WO2023056355A2 - Methods of using anti-sclerostin antibodies in treatment of osteogenesis imperfecta - Google Patents

Methods of using anti-sclerostin antibodies in treatment of osteogenesis imperfecta Download PDF

Info

Publication number
WO2023056355A2
WO2023056355A2 PCT/US2022/077259 US2022077259W WO2023056355A2 WO 2023056355 A2 WO2023056355 A2 WO 2023056355A2 US 2022077259 W US2022077259 W US 2022077259W WO 2023056355 A2 WO2023056355 A2 WO 2023056355A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
acid sequence
antibody
sclerostin antibody
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/077259
Other languages
English (en)
French (fr)
Other versions
WO2023056355A3 (en
Inventor
Alastair MACKINNON
Arun MISTRY
Emil Kakkis
Michael S. OMINSKY
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Mereo Biopharma 3 Ltd
Ultragenyx Pharmaceutical Inc
Original Assignee
Mereo Biopharma 3 Ltd
Ultragenyx Pharmaceutical Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Mereo Biopharma 3 Ltd, Ultragenyx Pharmaceutical Inc filed Critical Mereo Biopharma 3 Ltd
Priority to AU2022357544A priority Critical patent/AU2022357544A1/en
Priority to CA3233220A priority patent/CA3233220A1/en
Priority to KR1020247013976A priority patent/KR20240082380A/ko
Priority to JP2024518919A priority patent/JP2024536106A/ja
Priority to MX2024003828A priority patent/MX2024003828A/es
Priority to US18/696,578 priority patent/US20250011407A1/en
Priority to EP22877568.0A priority patent/EP4408884A4/en
Publication of WO2023056355A2 publication Critical patent/WO2023056355A2/en
Publication of WO2023056355A3 publication Critical patent/WO2023056355A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered

Definitions

  • This invention relates to antibodies and dosing regimens and their use as pharmaceutical compositions, more specifically to the chronic use of anti-sclerostin antibodies in the treatment of osteogenesis imperfecta.
  • Osteogenesis imperfecta is a rare genetic disorder of the connective tissue characterized by bone fragility and reduced bone mass.
  • OI comprises a group of inherited disorders which primarily, but not always, arise from mutations in the genes encoding type I collagen. About 85% of the cases are linked to mutations in one of the two genes encoding type I collagen (COL1A1 and COL1 A2). Clinically, OI is characterized by fragile bones that fracture easily and without any trauma.
  • Type I OI patients usually suffer from a mild non-deforming disease that is often associated with a premature stop codon in COL1A1. This defect results in a reduced rate of type I collagen production and quantitatively less collagen in bone.
  • Patients with type II 01 usually die during the perinatal period, as a result of respiratory failure from multiple severe fractures that include the rib cage.
  • Types III and IV 01 are often associated with glycine substitution in COL1 Al and COL1A2, which is a qualitative defect that prevents the 3 polypeptide chains of type I collagen to intertwine properly to form a normal triple alpha helical structure.
  • Type III 01 is the most severe form of 01 in those affected children who survive infancy, whereas patients with type IV have mild to moderate bone deformities.
  • Therapeutic agents useful for treating bone-related diseases include anti-sclerostin antibodies.
  • High affinity, neutralizing, fully human anti-sclerostin monoclonal antibodies (collectively “the human anti-sclerostin monoclonal antibody”) and their potent in vitro activity and in vivo activity are disclosed in e.g. US Patent Nos. 7,879,322, 8,246,953, and 8,486,661, which are hereby incorporated in their entirety by reference thereto.
  • the treatment of 01 using an anti-sclerostin antibody is disclosed in WO2018/115879A1 and WO2018/115880A1, which are hereby incorporated in their entirety by reference thereto.
  • Additional anti-sclerostin antibodies include those described, for example, in WO2013/019954A1; U.S. Patent Nos. 8,003,108, 7,592,429, and 8,017,120; and U.S. Patent Application Publication No. 20110044978 Al; which are hereby incorporated in their entirety by reference thereto.
  • Formulations of such antibodies are disclosed, for example, in W02021/030179A1, which is hereby incorporated in its entirety by reference thereto.
  • Additional anti-sclerostin antibodies include those described, for example, in W02008/115732A2, which is hereby incorporated in its entirety by reference thereto.
  • Additional anti-sclerostin antibodies include those described, for example, in US Patent No. 10,449,250, which is hereby incorporated in its entirety by reference thereto.
  • Additional anti-sclerostin antibodies include those described, for example, in WO20 15/087187A1, which is hereby incorporated in its entirety by reference thereto.
  • the present invention provides methods for the long-term or chronic treatment of osteogenesis imperfecta (01) with an anti-sclerostin antibody.
  • the instant disclosure provides a method for treating osteogenesis imperfecta (OI) in a human patient comprising administering to the human patient a therapeutically effective amount of an anti-sclerostin antibody each month for a period of at least 13 consecutive months.
  • OI osteogenesis imperfecta
  • the anti-sclerostin antibody comprises (a) a VH polypeptide sequence having at least 90 percent sequence identity to the amino acid sequence set forth in SEQ ID NO: 70; and/or (b) a VL polypeptide sequence having at least 90 percent sequence identity to the amino acid sequence set forth in SEQ ID NO: 81.
  • the anti- sclerostin antibody comprises a VH polypeptide sequence comprising the amino acid sequence set forth in SEQ ID NO: 70 and a VL polypeptide sequence comprising the amino acid sequence set forth in SEQ ID NO: 81.
  • the anti-sclerostin antibody comprises (a) a VH polypeptide sequence having at least 90 percent sequence identity to the amino acid sequence set forth in SEQ ID NO: 198; and/or (b) a VL polypeptide sequence having at least 90 percent sequence identity to the amino acid sequence set forth in SEQ ID NO: 199.
  • the anti- sclerostin antibody comprises a VH polypeptide sequence comprising the amino acid sequence set forth in SEQ ID NO: 198 and a VL polypeptide sequence comprising the amino acid sequence set forth in SEQ ID NO: 199.
  • the anti-sclerostin antibody comprises (a) a VH polypeptide sequence having at least 90 percent sequence identity to the amino acid sequence set forth in SEQ ID NO: 202; and/or (b) a VL polypeptide sequence having at least 90 percent sequence identity to the amino acid sequence set forth in SEQ ID NO: 203.
  • the anti- sclerostin antibody comprises a VH polypeptide sequence comprising the amino acid sequence set forth in SEQ ID NO: 202 and a VL polypeptide sequence comprising the amino acid sequence set forth in SEQ ID NO: 203.
  • the anti-sclerostin antibody comprises (a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 4; (b) a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 15; (c) a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26; (d) a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 37; (e) a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 48; and (f) a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 59.
  • the anti-sclerostin antibody comprises (a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 178; (b) a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 179; (c) a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26; (d) a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 37; (e) a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 180; and (f) a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 181.
  • the anti-sclerostin antibody comprises (a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 4; (b) a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 179; (c) a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26; (d) a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 37; (e) a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 180; and (f) a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 181.
  • the anti-sclerostin antibody is one described in US Patent No. 7,879,322, 8,246,953, 8,486,661, 8,003,108, 7,592,429, 8,017,120, or 10,449,250; International Patent Application Number WO2018/115879A1, WO2018/115880A1, WO2013/019954A1, W02008/115732A2, or WO2015/087187A1; or U.S. Patent Application Publication No. 20110044978 Al; which are hereby incorporated in their entirety by reference thereto.
  • the anti-sclerostin antibody is selected from setrusumab, romosozumab, and blosozumab.
  • a therapeutically effective amount of an anti-sclerostin antibody is administered to a patient each month, z.e., monthly, for a period of at least 13 consecutive months. In one embodiment, a therapeutically effective amount of an anti-sclerostin antibody is administered to a patient each month, z.e., monthly, for a period of at least 18 consecutive months. In another embodiment, a therapeutically effective amount of an anti-sclerostin antibody is administered to a patient each month, z.e., monthly, for a period of at least 24 consecutive months.
  • a therapeutically effective amount of an anti-sclerostin antibody is administered to a patient each month, z.e., monthly, for a period of at least 30 consecutive months.
  • the anti-sclerostin antibody is administered monthly for a period of at least 36 consecutive months.
  • the anti-sclerostin antibody is administered monthly for a period of up to 18 years.
  • administering the therapeutically effective amount of the anti-sclerostin antibody increases BMD of lumbar spine by 5% or more after 12 months of treatment of the human patient.
  • BMD may be measured by dual-energy x- ray absorptiometry (DXA).
  • administration of a therapeutically effective amount of an anti-sclerostin antibody increases bone mineral density (BMD) of lumbar spine by 5% or more after 12 months treatment of the human patient.
  • the chronic or long-term dosing regimens disclosed herein are effective in the treatment of any genetic disease of the bone which results in fractures or weakness that would benefit from chronic dosing, such as OI.
  • the OI is type I OI, type III OI or type IV OI.
  • the human patient has one or more mutations in the COL1 Al and/ or COL1 A2 genes.
  • the human patient is a paediatric patient.
  • the human patient is an adult patient.
  • the human patient is a child aged 0-17 year and the anti-scl erostin antibody is administered at a dose of 20-50 mg/kg.
  • the anti-sclerostin antibody is administered monthly at a dose of 10-50 mg/kg. In one embodiment, the anti-sclerostin antibody is administered monthly at a dose selected from 10 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 35 mg/kg, 40 mg/kg, 45 mg/kg, and 50 mg/kg. In another embodiment, the anti-sclerostin antibody is administered monthly at a dose of 10 mg/kg. In yet another embodiment, the anti-sclerostin antibody is administered monthly at a dose of 20 mg/kg. In yet another embodiment, the anti-sclerostin antibody is administered monthly at a dose of 40 mg/kg.
  • the anti-sclerostin antibody is administered intravenously or subcutaneously. In one embodiment, the anti-sclerostin antibody is administered intravenously.
  • Figure 1 shows the clinical study design.
  • Figure 2A and Figure 2B show graphs depicting mean changes from baseline in serum levels of:
  • Figure 2A shows P1NP (procollagen 1 intact N-terminal propeptide), a bone formation biomarker; and
  • Figure 2B shows CTX-1 (C -terminal telopeptide), a bone resorption biomarker.
  • Figure 3 shows a graph depicting mean change from baseline of BMD of lumbar spine data (measured by DXA), comparing monthly dosing with 8 mg/kg or 20 mg/kg setrusumab over a period of 12 months.
  • Figure 4 shows graphs depicting effects of setrusumab discontinuation on BMD after 12 months with or without zoledronic acid therapy.
  • Figure 4A shows lumbar BMD after discontinuation.
  • Figure 4B shows total hip BMD after discontinuation.
  • Figure 4C shows radius total volumetric BMD after discontinuation.
  • Figure 4D shows tibia total volumetric BMD after discontinuation.
  • Figure 5 shows graphs depicting effects of setrusumab discontinuation on bone turnover biomarkers after 12 months with or without zoledronic acid therapy.
  • Figure 5 A shows serum P1NP levels after setrusumab discontinuation.
  • Figure 5B shows serum CTX-1 (i.e., “CTx”) levels after setrusumab discontinuation.
  • CTx serum CTX-1
  • the present invention is based on the unexpected and surprising findings that, although biomarkers routinely used to determine bone turnover attenuate shortly after setrusumab therapy starts, setrusumab provides continuous increases in BMD in human patients with a bone-related disease (osteogenesis imperfecta; 01), which does not wane with the biomarkers.
  • Human OI patients treated with monthly administrations of setrusumab for one year show continuous increase in BMD over the course of the treatment period: the increase in the first six months was similar to the increase in the second six months (Example 1).
  • the bone turnover biomarker response peaked after one month and then waned, returning to a level not statistically significantly different from baseline after six months of therapy.
  • sclerostin is a naturally occurring protein that in humans is encoded by the SOST gene.
  • Sclerostin is a secreted glycoprotein with a C terminal cysteine knot-like (CTCK) domain and sequence similarity to the DAN (differential screening-selected gene aberrative in neuroblastoma) family of bone morphogenetic protein (BMP) antagonists.
  • CCK C terminal cysteine knot-like
  • BMP bone morphogenetic protein
  • Anti-sclerostin antibodies have been shown to boost bone formation and density and provide beneficial effects in treating bone-related disorders in humans, including osteoporosis and OI.
  • EVENITYTM anti-sclerostin antibody
  • EVENITYTM One anti-sclerostin antibody
  • EVENITYTM is approved by the FDA for treating osteoporosis in post-menopausal women at high risk for fracture.
  • the anabolic effect of EVENITYTM wanes after 12 monthly doses of therapy (see EVENITYTM prescribing information - “indications and usage” section, version revised 04/2020). So the duration of EVENITYTM use is limited to 12 monthly doses, after which continued therapy with an anti-resorptive agent is recommended if osteoporosis therapy remains warranted.
  • the present examples show that the effect of an anti-sclerostin antibody on BMD does not wane after 12 monthly doses for treatment of 01.
  • the invention is directed to methods of using an anti-sclerostin antibody in the chronic treatment of genetic diseases of the bone which result in fractures or weakness, such as OI.
  • the invention is concerned with the treatment of OI, with monthly administration of an anti-sclerostin antibody for at least 13 consecutive months.
  • composition “comprising” encompasses “including” as well as “consisting” e.g. a composition “comprising” X may consist exclusively of X or may include something additional e.g. X+Y.
  • sclerostin refers to human sclerostin as defined in SEQ ID NO: 155 (MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTM NRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPAR LLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKR LTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY).
  • Recombinant human sclerostin can be obtained from R&D Systems (Minneapolis, Minn., USA; 2006 cat# 1406-ST-025). Additionally, recombinant mouse sclerostin/SOST is commercially available from R&D Systems (Minneapolis, Minn., USA; 2006 cat# 1589-ST-025).
  • U.S. Pat. Nos. 6,395,511 and 6,803,453, and U.S. Patent Publications 20040009535 and 20050106683 refer to anti-sclerostin antibodies in general.
  • antibody as used herein includes whole antibodies and any antigen binding fragment (i.e., “antigen-binding portion”) or single chains thereof.
  • a naturally occurring “antibody” is a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds.
  • Each heavy chain comprises a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region.
  • the heavy chain constant region comprises three domains, CHI, CH2 and CH3.
  • Each light chain comprises a light chain variable region (abbreviated herein as VL) and a light chain constant region.
  • the light chain constant region comprises one domain, CL.
  • VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs).
  • CDRs complementarity determining regions
  • FRs framework regions
  • Each VH and VL is composed of three CDRs and four FRs arranged from amino-terminus to carboxyterminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
  • reference to an antibody herein embraces isolated, monoclonal, human and humanized monoclonal antibodies.
  • antigen-binding portion of an antibody refers to full length or one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., sclerostin). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
  • binding fragments encompassed within the term “antigen-binding portion” of an antibody include a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment consisting of the VH and CHI domains; a Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a dAb fragment (Ward et al., 1989 Nature 341 :544-546), which consists of a VH domain; and an isolated complementarity determining region (CDR).
  • Fab fragment a monovalent fragment consisting of the VL, VH, CL and CHI domains
  • F(ab)2 fragment a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region
  • a Fd fragment consisting of the VH and CHI domains
  • the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al., 1988 Science 242:423-426; and Huston et al., 1988 Proc. Natl. Acad. Sci. 85:5879-5883).
  • single chain Fv single chain Fv
  • Such single chain antibodies are also intended to be encompassed within the term “antigen-binding portion” of an antibody.
  • an “isolated antibody”, as used herein, refers to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds sclerostin is substantially free of antibodies that specifically bind antigens other than sclerostin).
  • An isolated antibody that specifically binds sclerostin may, however, have cross-reactivity to other antigens, such as sclerostin molecules from other species.
  • an isolated antibody may be substantially free of other cellular material and/or chemicals.
  • reference to an antibody herein means an isolated antibody.
  • monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition.
  • a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
  • human antibody is intended to include antibodies having variable regions in which both the framework and CDR regions are derived from sequences of human origin. Furthermore, if the human antibody contains a constant region, the constant region also is derived from such human sequences, e.g., human germline sequences, or mutated versions of human germline sequences, or from antibody containing consensus framework sequences derived from human framework sequences as described in Knappik, et al. (2000. J Mol Biol 296, 57-86).
  • the human antibodies may include amino acid residues not encoded by human sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
  • human antibody as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
  • human monoclonal antibody refers to antibodies displaying a single binding specificity which have variable regions in which both the framework and CDR regions are derived from human sequences.
  • the human monoclonal antibodies are produced by a hybridoma which includes a B cell obtained from a transgenic nonhuman animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
  • recombinant human antibody includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, antibodies isolated from a host cell transformed to express the human antibody, e.g., from a transfectoma, antibodies isolated from a recombinant, combinatorial human antibody library, and antibodies prepared, expressed, created or isolated by any other means that involve splicing of all or a portion of a human immunoglobulin gene, sequences to other DNA sequences.
  • Such recombinant human antibodies have variable regions in which the framework and CDR regions are derived from human germline immunoglobulin sequences. In certain embodiments, however, such recombinant human antibodies can be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.
  • an antibody that binds sclerostin e.g.
  • an anti- sclerostin antibody means that it specifically binds to sclerostin polypeptide.
  • Specifically binds to sclerostin polypeptide is intended to refer to an antibody that binds to sclerostin polypeptide with a KD of 1 x 10' 8 M or less, 1 x 10' 9 M or less, or 1 x IO' 10 M or less.
  • KD is intended to refer to the dissociation constant, which is obtained from the ratio of Kd to K a (i.e. Kd/K a ) and is expressed as a molar concentration (M).
  • KD values for antibodies can be determined using methods well established in the art. A method for determining the KD of an antibody is by using surface plasmon resonance, or using a biosensor system such as a Biacore® system.
  • Standard assays to evaluate the binding ability of the antibodies toward sclerostin of various species are known in the art, including for example, ELISAs, western blots and RIAs. Suitable assays are described in detail in W02009/047356.
  • the binding kinetics (e.g., binding affinity) of the antibodies also can be assessed by standard assays known in the art, such as by Biacore analysis.
  • Assays to evaluate the effects of the antibodies on functional properties of sclerostin are described in further detail in W02009/047356.
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described in the non-limiting examples below.
  • the percent identity between two amino acid sequences can be determined using the algorithm of E. Meyers and W. Miller (Comput. Appl. Biosci., 4: 11-17, 1988) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
  • the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch (J. Mol, Biol.
  • the protein sequences of the present invention can further be used as a "query sequence" to perform a search against public databases to, for example, identify related sequences. Such searches can be performed using the BLASTX program (version 2.0) of Altschul, et al., 1990 J.Mol. Biol. 215:403-10.
  • Gapped BLAST can be utilized as described in Altschul et al., 1997 Nucleic Acids Res. 25(17):3389-3402.
  • the default parameters of the respective programs e.g., BLASTX and BLASTN
  • BLASTX and BLASTN can be used. See www.ncbi.nlm.nih.gov.
  • cross-block means the ability of an antibody or other binding agent to interfere with the binding of other antibodies or binding agents to sclerostin in a standard competitive binding assay.
  • the ability or extent to which an antibody or other binding agent is able to interfere with the binding of another antibody or binding molecule to sclerostin, and therefore whether it can be said to cross-block according to the invention, can be determined using standard competition binding assays.
  • One suitable assay involves the use of the Biacore technology (e.g. by using the Biacore 3000 instrument (Biacore, Uppsala, Sweden)), which can measure the extent of interactions using surface plasmon resonance technology.
  • monthly administration refers to administration of a dose of anti-sclerostin antibody once per month for a given period of consecutive months.
  • anti-sclerostin therapy provides continuous increases in BMD in OI patients, long after the effect on bone turnover biomarkers wanes, or attenuates.
  • Anti-sclerostin antibody therapy is therefore surprisingly suitable for longterm, or chronic, therapy of bone-related genetic diseases that result in bone weakness or increased incidence of bone fracture, such as 01.
  • the invention is directed to methods of treating patients with a bone-related genetic disease such as OI.
  • patients as used herein, means human patients.
  • the invention provides use of an anti-sclerostin antibody for the manufacture of a medicament for the treatment of osteogenesis imperfecta. All of the other aspects/ embodiments described herein apply equally to this particular aspect of the invention. [0063] In another aspect the invention provides an anti-sclerostin antibody for use in the treatment of osteogenesis imperfecta. All of the other aspects/ embodiments described herein apply equally to this particular aspect of the invention.
  • the examples report a study of anti-sclerostin antibody therapy in OI patients, and show that OI patients respond to monthly anti-sclerostin antibody therapy. Accordingly, in one embodiment, the methods and uses described herein are for treating osteogenesis imperfecta (OI) using anti-sclerostin antibodies described herein.
  • OI osteogenesis imperfecta
  • OI is classified by the genetics and severity of disease, and can be classified as type I OI, type II OI, type III OI, type IV OI or type V OI according to the classification of Van Dijk and Sillence (2014, Am J Med Genet Part A 164A: 1470-1481 and Van Dijk and Sillence, 2014, Am J Med Genet Part A 167A: 1178; which are hereby incorporated in their entirety by reference thereto).
  • Classification relies on a combination of clinical evaluation/ diagnosis, biochemical analysis as well as molecular genetic testing, and is routine for those skilled in the art.
  • the OI nomenclature/ classification as used herein is as proposed by Van Dijk and Sillence, as referenced in the publications above. The study participants had type I, type III, or type IV OI, and all OI types responded to setrusumab therapy. Accordingly, in a certain embodiment, the bone-related disease is type I OI, type III OI, or type IV OI.
  • OI is caused by mutations in the COL 1 Al and COL1A2 genes (17q21.33 and 7q22.3, respectively) encoding the alphal and alpha 2 chains of type-I collagen.
  • a comprehensive database of over 1000 known mutations has been published along with a genotype-phenotype correlation (oi.gene.le.ac.uk/home.php; accessed 29 September 2021). Mutations in other genes, such as CRTAP, LEPRE1 or PPIB, are also known.
  • Molecular genetic tests for mutations in the COL1A1 and COL1A2 genes are known and routine for those skilled in the art. By way of example, Korkko et al.
  • the methods and uses described herein are for treating patients who exhibit a deficiency of type-I collagen, e.g. OI types I - IV. As a result, the normal architecture of bone, consisting of collagen fibrils and hydroxyapatite crystals, is altered and causes brittleness.
  • the methods and uses herein are for treating human OI patients characterized by one or more mutations in COL1 Al and/or COL1A2.
  • the methods and uses described herein are for treating OI type I, III and/or IV.
  • OI type I, III and IV are confirmed by DNA testing i.e. detection of COL1A1/ COL1A2 mutations.
  • the methods and uses herein are for treating OI type I, III and/or IV characterized by one or more mutations in COL1A1 and/or COL1A2.
  • the methods and uses of the anti-sclerostin antibody are for treating a mild to moderate form of OI.
  • the patient under treatment has a type I OI, a type II OI, a type III OI, or a type IV OI.
  • the invention provides a method for treating OI in a human patient comprising administering to the human patient a therapeutically effective amount of setrusumab at a dose of 300-1500 mg each month for a period of at least 30 consecutive months up to 18 years.
  • Paediatric dosing is a method for treating OI in a human patient comprising administering to the human patient a therapeutically effective amount of setrusumab at a dose of 300-1500 mg each month for a period of at least 30 consecutive months up to 18 years.
  • the 01 patients are adult patients aged 18 and above. In yet still other embodiments of the methods and uses of the anti-sclerostin antibody, the 01 patients are pediatric patients. Pediatric patients as defined herein embraces children aged 0-17 such as those aged 2-17, 3-17, 4-17 or 5-17.
  • the rate of drug clearance compared to body weight or body surface area is higher in children (particularly small children) than it is in adults and therefore pediatric doses when expressed as, for example mg/kg, generally have to be increased, relative to the equivalent adult dose, to ensure that children receive sufficiently high doses of a drug to be efficacious.
  • a suitable pediatric dose can be estimated from the ratio of the weights of a child and an adult to the power 0.7 (Pediatric Pharmacology - Therapeutic Principles in Practice, 2 nd Ed., Yaffe and Aranda), shown in Equation 1.
  • a dose of 20 mg/kg in an adult patient equates to a dose of 40 mg/kg in a 7 kg child ( ⁇ 6 month old). So the smallest patients may require a dose of up to 40 mg/kg setrusumab to achieve a therapeutic outcome similar to an adult dosed at 20 mg/kg. Higher mg/kg doses in adults would thus require still higher doses in paediatric patients.
  • the patient is aged 0-17 years and the anti-sclerostin antibody is administered at a dose of 20-50 mg/kg each month. In a certain embodiment, the patient is aged 0-17 years and the anti-sclerostin antibody is administered at a dose of 20-40 mg/kg each month.
  • the invention provides a method for treating OI in a human patient aged 0-17 years comprising administering to the human patient a therapeutically effective amount of an anti-sclerostin antibody at a dose of 20-50 mg/kg each month for a period of at least 13 consecutive months, e.g., at least 18 consecutive months, at least 24 consecutive months, or at least 30 consecutive months, up to 18 years.
  • the invention provides a method for treating 01 in a human patient aged 0-17 years comprising administering to the human patient a therapeutically effective amount anti-sclerostin antibody at a dose of 20-50 mg/kg each month for a period of at least 13 consecutive months, e.g., at least 18 consecutive months, at least 24 consecutive months, or at least 30 consecutive months, up to 18 years.
  • ranges are provided for certain quantities such as dosage amounts of an anti-sclerostin antibody. It is to be understood that these ranges comprise endpoints and all subranges therein, including each integer in and between a disclosed range. Thus, the range “from 20 to 50” includes all possible ranges therein (e.g., 21-49, 22-48, 23-47, etc.) as well as each individual integer from 20 to 50 (e.g., 20, 21, 22, 23, 24, etc.). Where ranges are provided in the form of fractions, percentages, decimals, and the like, such ranges likewise include all possible subranges therein and each individual fraction, percentage, decimal, etc. in and between the disclosed range.
  • dosage amounts of an anti-sclerostin antibody of 20-50 mg/kg include dosage amounts of 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, and 50 mg/kg of the anti-sclerostin antibody.
  • the invention is based on the discovery that anti-sclerostin antibody therapy can be used long-term, even though bone turnover biomarkers attenuate soon after therapy starts.
  • the invention therefore relates to monthly administration of anti-sclerostin antibodies for at least 13 months.
  • Dosing regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, the dose may be reduced or increased as indicated by the exigencies of the therapeutic situation.
  • the dosage ranges from about 8 milligram of said antibody per kilogram body weight of the patient (herein referred to as “mg/kg” throughout this application) to 50 mg/kg, more usually about 20 to 40 mg/kg.
  • dosages can be about 20 mg/kg body weight, about 30 mg/kg body weight, about 40 mg/kg body weight, or about 50 mg/kg body weight.
  • the monthly dose is about 20 to 30 mg/kg.
  • the anti-sclerostin antibody is administered at a dose of 20 mg per kg body weight of a patient, or at 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 mg/kg.
  • the anti-sclerostin antibody is administered at a dose of 150-3000 mg, for example 150-2500 mg. In one embodiment, the anti-sclerostin antibody is administered at a dose of 200-2500 mg, 400-2500 mg, 150-2000 mg, 200-2000 mg,
  • the anti- sclerostin antibody is administered at a dose of 200-2500 mg. In one embodiment, the antisclerostin antibody is administered at a dose of 400-2500 mg. In one embodiment, the antisclerostin antibody is administered at a dose of 150-2000 mg. In one embodiment, the antisclerostin antibody is administered at a dose of 200-2000 mg. In one embodiment, the antisclerostin antibody is administered at a dose of 400-2000 mg. In one embodiment, the antisclerostin antibody is administered at a dose of 150-1500 mg. In one embodiment, the antisclerostin antibody is administered at a dose of 200-1500 mg. In one embodiment, the anti- sclerostin antibody is administered at a dose of 400-1500 mg.
  • the anti-sclerostin antibody is administered at a dose of 200 mg, or 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100,
  • the invention relates to the surprising suitability of anti-sclerostin antibody for longterm therapy.
  • the anti-sclerostin antibody is therefore administered monthly for a period of at least 13 consecutive months.
  • the anti-sclerostin antibody is administered monthly for a period of at least 18 consecutive months.
  • the anti-sclerostin antibody is administered monthly for a period of at least 24 consecutive months.
  • the anti-sclerostin antibody is administered monthly for a period of at least 30 consecutive months.
  • the anti-sclerostin antibody is administered monthly for a period of at least 36 consecutive months.
  • the anti-sclerostin antibody is administered monthly for a period of up to 18 years, meaning that the period during which the anti-sclerostin antibody is administered each month does not last more than 18 years.
  • the anti- sclerostin antibody is administered monthly for a period of at least 13 consecutive months up to 18 years.
  • the anti-sclerostin antibody is administered monthly for a period of at least 18 consecutive months up to 18 years.
  • the anti- sclerostin antibody is administered monthly for a period of at least 24 consecutive months up to 18 years.
  • the anti-sclerostin antibody is administered monthly for a period of at least 30 consecutive months up to 18 years.
  • the anti- sclerostin antibody is administered monthly for a period of at least 36 consecutive months up to 18 years.
  • An exemplary treatment regimen entails administration of multiple doses, which may be of the same dosage, ranging from about 150-3000 mg, under a dosing schedule of once per month, for a period of at least 13 consecutive months up to 18 years.
  • the treatment entails monthly administration for at least 18 consecutive months.
  • the treatment entails monthly administration for at least 24 consecutive months.
  • the treatment entails monthly administration for at least 30 consecutive months.
  • the treatment entails monthly administration for at least 36 consecutive months.
  • the anti-sclerostin antibody is administered monthly at a dose of 150-2500 mg for a period of at least 30 consecutive months up to 18 years
  • Another exemplary treatment regimen entails administration of multiple doses, which may be of the same dosage, ranging from about 150-3000 mg, under a dosing schedule of once per month, for at least 13 consecutive months and until a treatment target is achieved or reached in the patient.
  • the treatment target is achieved or reached after a certain number of doses are administered.
  • the treatment target may be a complete normalization of bone mineral density, a partial normalization of bone mineral density, or a reduced frequency of bone fracture incidence.
  • the monthly administration of the anti-sclerostin antibody increases bone mineral density (BMD) of lumbar spine by 5% or more after 12 consecutive months of therapy.
  • the invention provides an anti-scl erostin antibody for use in the treatment of 01, wherein the anti-sclerostin antibody reduces the fracture rate in a patient/ patient population compared to a control patient/ patient population.
  • the anti- sclerostin antibody reduces the fracture rate by at least 10, 20, 30, 35, 40, 50, 60, 70, 80, or 90 percent.
  • the anti-sclerostin antibody reduces the fracture rate by at least 30 percent.
  • fractures are defined as peripheral or vertebral fractures (including all major, minor, and vertebral clinical fractures; fractures only detected by means of investigations without clinical symptoms are not included), confirmed by radiologic investigation(s).
  • the fracture rate pertains to a population of patients.
  • the patient population and control patient populations are preferably of a size that allow a statistically significant comparison to be made.
  • the anti-sclerostin antibody is administered intravenously.
  • administration occurs intravenously by way of an infusion.
  • BMD bone mineral density
  • DXA dual-energy x-ray absorptiometry
  • SXA single-energy x-ray absorptiometry
  • CT quantitative computed tomography
  • HR-pQCT high- resolution peripheral quantitative computed tomography
  • Radial bone strength may be measured by micro-finite element analysis (microFEA).
  • microFEA micro-finite element analysis
  • actual dosage levels of the anti-sclerostin antibody may be varied so as to obtain an amount of the anti-sclerostin antibody which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
  • the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions employed, the route of administration, the time of administration, the rate of excretion of the particular anti-sclerostin antibody being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
  • a “therapeutically effective amount” of the anti-sclerostin antibody may result in a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction. Accordingly, in one embodiment, the monthly administration of the anti-sclerostin antibody increases bone mineral density (BMD) of lumbar spine by 5% or more after 12 months of therapy.
  • BMD bone mineral density
  • the invention provides a method for treating osteogenesis imperfecta (OI) in a human patient comprising administering a therapeutically effective amount of the anti-sclerostin antibody to a human patient in need thereof, wherein the method entails administering a first dosage during an initial dosing period then administering a maintenance dosage thereafter.
  • the anti-sclerostin antibody is administered monthly for an initial dosing period of 12 months or greater followed by regular dosing at a maintenance dosage.
  • the maintenance dosage follows the initial dosing period directly without a dosing holiday between the initial dosing period and the maintenance dosing period.
  • the maintenance dosage comprises a different dosing regimen from that administered during the initial dosing period; i.e., the maintenance dosage comprises administering the anti-sclerostin antibody at a frequency and/or at a dosage amount that is different from that administered during the initial dosing period.
  • the anti-sclerostin antibody is administered during the initial dosing period at a dosage of 20-50 mg/kg, 20-40 mg/kg, or 20 mg/kg. In a particular embodiment, the anti-sclerostin antibody is administered during the initial dosing period at a dosage of 20 mg/kg, administered monthly.
  • a maintenance dosage may be a dosage of anti-sclerostin antibody administered monthly, about every 2 months, about every 3 months, about every 4 months, about every 6 months, or about every 12 months.
  • a maintenance dosage may be the same amount administered during the initial dosing period (e.g., about 20 mg/kg), or it may be a reduced amount relative to the amount administered during the initial dosing period (e.g., less than 20 mg/kg).
  • the maintenance dosage is administered regularly for a period of at least 2, at least 4, at least 6, at least 8, at least 10, or at least 12 consecutive months following the initial dosing period. In some embodiments, the maintenance dosage is administered for a period of at least 18 consecutive months following the initial dosing period. In some embodiments, the maintenance dosage is administered for a period of at least 24 consecutive months following the initial dosing period. In some embodiments, the maintenance dosage is administered for a period of at least 30 consecutive months following the initial dosing period. In some embodiments, the maintenance dosage is administered for a period of at least 36 consecutive months following the initial dosing period. In some embodiments, the maintenance dosage is administered for a period of up to 18 years following the initial dosing period.
  • the anti-sclerostin antibody is administered monthly for a period of 12 months or more then administered bi-monthly thereafter, e.g., for up to 18 years.
  • the anti-sclerostin antibody is administered during the initial dosing period at a dosage of 20 mg/kg, administered monthly, followed by a maintenance dose of 20 mg/kg administered bi-monthly, every three months, every four months, every six months, or every twelve months.
  • the anti-sclerostin antibody is administered during the initial dosing period at a dosage of 20 mg/kg, administered monthly, followed by a maintenance dose of 20 mg/kg administered bi-monthly.
  • the anti-sclerostin antibody is administered monthly for a period of 12 months or more at a dosage of about 20 mg/kg, then administered monthly thereafter, e.g., for up to 18 years, at a dosage amount of less than 20 mg/kg.
  • the anti-sclerostin antibody is administered during the initial dosing period at a dosage of 20 mg/kg, administered monthly, followed by a maintenance dose of less than 20 mg/kg administered monthly.
  • the maintenance dose of less than 20 mg/kg of the anti-sclerostin antibody may be 2-20 mg/kg, 5-20 mg/kg, 8- 20 mg/kg, 10-20 mg/kg, 15-20 mg/kg, 2-19 mg/kg, 5-19 mg/kg, 8-19 mg/kg, 10-19 mg/kg, 15- 19 mg/kg, 2-15 mg/kg, 5-15 mg/kg, 8-15 mg/kg, 10-15 mg/kg, 2-10 mg/kg, 5-10 mg/kg, 8-10 mg/kg, less than or about 19 mg/kg, less than or about 15 mg/kg, less than or about 10 mg/kg, less than or about 8 mg/kg, less than or about 2 mg/kg, about 2 mg/kg, about 8 mg/kg, about 10 mg/kg, about 11 mg/kg, about 12 mg/kg, about 13 mg/kg, about 14 mg/kg, about 15 mg/kg, about 16 mg/kg, about 17 mg/kg, about 18 mg/kg, about 19 mg/kg of the anti-sclerostin antibody.
  • a maintenance dosage may be a dosage amount sufficient to maintain BMD and/or stable bone turnover biomarker levels in a patient following the initial dosing period.
  • a maintenance dosage is a dosage amount sufficient to maintain gains (or the rate of gain) of BMD in a patient following the initial dosing period.
  • a maintenance dosage may be less than the dosage administered to a patient in the initial dosing period.
  • a maintenance dosage may be less than about 50 mg/kg of the anti-sclerostin antibody, less than about 40 mg/kg of the anti-sclerostin antibody, less than about 30 mg/kg of the anti- sclerostin antibody, less than about 20 mg/kg of the anti-sclerostin antibody, less than about 10 mg/kg of the anti-sclerostin antibody, less than about 8 mg/kg of the anti-sclerostin antibody, or less than about 2 mg/kg of the anti-sclerostin antibody.
  • the maintenance dosage is about 2 mg/kg of the anti-sclerostin antibody, about 8 mg/kg of the anti- sclerostin antibody, about 10 mg/kg of the anti-sclerostin antibody, about 11 mg/kg of the anti- sclerostin antibody, about 12 mg/kg of the anti-sclerostin antibody, about 13 mg/kg of the anti- sclerostin antibody, about 14 mg/kg of the anti-sclerostin antibody, about 15 mg/kg of the anti- sclerostin antibody, about 16 mg/kg of the anti-sclerostin antibody, about 17 mg/kg of the anti- sclerostin antibody, about 18 mg/kg of the anti-sclerostin antibody, about 19 mg/kg of the anti- sclerostin antibody, or about 20 mg/kg of the anti-sclerostin antibody.
  • ranges such as those provided herein for dosage amounts of an anti-sclerostin antibody comprise endpoints and all subranges therein, including each integer in and between a disclosed range.
  • the range “from 20 to 50” includes all possible ranges therein (e.g., 21-49, 22-48, 23-47, etc.) as well as each individual integer from 20 to 50 (e.g., 20, 21, 22, 23, 24, etc.).
  • dosage amounts of an anti- sclerostin antibody of 20-50 mg/kg include dosage amounts of 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, and 50 mg/kg of the anti-sclerostin antibody.
  • Dosage amounts of an anti-sclerostin antibody of less than 20 mg/kg include dosage amounts of 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, and 1 mg/kg of the anti sclerostin antibody.
  • the invention relates to the treatment of bone-related diseases using an anti-sclerostin antibody.
  • the anti-sclerostin antibody comprises a VH comprising HCDR1, HCDR2, and HCDR3 of the VH sequence of SEQ ID NO:70, and a VL comprising LCDR1, LCDR2, and LCDR3 of the VL sequence of SEQ ID LNO:81.
  • the anti-sclerostin antibody comprises: (a) an HCDR1 having the amino acid sequence of SEQ ID NO:4 (GFTFRSHWLS); (b) an HCDR2 having the amino acid sequence of SEQ ID NO: 15 (WVSNINYDGSSTYYADSVKG); (c) an HCDR3 having the amino acid sequence of SEQ ID NO:26 (DTYLHFDY); (d) an LCDR1 having the amino acid sequence of SEQ ID NO:37 (TGTSSDVGDINDVS); (e) an LCDR2 having the amino acid sequence of SEQ ID NO:48 (LMIYDVNNRPS); and (f) an LCDR3 having the amino acid sequence of SEQ ID NO:59 (QSYAGSYLSE).
  • CDRs within a VH or VL sequence can be delineated by different classification and numbering systems. CDRs may therefore be referred to by IMGT, Kabat, Chothia, AbM, Contact, a combination of these systems, or another system. See, for example: Kabat (Kabat, E. A., et al., 1991 Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242); Chothia (Chothia et al. (1987) J Mol Biol 196: 901-17); IMGT (Leffanc et al.
  • CDRs can be delineated using available programs such as abY sis (www.abysis.org; Swindells et al. J Mol Biol. 2017 Feb 3;429(3):356-64).
  • Table 1 shows the amino acid sequences of the CDR sequences of setrusumab (an antibody having the VH of SEQ ID NO: 70 and the VL of SEQ ID NO: 81) as defined according to the Kabat, Chothia, IMGT, AbM, and Contact systems.
  • the anti-sclerostin antibody comprises: (a) an HCDR1 having the amino acid sequence of SEQ ID NO: 178; (b) an HCDR2 having the amino acid sequence of SEQ ID NO: 179; (c) an HCDR3 having the amino acid sequence of SEQ ID NO:26; (d) an LCDR1 having the amino acid sequence of SEQ ID NO: 37; (e) an LCDR2 having the amino acid sequence of SEQ ID NO: 180; and (f) an LCDR3 having the amino acid sequence of SEQ ID NO: 181.
  • the setrusumab CDRs are delineated by Chothia.
  • the anti-sclerostin antibody comprises: (a) an HCDR1 having the amino acid sequence of SEQ ID NO: 182; (b) an HCDR2 having the amino acid sequence of SEQ ID NO: 183; (c) an HCDR3 having the amino acid sequence of SEQ ID NO:26; (d) an LCDR1 having the amino acid sequence of SEQ ID NO: 37; (e) an LCDR2 having the amino acid sequence of SEQ ID NO: 180; and (f) an LCDR3 having the amino acid sequence of SEQ ID NO: 181.
  • the setrusumab CDRs of the anti-sclerostin antibody are defined to encompass CDRs as defined by both Kabat and Chothia. Each CDR sequence therefore spans the sequence from the most N-terminal residue out of the Kabat and Chothia- defined CDRs to the most C-terminal residue out of the Kabat and Chothia-defined CDRs.
  • the anti-sclerostin antibody comprises: (a) an HCDR1 having the amino acid sequence of SEQ ID NO:4; (b) an HCDR2 having the amino acid sequence of SEQ ID NO: 179; (c) an HCDR3 having the amino acid sequence of SEQ ID NO:26; (d) an LCDR1 having the amino acid sequence of SEQ ID NO:37; (e) an LCDR2 having the amino acid sequence of SEQ ID NO: 180; and (f) an LCDR3 having the amino acid sequence of SEQ ID NO : 181.
  • the setrusumab CDRs are delineated by IMGT.
  • the anti-sclerostin antibody comprises: (a) an HCDR1 having the amino acid sequence of SEQ ID NO: 184; (b) an HCDR2 having the amino acid sequence of SEQ ID NO: 185; (c) an HCDR3 having the amino acid sequence of SEQ ID NO:186; (d) an LCDR1 having the amino acid sequence of SEQ ID NO: 187; (e) an LCDR2 having the amino acid sequence of SEQ ID NO: 188; and (f) an LCDR3 having the amino acid sequence of SEQ ID NO:181.
  • the setrusumab CDRs are delineated by AbM.
  • the anti-sclerostin antibody comprises: (a) an HCDR1 having the amino acid sequence of SEQ ID NO:4; (b) an HCDR2 having the amino acid sequence of SEQ ID NO: 189; (c) an HCDR3 having the amino acid sequence of SEQ ID NO:26; (d) an LCDR1 having the amino acid sequence of SEQ ID NO: 37; (e) an LCDR2 having the amino acid sequence of SEQ ID NO: 180; and (f) an LCDR3 having the amino acid sequence of SEQ ID NO: 181.
  • the setrusumab CDRs are delineated by Contact.
  • the anti-sclerostin antibody comprises: (a) an HCDR1 having the amino acid sequence of SEQ ID NO: 190; (b) an HCDR2 having the amino acid sequence of SEQ ID NO: 191; (c) an HCDR3 having the amino acid sequence of SEQ ID NO: 192; (d) an LCDR1 having the amino acid sequence of SEQ ID NO: 193; (e) an LCDR2 having the amino acid sequence of SEQ ID NO: 194; and (f) an LCDR3 having the amino acid sequence of SEQ ID NO:59.
  • the anti-sclerostin antibody comprises: a VH polypeptide amino acid sequence having at least 95 percent identity to the amino acid sequence of SEQ ID NO: 70.
  • the anti-sclerostin antibody comprises: a VL polypeptide amino acid sequence having at least 95 percent identity to the amino acid sequence of SEQ ID NO: 81.
  • the anti-sclerostin antibody comprises: a VH polypeptide amino acid sequence having at least 95 percent identity to the amino acid sequence of SEQ ID NO: 70 and a VL polypeptide amino acid sequence having at least 95 percent identity to the amino acid sequence of SEQ ID NO: 81.
  • the anti-sclerostin antibody comprises: the VH polypeptide amino acid sequence of SEQ ID NO: 70 and the VL polypeptide amino acid sequence of SEQ ID NO: 81.
  • the anti-sclerostin antibody comprises: the heavy chain polypeptide amino acid sequence of SEQ ID NO: 114 (MAWVWTLPFLMAAAQSVQAQVQLVESGGGLVQPGGSLRLSCAASGFTFRSHWLS WVRQAPGKGLEWVSNINYDGSSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDT AVYYCARDTYLHFDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVK DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDH KPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYK CKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEM
  • the anti-sclerostin antibody of the invention is a monoclonal anti- sclerostin antibody.
  • the anti-sclerostin antibody of the invention is a human or humanized monoclonal anti-sclerostin antibody.
  • the antibody can be, for example, a chimeric antibody.
  • the anti-sclerostin antibody is the antibody setrusumab, which is a human anti-sclerostin monoclonal antibody.
  • the VH and VL sequences of setrusumab comprise: the VH polypeptide amino acid sequence of SEQ ID NO: 70 and the VL polypeptide amino acid sequence of SEQ ID NO: 81.
  • the heavy and light chain sequences of setrusumab comprise: the heavy chain polypeptide amino acid sequence of SEQ ID NO: 172 and the light chain polypeptide amino acid sequence of SEQ ID NO: 173.
  • the anti-sclerostin antibody comprises: the VH polypeptide amino acid sequence of SEQ ID NO: 70 and the VL polypeptide amino acid sequence of SEQ ID NO: 195
  • VL polypeptide amino acid sequence of SEQ ID NO:81 is delineated according to the Kabat system.
  • the VL polypeptide amino acid sequence of 195 is an alternative delineation of the VL domain, which encompasses the sequence according to Kabat, but also includes an additional two amino acids.
  • the antibodies may exhibit at least one of the following functional properties: the antibody blocks the inhibitory effect of sclerostin in a cell based wnt signaling assay, the antibody blocks the inhibitory effect of sclerostin in a cell based mineralization assay, the antibody blocks the inhibitory effect of sclerostin in Smadl phosphorylation assay, the antibody inhibits binding of sclerostin to the LRP-6, and the antibody increases bone formation and mass and density. As noted above, these properties are described in detail in W02009/047356.
  • the anti-sclerostin antibody comprises (a) a VH polypeptide sequence having at least 90 percent sequence identity to the amino acid sequence set forth in SEQ ID NO: 198; and/or (b) a VL polypeptide sequence having at least 90 percent sequence identity to the amino acid sequence set forth in SEQ ID NO: 199.
  • the anti- sclerostin antibody comprises a VH polypeptide sequence comprising the amino acid sequence set forth in SEQ ID NO: 198 and a VL polypeptide sequence comprising the amino acid sequence set forth in SEQ ID NO: 199.
  • the antisclerostin antibody comprises a heavy chain (HC) polypeptide sequence having at least 90 percent sequence identity to the amino acid sequence set forth in SEQ ID NO: 196 and/or a light chain (LC) polypeptide sequence having at least 90 percent sequence identity to the amino acid sequence set forth in SEQ ID NO: 197.
  • the anti-sclerostin antibody comprises a HC polypeptide sequence comprising the amino acid sequence set forth in SEQ ID NO: 196 and a LC polypeptide sequence comprising the amino acid sequence set forth in SEQ ID NO: 197.
  • the anti-sclerostin antibody comprises (a) a VH polypeptide sequence having at least 90 percent sequence identity to the amino acid sequence set forth in SEQ ID NO: 202; and/or (b) a VL polypeptide sequence having at least 90 percent sequence identity to the amino acid sequence set forth in SEQ ID NO: 203.
  • the anti- sclerostin antibody comprises a VH polypeptide sequence comprising the amino acid sequence set forth in SEQ ID NO: 202 and a VL polypeptide sequence comprising the amino acid sequence set forth in SEQ ID NO: 203.
  • the antisclerostin antibody comprises a heavy chain (HC) polypeptide sequence having at least 90 percent sequence identity to the amino acid sequence set forth in SEQ ID NO: 200 and/or a light chain (LC) polypeptide sequence having at least 90 percent sequence identity to the amino acid sequence set forth in SEQ ID NO: 201.
  • the anti-sclerostin antibody comprises a HC polypeptide sequence comprising the amino acid sequence set forth in SEQ ID NO: 200 and a LC polypeptide sequence comprising the amino acid sequence set forth in SEQ ID NO: 201.
  • VH polypeptide sequence [0129]
  • VL polypeptide sequence [0130]
  • PSRFSGSGSGTDFTLTISSLQPEDFATYYCQQGDTLPYTFGGGTKVEIKRTV SEQ ID NO: 199
  • VL polypeptide sequence [0134]
  • the anti-sclerostin antibody comprises (a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 4; (b) a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 15; (c) a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26; (d) a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 37; (e) a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 48; and (f) a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 59.
  • the anti-sclerostin antibody comprises (a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 178; (b) a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 179; (c) a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26; (d) a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 37; (e) a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 180; and (f) a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 181.
  • the anti-sclerostin antibody comprises (a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 4; (b) a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 179; (c) a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26; (d) a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 37; (e) a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 180; and (f) a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 181.
  • the anti-sclerostin antibody is one described in US Patent No. 7,879,322, 8,246,953, 8,486,661, 8,003,108, 7,592,429, 8,017,120, or 10,449,250; International Patent Application Number WO2018/115879A1, WO2018/115880A1, WO2013/019954A1, W02008/115732A2, or WO2015/087187A1; or U.S. Patent Application Publication No. 20110044978 Al; which are hereby incorporated in their entirety by reference thereto.
  • the anti-sclerostin antibody is selected from setrusumab, romosozumab, and blosozumab.
  • the anti-sclerostin antibody of the invention increases bone formation and/or reduces bone resorption.
  • the present invention provides a method for treating a bone-related disease in a human patient comprising administering to the human patient a therapeutically effective amount of an anti-sclerostin antibody each month for a period of at least 13 consecutive months, and wherein the antibody cross-blocks an anti-sclerostin antibody that comprises a VH comprising an HCDR1, an HCDR2, and an HCDR3 domain of the VH sequence of SEQ ID NO: 70, and a VL comprising an LCDR1, an LCDR2, and an LCDR3 domain of the VL sequence of SEQ ID NO:81.
  • the invention provides an anti-sclerostin antibody for use in the treatment of a bone-related disease, wherein a therapeutically effective amount of the anti-sclerostin antibody is administered each month for a period of at least 13 consecutive months, and wherein the antibody cross-blocks an anti-sclerostin antibody that comprises a VH comprising an HCDR1, an HCDR2, and an HCDR3 domain of the VH sequence of SEQ ID NO:70, and a VL comprising an LCDR1, an LCDR2, and an LCDR3 domain of the VL sequence of SEQ ID NO : 81.
  • the invention provides use of an anti-sclerostin antibody for the manufacture of a medicament for the treatment of a bone-related disease, wherein the treatment comprises administering a therapeutically effective amount of the anti-sclerostin antibody each month for a period of at least 13 consecutive months, and wherein the antibody cross-blocks an anti-sclerostin antibody that comprises a VH comprising an HCDR1, an HCDR2, and an HCDR3 domain of the VH sequence of SEQ ID NO:70, and a VL comprising an LCDR1, an LCDR2, and an LCDR3 domain of the VL sequence of SEQ ID NO:81.
  • the anti-sclerostin antibody used according to the invention binds sclerostin with an affinity of less than or equal to 10' 11 M (measured by Biacore) and crossblocks an anti-sclerostin antibody that comprises a VH comprising an HCDR1, an HCDR2, and an HCDR3 domain of the VH sequence of SEQ ID NO:70, and a VL comprising an LCDR1, an LCDR2, and an LCDR3 domain of the VL sequence of SEQ ID NO:81.
  • a cross-blocking antibody or other binding agent binds to sclerostin in the Biacore cross-blocking assay, described below, such that the recorded binding of the combination (mixture) of the antibodies or binding agents is between 80% and 0.1% (e.g. 80% to 4%) of the maximum theoretical binding, specifically between 75% and 0.1% (e.g. 75% to 4%) of the maximum theoretical binding, and more specifically between 70% and 0.1% (e.g. 70% to 4%), and more specifically between 65% and 0.1 % (e.g. 65% to 4%) of maximum theoretical binding (as defined above) of the two antibodies or binding agents in combination.
  • the recorded binding of the combination (mixture) of the antibodies or binding agents is between 80% and 0.1% (e.g. 80% to 4%) of the maximum theoretical binding, specifically between 75% and 0.1% (e.g. 75% to 4%) of the maximum theoretical binding, and more specifically between 70% and 0.1% (e.g. 70% to 4%), and more specifically between 65% and 0.1 % (e
  • Biacore assay for determining whether an antibody or other binding agent cross-blocks or is capable of cross-blocking antibodies according to the invention. It will be appreciated that the assay can be used with any of the sclerostin binding antibodies described herein.
  • the Biacore machine (for example the Biacore 3000) is operated in line with the manufacturer's recommendations.
  • Sclerostin may be coupled to e.g. a CM5 Biacore chip by way of routinely used amine coupling chemistry, e.g. EDC-NHS amine coupling, to create a sclerostin-coated surface.
  • amine coupling chemistry e.g. EDC-NHS amine coupling
  • 200-800 resonance units of sclerostin may be coupled to the chip (this amount gives measurable levels of binding and is at the same time readily saturable by the concentrations of test reagent being used).
  • sclerostin to the Biacore chip
  • a "tagged" version of sclerostin for example N-terminal or C-terminal His-tagged Sclerostin.
  • an anti-His antibody would be coupled to the Biacore chip and then the His-tagged sclerostin would be passed over the surface of the chip and captured by the anti-His antibody.
  • the two antibodies to be assessed for their ability to cross-block each other are mixed in a stoichiometric amount, e.g. at a one to one molar ratio, of binding sites in a suitable buffer to create the test mixture.
  • the buffer used is typically a buffer which is normally used in protein chemistry, such as e.g. PBS (136 mM NaCl, 2.7 mM KCI, 10 mM Na2HPO4, 1.76 mM KH2PO4, pH 7.4).
  • PBS 136 mM NaCl, 2.7 mM KCI, 10 mM Na2HPO4, 1.76 mM KH2PO4, pH 7.4
  • each antibody in the test mixture should be high enough to ensure saturation of the binding sites for that antibody on the sclerostin molecules which are bound on the Biacore chip.
  • the antibodies in the mixture are at the same molar concentration (on a binding basis) and that concentration would typically be between 1.0 mM and 1.5 mM (on a binding site basis).
  • the test mixture is passed over the sclerostin-coated Biacore chip and the binding recorded.
  • the bound antibodies are thereafter removed by treating the chip with e.g. an acid, such as 30 mM HCI for about 1 minute. It is important that the sclerostin molecules which are bound to the chip are not damaged.
  • the solution of the first antibody alone is then passed over the sclerostin-coated surface and the binding is recorded. Thereafter, the chip is treated to remove all of the bound antibody without damaging the chip-bound sclerostin, e.g. by way of above mentioned acid treatment.
  • the solution of the second antibody alone is then passed over the sclerostin-coated surface and the amount of binding recorded.
  • the maximal theoretical binding can be defined as the sum of the binding to sclerostin of each antibody separately. This is then compared to the actual binding of the mixture of antibodies measured. If the actual binding is lower than that of the theoretical binding, the two antibodies are cross-blocking each other.
  • An antibody is defined as cross-blocking in the ELISA assay as described below, if the solution phase anti-sclerostin antibody is able to cause a reduction of between 60% and 100%, specifically between 70% and 100%, and more specifically between 80% and 100%, of the sclerostin detection signal (i.e. the amount of sclerostin bound by the coated antibody) as compared to the sclerostin detection signal obtained in the absence of the solution phase anti- sclerostin antibody (i.e. the positive control wells).
  • Cross-blocking of an anti-sclerostin antibody or another sclerostin binding agent may also be detected by using an ELISA assay.
  • the general principle of the ELISA-assay involves coating an anti-sclerostin antibody onto the wells of an ELISA plate. An excess amount of a second, potentially cross-blocking, anti-sclerostin antibody is then added in solution (i.e. not bound to the ELISA plate). A limited amount of sclerostin is then added to the wells.
  • the antibody which was coated onto the wells and the antibody in solution will compete for binding of the limited number of sclerostin molecules.
  • the plate is then washed to remove sclerostin that has not bound to the coated antibody and to also remove the second, solution phase, antibody as well as any complexes formed between the second, solution phase antibody and sclerostin.
  • the amount of bound sclerostin is then measured using an appropriate sclerostin detection reagent.
  • An antibody in solution that is able to cross-block the coated antibody will be able to cause a decrease in the number of sclerostin molecules that the coated antibody can bind relative to the number of sclerostin molecules that the coated antibody can bind in the absence of the second, solution phase, antibody.
  • Ab-X is chosen to be the immobilized antibody
  • Ab-Y is coated onto the wells of the ELISA plate, after which the plates are blocked with a suitable blocking solution to minimize non-specific binding of reagents that are subsequently added.
  • An excess amount of Ab-Y is then added to the ELISA plate such that the moles of Ab-Y sclerostin binding sites per well are at least 10-fold higher than the moles of Ab-X sclerostin binding sites that were used, per well, during the coating of the ELISA plate.
  • Sclerostin is then added such that the moles of sclerostin added per well are at least 25-fold lower than the moles of Ab-X sclerostin binding sites that were used for coating each well.
  • the ELISA plate is washed and a sclerostin detection reagent is added to measure the amount of sclerostin specifically bound by the coated anti-sclerostin antibody (in this case Ab-X).
  • the background signal for the assay is defined as the signal obtained in wells with the coated antibody (in this case Ab-X), second solution phase antibody (in this case Ab- Y), sclerostin buffer only (i.e.
  • the positive control signal for the assay is defined as the signal obtained in wells with the coated antibody (in this case Ab-X), second solution phase antibody buffer only (i.e. no second solution phase antibody), sclerostin and sclerostin detection reagents.
  • the ELISA assay needs to be run in such a manner so as to have the positive control signal be at least 6 times the background signal.
  • the cross-blocking assay needs to be run in two formats: 1) format 1 is where Ab-X is the antibody that is coated onto the ELISA plate and Ab-Y is the competitor antibody that is in solution and 2) format 2 is where Ab-Y is the antibody that is coated onto the ELISA plate and Ab-X is the competitor antibody that is in solution.
  • the present invention provides a method for treating a bone-related disease in a human patient comprising administering to the human patient a therapeutically effective amount of an anti-sclerostin antibody each month for a period of at least 13 consecutive months, and wherein the antibody binds to the same epitope as an anti-sclerostin antibody that comprises a VH comprising an HCDR1, an HCDR2, and an HCDR3 domain of the VH sequence of SEQ ID NO:70, and a VL comprising an LCDR1, an LCDR2, and an LCDR3 domain of the VL sequence of SEQ ID NO:81.
  • the invention provides an anti-sclerostin antibody for use in the treatment of a bone-related disease, wherein a therapeutically effective amount of the anti-sclerostin antibody is administered each month for a period of at least 13 consecutive months, and wherein the antibody binds to the same epitope as an anti-sclerostin antibody that comprises a VH comprising an HCDR1, an HCDR2, and an HCDR3 domain of the VH sequence of SEQ ID NO: 70, and a VL comprising an LCDR1, an LCDR2, and an LCDR3 domain of the VL sequence of SEQ ID NO:81.
  • the invention provides use of an anti-sclerostin antibody for the manufacture of a medicament for the treatment of a bone-related disease, