIHGJ-UHFFFAOYSA-N 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 231100000517 death Toxicity 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- MXHRCPNRJAMMIM-UHFFFAOYSA-N desoxyuridine Natural products C1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 MXHRCPNRJAMMIM-UHFFFAOYSA-N 0.000 description 2
- IZEKFCXSFNUWAM-UHFFFAOYSA-N dipyridamole Chemical compound C=12N=C(N(CCO)CCO)N=C(N3CCCCC3)C2=NC(N(CCO)CCO)=NC=1N1CCCCC1 IZEKFCXSFNUWAM-UHFFFAOYSA-N 0.000 description 2
- 229960002768 dipyridamole Drugs 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- 230000007717 exclusion Effects 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 229940028334 follicle stimulating hormone Drugs 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 230000009368 gene silencing by RNA Effects 0.000 description 2
- 230000004217 heart function Effects 0.000 description 2
- 201000002303 hemopericardium Diseases 0.000 description 2
- 102000058223 human VEGFA Human genes 0.000 description 2
- 230000009610 hypersensitivity Effects 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 239000011777 magnesium Substances 0.000 description 2
- 229910052749 magnesium Inorganic materials 0.000 description 2
- 238000002595 magnetic resonance imaging Methods 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 239000002105 nanoparticle Substances 0.000 description 2
- 125000003835 nucleoside group Chemical group 0.000 description 2
- 210000003240 portal vein Anatomy 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- PTJWIQPHWPFNBW-GBNDHIKLSA-N pseudouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1C1=CNC(=O)NC1=O PTJWIQPHWPFNBW-GBNDHIKLSA-N 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- DWRXFEITVBNRMK-JXOAFFINSA-N ribothymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 DWRXFEITVBNRMK-JXOAFFINSA-N 0.000 description 2
- 238000002603 single-photon emission computed tomography Methods 0.000 description 2
- 239000001509 sodium citrate Substances 0.000 description 2
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical group O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 238000003325 tomography Methods 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 210000000596 ventricular septum Anatomy 0.000 description 2
- RFCQJGFZUQFYRF-UHFFFAOYSA-N 2'-O-Methylcytidine Natural products COC1C(O)C(CO)OC1N1C(=O)N=C(N)C=C1 RFCQJGFZUQFYRF-UHFFFAOYSA-N 0.000 description 1
- OVYNGSFVYRPRCG-UHFFFAOYSA-N 2'-O-Methylguanosine Natural products COC1C(O)C(CO)OC1N1C(NC(N)=NC2=O)=C2N=C1 OVYNGSFVYRPRCG-UHFFFAOYSA-N 0.000 description 1
- SXUXMRMBWZCMEN-UHFFFAOYSA-N 2'-O-methyl uridine Natural products COC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 SXUXMRMBWZCMEN-UHFFFAOYSA-N 0.000 description 1
- OVYNGSFVYRPRCG-KQYNXXCUSA-N 2'-O-methylguanosine Chemical compound CO[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=C(N)NC2=O)=C2N=C1 OVYNGSFVYRPRCG-KQYNXXCUSA-N 0.000 description 1
- NOHUXXDTQJPXSB-UHFFFAOYSA-N 2-acetyloxybenzoic acid;2-[[2-[bis(2-hydroxyethyl)amino]-4,8-di(piperidin-1-yl)pyrimido[5,4-d]pyrimidin-6-yl]-(2-hydroxyethyl)amino]ethanol Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O.C=12N=C(N(CCO)CCO)N=C(N3CCCCC3)C2=NC(N(CCO)CCO)=NC=1N1CCCCC1 NOHUXXDTQJPXSB-UHFFFAOYSA-N 0.000 description 1
- XRWXMNBDACOLJY-JTFADIMSSA-N 2-amino-9-[(2r,3r,4s,5r)-2-ethyl-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-3h-purin-6-one Chemical compound C1=NC(C(NC(N)=N2)=O)=C2N1[C@]1(CC)O[C@H](CO)[C@@H](O)[C@H]1O XRWXMNBDACOLJY-JTFADIMSSA-N 0.000 description 1
- 108020005065 3' Flanking Region Proteins 0.000 description 1
- 108020005029 5' Flanking Region Proteins 0.000 description 1
- 239000005541 ACE inhibitor Substances 0.000 description 1
- 125000003345 AMP group Chemical group 0.000 description 1
- 201000011244 Acrocallosal syndrome Diseases 0.000 description 1
- 208000004476 Acute Coronary Syndrome Diseases 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- 208000007848 Alcoholism Diseases 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 206010001928 Amenorrhoea Diseases 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 108091023037 Aptamer Proteins 0.000 description 1
- 206010003671 Atrioventricular Block Diseases 0.000 description 1
- 208000020446 Cardiac disease Diseases 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 208000006545 Chronic Obstructive Pulmonary Disease Diseases 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-PSQAKQOGSA-N Cytidine Natural products O=C1N=C(N)C=CN1[C@@H]1[C@@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-PSQAKQOGSA-N 0.000 description 1
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 108091027757 Deoxyribozyme Proteins 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 208000000655 Distemper Diseases 0.000 description 1
- 206010013654 Drug abuse Diseases 0.000 description 1
- 108060006698 EGF receptor Proteins 0.000 description 1
- 206010014561 Emphysema Diseases 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 229940121710 HMGCoA reductase inhibitor Drugs 0.000 description 1
- 208000032843 Hemorrhage Diseases 0.000 description 1
- 208000005176 Hepatitis C Diseases 0.000 description 1
- 241000725303 Human immunodeficiency virus Species 0.000 description 1
- 108010003272 Hyaluronate lyase Proteins 0.000 description 1
- 102000001974 Hyaluronidases Human genes 0.000 description 1
- 206010061216 Infarction Diseases 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 238000012879 PET imaging Methods 0.000 description 1
- 208000031481 Pathologic Constriction Diseases 0.000 description 1
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 1
- 230000026279 RNA modification Effects 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 206010040639 Sick sinus syndrome Diseases 0.000 description 1
- 108091027967 Small hairpin RNA Proteins 0.000 description 1
- 108020004459 Small interfering RNA Proteins 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- 208000007536 Thrombosis Diseases 0.000 description 1
- 208000018452 Torsade de pointes Diseases 0.000 description 1
- 208000002363 Torsades de Pointes Diseases 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- DJJCXFVJDGTHFX-XVFCMESISA-N UMP group Chemical group P(=O)(O)(O)OC[C@@H]1[C@H]([C@H]([C@@H](O1)N1C(=O)NC(=O)C=C1)O)O DJJCXFVJDGTHFX-XVFCMESISA-N 0.000 description 1
- 208000007814 Unstable Angina Diseases 0.000 description 1
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 208000009729 Ventricular Premature Complexes Diseases 0.000 description 1
- 206010047289 Ventricular extrasystoles Diseases 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 208000019905 acrocephalosyndactyly Diseases 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000008186 active pharmaceutical agent Substances 0.000 description 1
- 206010051895 acute chest syndrome Diseases 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 206010001584 alcohol abuse Diseases 0.000 description 1
- 208000025746 alcohol use disease Diseases 0.000 description 1
- FQPFAHBPWDRTLU-UHFFFAOYSA-N aminophylline Chemical compound NCCN.O=C1N(C)C(=O)N(C)C2=C1NC=N2.O=C1N(C)C(=O)N(C)C2=C1NC=N2 FQPFAHBPWDRTLU-UHFFFAOYSA-N 0.000 description 1
- 230000003872 anastomosis Effects 0.000 description 1
- 210000003484 anatomy Anatomy 0.000 description 1
- 229940044094 angiotensin-converting-enzyme inhibitor Drugs 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- 208000006673 asthma Diseases 0.000 description 1
- 125000004429 atom Chemical group 0.000 description 1
- 230000003190 augmentative effect Effects 0.000 description 1
- 239000002876 beta blocker Substances 0.000 description 1
- 229940097320 beta blocking agent Drugs 0.000 description 1
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 230000000740 bleeding effect Effects 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 125000001309 chloro group Chemical group Cl* 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 230000004087 circulation Effects 0.000 description 1
- 230000015271 coagulation Effects 0.000 description 1
- 238000005345 coagulation Methods 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 238000002591 computed tomography Methods 0.000 description 1
- 229940124301 concurrent medication Drugs 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000011258 core-shell material Substances 0.000 description 1
- 229940109239 creatinine Drugs 0.000 description 1
- 238000011018 current good manufacturing practice Methods 0.000 description 1
- UHDGCWIWMRVCDJ-ZAKLUEHWSA-N cytidine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-ZAKLUEHWSA-N 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 229940124447 delivery agent Drugs 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 230000003205 diastolic effect Effects 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 230000009429 distress Effects 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 230000000142 dyskinetic effect Effects 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 208000015700 familial long QT syndrome Diseases 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 125000001153 fluoro group Chemical group F* 0.000 description 1
- CJOFXWAVKWHTFT-XSFVSMFZSA-N fluvoxamine Chemical compound COCCCC\C(=N/OCCN)C1=CC=C(C(F)(F)F)C=C1 CJOFXWAVKWHTFT-XSFVSMFZSA-N 0.000 description 1
- 229960004038 fluvoxamine Drugs 0.000 description 1
- 229940029575 guanosine Drugs 0.000 description 1
- 125000005843 halogen group Chemical group 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000005003 heart tissue Anatomy 0.000 description 1
- 208000018578 heart valve disease Diseases 0.000 description 1
- 230000000004 hemodynamic effect Effects 0.000 description 1
- 230000003054 hormonal effect Effects 0.000 description 1
- 229960002773 hyaluronidase Drugs 0.000 description 1
- 125000004029 hydroxymethyl group Chemical group [H]OC([H])([H])* 0.000 description 1
- 238000009802 hysterectomy Methods 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000007574 infarction Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 201000004332 intermediate coronary syndrome Diseases 0.000 description 1
- 201000009941 intracranial hypertension Diseases 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 230000004199 lung function Effects 0.000 description 1
- 208000002780 macular degeneration Diseases 0.000 description 1
- 206010025482 malaise Diseases 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 229940127554 medical product Drugs 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 108091070501 miRNA Proteins 0.000 description 1
- 239000002679 microRNA Substances 0.000 description 1
- 230000010060 microvascular dysfunction Effects 0.000 description 1
- 238000009126 molecular therapy Methods 0.000 description 1
- SQMWSBKSHWARHU-SDBHATRESA-N n6-cyclopentyladenosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(NC3CCCC3)=C2N=C1 SQMWSBKSHWARHU-SDBHATRESA-N 0.000 description 1
- 231100001079 no serious adverse effect Toxicity 0.000 description 1
- -1 nucleotide triphosphates Chemical class 0.000 description 1
- 238000009806 oophorectomy Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- SSYDTHANSGMJTP-UHFFFAOYSA-N oxolane-3,4-diol Chemical compound OC1COCC1O SSYDTHANSGMJTP-UHFFFAOYSA-N 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 150000004713 phosphodiesters Chemical group 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 238000002106 pulse oximetry Methods 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000002040 relaxant effect Effects 0.000 description 1
- 230000010410 reperfusion Effects 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 230000000250 revascularization Effects 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 238000009666 routine test Methods 0.000 description 1
- 231100000279 safety data Toxicity 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 239000002924 silencing RNA Substances 0.000 description 1
- 239000004055 small Interfering RNA Substances 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 210000002460 smooth muscle Anatomy 0.000 description 1
- 239000012475 sodium chloride buffer Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000036262 stenosis Effects 0.000 description 1
- 208000037804 stenosis Diseases 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 208000011117 substance-related disease Diseases 0.000 description 1
- 125000000547 substituted alkyl group Chemical group 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 230000035488 systolic blood pressure Effects 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 239000013638 trimer Substances 0.000 description 1
- 239000001226 triphosphate Substances 0.000 description 1
- 235000011178 triphosphate Nutrition 0.000 description 1
- 238000009810 tubal ligation Methods 0.000 description 1
- 230000005747 tumor angiogenesis Effects 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 1
- 229940045145 uridine Drugs 0.000 description 1
- 238000002562 urinalysis Methods 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 230000008728 vascular permeability Effects 0.000 description 1
- 239000013598 vector Substances 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 206010047302 ventricular tachycardia Diseases 0.000 description 1
- 230000007998 vessel formation Effects 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
Definitions
- compositions comprising modified RNA encoding VEGF-A, and the use of such compositions in methods of treating patients suffering from heart diseases responsive to VEGF-A therapy. Further aspects of the disclosure relate to use of such compositions in methods of improving LVEF, methods of improving the quality of life of patients, and methods of improving ventricular wall motion in patients suffering from heart diseases responsive to VEGF-A therapy.
- VEGF-A Vascular endothelial growth factor A
- VEGF-A vascular endothelial growth factor A pathway play a central role in the control of cardiovascular physiological function in general, and arteriogenesis in particular.
- VEGF-A’ s roles include activation of nitric oxide (NO) signaling, vascular permeability, tumor angiogenesis, arteriogenesis, endothelial replication, and cell fate switch for multipotent cardiovascular progenitors.
- NO nitric oxide
- VEGF-A pathways via both small molecules and antibodies has become the standard of care in selected forms of cancer and macular degeneration, it has remained challenging to unlock the potential of augmenting VEGF-A pathways for potential therapeutic effects that include relaxing smooth muscle and promoting new vessel formation.
- VEGF-A mRNA Epicardial injection of VEGF-A mRNA has been found to provide modest improvements in cardiac function in pigs following experimental myocardial infarction (Carlsson et al., Mol. Ther. Methods Clin. Dev., 2018, 9, 330-346, incorporated by reference in its entirety). However, the results were limited to pigs with modestly reduced LVEF (LVEF recovered to 51% ⁇ 0.9% and 52% ⁇ 1.0% at day 7 in the groups treated with VEGF-A mRNA, and the LVEF remaining at 47% ⁇ 0.8% in the vehicle group). Accordingly, there is a need to provide methods of treating patients with reduced LVEF (i.e. less than or equal to 40%).
- EPICCURE (ClinicalTrials.gov: NCT03370887) was a randomized, placebo-controlled, double-blind, multicenter, 6-month, phase 2a clinical trial of the safety, tolerability and exploratory efficacy of epicardial injections of a modified mRNA that encodes a VEGF-A polypeptide in patients with stable coronary artery disease and moderately decreased left ventricular ejection fraction (LVEF) who are undergoing coronary artery bypass grafting (CABG) surgery.
- LVEF left ventricular ejection fraction
- CABG coronary artery bypass grafting
- compositions comprising a modified RNA that encodes a VEGF-A polypeptide for use in the methods disclosed herein.
- composition disclosed herein in the manufacture of a medicament for use in the methods disclosed herein.
- a method of treating a condition selected from heart failure with reduced ejection fraction; heart failure with preserved ejection fraction; post-MI cardiac dysfunction; and ischemic heart disease in a patient in need thereof comprising administering to the patient an effective amount of a composition comprising a modified RNA in accordance with the present disclosure.
- a method of increasing the left ventricular ejection fraction (LVEF) in a patient comprising administering to the patient an effective amount of a composition comprising a modified RNA in accordance with the present disclosure; wherein the patient has a left ventricular ejection fraction (LVEF) of less than or equal to 40% prior to treatment with the modified RNA that encodes a VEGF-A polypeptide.
- LVEF left ventricular ejection fraction
- a method of improving the quality of life of a patient diagnosed with heart failure with reduced ejection fraction; heart failure with preserved ejection fraction; post-MI cardiac dysfunction; and/or ischemic heart disease comprising administering to the patient an effective amount of a composition comprising a modified RNA in accordance with the present disclosure, wherein the improvement in the quality of life of the patient is characterised by an increase in one or more patient reported outcome scores relative to before administration of the composition, wherein the patient reported outcome scores are (a) KCCQ Overall Summary Score; (b) SAQ Physical Limitation Score; (c) SAQ Quality of Life Score; and (d) SAQ Treatment Satisfaction Score.
- a method of improving the ventricular wall motion in the heart of a patient in need thereof comprising administering to the patient an effective amount of a composition comprising a modified RNA in accordance with the present disclosure.
- Fig. 1 shows the LVEF (Echocardiography (rest/hyperaemia), Biplane Simpson) of individual patients in the EPICCURE study as measured at Visit 1 (baseline) and at Visits 5, 6 and 7.
- Fig. 2 shows the 15 O-water PET global stress myocardial blood flow of individual patients in the EPICCURE study as measured at Visit 2 (baseline) and at Visits 5 and 6.
- Fig. 3 shows the 15 O-water PET regional stress myocardial blood flow in the treated area of individual patients in the EPICCURE study as measured at Visit 2 (baseline) and at Visits 5 and 6.
- Fig. 4 shows the 15 O-water PET global rest myocardial blood flow of individual patients in the EPICCURE study as measured at Visit 2 (baseline) and at Visits
- Fig. 5 shows the 15 O-water PET regional rest myocardial blood flow in the treated area of individual patients in the EPICCURE study as measured at Visit 2 (baseline) and at Visits 5 and 6.
- Fig. 6 shows the 15 O-water PET treated area coronary flow reserve of individual patients in the EPICCURE study as measured at Visit 2 (baseline) and at Visits 5 and 6.
- Figs. 7A, 7B, 7C and 7D show the mean SAQ Physical limitation score (PLS), SAQ Treatment satisfaction score (TSS), SAQ Quality of life score (QoLS) and SAQ Angina stability score (ASS) over time, respectively, of patients in the EPICCURE study.
- PLS Physical limitation score
- TSS SAQ Treatment satisfaction score
- QoLS SAQ Quality of life score
- ASS SAQ Angina stability score
- Fig. 8. Shows the mean KCCQ Overall summary score over time of patients in the EPICCURE study.
- Fig. 9A is the 15 O-water PET image from Patient 1 recorded at Visit 2 showing the pre-operative suggested area for treatment.
- Fig. 9B is the 15 O-water PET image showing the injection map for Patient 1.
- Fig. 10A shows the 15 O-water PET myocardial blood flow (divided into segments of the left ventricle) of Patient 1 at Baseline (Visit 2) at rest (left image) and under stress (right image).
- Fig. 10B shows the 15 O-water PET myocardial blood flow (divided into segments of the left ventricle) of Patient 1 at 3 months after surgery (Visit 6) at rest (left image) and under stress (right image).
- Fig. 11 A shows the change in LVEF of Patient 1 over time.
- Fig. 1 IB shows the KCCQ and SAQ scores of Patient 1 over time. 5.
- the numerical parameters set forth in the specification are approximations that can vary depending upon the desired properties sought to be obtained by a particular embodiment.
- the numerical parameters should be construed in light of the number of reported significant digits and by applying ordinary rounding techniques. Notwithstanding that the numerical ranges and parameters setting forth the broad scope of some embodiments of the present disclosure are approximations, the numerical values set forth in the specific examples are reported as precisely as practicable. The numerical values presented in some embodiments of the present disclosure may contain certain errors necessarily resulting from the standard deviation found in their respective testing measurements.
- administering refers to the placement of a composition comprising a modified RNA, into a patient by a method or route that results in at least partial localization of the composition, at a desired site or tissue location.
- the composition comprising modified RNA can be administered by any appropriate route that results in effective treatment in the patient, i.e. administration results in delivery to a desired location or tissue in the patient where at least a portion of the protein expressed by the modified RNA is located at a desired target tissue or target cell location.
- Administration can be through a portal vein catheter, through a coronary sinus catheter, and/or direct administration into the area to be treated.
- composition used herein is generally understood to mean a combination of at least two parts or elements that make up something.
- a composition as used herein usually comprises at least a modified RNA according to the disclosure and a suitable carrier or excipient such as citrate saline buffer.
- compositions, methods, and respective components thereof as described herein, which are exclusive of any element not recited in that description of the embodiment.
- disease or disorder
- a disease or disorder can also related to a distemper, ailing, ailment, malady, sickness, illness, complaint, indisposition, or affection.
- the term “effective amount” as used herein refers to the amount of therapeutic agent (for example, a modified RNA), or composition, sufficient to reduce at least one or more symptom(s) of the disease or disorder, or to provide the desired effect.
- therapeutic agent for example, a modified RNA
- it can be the amount that effects a therapeutically or prophylactically significant reduction in a symptom or clinical marker associated with a cardiac dysfunction or other disorder when administered to a typical patient who has a cardiovascular condition, or other disease or disorder.
- expression of a nucleic acid sequence refers to one or more of the following events: (1) production of an RNA template from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5' cap formation, and/or 3' end processing); (3) translation of an RNA into a polypeptide or protein; and (4) post-translational modification of a polypeptide or protein.
- composition refers to a type of composition that comprises a pharmaceutical mixture or solution containing an active pharmaceutical ingredient (for example, a modified RNA), together with pharmaceutically acceptable excipients suitable to be administered to a mammal (e.g., a human in need thereof) via a particular route of administration.
- a “pharmaceutical composition” as used herein can be specifically formulated to include suitable delivery agents and/or other pharmaceutically acceptable carriers for administration via one or more of a number of routes, such as via intramuscular, intradermal, subcutaneous, or intracardiac route, through a portal vein catheter, through a coronary sinus catheter, and/or by direct administration into the area to be treated.
- modified RNA refers to RNA molecules containing one, two, or more than two nucleoside modifications comparing to adenosine (A) ((2A,3A,45',5A)-2-(6-amino-9Z/-purin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol), guanosine (G) (2-Amino-9-[3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-3Z/-purin-6- one), cytidine (C) (4-amino-l-[3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-2- yl]pyrimidin-2-one), and uridine (U) (l-[(3A,45,5A)-3,4-dihydroxy-5- (hydroxymethyl)oxolan-2-yl]pyrimidine-2, 4-dione), or compared to adenosine (A) ((2A,
- Non-limiting examples of nucleoside modifications are provided elsewhere in this specification. Where the nucleotide sequence of a particular claimed RNA is otherwise identical to the sequence of a naturally-existing RNA molecule, the modified RNA is understood to be an RNA molecule with at least one modification different from those existing in the natural counterpart. The difference can be either in the chemical change to the nucleoside/nucleotide or in the position of that change within the sequence.
- the modified RNA is modified messenger RNA (or “modified mRNA”).
- nucleic acid in its broadest sense, includes any compound and/or substance that comprises a polymer of nucleotides linked via a phosphodiester bond. These polymers are often referred to as oligonucleotides or polynucleotides, depending on the size.
- polynucleotide sequence and
- nucleotide sequence are also used interchangeably herein.
- phrases “pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- Drugapproval agencies e.g., EMA, US-FDA
- Examples can be listed in Pharmacopeias.
- phrases “pharmaceutically acceptable excipient” is employed herein to refer to a pharmaceutically acceptable material chosen from a solvent, dispersion media, diluent, dispersion, suspension aid, surface active agent, isotonic agent, thickening or emulsifying agent, preservative, core-shell nanoparticles, polymer, peptide, protein, cell, hyaluronidase, and mixtures thereof.
- the solvent is an aqueous solvent.
- polypeptide means a polymer of amino acid residues (natural or unnatural) linked together most often by peptide bonds.
- a polypeptide may be a single molecule or may be a multi-molecular complex such as a dimer, trimer or tetramer. They may also comprise single chain or multichain polypeptides such as antibodies or insulin and may be associated or linked. Most commonly disulfide linkages are found in multichain polypeptides.
- polypeptide may also apply to amino acid polymers in which one or more amino acid residues are an artificial chemical analogue of a corresponding naturally occurring amino acid.
- protein is a polymer consisting essentially of any of the 20 amino acids.
- polypeptide is often used in reference to relatively large polypeptides, and “peptide” is often used in reference to small polypeptides, usage of these terms in the art overlaps and is varied.
- peptide(s)”, “protein(s)” and “polypeptide(s)” are sometime used interchangeably herein.
- recombinant means that a protein is derived from a prokaryotic or eukaryotic expression system through the use of a nucleic acid that has been genetically manipulated by the introduction of a “heterologous nucleic acid” or the alteration of a native nucleic acid.
- statically significant refers to statistical significance.
- the term refers to statistical evidence that there is a difference. It can be defined as the probability of making a decision to reject the null hypothesis when the null hypothesis is actually true. The decision is often made using the p-value. Any other measure of significant significance that is well-known in the art can be used.
- patient refers to an animal, for example a human, to whom treatment, including prophylactic treatment, with methods and compositions described herein, is or are provided.
- treatment including prophylactic treatment, with methods and compositions described herein, is or are provided.
- patient refers to that specific animal.
- a patient who is “suffering from” a disease, disorder, and/or condition has been diagnosed with or displays one or more symptoms of a disease, disorder, and/or condition.
- a patient may be at risk of suffering from a disease, disorder and/or condition.
- tissue refers to a group or layer of similarly specialized cells which together perform certain special functions.
- tissue-specific refers to a source or defining characteristic of cells from a specific tissue.
- the terms “treat” or “treatment” or “treating” refers to therapeutic treatment, wherein the object is to prevent or slow the development of the disease, such as slow down the development of a cardiac disorder, or reducing at least one adverse effect or symptom of a vascular condition, disease or disorder, such as, any disorder characterized by insufficient or undesired cardiac function.
- compositions for use in the methods disclosed herein wherein the composition comprises a modified RNA that encodes a VEGF-A polypeptide.
- VEGF-A polypeptides in accordance with the present disclosure are listed in Table 1. It will be appreciated by those of skill in the art that the sequences disclosed in the Table 1 contain potential flanking regions. These are encoded in each nucleotide sequence either to the 5’ (upstream) or 3’ (downstream) of the open reading frame. The open reading frame is definitively and specifically disclosed by teaching the nucleotide reference sequence. It is also possible to further characterize the 5' and 3' flanking regions by utilizing one or more available databases or algorithms. Databases have annotated the features contained in the flanking regions of the NCBI sequences and these are available in the art.
- Table 1 Homo sapiens VEGF-A mRNA isoforms.
- modified RNA encoding a VEGF-A polypeptide e.g., a human VEGF-A polypeptide
- a VEGF-A polypeptide e.g., a human VEGF-A polypeptide
- modified RNA encoding a VEGF-A polypeptide can be designed according to the VEGF-A mRNA isoforms listed in the Table 1.
- One of ordinary of skill in the art is generally familiar with the multiple isoforms of the remaining VEGF family members.
- the VEGF-A polypeptide comprises an amino acid sequence at least 95%, or at least 98%, or 100% identical to the amino acid sequence of SEQ ID NO: 3, wherein the amino acid sequence has VEGF-A activity.
- the VEGF-A polypeptide is VEGF-Aies.
- the VEGF-A polypeptide consists of an amino acid sequence identical to SEQ ID NO: 3.
- the modified RNA has an open reading frame (ORF) comprising or consisting of the nucleotide sequence of SEQ ID NO: 2.
- ORF open reading frame
- the modified RNA comprises a nucleotide sequence at least 95%, or at least 98%, or 100% identical to a nucleotide sequence selected from SEQ ID NOs: 1 and 4-7.
- the modified RNA consists of a nucleotide sequence selected from SEQ ID NOs: 1 and 4-7.
- the modified RNA consists of the nucleotide sequence of SEQ ID NO: 1.
- the modified RNA consists of the nucleotide sequence of SEQ ID NO: 4.
- RNAs are synthesized from four basic ribonucleotides: ATP, CTP, UTP and GTP, but may contain post-transcriptionally modified nucleotides. Further, approximately one hundred different nucleoside modifications have been identified in RNA (Rozenski, J, Crain, P, and McCloskey, J., The RNA Modification Database: 1999 update, Nucl Acids Res, (1999) 27: 196-197).
- these RNAs are preferably modified as to avoid the deficiencies of other RNA molecules of the art (e.g., activating the innate immune response and rapid degradation upon administration).
- these polynucleotides are referred to as modified RNA.
- the modified RNA contains one or more chemical modifications to one or more of the natural nucleotides AMP, CMP, UMP and GMP.
- the modified RNA avoids the innate immune response upon administration to a patient.
- the half-life of the modified RNA is extended compared to an unmodified RNA.
- the modified RNA is a modified messenger
- RNA RNA
- messenger RNA mRNA refers to any polynucleotide that encodes a polypeptide of interest and that is capable of being translated to produce the encoded polypeptide of interest in vitro, in vivo, in situ or ex vivo.
- the basic components of an mRNA molecule include at least a coding region (including an open reading frame (ORF)), a 5’ untranslated region (UTR), a 3’ untranslated region (UTR), a 5’ cap and a poly-(A) tail.
- ORF open reading frame
- UTR untranslated region
- UTR 3’ untranslated region
- 5’ cap and a poly-(A) tail.
- the present disclosure expands the scope of functionality of traditional mRNA molecules by providing polynucleotides or primary RNA constructs which maintain a modular organization, but which comprise one or more structural and/or chemical modifications or alterations that impart useful properties to the polynucleotide including, in some embodiments, the lack of a substantial induction of the innate immune response of a cell into which the polynucleotide is introduced.
- the modified RNAs can include any useful modification relative to the standard RNA nucleotide chain, such as to the sugar, the nucleobase (e.g., one or more modifications of a nucleobase, such as by replacing or substituting an atom of a pyrimidine nucleobase with optionally substituted amino, optionally substituted thiol, optionally substituted alkyl (e.g., methyl or ethyl), or halo (e.g., chloro or fluoro), or the internucleoside linkage (e.g., one or more modification to the phosphodiester backbone).
- the nucleobase e.g., one or more modifications of a nucleobase, such as by replacing or substituting an atom of a pyrimidine nucleobase with optionally substituted amino, optionally substituted thiol, optionally substituted alkyl (e.g., methyl or ethyl), or halo (e.g., chloro or flu
- the modified RNAs can optionally include other agents (e.g., RNAi-inducing agents, RNAi agents, siRNA, shRNA, miRNA, antisense RNA, ribozymes, catalytic DNA, tRNA, RNA that induce triple helix formation, aptamers, vectors, etc.).
- agents e.g., RNAi-inducing agents, RNAi agents, siRNA, shRNA, miRNA, antisense RNA, ribozymes, catalytic DNA, tRNA, RNA that induce triple helix formation, aptamers, vectors, etc.
- U.S. Patent Application Publication No. 2014/0073687 discloses exemplary modified RNAs with several useful modifications, for example, at least one or more modified nucleosides chosen from 5-methylcytidine (5mC), N6-methyladenosine (m6A), 3,2’-O-dimethyluridine (m4U), 2-thiouridine (s2U), 2’ fluorouridine, pseudouridine, 2 ’-O-m ethyluridine (Um), 2’ deoxy uridine (2’ dU), 4-thiouridine (s4U), 5 -methyluridine (m5U), 2’-O-methyladenosine (m6A), N6,2’-O-dimethyladenosine (m6Am), N6,N6,2’-O-trimethyladenosine (m62Am), 2’-O-methylcytidine (Cm), 7- methylguanosine (m7G), 2’ -O-m ethy
- the present disclosure provides for a modified RNA encoding a VEGF-A polypeptide (e.g., SEQ ID NO: 3).
- a modified RNA encodes a VEGF-A polypeptide, wherein the modified RNA comprises a nucleotide sequence selected from SEQ ID NOs: 1 and 4-7.
- the modified RNA further comprises a 5’ cap, a 5’ UTR, a 3’ UTR, a poly(A) tail, or any combination thereof.
- the 5’ cap, the 5’ UTR, the 3’ UTR, the poly(A) tail, or any combination thereof may include one or more modified nucleotides.
- a modified RNA encoding a VEGF-A polypeptide can include, for example, at least one of the UMP is modified to form Nl- methyl-pseudo-UMP.
- the Nl-methyl-pseudo-UMP is present instead of UMP in a percentage of the UMPs in the sequence chosen from 0.1%, 1%,
- the modified RNA encoding a VEGF-A polypeptide can include, for example, at least one of the CMP is modified to form methyl-CMP.
- the methyl-CMP is present instead of CMP in a percentage of the CMPs in the sequence chosen from 0.1%, 2%, 3%, 4%, 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99.9%, and 100%.
- all CMP have been replaced by 5- methyl-CMP.
- the modified RNA encoding a VEGF-A polypeptide can include, for example, at least one of the AMP is modified to form N6- methyl-AMP.
- the N6-methyl-AMP is present instead of AMP in a percentage of the AMPs in the sequence chosen from 0.1%, 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99.9%, and 100%.
- all AMP have been replaced by N6- methyl-AMP.
- the modified RNA can include, for example, at least one of the GMP is modified to form 7-methyl-GMP.
- the 7- methyl-GMP is present instead of GMP in a percentage of the GMPs in the sequence chosen from 0.1%, 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99.9%, and 100%.
- all GMP have been replaced by 7-methyl-GMP.
- the modified RNA encoding a VEGF-A polypeptide can include, for example, at least one or more modified nucleosides chosen from 5-methylcytidine (5mC), N6-methyladenosine (m6A), 3,2’-O-dimethyluridine (m4U), 2-thiouridine (s2U), 2’ fluorouridine, pseudouridine, 2’ -O-m ethyluridine (Um), 2’ deoxy uridine (2’ dU), 4-thiouridine (s4U), 5-methyluridine (m5U), 2’-O- methyladenosine (m6A), N6,2’-O-dimethyladenosine (m6Am), N6,N6,2’-O- trimethyladenosine (m62Am), 2’ -O-m ethylcytidine (Cm), 7-methylguanosine (m7G), 2’- O-methylguanosine (mC), 5-methylcyt
- modified RNAs comprise a modification to a 5' cap, such as a 5’ diguanosine cap or 5’ 7-methylguanosine cap. In some embodiments, modified RNAs have a Capl 5’ terminal cap. In some embodiments, modified RNAs comprise a modification to a coding region. In some embodiments, modified RNAs comprise a modification to a 5’ UTR. In some embodiments, modified RNAs comprise a modification to a 3’ UTR. In some embodiments, modified RNAs comprise a modification to a poly-(A) tail.
- modified RNAs comprise any combination of modifications to a coding region, 5’ cap, 5’ UTR, 3’ UTR, or poly-(A) tail.
- a modified RNA can optionally be treated with an alkaline phosphatase.
- the modified RNA comprises a Capl 5 '-terminal cap, a 5' UTR, the ORF sequence encodes a VEGF-A polypeptide (e.g., consisting of the amino acid sequence of SEQ ID NO: 3), a 3' UTR, and a poly(A) tail (e.g., about 100 nucleotides in length), wherein all uracils in the modified RNA are
- composition is a pharmaceutical composition further comprising a pharmaceutically acceptable excipient.
- the composition may further comprise a buffer.
- the composition may further comprise a citrate saline buffer.
- the citrate saline buffer has a pH of pH 6 to pH 7.
- the citrate saline buffer has a pH of about pH 6.5.
- the citrate saline buffer has a citrate concentration of 5 to 15 mmol/L, optionally about 10 mmol/L.
- the citrate saline buffer has a sodium chloride concentration of 100 to 160 mmol/L, optionally about 130 mmol/L.
- the citrate saline buffer is a sodium citrate/sodium chloride buffer.
- the composition does not comprise a lipid. In some embodiments, the composition does not comprise a lipid nanoparticle. In some embodiments, the citrate saline buffer is substantially free of divalent cations, including calcium and magnesium. In some embodiments, the citrate saline buffer contains no calcium or magnesium.
- a method of treating a condition selected from heart failure with reduced ejection fraction; heart failure with preserved ejection fraction; post-MI cardiac dysfunction; and ischemic heart disease in a patient in need thereof comprising administering to the patient an effective amount of a composition comprising a modified RNA in accordance with the present disclosure.
- the condition is selected from heart failure with reduced ejection fraction; post-MI cardiac dysfunction; and ischemic heart disease.
- the condition is heart failure with reduced ejection fraction.
- a method of increasing the left ventricular ejection fraction (LVEF) in a patient comprising administering to the patient an effective amount of a composition comprising a modified RNA in accordance with the present disclosure; wherein the patient has a left ventricular ejection fraction (LVEF) of less than or equal to 40% prior to treatment with the modified RNA that encodes a VEGF-A polypeptide.
- LVEF left ventricular ejection fraction
- a method of improving the quality of life of a patient diagnosed with heart failure with reduced ejection fraction; heart failure with preserved ejection fraction; post-MI cardiac dysfunction; and/or ischemic heart disease comprising administering to the patient an effective amount of a composition comprising a modified RNA in accordance with the present disclosure, wherein the improvement in the quality of life of the patient is characterised by an increase in one or more patient reported outcome scores relative to before administration of the composition, wherein the patient reported outcome scores are (a) Kansas City Cardiomyopathy Questionnaire (KCCQ) Overall Summary Score; (b) Seattle Angina Questionnaire (SAQ) Physical Limitation Score; (c) SAQ Quality of Life Score; and (d) SAQ Treatment Satisfaction Score.
- the patient is diagnosed with heart failure with reduced ejection fraction; post-MI cardiac dysfunction; and ischemic heart disease.
- the patient is diagnosed with heart failure with reduced ejection fraction.
- a method of improving the ventricular wall motion in the heart of a patient in need thereof comprising administering to the patient an effective amount of a composition comprising a modified RNA in accordance with the present disclosure.
- Heart failure occurs when the heart is weakened and is not filled with, or cannot pump, enough blood to meet the body's needs for blood and oxygen and the heart itself is perhaps poorly perfused.
- Patients with ischemic heart disease (IHD) have heart problems caused by narrowed heart arteries limiting the blood supply to the heart and thus limiting the amount of oxygen that reaches the heart muscle.
- Another consequence of poor circulation is seen in patients with microvascular dysfunction, loss of functional vessels, and/or loss of cardiac tissue, frequently seen in patients with post- myocardial infarction (post-MI) or other forms of cardiomyopathies.
- post-MI post- myocardial infarction
- the patient has a condition selected from heart failure with reduced ejection fraction; heart failure with preserved ejection fraction; post- MI cardiac dysfunction; and ischemic heart disease.
- the patient has a condition selected from heart failure with reduced ejection fraction; post-MI cardiac dysfunction; and ischemic heart disease.
- the patient has heart failure with reduced ejection fraction.
- the patient has suffered a myocardial infarction and/or has severe multivessel disease limiting blood supply to the heart. In some embodiments, the patient has suffered a myocardial infarction. In some embodiments, the patient has suffered a myocardial infarction within about one month prior to treatment with the compositions disclosed herein.
- the myocardial infarction triggers activation of Epicardium-derived cells (EPDC) over time.
- EPDC Epicardium-derived cells
- the patient suffering a myocardial infarction is treated with the compositions disclosed herein several days after the myocardial infarction, preferably at the peak time of EPDC activation.
- the patient suffering a myocardial infarction is treated with the compositions disclosed herein about 7 days after the myocardial infarction.
- the patient suffering a myocardial infarction is treated with the compositions disclosed herein about 10 days after the myocardial infarction, 2 weeks after the myocardial infarction, 3 weeks after the myocardial infarction, or 6 weeks after the myocardial infarction.
- the patient also suffers from coronary artery disease, high blood pressure, diabetes, atrial fibrillation, valvular heart disease, cardiomyopathy or an infection.
- the patient has a left ventricular ejection fraction (LVEF) of less than or equal to 40% prior to administration of the composition. In some embodiments, the patient has a left ventricular ejection fraction (LVEF) of less than or equal to 35% prior to administration of the composition; optionally less than or equal to 30% prior to administration of the composition; optionally less than or equal to 25% prior to administration of the composition.
- LVEF left ventricular ejection fraction
- the LVEF of the patient is increased by greater than 10% after administration of the composition. In some embodiments, the LVEF of the patient is increased by 15% or greater after administration of the composition; optionally 20% or greater after administration of the composition. In some embodiments, the increase in LVEF occurs within 6 months after administration of the composition; optionally within 3 months after administration of the composition.
- the LVEF of the patient is increased to 55% or greater after administration of the composition. In some embodiments, the LVEF of the patient is increased to 60% or greater after administration of the composition. In some embodiments, the LVEF of the patient is increased to a normal level after administration of the composition. In some embodiments, the increased LVEF occurs within 6 months after administration of the composition; optionally within 3 months after administration of the composition. [090] In some embodiments, the LVEF of the patient is determined by echocardiography, radionuclide ventriculography, contrast angiography, and/or cardiac MRI. In some embodiments, the LVEF of the patient is determined by echocardiography.
- the method improves the quality of life of the patient as characterised by an increase in one or more patient reported outcome scores relative to before administration of the composition, wherein the patient reported outcome scores are (a) KCCQ Overall Summary Score; (b) SAQ Physical Limitation Score; (c) SAQ Quality of Life Score; and (d) SAQ Treatment Satisfaction Score.
- the method improves the quality of life of the patient as characterised by an increase in the patient’s KCCQ Overall Summary Score relative to before administration of the composition. In some embodiments, the method improves the quality of life of the patient as characterised by an increase in the patient’s SAQ Physical Limitation Score relative to before administration of the composition. In some embodiments, the method improves the quality of life of the patient as characterised by an increase in the patient’s SAQ Quality of Life Score relative to before administration of the composition. In some embodiments, the method improves the quality of life of the patient as characterised by an increase in the patient’s SAQ Treatment Satisfaction Score relative to before administration of the composition.
- the KCCQ Overall Summary Score is increased by at least 5 points relative to before administration of the composition; optionally increased by at least 10 points; optionally increased by at least 12 points; optionally increased by at least 14 points.
- the SAQ Physical Limitation Score is increased by at least 10 points relative to before administration of the composition; optionally increased by at least 15 points; optionally increased by at least 20 points; optionally increased by at least 30 points.
- the SAQ Quality of Life Score is increased at least 10 points relative to before administration of the composition; optionally at least 20 points; optionally at least 30 points.
- the SAQ Treatment Satisfaction Score is increased by at least 5 points relative to before administration of the composition.
- the method improves the quality of life of the patient as characterised by an increase in one or more patient reported outcome scores relative to placebo, wherein the patient reported outcome scores are (a) KCCQ Overall Summary Score; (b) SAQ Physical Limitation Score; (c) SAQ Quality of Life Score; and (d) SAQ Treatment Satisfaction Score.
- the method improves the quality of life of the patient as characterised by an increase in the patient’s KCCQ Overall Summary Score relative to placebo. In some embodiments, the method improves the quality of life of the patient as characterised by an increase in the patient’s SAQ Physical Limitation Score relative to placebo. In some embodiments, the method improves the quality of life of the patient as characterised by an increase in the patient’s SAQ Quality of Life Score relative to placebo. In some embodiments, the method improves the quality of life of the patient as characterised by an increase in the patient’s SAQ Treatment Satisfaction Score relative to placebo.
- the KCCQ Overall Summary Score is increased by at least 5 points relative to placebo; optionally increased by at least 10 points; optionally increased by at least 12 points; optionally increased by at least 14 points.
- the SAQ Physical Limitation Score is increased by at least 10 points relative to placebo; optionally increased by at least 15 points; optionally increased by at least 20 points; optionally increased by at least 30 points.
- the SAQ Quality of Life Score is increased at least 10 points relative to placebo; optionally at least 20 points; optionally at least 30 points.
- the SAQ Treatment Satisfaction Score is increased by at least 5 points relative to placebo.
- the increase in one or more patient reported outcome scores occurs within 6 months after administration of the composition. In some embodiments, the increase in one or more patient reported outcome scores occurs within 3 months after administration of the composition, optionally within 1 month after administration of the composition.
- the composition is injected into a normal, hypokinetic or akinetic ventricular segment of the heart of the patient. In some embodiments, the composition is injected into a hypokinetic or akinetic ventricular segment of the heart of the patient. In some embodiments, the composition is injected into a hypokinetic ventricular segment of the heart of the patient. In some embodiments, the composition is injected into an akinetic ventricular segment of the heart of the patient.
- the composition is injected into a hypokinetic ventricular segment of the heart of the patient, and the injected segment improves to normal wall motion within 6 months after administration of the composition, optionally within 3 months after administration of the composition.
- the composition is injected into a akinetic ventricular segment of the heart of the patient, and the injected segment improves to hypokinetic or normal wall motion within 6 months after administration of the composition, optionally within 3 months after administration of the composition.
- the composition is injected into one or more ventricular segments of the heart of the patient, and one or more non-injected hypokinetic ventricular segments improve to normal wall motion within 6 months after administration of the composition, optionally within 3 months after administration of the composition.
- the one or more non-injected ventricular segments are adjacent to the injected ventricular segment.
- the composition is injected into one or more ventricular segments of the heart of the patient, and one or more non-injected akinetic ventricular segments improves to hypokinetic or normal wall motion within 6 months after administration of the composition, optionally within 3 months after administration of the composition.
- the one or more non-injected ventricular segments are adjacent to the injected ventricular segment.
- the patient has a New York Heart Association (NYHA) heart failure classification of I, II, III or IV prior to administration of the composition.
- NYHA New York Heart Association
- the patient has a NYHA heart failure classification of II, III or IV prior to administration of the composition.
- the patient has a NYHA heart failure classification of III or IV prior to administration of the composition.
- the patient has a NYHA heart failure classification of II prior to administration of the composition.
- the patient has a NYHA heart failure classification of III prior to administration of the composition.
- the patient has a NYHA heart failure classification of IV prior to administration of the composition.
- the patient’s NYHA heart failure classification improves within 6 months after administration of the composition, optionally within 3 months after administration of the composition, optionally within 1 month after administration of the composition.
- the patient has a NYHA heart failure classification of I or II within 6 months after administration of the composition, optionally within 3 months after administration of the composition, optionally within 1 month after administration of the composition.
- the patient has a NYHA heart failure classification of I within 6 months after administration of the composition, optionally within 3 months after administration of the composition, optionally within 1 month after administration of the composition.
- the patient has a Canadian Cardiovascular Society (CCS) angina classification of I, II, III or IV prior to administration of the composition.
- CCS Canadian Cardiovascular Society
- the patient has a CCS angina classification of II, III or IV prior to administration of the composition.
- the patient has a CCS angina classification of III or IV prior to administration of the composition.
- the patient has a CCS angina classification of II prior to administration of the composition.
- the patient has a CCS angina classification of III prior to administration of the composition.
- the patient has a CCS angina classification of IV prior to administration of the composition.
- the patient’s CCS angina classification improves within 6 months after administration of the composition, optionally within 3 months after administration of the composition, optionally within 1 month after administration of the composition.
- the patient has a CCS angina classification of I or II within 6 months after administration of the composition, optionally within 3 months after administration of the composition, optionally within 1 month after administration of the composition.
- the patient has a CCS angina classification of I within 6 months after administration of the composition, optionally within 3 months after administration of the composition, optionally within 1 month after administration of the composition.
- the patient has a coronary flow reserve of less than 2.5 prior to administration of the composition. In some embodiments, the patient has a coronary flow reserve of less than 2.0 prior to administration of the composition.
- the patient is undergoing coronary artery bypass graft (CABG) surgery.
- the composition is administered during coronary artery bypass graft (CABG) surgery.
- the composition is administered to the patient by epicardial injection. In some embodiments, the composition is administered to the patient by epicardial injection into one or more segments of the left ventricle. In some embodiments, the composition is administered to the patient by epicardial injection at a fixed-dosage in multiple administrations. In some embodiments, the composition is administered to the patient by epicardial injection at a fixed-dosage in 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more administrations. In some embodiments, the composition is administered to the patient by epicardial injection at a fixed-dosage in 30 administrations. The “multiple administrations” can be separated from each other by short (1 second to 1 minute) medium (more than 1 minute to 30 minutes), or long (more than 30 minutes to 1 hour) intervals of time.
- composition may be administered to the patient using any amount of the composition effective for treating a disease, disorder, and/or condition.
- amount will vary from patient to patient, depending on the species, age, and general condition of the patient, the severity of the disease, the particular composition, its mode of administration, its mode of activity, and the like. It will be understood, however, that the total daily usage of the compositions may be decided by the attending physician within the scope of sound medical judgment.
- the specific pharmaceutically effective, dose level for any particular patient will depend upon a variety of factors including the disease being treated and the severity of the disease; the activity of the specific compound employed; the specific formulation employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the specific compound employed; the duration of the treatment; drugs (for example, a modified RNA) used in combination or coincidental with the specific compound employed; and like factors well known in the medical arts.
- the concentration of the modified RNA in the composition is between 0.1 and 5 mg/mL. In some embodiments, the concentration of the modified RNA in the composition is between 0.5 and 5 mg/mL. In some embodiments, the concentration of the modified RNA in the composition is about 0.5 mg/mL. In some embodiments, the concentration of the modified RNA in the composition is about 5 mg/mL.
- the composition may be administered at fixed- dosage levels of modified RNA. For example, the composition may be administered at fixed-dosage levels from about 0.1 mg to about 1 mg of modified RNA, per administration. In some embodiments, the composition is administered at a fixed-dosage level of about 0.1 mg of modified RNA per administration.
- the composition is administered at a fixed-dosage level of about 1 mg of modified RNA per administration. In some embodiments, the composition is administered at a fixed-dosage level of about 1 mg to about 30 mg total dose of modified RNA. In some embodiments, the composition is administered at a fixed-dosage level of about 3 mg to about 30 mg total dose of modified RNA. In some embodiments, the composition is administered at a fixed-dosage level of about 3 mg total dose of modified RNA. In some embodiments, the composition is administered at a fixed-dosage level of about 30 mg total dose of modified RNA. In some embodiments, the composition is administered as about 30 administrations of about 0.1 mg of modified RNA per administration.
- the composition is injected into an ischemic area of the myocardium.
- the ischemic area is a region with stress myocardial blood flow ⁇ 2.3 ⁇ 0.3 mL/g/min or ⁇ 80 ⁇ 10% of the segment with highest stress myocardial blood flow.
- the ischemic area is a region with stress myocardial blood flow ⁇ 2.6 mL/g/min or ⁇ 90% of the segment with highest stress myocardial blood flow.
- the ischemic area is a region with stress myocardial blood flow ⁇ 2.3 mL/g/min or ⁇ 80% of the segment with highest stress myocardial blood flow.
- the stress myocardial blood flow is determined by 15 O-water PET.
- the composition is injected into an ischemic but viable area of the myocardium.
- ischemic but viable area is a region with resting myocardial blood flow above 0.6 mL/g/min.
- ischemic but viable area is a region with resting myocardial blood flow above 0.6 mL/g/min and stress myocardial blood flow ⁇ 2.3 ⁇ 0.3 mL/g/min or ⁇ 80 ⁇ 10% of the segment with highest stress myocardial blood flow.
- the resting myocardial blood flow is determined by 15 O-water PET.
- the patient does not have a region of ischemic non-viable myocardium.
- the ischemic non-viable myocardium is a region with resting myocardial blood flow of ⁇ 0.6 mL/g/min.
- the resting myocardial blood flow is determined by 15 O-water PET.
- Ischemic areas of the myocardium, and viable and non-viable ischemic areas of the myocardium may be identified by various methods known in the art (for example, see Garcia et al. Circ Cardiovasc Imaging. 2020, 13, e000053).
- ischemic areas of the myocardium, and viable and non-viable ischemic areas of the myocardium may be identified by single-photon emission computed tomography (SPECT); positron emission tomography (PET) with one or more perfusion agents, for example 15 O-water, 82 Rb perfusion agents, 13 N-ammonia and 18 F perfusion agents; perfusion cardiac magnetic resonance imaging; echocardiography; cardiac computerized tomography (CT); and/or invasive coronary angiography.
- ischemic areas of the myocardium, and viable and non-viable ischemic areas of the myocardium may be identified by 15 O-water PET.
- the stress myocardial blood flow of the injected area is not increased by more than 20% at 3 months after administration of the composition compared to before administration of the composition, optionally not increased by more than 10% at 3 months after administration of the composition compared to before administration of the composition.
- the stress myocardial blood flow is determined by 15 O-water PET.
- the resting myocardial blood flow of the injected area is not increased by more than 20% at 3 months after administration of the composition compared to before administration of the composition, optionally not increased by more than 10% at 3 months after administration of the composition compared to before administration of the composition.
- the resting myocardial blood flow is determined by 15 O-water PET.
- the global stress myocardial blood flow is not increased by more than 20% at 3 months after administration of the composition compared to before administration of the composition, optionally not increased by more than 10% at 3 months after administration of the composition compared to before administration of the composition. In some embodiments, the global stress myocardial blood flow is determined by 15 O-water PET.
- the global resting myocardial blood flow is not increased by more than 20% at 3 months after administration of the composition compared to before administration of the composition, optionally not increased by more than 10% at 3 months after administration of the composition compared to before administration of the composition. In some embodiments, the global resting myocardial blood flow is determined by 15 O-water PET.
- Global myocardial blood flow at stress and/or rest, and/or myocardial blood flow in the treated area at stress and/or rest may be determined by various techniques known in the art, for example, by single-photon emission computed tomography (SPECT); positron emission tomography (PET) with one or more perfusion agents, for example 15 O-water, 82 Rb perfusion agents, 13 N-ammonia and 18 F perfusion agents; perfusion cardiac magnetic resonance imaging; echocardiography; cardiac computerized tomography (CT); and/or invasive coronary angiography.
- SPECT single-photon emission computed tomography
- PET positron emission tomography
- perfusion agents for example 15 O-water, 82 Rb perfusion agents, 13 N-ammonia and 18 F perfusion agents
- perfusion cardiac magnetic resonance imaging for example 15 O-water, 82 Rb perfusion agents, 13 N-ammonia and 18 F perfusion agents
- perfusion cardiac magnetic resonance imaging for example 15 O-water, 82 Rb perfusion
- administration of the composition does not induce ventricular arrhythmia in the patient. In some embodiments, administration of the composition does not induce severe ventricular arrhythmia in the patient.
- EPICCURE (ClinicalTrials.gov: NCT03370887) was a randomized, placebo-controlled, double-blind, multicenter, 6-month, phase 2a clinical trial of the safety, tolerability and exploratory efficacy of epicardial injections of a modified mRNA that encodes a VEGF-A polypeptide in patients with stable coronary artery disease and moderately decreased left ventricular ejection fraction (LVEF) who are undergoing coronary artery bypass grafting (CABG) surgery.
- LVEF left ventricular ejection fraction
- CABG coronary artery bypass grafting
- the VEGF-A mRNA referred to in this Example is modified mRNA (SEQ ID NO: 1) encoding VEGF-Aies (SEQ ID NO: 3), and was manufactured in compliance with current Good Manufacturing Practices (GMP) by in vitro transcription using a linearized plasmid DNA template, nucleotide triphosphates and purified enzymes, followed by purification and filtration.
- the VEGF-A mRNA was used in this Example as a citrate/saline solution (pH 6.5, 10 mmol/L sodium citrate, 130 mmol/L sodium chloride) at a concentration of 0.5 mg/mL VEGF-A mRNA.
- the composition of the formulation is as described in Table 2.
- EPICCURE is registered on ClinicalTrials.gov (identifier:
- EPICCURE The primary objective of EPICCURE was to assess the safety and tolerability of VEGF-A mRNA. Primary outcome measures included the following:
- Females must be of non-childbearing potential confirmed at screening by fulfilling one of the following criteria a) postmenopausal defined as amenorrhoea for at least 12 months or more following cessation of all exogenous hormonal treatments and follicle-stimulating hormone (FSH) levels in the postmenopausal range, b) documentation of irreversible surgical sterilisation by hysterectomy, bilateral oophorectomy or bilateral salpingectomy but not tubal ligation
- Table 3 Schedule of assessments for enrollment, treatment and follow-up periods
- Ischemic regions were identified as those with stress myocardial blood flow below 2.3 mL/g/min ( ⁇ 0.3 mL/g/min), or below 80% ( ⁇ 10%) of the segment with highest stress myocardial blood flow on 15 O-water PET (see Kajander, SA et al, Circ Cardiovasc Imaging, 2011, 4, 678-684; and Danad, I et al., J Am Coll Cardiol, 2014, 64, 1464- 1475).
- Target regions of ischemic but viable myocardium were identified as ischemic regions with resting myocardial blood flow above 0.6 mL/g/min (i.e. >60% of normal myocardium resting blood flow of 1 mL/g/min) on 15 O-water PET.
- 30 epicardial injection sites with approximately 1 cm spacing were identified within the target regions (Fig. 9B provides an example of such an injection map).
- Safety outcomes included monitoring of adverse events and serious adverse events, physical examinations, electrocardiography, monitoring of vital signs (blood pressure, pulse, oxygen saturation), laboratory assessments, and echocardiographic assessment of hemopericardium, tamponade, and left ventricular ejection fraction.
- Adverse events were recorded from coronary artery bypass grafting until the end of follow-up and serious adverse events were recorded from informed consent until the end of follow-up. All adverse events were followed up by the investigator until resolved or for as long as medically indicated. Investigators assessed whether adverse events were causally related to the investigational medical product and also whether serious adverse events were causally related to other medications, to study procedures and to the drug injection procedure.
- LVEF Change in LVEF (LSMean) from baseline was greater in the group receiving VEGF-A mRNA (3 mg) by 9.367% relative to placebo (95% CI, -2.251 to 20.986; P, 0.108). LVEF change from baseline for each patient group is shown in Table 5. LVEF was measured by echocardiography using Simpson’s biplane method.
- LVEF Echocardiography (rest/hyperaemia), Biplane Simpson) of individual patients in the study as measured at Visit 1 (baseline) and at Visits 5, 6 and 7.
- Fig. 2 shows the 15 O-water PET global stress myocardial blood flow of individual patients in the study as measured at Visit 2 (baseline) and at Visits 5 and 6.
- Table 7 15 O-water PET assessment: regional stress myocardial blood flow
- Fig. 3 shows the 15 O-water PET regional stress myocardial blood flow in the treated area of individual patients in the study as measured at Visit 2 (baseline) and at Visits 5 and 6.
- Fig. 4 shows the global rest myocardial blood flow of individual patients in the study as measured at Visit 2 (baseline) and at Visits 5 and 6.
- Fig. 5 shows the regional rest myocardial blood flow in the treated area of individual patients in the study as measured at Visit 2 (baseline) and at Visits 5 and 6.
- Fig. 6 shows the treated area coronary flow reserve of individual patients in the study as measured at Visit 2 (baseline) and at Visits 5 and 6.
- Table 12 SAQ Angina frequency score (ATS):
- PLS mean SAQ Physical limitation score
- TSS SAQ Treatment satisfaction score
- QoLS SAQ Quality of life score
- ASS SAQ Angina stability score
- LVEF less than 40% at baseline (Visit 1)
- this patient received treatment with VEGF-A mRNA (3 mg).
- This patient is identified as “Patient 1” herein, and the data corresponding to Patient 1 are marked in bold in Figs. 1-6.
- Patient 1 is a 61 -years old male with coronary artery disease, an exsmoker, and had hypertension and positive family history.
- Patient 1 had a history of pulmonary emphysema and impaired lung functions.
- a coronary angiogram of Patient 1 indicated significant stenosis in LAD ostium, LCX and chronic total occlusion in RCA.
- the LVEF was 30-35%, and the low LVEF was due to akinetic anterior wall and anterior septum.
- Patient l’s ECG revealed signs of previous anterior infarct.
- Fig. 9A is the 15 O-water PET image from Patient 1 recorded at Visit 2 showing the pre-operative suggested area for treatment.
- Fig. 9B is the 15 O-water PET image showing the injection map for Patient 1.
- the injections (30 points between the LAD and the LOM coronary arteries) were spaced about 1 cm from each other in midmyocardium, but not in the ventricular septum (the injected area was within the following left ventricular segments: basal anterior, basal inferolateral, basal anterolateral, mid anterior, mid inferolateral and mid anterolateral).
- the area with most damage (ventricular septum) was not treated directly by injections as this area is not accessible during CABG surgery.
- Fig. 10A shows the 15 O-water PET myocardial blood flow (divided into segments of the left ventricle) of Patient 1 at Baseline (Visit 2) at rest (left image) and under stress (right image).
- Fig. 10B shows the 15 O-water PET myocardial blood flow (divided into segments of the left ventricle) of Patient 1 at 3 months after surgery (Visit 6) at rest (left image) and under stress (right image).
- the regional wall motion scores at Baseline (Visit 1), 3 months after treatment (Visit 6) and 6 months after treatment (Visit 7) are provided in Table 15.
- Table 15 Left-ventricular regional wall motion scores for Patient 1
- Table 16 KCCQ and SAQ scores for Patient 1 at Visits 1, 5, 6 and 7
- SEQ ID NO: 1 Modified RNA encoding VEGF-A used in Example
- SEQ ID NO: 2 ORF of modified RNA encoding VEGF-A used in the Examples (excluding the stop codon):
- SEQ ID NO: 4 A modified RNA encoding VEGF-A
- SEQ ID NO: 5 A modified RNA encoding VEGF-A
- A, C, G & U AMP, CMP, GMP & Nl-methyl-pseudoUMP, respectively
- SEQ ID NO: 6 A modified RNA encoding VEGF-A
- A, C, G & U AMP, CMP, GMP & Nl-methyl-pseudoUMP, respectively
- SEQ ID NO: 7 A modified RNA encoding VEGF-A
- A, C, G & U AMP, CMP, GMP & Nl-methyl-pseudoUMP, respectively
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Veterinary Medicine (AREA)
- Biochemistry (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Animal Behavior & Ethology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pharmacology & Pharmacy (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Abstract
This disclosure relates to compositions comprising modified RNA encoding VEGF-A, and the use of such compositions in methods of treating patients suffering from heart diseases responsive to VEGF-A therapy. Further aspects of the disclosure relate to use of such compositions in methods of improving LVEF, methods of improving the quality of life of patients, and methods of improving ventricular wall motion in patients suffering from heart diseases responsive to VEGF-A therapy.
Description
COMPOSITIONS COMPRISING MODIFIED RNA ENCODING VEGF-A AND
METHODS OF USE
1. FIELD
[001] The disclosure relates to compositions comprising modified RNA encoding VEGF-A, and the use of such compositions in methods of treating patients suffering from heart diseases responsive to VEGF-A therapy. Further aspects of the disclosure relate to use of such compositions in methods of improving LVEF, methods of improving the quality of life of patients, and methods of improving ventricular wall motion in patients suffering from heart diseases responsive to VEGF-A therapy.
2. BACKGROUND
[002] Vascular endothelial growth factor A (VEGF-A) pathways play a central role in the control of cardiovascular physiological function in general, and arteriogenesis in particular. VEGF-A’ s roles include activation of nitric oxide (NO) signaling, vascular permeability, tumor angiogenesis, arteriogenesis, endothelial replication, and cell fate switch for multipotent cardiovascular progenitors. While inhibition of VEGF-A pathways via both small molecules and antibodies has become the standard of care in selected forms of cancer and macular degeneration, it has remained challenging to unlock the potential of augmenting VEGF-A pathways for potential therapeutic effects that include relaxing smooth muscle and promoting new vessel formation. Epicardial injection of VEGF-A mRNA has been found to provide modest improvements in cardiac function in pigs following experimental myocardial infarction (Carlsson et al., Mol. Ther. Methods Clin. Dev., 2018, 9, 330-346, incorporated by reference in its entirety). However, the results were limited to pigs with modestly reduced LVEF (LVEF recovered to 51% ±
0.9% and 52% ± 1.0% at day 7 in the groups treated with VEGF-A mRNA, and the LVEF remaining at 47% ± 0.8% in the vehicle group). Accordingly, there is a need to provide methods of treating patients with reduced LVEF (i.e. less than or equal to 40%).
[003] EPICCURE (ClinicalTrials.gov: NCT03370887) was a randomized, placebo-controlled, double-blind, multicenter, 6-month, phase 2a clinical trial of the safety, tolerability and exploratory efficacy of epicardial injections of a modified mRNA that encodes a VEGF-A polypeptide in patients with stable coronary artery disease and moderately decreased left ventricular ejection fraction (LVEF) who are undergoing coronary artery bypass grafting (CABG) surgery. The design of the EPICCURE clinical trial is described in Anttila et al. Molecular Therapy: Methods & Clinical Development, 2020, 18, 464-472, incorporated by reference into the specification in its entirety. Results from the EPICCURE study are disclosed herein.
[004] It is known that the LVEF of patients does not necessarily increase after the patient undergoes CABG surgery (Adachi et al. Int Heart J, 2016, 57(5), 565-72). Accordingly, a significant increase in LVEF of patients in the EPICCURE clinical trial would not be expected to result from the CABG surgery alone.
[005] Accordingly, there remains a need to provide methods of treating patients with reduced LVEF (i.e. less than or equal to 40%).
3. SUMMARY
[006] Disclosed herein are compositions comprising a modified RNA that encodes a VEGF-A polypeptide for use in the methods disclosed herein.
[007] Also disclosed is the use of a composition disclosed herein in the manufacture of a medicament for use in the methods disclosed herein.
[008] In one embodiment, there is provided a method of treating a condition selected from heart failure with reduced ejection fraction; heart failure with preserved ejection fraction; post-MI cardiac dysfunction; and ischemic heart disease in a patient in need thereof comprising administering to the patient an effective amount of a composition comprising a modified RNA in accordance with the present disclosure.
[009] In one embodiment, there is provided a method of increasing the left ventricular ejection fraction (LVEF) in a patient comprising administering to the patient an effective amount of a composition comprising a modified RNA in accordance with the present disclosure; wherein the patient has a left ventricular ejection fraction (LVEF) of less than or equal to 40% prior to treatment with the modified RNA that encodes a VEGF-A polypeptide.
[010] In one embodiment, there is provided a method of improving the quality of life of a patient diagnosed with heart failure with reduced ejection fraction; heart failure with preserved ejection fraction; post-MI cardiac dysfunction; and/or ischemic heart disease comprising administering to the patient an effective amount of a composition comprising a modified RNA in accordance with the present disclosure, wherein the improvement in the quality of life of the patient is characterised by an increase in one or more patient reported outcome scores relative to before administration of the composition, wherein the patient reported outcome scores are (a) KCCQ Overall Summary Score; (b) SAQ Physical Limitation Score; (c) SAQ Quality of Life Score; and (d) SAQ Treatment Satisfaction Score.
[011] In one embodiment, there is provided a method of improving the ventricular wall motion in the heart of a patient in need thereof comprising administering
to the patient an effective amount of a composition comprising a modified RNA in accordance with the present disclosure.
[012] Certain embodiments of the present disclosure are summarized in the following paragraphs. This list is only exemplary and not exhaustive of all of the embodiments provided by this disclosure.
4. DESCRIPTION OF DRAWINGS
[013] Those of skill in the art will understand that the drawings, described below, are for illustrative purposes only. The drawings are not intended to limit the scope of the present teachings in any way.
[014] Fig. 1 shows the LVEF (Echocardiography (rest/hyperaemia), Biplane Simpson) of individual patients in the EPICCURE study as measured at Visit 1 (baseline) and at Visits 5, 6 and 7.
[015] Fig. 2 shows the 15O-water PET global stress myocardial blood flow of individual patients in the EPICCURE study as measured at Visit 2 (baseline) and at Visits 5 and 6.
[016] Fig. 3 shows the 15O-water PET regional stress myocardial blood flow in the treated area of individual patients in the EPICCURE study as measured at Visit 2 (baseline) and at Visits 5 and 6.
[017] Fig. 4 shows the 15O-water PET global rest myocardial blood flow of individual patients in the EPICCURE study as measured at Visit 2 (baseline) and at Visits
5 and 6.
[018] Fig. 5 shows the 15O-water PET regional rest myocardial blood flow in the treated area of individual patients in the EPICCURE study as measured at Visit 2 (baseline) and at Visits 5 and 6.
[019] Fig. 6 shows the 15O-water PET treated area coronary flow reserve of individual patients in the EPICCURE study as measured at Visit 2 (baseline) and at Visits 5 and 6.
[020] Figs. 7A, 7B, 7C and 7D show the mean SAQ Physical limitation score (PLS), SAQ Treatment satisfaction score (TSS), SAQ Quality of life score (QoLS) and SAQ Angina stability score (ASS) over time, respectively, of patients in the EPICCURE study.
[021] Fig. 8. Shows the mean KCCQ Overall summary score over time of patients in the EPICCURE study.
[022] Fig. 9A is the 15O-water PET image from Patient 1 recorded at Visit 2 showing the pre-operative suggested area for treatment. Fig. 9B is the 15O-water PET image showing the injection map for Patient 1.
[023] Fig. 10A shows the 15O-water PET myocardial blood flow (divided into segments of the left ventricle) of Patient 1 at Baseline (Visit 2) at rest (left image) and under stress (right image). Fig. 10B shows the 15O-water PET myocardial blood flow (divided into segments of the left ventricle) of Patient 1 at 3 months after surgery (Visit 6) at rest (left image) and under stress (right image).
[024] Fig. 11 A shows the change in LVEF of Patient 1 over time. Fig. 1 IB shows the KCCQ and SAQ scores of Patient 1 over time.
5. DETAILED DESCRIPTION
[025] All references referred to are incorporated herein by reference in their entireties.
[026] Many modifications and other embodiments of the disclosures set forth herein will come to mind to one skilled in the art to which these disclosures pertain having the benefit of the teachings presented in the foregoing descriptions and the associated drawings. Therefore, it is to be understood that the disclosures are not to be limited to the specific embodiments disclosed and that modifications and other embodiments are intended to be included within the scope of the appended claims. Although specific terms are employed herein, they are used in a generic and descriptive sense only and not for purposes of limitation.
[027] Units, prefixes and symbols may be denoted in their SI accepted form. Unless otherwise indicated, nucleic acids are written left to right in 5' to 3' orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively. Numeric ranges are inclusive of the numbers defining the range. Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes. The terms defined below are more fully defined by reference to the specification as a whole.
5.1. Definitions
[028] Unless specifically defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in
the art to which this disclosure belongs. Unless mentioned otherwise, the techniques employed or contemplated herein are standard methodologies well known to one of ordinary skill in the art. The practice of the present disclosure will employ, unless otherwise indicated, conventional techniques of microbiology, tissue culture, molecular biology, chemistry, biochemistry and recombinant DNA technology, which are within the skill of the art. The materials, methods and examples are illustrative only and not limiting. The following is presented by way of illustration and is not intended to limit the scope of the disclosure.
[029] In some embodiments, the numerical parameters set forth in the specification (into which the claims are incorporated in their entirety) are approximations that can vary depending upon the desired properties sought to be obtained by a particular embodiment. In some embodiments, the numerical parameters should be construed in light of the number of reported significant digits and by applying ordinary rounding techniques. Notwithstanding that the numerical ranges and parameters setting forth the broad scope of some embodiments of the present disclosure are approximations, the numerical values set forth in the specific examples are reported as precisely as practicable. The numerical values presented in some embodiments of the present disclosure may contain certain errors necessarily resulting from the standard deviation found in their respective testing measurements. The recitation of ranges of values herein is merely intended to serve as a shorthand method of referring individually to each separate value falling within the range. Unless otherwise indicated herein, each individual value is incorporated into the specification as if it were individually recited herein.
[030] For convenience, certain terms employed in the entire application (including the specification, examples, and appended claims) are collected here. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs.
[031] As used herein, the term “administering” refers to the placement of a composition comprising a modified RNA, into a patient by a method or route that results in at least partial localization of the composition, at a desired site or tissue location. In some embodiments, the composition comprising modified RNA can be administered by any appropriate route that results in effective treatment in the patient, i.e. administration results in delivery to a desired location or tissue in the patient where at least a portion of the protein expressed by the modified RNA is located at a desired target tissue or target cell location.
[032] Administration can be through a portal vein catheter, through a coronary sinus catheter, and/or direct administration into the area to be treated.
[033] The term “composition” used herein is generally understood to mean a combination of at least two parts or elements that make up something. For example, a composition as used herein usually comprises at least a modified RNA according to the disclosure and a suitable carrier or excipient such as citrate saline buffer.
[034] The terms “comprise,” “have” and “include” are open-ended linking verbs. Any forms or tenses of one or more of these verbs, such as “comprises,” “comprising,” “has,” “having,” “includes” and “including,” are also open-ended. For example, any method that “comprises,” “has” or “includes” one or more steps is not
limited to possessing only those one or more steps and can also cover other unlisted steps. Similarly, any composition that “comprises,” “has” or “includes” one or more features is not limited to possessing only those one or more features and can cover other unlisted features. All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g. “such as”) provided with respect to certain embodiments herein is intended merely to better illuminate the present disclosure and does not pose a limitation on the scope of the present disclosure otherwise claimed. No language in the specification should be construed as indicating any non-claimed element as essential to the practice of the present disclosure.
[035] The term “consisting essentially of’ limits the scope of a claim to the specified materials or steps “and those that do not materially affect the basic and novel characteristic(s)” of the claimed invention. In re Herz, 537 F.2d 549, 551-52, 190 USPQ 461, 463 (CCPA 1976) (emphasis in original) (Prior art hydraulic fluid required a dispersant which appellants argued was excluded from claims limited to a functional fluid “consisting essentially of’ certain components).
[036] The term “consisting of’ refers to compositions, methods, and respective components thereof as described herein, which are exclusive of any element not recited in that description of the embodiment.
[037] Wherever aspects are described herein with the language "comprising," otherwise analogous aspects described in terms of "consisting of and/or "consisting essentially of are also provided.
[038] The terms “disease” or “disorder” are used interchangeably herein, and refers to any alternation in state of the body or of some of the organs, interrupting or disturbing the performance of the functions and/or causing symptoms such as discomfort, dysfunction, distress, or even death to the person afflicted or those in contact with a person. A disease or disorder can also related to a distemper, ailing, ailment, malady, sickness, illness, complaint, indisposition, or affection.
[039] The term “effective amount” as used herein refers to the amount of therapeutic agent (for example, a modified RNA), or composition, sufficient to reduce at least one or more symptom(s) of the disease or disorder, or to provide the desired effect. For example, it can be the amount that effects a therapeutically or prophylactically significant reduction in a symptom or clinical marker associated with a cardiac dysfunction or other disorder when administered to a typical patient who has a cardiovascular condition, or other disease or disorder.
[040] As used herein, “expression” of a nucleic acid sequence refers to one or more of the following events: (1) production of an RNA template from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5' cap formation, and/or 3' end processing); (3) translation of an RNA into a polypeptide or protein; and (4) post-translational modification of a polypeptide or protein.
[041] The term “pharmaceutical composition” as used herein refers to a type of composition that comprises a pharmaceutical mixture or solution containing an active pharmaceutical ingredient (for example, a modified RNA), together with pharmaceutically acceptable excipients suitable to be administered to a mammal (e.g., a human in need thereof) via a particular route of administration. For example, a
“pharmaceutical composition” as used herein can be specifically formulated to include suitable delivery agents and/or other pharmaceutically acceptable carriers for administration via one or more of a number of routes, such as via intramuscular, intradermal, subcutaneous, or intracardiac route, through a portal vein catheter, through a coronary sinus catheter, and/or by direct administration into the area to be treated.
[042] As used herein, the term “modified RNA” refers to RNA molecules containing one, two, or more than two nucleoside modifications comparing to adenosine (A) ((2A,3A,45',5A)-2-(6-amino-9Z/-purin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol), guanosine (G) (2-Amino-9-[3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-3Z/-purin-6- one), cytidine (C) (4-amino-l-[3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-2- yl]pyrimidin-2-one), and uridine (U) (l-[(3A,45,5A)-3,4-dihydroxy-5- (hydroxymethyl)oxolan-2-yl]pyrimidine-2, 4-dione), or compared to AMP, GMP, CMP, and UMP, in RNA molecules, or a portion thereof. Non-limiting examples of nucleoside modifications are provided elsewhere in this specification. Where the nucleotide sequence of a particular claimed RNA is otherwise identical to the sequence of a naturally-existing RNA molecule, the modified RNA is understood to be an RNA molecule with at least one modification different from those existing in the natural counterpart. The difference can be either in the chemical change to the nucleoside/nucleotide or in the position of that change within the sequence. In one embodiment, the modified RNA is modified messenger RNA (or “modified mRNA”).
[043] As used herein, the term “nucleic acid,” in its broadest sense, includes any compound and/or substance that comprises a polymer of nucleotides linked via a phosphodiester bond. These polymers are often referred to as oligonucleotides or
polynucleotides, depending on the size. The terms “polynucleotide sequence” and
“nucleotide sequence” are also used interchangeably herein.
[044] The phrase “pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio. Drugapproval agencies (e.g., EMA, US-FDA) provide guidance and approve pharmaceutically acceptable compounds, materials, compositions, and/or dosage forms. Examples can be listed in Pharmacopeias.
[045] The phrase “pharmaceutically acceptable excipient” is employed herein to refer to a pharmaceutically acceptable material chosen from a solvent, dispersion media, diluent, dispersion, suspension aid, surface active agent, isotonic agent, thickening or emulsifying agent, preservative, core-shell nanoparticles, polymer, peptide, protein, cell, hyaluronidase, and mixtures thereof. In some embodiments, the solvent is an aqueous solvent.
[046] As used herein, “polypeptide” means a polymer of amino acid residues (natural or unnatural) linked together most often by peptide bonds. The term, as used herein, refers to proteins, polypeptides, and peptides of any size, structure, or function. A polypeptide may be a single molecule or may be a multi-molecular complex such as a dimer, trimer or tetramer. They may also comprise single chain or multichain polypeptides such as antibodies or insulin and may be associated or linked. Most commonly disulfide linkages are found in multichain polypeptides. The term polypeptide
may also apply to amino acid polymers in which one or more amino acid residues are an artificial chemical analogue of a corresponding naturally occurring amino acid.
[047] As used herein, “protein” is a polymer consisting essentially of any of the 20 amino acids. Although “polypeptide” is often used in reference to relatively large polypeptides, and “peptide” is often used in reference to small polypeptides, usage of these terms in the art overlaps and is varied. The terms “peptide(s)”, “protein(s)” and “polypeptide(s)” are sometime used interchangeably herein.
[048] The term “recombinant,” as used herein, means that a protein is derived from a prokaryotic or eukaryotic expression system through the use of a nucleic acid that has been genetically manipulated by the introduction of a “heterologous nucleic acid” or the alteration of a native nucleic acid.
[049] The term “statistically significant” or “significantly” refers to statistical significance. The term refers to statistical evidence that there is a difference. It can be defined as the probability of making a decision to reject the null hypothesis when the null hypothesis is actually true. The decision is often made using the p-value. Any other measure of significant significance that is well-known in the art can be used.
[050] The term “patient” refers to an animal, for example a human, to whom treatment, including prophylactic treatment, with methods and compositions described herein, is or are provided. For treatment of those conditions or disease states which are specific for a specific animal such as a human patient, the term “patient” refers to that specific animal.
[051] As used herein, a patient who is “suffering from” a disease, disorder, and/or condition has been diagnosed with or displays one or more symptoms of a disease,
disorder, and/or condition. In some embodiments, a patient may be at risk of suffering from a disease, disorder and/or condition.
[052] The term “tissue” refers to a group or layer of similarly specialized cells which together perform certain special functions. The term “tissue-specific” refers to a source or defining characteristic of cells from a specific tissue.
[053] As used herein, the terms “treat” or “treatment” or “treating” refers to therapeutic treatment, wherein the object is to prevent or slow the development of the disease, such as slow down the development of a cardiac disorder, or reducing at least one adverse effect or symptom of a vascular condition, disease or disorder, such as, any disorder characterized by insufficient or undesired cardiac function.
[054] It should be understood that this disclosure is not limited to the particular methodology, protocols, and reagents, etc., described herein and as such can vary. The terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present disclosure, which is defined solely by the claims.
5.2. Compositions
[055] In one embodiment there is provided a composition for use in the methods disclosed herein, wherein the composition comprises a modified RNA that encodes a VEGF-A polypeptide.
[056] It will be appreciated by those of skill in the art that for any particular VEGF gene there may exist one or more variants or isoforms. Non-limiting examples of VEGF-A polypeptides in accordance with the present disclosure are listed in Table 1. It will be appreciated by those of skill in the art that the sequences disclosed in the Table 1
contain potential flanking regions. These are encoded in each nucleotide sequence either to the 5’ (upstream) or 3’ (downstream) of the open reading frame. The open reading frame is definitively and specifically disclosed by teaching the nucleotide reference sequence. It is also possible to further characterize the 5' and 3' flanking regions by utilizing one or more available databases or algorithms. Databases have annotated the features contained in the flanking regions of the NCBI sequences and these are available in the art.
[057] It will be appreciated by those of skill in the art that modified RNA encoding a VEGF-A polypeptide, e.g., a human VEGF-A polypeptide, can be designed according to the VEGF-A mRNA isoforms listed in the Table 1. One of ordinary of skill in the art is generally familiar with the multiple isoforms of the remaining VEGF family members.
[058] In one embodiment, the VEGF-A polypeptide comprises an amino acid sequence at least 95%, or at least 98%, or 100% identical to the amino acid sequence of SEQ ID NO: 3, wherein the amino acid sequence has VEGF-A activity. In one embodiment, the VEGF-A polypeptide is VEGF-Aies. In one embodiment, the VEGF-A polypeptide consists of an amino acid sequence identical to SEQ ID NO: 3.
[059] In one embodiment, the modified RNA has an open reading frame (ORF) comprising or consisting of the nucleotide sequence of SEQ ID NO: 2. In one embodiment, the modified RNA comprises a nucleotide sequence at least 95%, or at least
98%, or 100% identical to a nucleotide sequence selected from SEQ ID NOs: 1 and 4-7. In one embodiment, the modified RNA consists of a nucleotide sequence selected from SEQ ID NOs: 1 and 4-7. In one embodiment, the modified RNA consists of the nucleotide sequence of SEQ ID NO: 1. In one embodiment, the modified RNA consists of the nucleotide sequence of SEQ ID NO: 4.
[060] Naturally occurring RNAs are synthesized from four basic ribonucleotides: ATP, CTP, UTP and GTP, but may contain post-transcriptionally modified nucleotides. Further, approximately one hundred different nucleoside modifications have been identified in RNA (Rozenski, J, Crain, P, and McCloskey, J., The RNA Modification Database: 1999 update, Nucl Acids Res, (1999) 27: 196-197).
[061] According to the present disclosure, these RNAs are preferably modified as to avoid the deficiencies of other RNA molecules of the art (e.g., activating the innate immune response and rapid degradation upon administration). Hence, these polynucleotides are referred to as modified RNA. In some embodiments, the modified RNA contains one or more chemical modifications to one or more of the natural nucleotides AMP, CMP, UMP and GMP. In some embodiments, the modified RNA avoids the innate immune response upon administration to a patient. In some embodiments, the half-life of the modified RNA is extended compared to an unmodified RNA.
[062] In preferred embodiments, the modified RNA is a modified messenger
RNA (mRNA). As used herein, the term “messenger RNA” (mRNA) refers to any polynucleotide that encodes a polypeptide of interest and that is capable of being
translated to produce the encoded polypeptide of interest in vitro, in vivo, in situ or ex vivo.
[063] Traditionally, the basic components of an mRNA molecule include at least a coding region (including an open reading frame (ORF)), a 5’ untranslated region (UTR), a 3’ untranslated region (UTR), a 5’ cap and a poly-(A) tail. Building on this wild type modular structure, the present disclosure expands the scope of functionality of traditional mRNA molecules by providing polynucleotides or primary RNA constructs which maintain a modular organization, but which comprise one or more structural and/or chemical modifications or alterations that impart useful properties to the polynucleotide including, in some embodiments, the lack of a substantial induction of the innate immune response of a cell into which the polynucleotide is introduced.
[064] The modified RNAs can include any useful modification relative to the standard RNA nucleotide chain, such as to the sugar, the nucleobase (e.g., one or more modifications of a nucleobase, such as by replacing or substituting an atom of a pyrimidine nucleobase with optionally substituted amino, optionally substituted thiol, optionally substituted alkyl (e.g., methyl or ethyl), or halo (e.g., chloro or fluoro), or the internucleoside linkage (e.g., one or more modification to the phosphodiester backbone). The modified RNAs can optionally include other agents (e.g., RNAi-inducing agents, RNAi agents, siRNA, shRNA, miRNA, antisense RNA, ribozymes, catalytic DNA, tRNA, RNA that induce triple helix formation, aptamers, vectors, etc.).
[065] U.S. Patent Application Publication No. 2014/0073687 discloses exemplary modified RNAs with several useful modifications, for example, at least one or more modified nucleosides chosen from 5-methylcytidine (5mC), N6-methyladenosine
(m6A), 3,2’-O-dimethyluridine (m4U), 2-thiouridine (s2U), 2’ fluorouridine, pseudouridine, 2 ’-O-m ethyluridine (Um), 2’ deoxy uridine (2’ dU), 4-thiouridine (s4U), 5 -methyluridine (m5U), 2’-O-methyladenosine (m6A), N6,2’-O-dimethyladenosine (m6Am), N6,N6,2’-O-trimethyladenosine (m62Am), 2’-O-methylcytidine (Cm), 7- methylguanosine (m7G), 2’ -O-m ethyl guanosine (Gm), N2,7-dimethylguanosine (m- 2,7G), N2,N2,7-trimethylguanosine (m-2,2,7G). Additional modifications are described in U.S. Patent Application Publication No. 2015/0051268, filed on October 7, 2014 and U.S. Patent No. 9,061,059, filed on February 3, 2014. Accordingly, all of these modifications are incorporated herein in their entirety by reference. Additional modifications are described herein.
[066] In one embodiment, the present disclosure provides for a modified RNA encoding a VEGF-A polypeptide (e.g., SEQ ID NO: 3). In some embodiments, a modified RNA encodes a VEGF-A polypeptide, wherein the modified RNA comprises a nucleotide sequence selected from SEQ ID NOs: 1 and 4-7. In some embodiments, the modified RNA further comprises a 5’ cap, a 5’ UTR, a 3’ UTR, a poly(A) tail, or any combination thereof. In some embodiments, the 5’ cap, the 5’ UTR, the 3’ UTR, the poly(A) tail, or any combination thereof may include one or more modified nucleotides.
[067] In some embodiments, a modified RNA encoding a VEGF-A polypeptide can include, for example, at least one of the UMP is modified to form Nl- methyl-pseudo-UMP. In some embodiments, the Nl-methyl-pseudo-UMP is present instead of UMP in a percentage of the UMPs in the sequence chosen from 0.1%, 1%,
2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%
70%, 75%, 80%, 85%, 90%, 95%, 99.9%, and 100%. In some embodiments, all UMP have been replaced by N1 -methyl -pseudo-UMP.
[068] In some embodiments, the modified RNA encoding a VEGF-A polypeptide can include, for example, at least one of the CMP is modified to form methyl-CMP. In some embodiments, the methyl-CMP is present instead of CMP in a percentage of the CMPs in the sequence chosen from 0.1%, 2%, 3%, 4%, 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99.9%, and 100%. In some embodiments, all CMP have been replaced by 5- methyl-CMP.
[069] In some embodiments, the modified RNA encoding a VEGF-A polypeptide can include, for example, at least one of the AMP is modified to form N6- methyl-AMP. In some embodiments, the N6-methyl-AMP is present instead of AMP in a percentage of the AMPs in the sequence chosen from 0.1%, 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99.9%, and 100%. In some embodiments, all AMP have been replaced by N6- methyl-AMP.
[070] In some embodiments, the modified RNA can include, for example, at least one of the GMP is modified to form 7-methyl-GMP. In some embodiments, the 7- methyl-GMP is present instead of GMP in a percentage of the GMPs in the sequence chosen from 0.1%, 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99.9%, and 100%. In some embodiments, all GMP have been replaced by 7-methyl-GMP.
[071] In some embodiments, the modified RNA encoding a VEGF-A polypeptide can include, for example, at least one or more modified nucleosides chosen from 5-methylcytidine (5mC), N6-methyladenosine (m6A), 3,2’-O-dimethyluridine (m4U), 2-thiouridine (s2U), 2’ fluorouridine, pseudouridine, 2’ -O-m ethyluridine (Um), 2’ deoxy uridine (2’ dU), 4-thiouridine (s4U), 5-methyluridine (m5U), 2’-O- methyladenosine (m6A), N6,2’-O-dimethyladenosine (m6Am), N6,N6,2’-O- trimethyladenosine (m62Am), 2’ -O-m ethylcytidine (Cm), 7-methylguanosine (m7G), 2’- O-methylguanosine (Gm), N2,7-dimethylguanosine (m-2,7G), N2,N2,7- trimethylguanosine (m-2,2,7G), and Nl-methyl-pseudouridine, or any combination thereof. Each possibility and combination represents a separate embodiment of the present disclosure.
[072] In some embodiments, modified RNAs comprise a modification to a 5' cap, such as a 5’ diguanosine cap or 5’ 7-methylguanosine cap. In some embodiments, modified RNAs have a Capl 5’ terminal cap. In some embodiments, modified RNAs comprise a modification to a coding region. In some embodiments, modified RNAs comprise a modification to a 5’ UTR. In some embodiments, modified RNAs comprise a modification to a 3’ UTR. In some embodiments, modified RNAs comprise a modification to a poly-(A) tail. In some embodiments, modified RNAs comprise any combination of modifications to a coding region, 5’ cap, 5’ UTR, 3’ UTR, or poly-(A) tail. In some embodiments, a modified RNA can optionally be treated with an alkaline phosphatase.
[073] In some embodiments, the modified RNA comprises a Capl 5 '-terminal cap, a 5' UTR, the ORF sequence encodes a VEGF-A polypeptide (e.g., consisting of the
amino acid sequence of SEQ ID NO: 3), a 3' UTR, and a poly(A) tail (e.g., about 100 nucleotides in length), wherein all uracils in the modified RNA are
N1 -methylpseudouracils.
[074] In one embodiment the composition is a pharmaceutical composition further comprising a pharmaceutically acceptable excipient.
[075] In one embodiment, the composition may further comprise a buffer. In one embodiment, the composition may further comprise a citrate saline buffer. In one embodiment, the citrate saline buffer has a pH of pH 6 to pH 7. In one embodiment, the citrate saline buffer has a pH of about pH 6.5. In one embodiment, the citrate saline buffer has a citrate concentration of 5 to 15 mmol/L, optionally about 10 mmol/L. In one embodiment, the citrate saline buffer has a sodium chloride concentration of 100 to 160 mmol/L, optionally about 130 mmol/L. In one embodiment, the citrate saline buffer is a sodium citrate/sodium chloride buffer.
[076] In some embodiments, the composition does not comprise a lipid. In some embodiments, the composition does not comprise a lipid nanoparticle. In some embodiments, the citrate saline buffer is substantially free of divalent cations, including calcium and magnesium. In some embodiments, the citrate saline buffer contains no calcium or magnesium.
5.3. Treating Patients Suffering from Diseases Responsive to VEGF-A Therapy
[077] In one embodiment, there is provided a method of treating a condition selected from heart failure with reduced ejection fraction; heart failure with preserved ejection fraction; post-MI cardiac dysfunction; and ischemic heart disease in a patient in
need thereof comprising administering to the patient an effective amount of a composition comprising a modified RNA in accordance with the present disclosure. In some embodiments, the condition is selected from heart failure with reduced ejection fraction; post-MI cardiac dysfunction; and ischemic heart disease. In some embodiments, the condition is heart failure with reduced ejection fraction.
[078] In one embodiment, there is provided a method of increasing the left ventricular ejection fraction (LVEF) in a patient comprising administering to the patient an effective amount of a composition comprising a modified RNA in accordance with the present disclosure; wherein the patient has a left ventricular ejection fraction (LVEF) of less than or equal to 40% prior to treatment with the modified RNA that encodes a VEGF-A polypeptide.
[079] In one embodiment, there is provided a method of improving the quality of life of a patient diagnosed with heart failure with reduced ejection fraction; heart failure with preserved ejection fraction; post-MI cardiac dysfunction; and/or ischemic heart disease comprising administering to the patient an effective amount of a composition comprising a modified RNA in accordance with the present disclosure, wherein the improvement in the quality of life of the patient is characterised by an increase in one or more patient reported outcome scores relative to before administration of the composition, wherein the patient reported outcome scores are (a) Kansas City Cardiomyopathy Questionnaire (KCCQ) Overall Summary Score; (b) Seattle Angina Questionnaire (SAQ) Physical Limitation Score; (c) SAQ Quality of Life Score; and (d) SAQ Treatment Satisfaction Score. In some embodiments, the patient is diagnosed with heart failure with reduced ejection fraction; post-MI cardiac dysfunction; and ischemic
heart disease. In some embodiments, the patient is diagnosed with heart failure with reduced ejection fraction.
[080] In one embodiment, there is provided a method of improving the ventricular wall motion in the heart of a patient in need thereof comprising administering to the patient an effective amount of a composition comprising a modified RNA in accordance with the present disclosure.
[081] The following embodiments apply equally to one or more of the methods disclosed herein:
[082] Heart failure (HF) occurs when the heart is weakened and is not filled with, or cannot pump, enough blood to meet the body's needs for blood and oxygen and the heart itself is perhaps poorly perfused. Patients with ischemic heart disease (IHD) have heart problems caused by narrowed heart arteries limiting the blood supply to the heart and thus limiting the amount of oxygen that reaches the heart muscle. Another consequence of poor circulation is seen in patients with microvascular dysfunction, loss of functional vessels, and/or loss of cardiac tissue, frequently seen in patients with post- myocardial infarction (post-MI) or other forms of cardiomyopathies. These conditions are routinely clinically diagnosed based on various physical examinations with confirmation by echocardiography, blood tests, magnetic resonance imaging (MRI) electrocardiography, and other suitable tests. Accordingly, a treatment for any one of these conditions is working if the patient shows less severe symptoms by physical examinations and/or improvements in testing results from echocardiography, blood tests, MRI, electrocardiography, or any other suitable and/or routine tests.
[083] In some embodiments, the patient has a condition selected from heart failure with reduced ejection fraction; heart failure with preserved ejection fraction; post- MI cardiac dysfunction; and ischemic heart disease. In some embodiments, the patient has a condition selected from heart failure with reduced ejection fraction; post-MI cardiac dysfunction; and ischemic heart disease. In some embodiments, the patient has heart failure with reduced ejection fraction.
[084] In some embodiments, the patient has suffered a myocardial infarction and/or has severe multivessel disease limiting blood supply to the heart. In some embodiments, the patient has suffered a myocardial infarction. In some embodiments, the patient has suffered a myocardial infarction within about one month prior to treatment with the compositions disclosed herein.
[085] In some embodiments, the myocardial infarction triggers activation of Epicardium-derived cells (EPDC) over time. In some embodiments, the patient suffering a myocardial infarction is treated with the compositions disclosed herein several days after the myocardial infarction, preferably at the peak time of EPDC activation. In some embodiments, the patient suffering a myocardial infarction is treated with the compositions disclosed herein about 7 days after the myocardial infarction. In some embodiments, the patient suffering a myocardial infarction is treated with the compositions disclosed herein about 10 days after the myocardial infarction, 2 weeks after the myocardial infarction, 3 weeks after the myocardial infarction, or 6 weeks after the myocardial infarction.
[086] In some embodiments, the patient also suffers from coronary artery disease, high blood pressure, diabetes, atrial fibrillation, valvular heart disease, cardiomyopathy or an infection.
[087] In some embodiments, the patient has a left ventricular ejection fraction (LVEF) of less than or equal to 40% prior to administration of the composition. In some embodiments, the patient has a left ventricular ejection fraction (LVEF) of less than or equal to 35% prior to administration of the composition; optionally less than or equal to 30% prior to administration of the composition; optionally less than or equal to 25% prior to administration of the composition.
[088] In some embodiments, the LVEF of the patient is increased by greater than 10% after administration of the composition. In some embodiments, the LVEF of the patient is increased by 15% or greater after administration of the composition; optionally 20% or greater after administration of the composition. In some embodiments, the increase in LVEF occurs within 6 months after administration of the composition; optionally within 3 months after administration of the composition.
[089] In some embodiments, the LVEF of the patient is increased to 55% or greater after administration of the composition. In some embodiments, the LVEF of the patient is increased to 60% or greater after administration of the composition. In some embodiments, the LVEF of the patient is increased to a normal level after administration of the composition. In some embodiments, the increased LVEF occurs within 6 months after administration of the composition; optionally within 3 months after administration of the composition.
[090] In some embodiments, the LVEF of the patient is determined by echocardiography, radionuclide ventriculography, contrast angiography, and/or cardiac MRI. In some embodiments, the LVEF of the patient is determined by echocardiography.
[091] In some embodiments, the method improves the quality of life of the patient as characterised by an increase in one or more patient reported outcome scores relative to before administration of the composition, wherein the patient reported outcome scores are (a) KCCQ Overall Summary Score; (b) SAQ Physical Limitation Score; (c) SAQ Quality of Life Score; and (d) SAQ Treatment Satisfaction Score.
[092] In some embodiments, the method improves the quality of life of the patient as characterised by an increase in the patient’s KCCQ Overall Summary Score relative to before administration of the composition. In some embodiments, the method improves the quality of life of the patient as characterised by an increase in the patient’s SAQ Physical Limitation Score relative to before administration of the composition. In some embodiments, the method improves the quality of life of the patient as characterised by an increase in the patient’s SAQ Quality of Life Score relative to before administration of the composition. In some embodiments, the method improves the quality of life of the patient as characterised by an increase in the patient’s SAQ Treatment Satisfaction Score relative to before administration of the composition.
[093] In some embodiments, the KCCQ Overall Summary Score is increased by at least 5 points relative to before administration of the composition; optionally increased by at least 10 points; optionally increased by at least 12 points; optionally increased by at least 14 points. In some embodiments, the SAQ Physical Limitation Score is increased by at least 10 points relative to before administration of the composition;
optionally increased by at least 15 points; optionally increased by at least 20 points; optionally increased by at least 30 points. In some embodiments, the SAQ Quality of Life Score is increased at least 10 points relative to before administration of the composition; optionally at least 20 points; optionally at least 30 points. In some embodiments, the SAQ Treatment Satisfaction Score is increased by at least 5 points relative to before administration of the composition.
[094] In some embodiments, the method improves the quality of life of the patient as characterised by an increase in one or more patient reported outcome scores relative to placebo, wherein the patient reported outcome scores are (a) KCCQ Overall Summary Score; (b) SAQ Physical Limitation Score; (c) SAQ Quality of Life Score; and (d) SAQ Treatment Satisfaction Score.
[095] In some embodiments, the method improves the quality of life of the patient as characterised by an increase in the patient’s KCCQ Overall Summary Score relative to placebo. In some embodiments, the method improves the quality of life of the patient as characterised by an increase in the patient’s SAQ Physical Limitation Score relative to placebo. In some embodiments, the method improves the quality of life of the patient as characterised by an increase in the patient’s SAQ Quality of Life Score relative to placebo. In some embodiments, the method improves the quality of life of the patient as characterised by an increase in the patient’s SAQ Treatment Satisfaction Score relative to placebo.
[096] In some embodiments, the KCCQ Overall Summary Score is increased by at least 5 points relative to placebo; optionally increased by at least 10 points; optionally increased by at least 12 points; optionally increased by at least 14 points. In
some embodiments, the SAQ Physical Limitation Score is increased by at least 10 points relative to placebo; optionally increased by at least 15 points; optionally increased by at least 20 points; optionally increased by at least 30 points. In some embodiments, the SAQ Quality of Life Score is increased at least 10 points relative to placebo; optionally at least 20 points; optionally at least 30 points. In some embodiments, the SAQ Treatment Satisfaction Score is increased by at least 5 points relative to placebo.
[097] In some embodiments, the increase in one or more patient reported outcome scores occurs within 6 months after administration of the composition. In some embodiments, the increase in one or more patient reported outcome scores occurs within 3 months after administration of the composition, optionally within 1 month after administration of the composition.
[098] In some embodiments, the composition is injected into a normal, hypokinetic or akinetic ventricular segment of the heart of the patient. In some embodiments, the composition is injected into a hypokinetic or akinetic ventricular segment of the heart of the patient. In some embodiments, the composition is injected into a hypokinetic ventricular segment of the heart of the patient. In some embodiments, the composition is injected into an akinetic ventricular segment of the heart of the patient.
[099] In some embodiments, the composition is injected into a hypokinetic ventricular segment of the heart of the patient, and the injected segment improves to normal wall motion within 6 months after administration of the composition, optionally within 3 months after administration of the composition. In some embodiments, the composition is injected into a akinetic ventricular segment of the heart of the patient, and the injected segment improves to hypokinetic or normal wall motion within 6 months
after administration of the composition, optionally within 3 months after administration of the composition.
[0100] In some embodiments, the composition is injected into one or more ventricular segments of the heart of the patient, and one or more non-injected hypokinetic ventricular segments improve to normal wall motion within 6 months after administration of the composition, optionally within 3 months after administration of the composition. In some embodiments, the one or more non-injected ventricular segments are adjacent to the injected ventricular segment.
[0101] In some embodiments, the composition is injected into one or more ventricular segments of the heart of the patient, and one or more non-injected akinetic ventricular segments improves to hypokinetic or normal wall motion within 6 months after administration of the composition, optionally within 3 months after administration of the composition. In some embodiments, the one or more non-injected ventricular segments are adjacent to the injected ventricular segment.
[0102] In some embodiments, the patient has a New York Heart Association (NYHA) heart failure classification of I, II, III or IV prior to administration of the composition. In some embodiments, the patient has a NYHA heart failure classification of II, III or IV prior to administration of the composition. In some embodiments, the patient has a NYHA heart failure classification of III or IV prior to administration of the composition. In some embodiments, the patient has a NYHA heart failure classification of II prior to administration of the composition. In some embodiments, the patient has a NYHA heart failure classification of III prior to administration of the composition. In
some embodiments, the patient has a NYHA heart failure classification of IV prior to administration of the composition.
[0103] In some embodiments, the patient’s NYHA heart failure classification improves within 6 months after administration of the composition, optionally within 3 months after administration of the composition, optionally within 1 month after administration of the composition. In some embodiments, the patient has a NYHA heart failure classification of I or II within 6 months after administration of the composition, optionally within 3 months after administration of the composition, optionally within 1 month after administration of the composition. In some embodiments, the patient has a NYHA heart failure classification of I within 6 months after administration of the composition, optionally within 3 months after administration of the composition, optionally within 1 month after administration of the composition.
[0104] In some embodiments, the patient has a Canadian Cardiovascular Society (CCS) angina classification of I, II, III or IV prior to administration of the composition. In some embodiments, the patient has a CCS angina classification of II, III or IV prior to administration of the composition. In some embodiments, the patient has a CCS angina classification of III or IV prior to administration of the composition. In some embodiments, the patient has a CCS angina classification of II prior to administration of the composition. In some embodiments, the patient has a CCS angina classification of III prior to administration of the composition. In some embodiments, the patient has a CCS angina classification of IV prior to administration of the composition.
[0105] In some embodiments, the patient’s CCS angina classification improves within 6 months after administration of the composition, optionally within 3 months after
administration of the composition, optionally within 1 month after administration of the composition. In some embodiments, the patient has a CCS angina classification of I or II within 6 months after administration of the composition, optionally within 3 months after administration of the composition, optionally within 1 month after administration of the composition. In some embodiments, the patient has a CCS angina classification of I within 6 months after administration of the composition, optionally within 3 months after administration of the composition, optionally within 1 month after administration of the composition.
[0106] In some embodiments, the patient has a coronary flow reserve of less than 2.5 prior to administration of the composition. In some embodiments, the patient has a coronary flow reserve of less than 2.0 prior to administration of the composition.
[0107] In some embodiments, the patient is undergoing coronary artery bypass graft (CABG) surgery. In some embodiments, the composition is administered during coronary artery bypass graft (CABG) surgery.
[0108] In some embodiments, the composition is administered to the patient by epicardial injection. In some embodiments, the composition is administered to the patient by epicardial injection into one or more segments of the left ventricle. In some embodiments, the composition is administered to the patient by epicardial injection at a fixed-dosage in multiple administrations. In some embodiments, the composition is administered to the patient by epicardial injection at a fixed-dosage in 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more administrations. In some embodiments, the composition is administered to the patient by epicardial injection at a fixed-dosage in 30 administrations. The “multiple
administrations” can be separated from each other by short (1 second to 1 minute) medium (more than 1 minute to 30 minutes), or long (more than 30 minutes to 1 hour) intervals of time.
[0109] The composition may be administered to the patient using any amount of the composition effective for treating a disease, disorder, and/or condition. The exact amount required will vary from patient to patient, depending on the species, age, and general condition of the patient, the severity of the disease, the particular composition, its mode of administration, its mode of activity, and the like. It will be understood, however, that the total daily usage of the compositions may be decided by the attending physician within the scope of sound medical judgment. The specific pharmaceutically effective, dose level for any particular patient will depend upon a variety of factors including the disease being treated and the severity of the disease; the activity of the specific compound employed; the specific formulation employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the specific compound employed; the duration of the treatment; drugs (for example, a modified RNA) used in combination or coincidental with the specific compound employed; and like factors well known in the medical arts.
[0110] In some embodiments, the concentration of the modified RNA in the composition is between 0.1 and 5 mg/mL. In some embodiments, the concentration of the modified RNA in the composition is between 0.5 and 5 mg/mL. In some embodiments, the concentration of the modified RNA in the composition is about 0.5 mg/mL. In some embodiments, the concentration of the modified RNA in the composition is about 5 mg/mL.
[0111] In some embodiments, the composition may be administered at fixed- dosage levels of modified RNA. For example, the composition may be administered at fixed-dosage levels from about 0.1 mg to about 1 mg of modified RNA, per administration. In some embodiments, the composition is administered at a fixed-dosage level of about 0.1 mg of modified RNA per administration. In some embodiments, the composition is administered at a fixed-dosage level of about 1 mg of modified RNA per administration. In some embodiments, the composition is administered at a fixed-dosage level of about 1 mg to about 30 mg total dose of modified RNA. In some embodiments, the composition is administered at a fixed-dosage level of about 3 mg to about 30 mg total dose of modified RNA. In some embodiments, the composition is administered at a fixed-dosage level of about 3 mg total dose of modified RNA. In some embodiments, the composition is administered at a fixed-dosage level of about 30 mg total dose of modified RNA. In some embodiments, the composition is administered as about 30 administrations of about 0.1 mg of modified RNA per administration.
[0112] In some embodiments, the composition is injected into an ischemic area of the myocardium. In some embodiments, the ischemic area is a region with stress myocardial blood flow < 2.3±0.3 mL/g/min or < 80±10% of the segment with highest stress myocardial blood flow. In some embodiments, the ischemic area is a region with stress myocardial blood flow < 2.6 mL/g/min or < 90% of the segment with highest stress myocardial blood flow. In some embodiments, the ischemic area is a region with stress myocardial blood flow < 2.3 mL/g/min or < 80% of the segment with highest stress myocardial blood flow. In some embodiments, the stress myocardial blood flow is determined by 15O-water PET.
[0113] In some embodiments, the composition is injected into an ischemic but viable area of the myocardium. In some embodiments, ischemic but viable area is a region with resting myocardial blood flow above 0.6 mL/g/min. In some embodiments, ischemic but viable area is a region with resting myocardial blood flow above 0.6 mL/g/min and stress myocardial blood flow < 2.3±0.3 mL/g/min or < 80±10% of the segment with highest stress myocardial blood flow. In some embodiments, the resting myocardial blood flow is determined by 15O-water PET.
[0114] In some embodiments, the patient does not have a region of ischemic non-viable myocardium. In some embodiments, the ischemic non-viable myocardium is a region with resting myocardial blood flow of < 0.6 mL/g/min. In some embodiments, the resting myocardial blood flow is determined by 15O-water PET.
[0115] Ischemic areas of the myocardium, and viable and non-viable ischemic areas of the myocardium may be identified by various methods known in the art (for example, see Garcia et al. Circ Cardiovasc Imaging. 2020, 13, e000053). In some embodiments, ischemic areas of the myocardium, and viable and non-viable ischemic areas of the myocardium may be identified by single-photon emission computed tomography (SPECT); positron emission tomography (PET) with one or more perfusion agents, for example 15O-water, 82Rb perfusion agents, 13N-ammonia and 18F perfusion agents; perfusion cardiac magnetic resonance imaging; echocardiography; cardiac computerized tomography (CT); and/or invasive coronary angiography. In some embodiments, ischemic areas of the myocardium, and viable and non-viable ischemic areas of the myocardium may be identified by 15O-water PET.
[0116] In some embodiments, the stress myocardial blood flow of the injected area is not increased by more than 20% at 3 months after administration of the composition compared to before administration of the composition, optionally not increased by more than 10% at 3 months after administration of the composition compared to before administration of the composition. In some embodiments, the stress myocardial blood flow is determined by 15O-water PET.
[0117] In some embodiments, the resting myocardial blood flow of the injected area is not increased by more than 20% at 3 months after administration of the composition compared to before administration of the composition, optionally not increased by more than 10% at 3 months after administration of the composition compared to before administration of the composition. In some embodiments, the resting myocardial blood flow is determined by 15O-water PET.
[0118] In some embodiments, the global stress myocardial blood flow is not increased by more than 20% at 3 months after administration of the composition compared to before administration of the composition, optionally not increased by more than 10% at 3 months after administration of the composition compared to before administration of the composition. In some embodiments, the global stress myocardial blood flow is determined by 15O-water PET.
[0119] In some embodiments, the global resting myocardial blood flow is not increased by more than 20% at 3 months after administration of the composition compared to before administration of the composition, optionally not increased by more than 10% at 3 months after administration of the composition compared to before
administration of the composition. In some embodiments, the global resting myocardial blood flow is determined by 15O-water PET.
[0120] Global myocardial blood flow at stress and/or rest, and/or myocardial blood flow in the treated area at stress and/or rest may be determined by various techniques known in the art, for example, by single-photon emission computed tomography (SPECT); positron emission tomography (PET) with one or more perfusion agents, for example 15O-water, 82Rb perfusion agents, 13N-ammonia and 18F perfusion agents; perfusion cardiac magnetic resonance imaging; echocardiography; cardiac computerized tomography (CT); and/or invasive coronary angiography.
[0121] In some embodiments, administration of the composition does not induce ventricular arrhythmia in the patient. In some embodiments, administration of the composition does not induce severe ventricular arrhythmia in the patient.
[0122] All of the claims in the claim listing are herein incorporated by reference into the specification in their entireties as additional embodiments.
6. EXAMPLES
EXAMPLE 1
EPICCURE Phase 2a Clinical Trial Results
Overview
[0123] EPICCURE (ClinicalTrials.gov: NCT03370887) was a randomized, placebo-controlled, double-blind, multicenter, 6-month, phase 2a clinical trial of the safety, tolerability and exploratory efficacy of epicardial injections of a modified mRNA that encodes a VEGF-A polypeptide in patients with stable coronary artery disease and moderately decreased left ventricular ejection fraction (LVEF) who are undergoing
coronary artery bypass grafting (CABG) surgery. In this Example, results from the EPICCURE phase 2a clinical study are provided.
VEGF-A modified mRNA
[0124] The VEGF-A mRNA referred to in this Example is modified mRNA (SEQ ID NO: 1) encoding VEGF-Aies (SEQ ID NO: 3), and was manufactured in compliance with current Good Manufacturing Practices (GMP) by in vitro transcription using a linearized plasmid DNA template, nucleotide triphosphates and purified enzymes, followed by purification and filtration. The VEGF-A mRNA was used in this Example as a citrate/saline solution (pH 6.5, 10 mmol/L sodium citrate, 130 mmol/L sodium chloride) at a concentration of 0.5 mg/mL VEGF-A mRNA. The composition of the formulation is as described in Table 2.
Ethics and Conduct
[0125] EPICCURE is registered on ClinicalTrials.gov (identifier:
NCT03370887), and conformed to the principles of the Declaration of Helsinki, the International Conference on Harmonisation Good Clinical Practice, the AstraZeneca policy on Bioethics and Human Biological Samples and all applicable regulatory
requirements. Local ethics committees reviewed and approved the study protocol, and participants give their written informed consent before study enrollment. A 10-minute extension of cardioplegia was considered ethically acceptable to allow epicardial injections after completion of the peripheral anastomoses.
Objectives
[0126] The primary objective of EPICCURE was to assess the safety and tolerability of VEGF-A mRNA. Primary outcome measures included the following:
• Serious adverse events
• Adverse events
• Vital signs (blood pressure, pulse, pulse oximetry)
• ECG
• Physical examination
• Laboratory assessments (hematology, clinical chemistry and urinalysis)
• Hemopericardium and/or tamponade assessment, and LVEF with echocar di ography
• Coagulation and use of concomitant medication
[0127] Exploratory objectives included the following:
• To assess the effect of VEGF-A mRNA in patients undergoing CABG surgery on regional and global sMBF measured with 15O-water PET imaging.
To assess the effect of VEGF-A mRNA on global LVEF by echocar di ography .
• To assess the effect of VEGF-A mRNA on regional myocardial wall motion measured by echocardiography and strain analysis in patients undergoing CABG surgery
• To assess the effect of VEGF-A mRNA on clinical symptoms in terms of New York Heart Association (NYHA) class, Seattle Angina Questionnaire (SAQ) and Kansas City Cardiomyopathy Questionnaire (KCCQ)
Participants
• For inclusion in the study patients should have fulfilled the following criteria at Visit 1 and/or 2:
■ Provision of signed and dated informed consent prior to any study specific procedures;
• Males and females:
• a. Males must be surgically sterile or using an acceptable method of contraception
• b. Females must be of non-childbearing potential confirmed at screening by fulfilling one of the following criteria a) postmenopausal defined as amenorrhoea for at least 12 months or more following cessation of all exogenous hormonal treatments and follicle-stimulating hormone (FSH) levels in the postmenopausal range, b) documentation of irreversible surgical sterilisation by hysterectomy, bilateral oophorectomy or bilateral salpingectomy but not tubal ligation
• Age >18 years
• Indication for elective CABG surgery enrolled at least 15 days before the planned surgery
• Moderately reduced global LVEF at rest (30% < LVEF < 50%) from medical records
• If patient is on statin, ACE inhibitor/ ARB, and/or beta-blocker, the dose should be stable at least 2 weeks prior to Visit 1
• Patients who are blood donors should not donate blood during the study and for 3 months following their last dose of VEGF-A mRNA.
Exclusion criteria
[0128] Patients should not enter the study if any of the following exclusion criteria are fulfilled:
• Involvement in the planning and/or conduct of the study
• Previous randomisation in the present study
• Participation in another clinical study with an investigational product during the last 3 months
• BMI > 35 kg/m2 OR poor image window for echocardiography
• Need for CABG emergency operation. (Emergency operation is defined as significant symptom status worsening in CAD, such as crescendo angina, unstable angina or ACS requiring rescheduling the revascularization. CAD should be stable at least 3 months prior to Visit 3.)
• History of ventricular arrhythmia (> Lown III) without Implantable Cardiac Defibrillator (ICD)
History of any clinically significant disease or disorder which, in the opinion of the PI, may either put the patient at risk because of participation in the study, or influence the results or the patient’s ability to participate in the study
• Severe co-morbidities that can interfere with the execution of the study, interpretation of study results or affect the safety of the patient, in judgement of the investigator
• eGFR < 30 mL/min (derived from creatinine clearance, calculated by local lab)
• For CFVR (Visit 1) and sMBF (Visit 2) measurement: o Known severe adverse reactions to adenosine o Known elevated intracranial pressure o AV block > second degree and/or sick sinus syndrome in patient without pacemaker o Heart rate < 40 bpm (ECG verified) o Systolic blood pressure < 90 mmHg o Asthma or COPD with strong reactive component in judgement of investigator o Treatment with dipyridamole (e.g. Persantin or Asasantin), theophyllamine or fluvoxamine that cannot be paused
• Inability to comply with the protocol
• History of severe allergy/hypersensitivity or ongoing clinically important allergy /hypersensitivity to drugs with a similar chemical structure or class as study drugs
Patients unable to give their consent or communicate reliably with the investigator or vulnerable patients e.g., kept in detention, protected adults under guardianship, trusteeship, or committed to an institution by governmental or juridical order
• Positive hepatitis C antibody hepatitis B virus surface antigen or hepatitis B virus core antibody or human immunodeficiency virus, at Visit 1
• Known history of drug or alcohol abuse
• Any concomitant medications that are known to be associated with Torsades de Pointes
• History of QT prolongation associated with other medications that required discontinuation of that medication
• Congenital long QT syndrome
• History of arrhythmia (multifocal premature ventricular contractions, bigeminy, trigeminy, ventricular tachycardia), which is symptomatic or requires treatment (CTCAE Grade 3).
• Current atrial fibrillation as well as paroxysmal atrial fibrillation.
Randomization and Blinding
[0129] 11 participants were enrolled into the study. Enrolled participants were randomized to receive VEGF-A mRNA (3 mg total dose) or placebo in a ratio of 2: 1 at least 14 days before coronary artery bypass grafting. Within the cohort, two sentinel participants were randomized 1 : 1 to VEGF-A mRNA or placebo, followed by another two sentinel participants randomized 1 : 1 to VEGF-A mRNA or placebo, followed by the remaining seven participants randomized 3 : 1 to VEGF-A mRNA (n = 5) or placebo (n = 2). In total, 7 patients received VEGF-A mRNA (3 mg total dose), and 4 patients received placebo (n = 4). Safety data from up to 1 month after administration were reviewed by a safety review committee before the treatment of participants in the next sentinel subgroup.
[0130] Participants and the study team remained blinded to treatment assignments throughout the study. Investigators remained blinded unless they needed to know a patient’s assigned treatment in a medical emergency. The safety review committee was unblinded. Placebo solution for injection matched the appearance of VEGF-A mRNA, so the identity of the treatment cannot be discerned.
Procedures
[0131] The Schedule of assessments for enrollment, treatment and follow-up periods is described in Table 3:
[0132] At baseline (Visit 2), participants had a 15O-water PET scan to quantify pre-operative myocardial blood flow at rest and during adenosine stress. This was paired with the baseline contrast-enhanced coronary computed tomography (CT) angiogram to generate a perfusion map that combines coronary anatomy and myocardial blood flow. Ischemic regions were identified as those with stress myocardial blood flow below 2.3 mL/g/min (± 0.3 mL/g/min), or below 80% (± 10%) of the segment with highest stress myocardial blood flow on 15O-water PET (see Kajander, SA et al, Circ Cardiovasc Imaging, 2011, 4, 678-684; and Danad, I et al., J Am Coll Cardiol, 2014, 64, 1464- 1475). Target regions of ischemic but viable myocardium were identified as ischemic regions with resting myocardial blood flow above 0.6 mL/g/min (i.e. >60% of normal myocardium resting blood flow of 1 mL/g/min) on 15O-water PET. On the individualized injection map, 30 epicardial injection sites with approximately 1 cm spacing were identified within the target regions (Fig. 9B provides an example of such an injection map).
[0133] During surgery, participants received 30 epicardial injections of 200 pL volume each, guided by their individualized injection map to target ischemic but viable myocardial regions. Injections were given under cardioplegia immediately after bypass grafting and before reperfusion. Participants received their randomly assigned treatment of VEGF-A mRNA (3 mg total of VEGF-A mRNA; 0.1 mg per injection site; 0.5 mg/mL solution), or matching placebo.
[0134] Injections were performed using a 30G (approximately 0.3 mm diameter) x 13 mm hypodermic needle coupled to a 1 mL syringe. Comments were recorded on the presence or absence of potential or suspected perforation, potential sustained bleeding at the injection site, and other adverse events.
[0135] Patients remained in hospital for at least 4 days after surgery, and then attended follow-up Visits 5, 6 and 7 to assess safety and efficacy. Adverse events were also assessed by telephone interviews at Visit 4.
Safety Outcomes
[0136] Safety outcomes included monitoring of adverse events and serious adverse events, physical examinations, electrocardiography, monitoring of vital signs (blood pressure, pulse, oxygen saturation), laboratory assessments, and echocardiographic assessment of hemopericardium, tamponade, and left ventricular ejection fraction. Adverse events were recorded from coronary artery bypass grafting until the end of follow-up and serious adverse events were recorded from informed consent until the end of follow-up. All adverse events were followed up by the investigator until resolved or for as long as medically indicated. Investigators assessed whether adverse events were causally related to the investigational medical product and also whether serious adverse events were causally related to other medications, to study procedures and to the drug injection procedure.
Exploratory Outcomes
Cardiac Imaging
[0137] Regional and global stress myocardial blood flow and myocardial flow reserve (stress-to-rest ratio in myocardial blood flow) was assessed using 15O-water PET
at baseline (Visit 2) and at Visits 5 and 6 (see Kajander, SA et al, Circ Cardiovasc Imaging, 2011, 4, 678-684; and Danad, I et al., J Am Coll Cardiol, 2014, 64, 1464- 1475). Participants also had follow-up CT angiograms 3 months after surgery.
[0138] Regional wall motion, global longitudinal strain, and cardiac volumes were assessed using comprehensive echocardiography at baseline (Visit 1) and at Visits 5, 6 and 7. Comprehensive echocardiographic examination was performed with patients in the left recumbent position at rest. Standard clinical cardiac transducers were used for B-mode, colour Doppler, and tissue Doppler imaging. CINE-loops (a CINE-loop is a period of images, stored digitally as a sequence of individual frames) of the parasternal long- and short- axis views, apical 4-, 2-, and 3-chamber views, and subcostal views were obtained and stored for off-line analysis of cardiac structure and function. Doppler and tissue Doppler echocardiography was performed to obtain indices necessary for comprehensive assessment of left ventricular (LV) diastolic function and non-invasive hemodynamic measurements.
Clinical and Functional Outcomes
[0139] Patients completed the Kansas City Cardiomyopathy Questionnaire (Green, CP et al., J Am Coll Cardiol 2000, 35, 1245-1255) and the Seattle Angina Questionnaire (Spertus, JA et al, J Am Coll Cardiol 1995, 25, 333-341), and investigators performed New York Heart Association classifications (The Criteria Committee of the New York Heart Association (1994). Nomenclature and Criteria for Diagnosis of Diseases of the Heart and Great Vessels (9th Ed.). Little, Brown & Co.: Boston) at baseline (Visit 1) and at Visits 5, 6 and 7 after surgery.
RESULTS
[0140] The characteristics of the patients in the clinical study are described in
Table 4:
Study Outcomes
Safety
[0141] No deaths were reported during the study. Two serious adverse events were recorded in the group receiving VEGF-A mRNA, but neither of these serious adverse events was related to the drug. No serious adverse events were recorded in the placebo group. No unexpected adverse events were observed in the group receiving VEGF-A mRNA. Ventricular arrhythmia was observed in one patient in the group receiving VEGF-A mRNA, but this was prior to giving the drug and related to acute thrombosis in a grafted artery. No severe arrhythmia was otherwise observed.
Exploratory outcomes
[0142] Change in LVEF (LSMean) from baseline was greater in the group receiving VEGF-A mRNA (3 mg) by 9.367% relative to placebo (95% CI, -2.251 to 20.986; P, 0.108). LVEF change from baseline for each patient group is shown in Table 5. LVEF was measured by echocardiography using Simpson’s biplane method.
Table 5: Echocardiography assessment: left ventricular ejection fraction
(LVEF) at Visit 7, mixed model repeated measures (MMRM)
[0143] Fig. 1 shows the LVEF (Echocardiography (rest/hyperaemia), Biplane Simpson) of individual patients in the study as measured at Visit 1 (baseline) and at Visits 5, 6 and 7.
[0144] Change in global stress myocardial blood flow (as measured by 15O- water PET) was less in the group receiving VEGF-A mRNA (3 mg) by 0.3075 mL/g/min relative to placebo (95% CI, -0.8788 to 0.2639; P, 0.254). Change in global stress myocardial blood flow from baseline for each patient group is shown in Table 6.
Table 6: 15O-water PET assessment: global stress myocardial blood flow
[0145] Fig. 2 shows the 15O-water PET global stress myocardial blood flow of individual patients in the study as measured at Visit 2 (baseline) and at Visits 5 and 6.
[0146] Change in regional stress myocardial blood flow (as measured by 15O- water PET) in the treated area was similar for the group treated with VEGF-A mRNA (3 mg) relative to placebo (LSmean of difference = 0.0272 mL/g/min; 95% CI, -0.5912 to
0.6456; P, 0.923). Change in regional stress myocardial blood flow in the treated area from baseline for each patient group is shown in Table 7.
Table 7: 15O-water PET assessment: regional stress myocardial blood flow
(tMBFs) in the treated area at Visit 6, mixed model repeated measures
[0147] Fig. 3 shows the 15O-water PET regional stress myocardial blood flow in the treated area of individual patients in the study as measured at Visit 2 (baseline) and at Visits 5 and 6.
[0148] Fig. 4 shows the global rest myocardial blood flow of individual patients in the study as measured at Visit 2 (baseline) and at Visits 5 and 6.
[0149] Fig. 5 shows the regional rest myocardial blood flow in the treated area of individual patients in the study as measured at Visit 2 (baseline) and at Visits 5 and 6.
[0150] Fig. 6 shows the treated area coronary flow reserve of individual patients in the study as measured at Visit 2 (baseline) and at Visits 5 and 6.
Patient Reported Outcomes
[0151] Patients completed the Kansas City Cardiomyopathy Questionnaire and the Seattle Angina Questionnaire at baseline (Visit 1) and at Visits 5, 6 and 7 after surgery. The Physical Limitation Scores (PLS), Treatment Satisfaction Scores (TSS), Quality of Life Scores (QoLS), Angina Stability Scores (ASS) and Angina Frequency Scores (AFS) from the Seattle Angina Questionnaires are provided in Table 8, Table 9, Table 10, Table 11 and Table 12, respectively. The Overall Summary Scores from the Kansas City Cardiomyopathy Questionnaires are presented in Table 13.
[0152] The mean SAQ Physical limitation score (PLS), SAQ Treatment satisfaction score (TSS), SAQ Quality of life score (QoLS) and SAQ Angina stability score (ASS) over time are presented in Figs. 7A, 7B, 7C and 7D, respectively.
[0153] The mean KCCQ Overall summary score over time is presented in Fig. 8.
Patient 1
[0154] One patient in the study had a LVEF of less than 40% at baseline (Visit 1), and this patient received treatment with VEGF-A mRNA (3 mg). This patient is identified as “Patient 1” herein, and the data corresponding to Patient 1 are marked in bold in Figs. 1-6.
[0155] Patient 1 is a 61 -years old male with coronary artery disease, an exsmoker, and had hypertension and positive family history. Patient 1 had a history of pulmonary emphysema and impaired lung functions.
[0156] A coronary angiogram of Patient 1 indicated significant stenosis in LAD ostium, LCX and chronic total occlusion in RCA. In a preoperative echo study, the LVEF was 30-35%, and the low LVEF was due to akinetic anterior wall and anterior septum. Patient l’s ECG revealed signs of previous anterior infarct.
[0157] Fig. 9A is the 15O-water PET image from Patient 1 recorded at Visit 2 showing the pre-operative suggested area for treatment. Fig. 9B is the 15O-water PET image showing the injection map for Patient 1. The injections (30 points between the LAD and the LOM coronary arteries) were spaced about 1 cm from each other in midmyocardium, but not in the ventricular septum (the injected area was within the following left ventricular segments: basal anterior, basal inferolateral, basal anterolateral, mid anterior, mid inferolateral and mid anterolateral). The area with most damage (ventricular septum) was not treated directly by injections as this area is not accessible during CABG surgery.
[0158] Following surgery, a remarkable increase was observed in the LVEF of Patient 1, increasing from 26.92% at Baseline (Visit 1), to 39.62% at 1 month post treatment (Visit 5), 47.63% at 3 months post treatment (Visit 6), and 59.48% at 6 months post treatment (Visit 7). The increase in the LVEF of Patient 1 over time is illustrated in Fig. 11 A. The increase in LVEF of Patient 1 is particularly remarkable since it is known that LVEF is not necessarily increased by CABG surgery (Adachi et al. Int Heart J, 2016, 57(5), 565-72).
[0159] The 15O-water PET blood flow measurements for Patient 1 at Baseline (Visit 2), Visit 5 and Visit 6 are shown in Table 14. Despite the significant increase in LVEF, the observed global myocardial blood flow at rest and stress, and the observed myocardial blood flow in the treated area at rest and stress did not change significantly.
Table 14: 15O-water PET blood flow measurements for Patient 1
[0160] Fig. 10A shows the 15O-water PET myocardial blood flow (divided into segments of the left ventricle) of Patient 1 at Baseline (Visit 2) at rest (left image) and
under stress (right image). Fig. 10B shows the 15O-water PET myocardial blood flow (divided into segments of the left ventricle) of Patient 1 at 3 months after surgery (Visit 6) at rest (left image) and under stress (right image).
[0161] The left-ventricular regional wall motion of Patient 1 was recorded by echocardiography, and scored according to: 0 = Unable to score; 1 = Normal; 2 = Hypokinetic; 3 = Akinetic; 4 = Dyskinetic; and 5 = Aneurysmal. The regional wall motion scores at Baseline (Visit 1), 3 months after treatment (Visit 6) and 6 months after treatment (Visit 7) are provided in Table 15.
[0162] Patient 1 completed the Kansas City Cardiomyopathy Questionnaire and the Seattle Angina Questionnaire at baseline (Visit 1) and at Visits 5, 6 and 7 after surgery. The scores from the two questionnaires are provided in Table 16.
[0163] The KCCQ and SAQ scores of Patient 1 over time are illustrated in Fig. 11B.
[0164] Investigators performed New York Heart Association classifications for Patient 1 at baseline (Visit 1) and at Visits 5, 6 and 7 after surgery. The NYHA score of Patient 1 was III at Visit 1; I at Visit 5; I at Visit 6; and II at Visit 7.
7. SEQUENCE LISTING
[0165] SEQ ID NO: 1: Modified RNA encoding VEGF-A used in Example
1:
5 ’ 7MeGppPG2’OMeGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGA GCCACCAUGAACUUUCUGCUGUCUUGGGUGCAUUGGAGCCUUGCCUUGCU GCUCUACCUCCACCAUGCCAAGUGGUCCCAGGCUGCACCCAUGGCAGAAGG AGGAGGGCAGAAUCAUCACGAAGUGGUGAAGUUCAUGGAUGUCUAUCAGC GCAGCUACUGCCAUCCAAUCGAGACCCUGGUGGACAUCUUCCAGGAGUACC CUGAUGAGAUCGAGUACAUCUUCAAGCCAUCCUGUGUGCCCCUGAUGCGA UGCGGGGGCUGCUGCAAUGACGAGGGCCUGGAGUGUGUGCCCACUGAGGA GUCCAACAUCACCAUGCAGAUUAUGCGGAUCAAACCUCACCAAGGCCAGCA CAUAGGAGAGAUGAGCUUCCUACAGCACAACAAAUGUGAAUGCAGACCAA AGAAAGAUAGAGCAAGACAAGAAAAUCCCUGUGGGCCUUGCUCAGAGCGG AGAAAGCAUUUGUUUGUACAAGAUCCGCAGACGUGUAAAUGUUCCUGCAA AAACACAGACUCGCGUUGCAAGGCGAGGCAGCUUGAGUUAAACGAACGUA CUUGCAGAUGUGACAAGCCGAGGCGGUGAUAAUAGGCUGGAGCCUCGGUG GCCAUGCUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGC ACCCGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGCAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAUCUAGo H3’ (SEQ ID NO: 1)
Wherein:
A, C, G & U= AMP, CMP, GMP & Nl-methyl-pseudoUMP, respectively Me = methyl p = inorganic phosphate
[0166] SEQ ID NO: 2: ORF of modified RNA encoding VEGF-A used in the Examples (excluding the stop codon):
AUGAACUUUCUGCUGUCUUGGGUGCAUUGGAGCCUUGCCUUGCUGCUCUA CCUCCACCAUGCCAAGUGGUCCCAGGCUGCACCCAUGGCAGAAGGAGGAGG GCAGAAUCAUCACGAAGUGGUGAAGUUCAUGGAUGUCUAUCAGCGCAGCU ACUGCCAUCCAAUCGAGACCCUGGUGGACAUCUUCCAGGAGUACCCUGAUG AGAUCGAGUACAUCUUCAAGCCAUCCUGUGUGCCCCUGAUGCGAUGCGGG GGCUGCUGCAAUGACGAGGGCCUGGAGUGUGUGCCCACUGAGGAGUCCAA CAUCACCAUGCAGAUUAUGCGGAUCAAACCUCACCAAGGCCAGCACAUAGG AGAGAUGAGCUUCCUACAGCACAACAAAUGUGAAUGCAGACCAAAGAAAG AUAGAGCAAGACAAGAAAAUCCCUGUGGGCCUUGCUCAGAGCGGAGAAAG CAUUUGUUUGUACAAGAUCCGCAGACGUGUAAAUGUUCCUGCAAAAACAC AGACUCGCGUUGCAAGGCGAGGCAGCUUGAGUUAAACGAACGUACUUGCA GAUGUGACAAGCCGAGGCGG (SEQ ID NO: 2)
Wherein:
A, C, G & U= AMP, CMP, GMP & Nl-methyl-pseudoUMP, respectively
[0167] SEQ ID NO: 3: Amino acid sequence of human VEGF-A isoform
VEGF-A165
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSY CHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMR IKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCK CSCKNTDSRCKARQLELNERTCRCDKPRR (SEQ ID NO: 3)
[0168] SEQ ID NO: 4: A modified RNA encoding VEGF-A
5 ’ 7MeGpPP A2’oMeGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGA GCCACCAUGAACUUUCUGCUGUCUUGGGUGCAUUGGAGCCUUGCCUUGCU GCUCUACCUCCACCAUGCCAAGUGGUCCCAGGCUGCACCCAUGGCAGAAGG AGGAGGGCAGAAUCAUCACGAAGUGGUGAAGUUCAUGGAUGUCUAUCAGC GCAGCUACUGCCAUCCAAUCGAGACCCUGGUGGACAUCUUCCAGGAGUACC CUGAUGAGAUCGAGUACAUCUUCAAGCCAUCCUGUGUGCCCCUGAUGCGA UGCGGGGGCUGCUGCAAUGACGAGGGCCUGGAGUGUGUGCCCACUGAGGA GUCCAACAUCACCAUGCAGAUUAUGCGGAUCAAACCUCACCAAGGCCAGCA CAUAGGAGAGAUGAGCUUCCUACAGCACAACAAAUGUGAAUGCAGACCAA AGAAAGAUAGAGCAAGACAAGAAAAUCCCUGUGGGCCUUGCUCAGAGCGG AGAAAGCAUUUGUUUGUACAAGAUCCGCAGACGUGUAAAUGUUCCUGCAA AAACACAGACUCGCGUUGCAAGGCGAGGCAGCUUGAGUUAAACGAACGUA CUUGCAGAUGUGACAAGCCGAGGCGGUGAUAAUAGGCUGGAGCCUCGGUG GCCAUGCUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGC ACCCGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGCAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAUCUAGo H3’ (SEQ ID NO: 4)
Wherein:
A, C, G & U= AMP, CMP, GMP & Nl-methyl-pseudoUMP, respectively Me = methyl p = inorganic phosphate
[0169] SEQ ID NO: 5: A modified RNA encoding VEGF-A
5 ’ 7MeGppPG2’OMe AGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAG
AGCCACCAUGAACUUUCUGCUGUCUUGGGUGCAUUGGAGCCUUGCCUUGC
UGCUCUACCUCCACCAUGCCAAGUGGUCCCAGGCUGCACCCAUGGCAGAAG GAGGAGGGCAGAAUCAUCACGAAGUGGUGAAGUUCAUGGAUGUCUAUCAG
CGCAGCUACUGCCAUCCAAUCGAGACCCUGGUGGACAUCUUCCAGGAGUAC
CCUGAUGAGAUCGAGUACAUCUUCAAGCCAUCCUGUGUGCCCCUGAUGCG
AUGCGGGGGCUGCUGCAAUGACGAGGGCCUGGAGUGUGUGCCCACUGAGG
AGUCCAACAUCACCAUGCAGAUUAUGCGGAUCAAACCUCACCAAGGCCAGC
ACAUAGGAGAGAUGAGCUUCCUACAGCACAACAAAUGUGAAUGCAGACCA
AAGAAAGAUAGAGCAAGACAAGAAAAUCCCUGUGGGCCUUGCUCAGAGCG
GAGAAAGCAUUUGUUUGUACAAGAUCCGCAGACGUGUAAAUGUUCCUGCA
AAAACACAGACUCGCGUUGCAAGGCGAGGCAGCUUGAGUUAAACGAACGU
ACUUGCAGAUGUGACAAGCCGAGGCGGUGAUAAUAGGCUGGAGCCUCGGU
GGCCAUGCUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCU
GCACCCGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGCAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAUCU
AGOH3’ (SEQ ID NO: 5)
Wherein:
A, C, G & U= AMP, CMP, GMP & Nl-methyl-pseudoUMP, respectively
Me = methyl p = inorganic phosphate
[0170] SEQ ID NO: 6: A modified RNA encoding VEGF-A
5 ’ 7MeGppPGGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCC
ACCAUGAACUUUCUCCUUUCUUGGGUGCAUUGGAGCCUUGCCUUGUUACU
CUACCUCCACCACGCCAAGUGGUCCCAGGCCGCACCCAUGGCAGAAGGAGG
AGGGCAGAAUCAUCACGAAGUGGUGAAGUUCAUGGACGUCUAUCAGCGCA
GCUACUGCCAUCCAAUCGAGACACUGGUGGACAUCUUCCAGGAGUACCCUG
AUGAGAUCGAGUACAUCUUCAAGCCAUCCUGUGUGCCCCUGAUGCGAUGC
GGCGGCUGCUGCAAUGACGAGGGCCUGGAGUGUGUGCCUACUGAGGAGUC
CAACAUCACCAUGCAGAUUAUGCGGAUCAAACCUCACCAAGGCCAGCACAU
AGGAGAGAUGAGCUUCCUACAGCACAACAAAUGUGAAUGCAGACCAAAGA
AAGAUAGAGCAAGACAAGAGAAUCCCUGUGGGCCUUGCUCAGAGCGGAGA
AAGCAUUUGUUUGUACAAGAUCCGCAGACGUGUAAAUGUUCCUGCAAGAA
CACAGACUCGCGUUGCAAGGCGAGGCAGCUUGAGUUAAACGAACGUACUU
GCAGAUGUGACAAGCCGAGGCGGUGAUAAUAGGCUGGAGCCUCGGUGGCC
AUGCUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGCACC
CGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGCAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAUCUAG3’
(SEQ ID NO: 6)
Wherein:
A, C, G & U= AMP, CMP, GMP & Nl-methyl-pseudoUMP, respectively
Me = methyl p = inorganic phosphate
[0171] SEQ ID NO: 7: A modified RNA encoding VEGF-A
5 ’ 7MeGpPP AGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAA AUAUAAGAGCC
ACCAUGAACUUUCUGCUGUCUUGGGUGCAUUGGAGCCUUGCCUUGCUGCU
CUACCUCCACCAUGCCAAGUGGUCCCAGGCUGCACCCAUGGCAGAAGGAGG
AGGGCAGAAUCAUCACGAAGUGGUGAAGUUCAUGGAUGUCUAUCAGCGCA
GCUACUGCCAUCCAAUCGAGACCCUGGUGGACAUCUUCCAGGAGUACCCUG
AUGAGAUCGAGUACAUCUUCAAGCCAUCCUGUGUGCCCCUGAUGCGAUGC
GGGGGCUGCUGCAAUGACGAGGGCCUGGAGUGUGUGCCCACUGAGGAGUC
CAACAUCACCAUGCAGAUUAUGCGGAUCAAACCUCACCAAGGCCAGCACAU
AGGAGAGAUGAGCUUCCUACAGCACAACAAAUGUGAAUGCAGACCAAAGA
AAGAUAGAGCAAGACAAGAAAAUCCCUGUGGGCCUUGCUCAGAGCGGAGA
AAGCAUUUGUUUGUACAAGAUCCGCAGACGUGUAAAUGUUCCUGCAAAAA
CACAGACUCGCGUUGCAAGGCGAGGCAGCUUGAGUUAAACGAACGUACUU
GCAGAUGUGACAAGCCGAGGCGGUGAUAAUAGGCUGGAGCCUCGGUGGCC
AUGCUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGCACC
CGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGCAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAUCUAG3’
(SEQ ID NO: 7)
Wherein:
A, C, G & U= AMP, CMP, GMP & Nl-methyl-pseudoUMP, respectively
Me = methyl p = inorganic phosphate
Claims
1. A method of treating a condition selected from heart failure with reduced ejection fraction; heart failure with preserved ejection fraction; post-MI cardiac dysfunction; and ischemic heart disease in a patient in need thereof comprising administering to the patient an effective amount of a composition comprising a modified RNA that encodes a VEGF-A polypeptide.
2. A method of increasing the left ventricular ejection fraction (LVEF) in a patient comprising administering to the patient an effective amount of a composition comprising a modified RNA that encodes a VEGF-A polypeptide; wherein the patient has a left ventricular ejection fraction (LVEF) of less than or equal to 40% prior to treatment with the modified RNA that encodes a VEGF-A polypeptide.
3. A method of improving the quality of life of a patient diagnosed with heart failure with reduced ejection fraction; heart failure with preserved ejection fraction; post- MI cardiac dysfunction; and/or ischemic heart disease comprising administering to the patient an effective amount of a composition comprising a modified RNA that encodes a VEGF-A polypeptide, wherein the improvement in the quality of life of the patient is characterised by an increase in one or more patient reported outcome scores relative to before administration of the composition, wherein the patient reported outcome scores are (a) KCCQ Overall Summary Score; (b) SAQ Physical Limitation Score; (c) SAQ Quality of Life Score; and (d) SAQ Treatment Satisfaction Score.
4. A method of improving the ventricular wall motion in the heart of a patient in need thereof comprising administering to the patient an effective amount of a composition comprising a modified RNA that encodes a VEGF-A polypeptide.
66
5. The method of any one of the preceding claims, wherein the patient has a left ventricular ejection fraction (LVEF) of less than or equal to 40% prior to administration of the composition.
6. The method of claim 5, wherein the LVEF is less than or equal to 35%, 30%, or 25% prior to administration of the composition.
7. The method of any one of the preceding claims, wherein the LVEF of the patient is increased by greater than 10%, optionally 15% or greater, optionally 20% or greater after administration of the composition.
8. The method of any one of the preceding claims, wherein the LVEF of the patient is increased to 55% or greater after administration of the composition, optionally 60% or greater after administration of the composition.
9. The method of any one of claims 7-8, wherein the increased LVEF occurs within 6 months after administration of the composition; optionally within 3 months after administration of the composition.
10. The method of any one of claims 2 and 5-9, wherein the LVEF is determined by echocardiography, radionuclide ventriculography, contrast angiography, and/or cardiac MRI; optionally by echocardiography.
11. The method of any one of the previous claims, wherein the method improves the quality of life of the patient as characterised by an increase in one or more patient reported outcome scores relative to before administration of the composition, wherein the patient reported outcome scores are (a) KCCQ Overall Summary Score; (b) SAQ Physical Limitation Score; (c) S AQ Quality of Life Score; and (d) S AQ Treatment
Satisfaction Score.
67
12. The method of any one of the previous claims, wherein the method improves the quality of life of the patient as characterised by an increase in one or more patient reported outcome scores relative to placebo, wherein the patient reported outcome scores are (a) KCCQ Overall Summary Score; (b) SAQ Physical Limitation Score; (c) SAQ Quality of Life Score; and (d) SAQ Treatment Satisfaction Score.
13. The method of any one of claims 3 and 11-12, wherein the increase in one or more patient reported outcome scores occurs within 6 months after administration of the composition, optionally within 3 months, optionally within 1 month.
14. The method of any one of claims 3 and 11-13, wherein the KCCQ Overall Summary Score is increased by at least 5 points relative to before administration of the composition; optionally increased by at least 10 points; optionally increased by at least 12 points; optionally increased by at least 14 points.
15. The method of any one of claims 3 and 11-14, wherein the SAQ Physical Limitation Score is increased by at least 10 points relative to before administration of the composition; optionally increased by at least 15 points; optionally increased by at least 20 points; optionally increased by at least 30 points.
16. The method of any one of claims 3 and 11-15, wherein the SAQ Quality of Life Score is increased at least 10 points relative to before administration of the composition; optionally at least 20 points; optionally at least 30 points.
17. The method of any one of claims 3 and 11-16, wherein the SAQ Treatment
Satisfaction Score is increased by at least 5 points relative to before administration of the composition.
68
18. The method of any one of the preceding claims, wherein the composition is injected into a hypokinetic or akinetic ventricular segment of the heart of the patient.
19. The method of any one of the preceding claims, wherein the composition is injected into a hypokinetic ventricular segment of the heart of the patient, and the injected segment improves to normal wall motion within 6 months after administration of the composition, optionally within 3 months.
20. The method of any one of the preceding claims, wherein the composition is injected into a akinetic ventricular segment of the heart of the patient, and the injected segment improves to hypokinetic or normal wall motion within 6 months after administration of the composition, optionally within 3 months.
21. The method of any one of the preceding claims, wherein the composition is injected into one or more ventricular segments of the heart of the patient, and one or more non-injected hypokinetic ventricular segments improve to normal wall motion within 6 months after administration of the composition, optionally within 3 months.
22. The method of any one of the preceding claims, wherein the composition is injected into one or more ventricular segments of the heart of the patient, and one or more non-injected akinetic ventricular segments improve to hypokinetic or normal wall motion within 6 months after administration of the composition, optionally within 3 months.
23. The method of claim 21 or 22, wherein the one or more non-injected ventricular segments are adjacent to the injected ventricular segment.
24. The method of any one of the preceding claims, wherein the patient has a
New York Heart Association (NYHA) heart failure classification of II, III or IV.
69
25. The method of any one of the preceding claims, wherein the patient has a
NYHA heart failure classification of III or IV.
26. The method of any one of the preceding claims, wherein the patient is undergoing coronary artery bypass graft (CABG) surgery.
27. The method of any one of the preceding claims, wherein the composition is administered during coronary artery bypass graft (CABG) surgery.
28. The method of any one of the preceding claims, wherein the composition is administered to the patient by epicardial injection.
29. The method of any one of the preceding claims, wherein the composition is administered to the patient by epicardial injection into one or more segments of the left ventricle.
30. The method of any one of the preceding claims, wherein the composition is administered to the patient by epicardial injection at a fixed-dosage in multiple administrations.
31. The method of any one of the preceding claims, wherein the composition is injected into an ischemic area of the myocardium.
32. The method of claim 31, wherein the ischemic area is a region with stress myocardial blood flow < 2.3±0.3 mL/g/min or < 80±10% of the segment with highest stress myocardial blood flow.
33. The method of any one of the preceding claims, wherein the composition is injected into an ischemic but viable area of the myocardium.
34. The method of claim 33, wherein the ischemic but viable area is a region with resting myocardial blood flow above 0.6 mL/g/min.
70
35. The method of any one of the preceding claims, wherein the patient does not have a region of ischemic non-viable myocardium.
36. The method of claim 35, wherein the region of ischemic non-viable myocardium is a region with resting myocardial blood flow of < 0.6 mL/g/min.
37. The method of any one of the preceding claims, wherein the stress myocardial blood flow of the injected area is not increased by more than 20% at 3 months after administration of the composition compared to before administration of the composition, optionally not increased by more than 10% at 3 months after administration of the composition compared to before administration of the composition.
38. The method of any one of the preceding claims, wherein the resting myocardial blood flow of the injected area is not increased by more than 20% at 3 months after administration of the composition compared to before administration of the composition, optionally not increased by more than 10% at 3 months after administration of the composition compared to before administration of the composition.
39. The method of any one of the preceding claims, wherein the global stress myocardial blood flow is not increased by more than 20% at 3 months after administration of the composition compared to before administration of the composition, optionally not increased by more than 10% at 3 months after administration of the composition compared to before administration of the composition.
40. The method of any one of the preceding claims, wherein the global resting myocardial blood flow is not increased by more than 20% at 3 months after administration of the composition compared to before administration of the composition, optionally not
71
increased by more than 10% at 3 months after administration of the composition compared to before administration of the composition.
41. The method of any one of claims 32-40, wherein the stress and/or resting myocardial blood flow is determined by 15O-water PET.
42. The method of any one of the preceding claims, wherein administration of the composition does not induce ventricular arrythmia.
43. The method of any one of the preceding claims, wherein the VEGF-A polypeptide comprises an amino acid sequence at least 95%, or at least 98%, or 100% identical to the amino acid sequence of SEQ ID NO: 3, wherein the amino acid sequence has VEGF-A activity.
44. The method of any one of the preceding claims, wherein the VEGF-A polypeptide consists of an amino acid sequence identical to SEQ ID NO: 3.
45. The method of any one of the preceding claims, wherein the modified RNA has an open reading frame (ORF) comprising or consisting of the nucleotide sequence of SEQ ID NO: 2.
46. The method of any one of the preceding claims, wherein the modified RNA comprises a nucleotide sequence at least 95%, or at least 98%, or 100% identical to a nucleotide sequence selected from SEQ ID NOs: 1 and 4-7.
47. The method of any one of the preceding claims, wherein the modified RNA consists of a nucleotide sequence selected from SEQ ID NOs: 1 and 4-7, optionally wherein the modified RNA consists of the nucleotide sequence of SEQ ID NO: 1, optionally wherein the modified RNA consists of the nucleotide sequence of SEQ ID NO: 4.
48. The method of any one of the preceding claims, wherein the modified RNA is a modified mRNA.
49. The method of any one of the preceding claims, wherein the composition comprises a citrate saline buffer.
50. The method of claim 49, wherein the citrate saline buffer is pH 6 to pH 7, optionally about pH 6.5.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202163262398P | 2021-10-12 | 2021-10-12 | |
US63/262,398 | 2021-10-12 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2023061985A2 true WO2023061985A2 (en) | 2023-04-20 |
WO2023061985A3 WO2023061985A3 (en) | 2023-05-25 |
Family
ID=84360355
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2022/078199 WO2023061985A2 (en) | 2021-10-12 | 2022-10-11 | Compositions comprising modified rna encoding vegf-a and methods of use |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2023061985A2 (en) |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20140073687A1 (en) | 2011-04-03 | 2014-03-13 | Immune Disease Institute, Inc. | Efficient protein expression in vivo using modified rna (mod-rna) |
US20150051268A1 (en) | 2011-12-21 | 2015-02-19 | Moderna Therapeutics, Inc. | Methods of increasing the viability or longevity of an organ or organ explant |
US9061059B2 (en) | 2012-04-02 | 2015-06-23 | Moderna Therapeutics, Inc. | Modified polynucleotides for treating protein deficiency |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP3464338B1 (en) * | 2016-06-07 | 2021-07-21 | Modernatx, Inc. | Modified rna encoding vegf-a polypeptides, formulations, and uses relating thereto |
-
2022
- 2022-10-11 WO PCT/EP2022/078199 patent/WO2023061985A2/en unknown
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20140073687A1 (en) | 2011-04-03 | 2014-03-13 | Immune Disease Institute, Inc. | Efficient protein expression in vivo using modified rna (mod-rna) |
US20150051268A1 (en) | 2011-12-21 | 2015-02-19 | Moderna Therapeutics, Inc. | Methods of increasing the viability or longevity of an organ or organ explant |
US9061059B2 (en) | 2012-04-02 | 2015-06-23 | Moderna Therapeutics, Inc. | Modified polynucleotides for treating protein deficiency |
Non-Patent Citations (6)
Title |
---|
ADACHI ET AL., INT HEART J, vol. 57, no. 5, 2016, pages 565 - 72 |
DANAD, I ET AL., JAM COLL CARDIOL, vol. 64, 2014, pages 1464 - 1475 |
GREEN, CP ET AL., JAM COLL CARDIOL, vol. 35, 2000, pages 1245 - 1255 |
KAJANDER, SA ET AL., CIRC CARDIOVASC IMAGING, vol. 4, 2011, pages 678 - 684 |
ROZENSKI, JCRAIN, PMCCLOSKEY, J.: "The RNA Modification Database: 1999 update", NUCL ACIDS RES, vol. 27, 1999, pages 196 - 197 |
SPERTUS, JA ET AL., JAM COLL CARDIOL, vol. 25, 1995, pages 333 - 341 |
Also Published As
Publication number | Publication date |
---|---|
WO2023061985A3 (en) | 2023-05-25 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Rufaihah et al. | Dual delivery of VEGF and ANG-1 in ischemic hearts using an injectable hydrogel | |
Laham et al. | Intracoronary basic fibroblast growth factor (FGF-2) in patients with severe ischemic heart disease: results of a phase I open-label dose escalation study | |
Hughes et al. | Therapeutic angiogenesis in chronically ischemic porcine myocardium: comparative effects of bFGF and VEGF | |
US20160250290A1 (en) | Gene therapy for diabetic ischemic disease | |
JP7167226B2 (en) | Modified RNA Encoding VEGF-A Polypeptides, Formulations, and Uses Associated Therewith | |
US20220273729A1 (en) | Cdc-derived exosomes for treatment of ventricular tachyarrythmias | |
JP2009024026A (en) | Angiogenically effective unit dose of fgf-2 and method of use | |
EA009390B1 (en) | Plasmid encoding fibroblast growth factor for the treatment of hypercholesterolemia or diabetes associated angiogenic defects | |
CN105112550B (en) | MTUS1 genes as osteoporosis diagnosis and treatment target | |
WO2023061985A2 (en) | Compositions comprising modified rna encoding vegf-a and methods of use | |
JP2012524781A (en) | Compositions, kits and methods for promoting healing of ischemic and diabetic wounds | |
WO2023084013A1 (en) | Compositions comprising modified rna encoding vegf-a and methods of use | |
KR20060018851A (en) | Preventive and/or remedy for diseases accompanied by tissue destruction | |
CN101495627A (en) | Extended antegrade epicardial coronary infusion of adeno-associated viral vectors for gene therapy | |
US20240336664A1 (en) | Sulfated polypeptides for systemic delivery | |
Li et al. | Glycyrrhizin improves cardiac function in rheumatic heart disease by regulating Cx43 through miRNA-223 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22808603 Country of ref document: EP Kind code of ref document: A2 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |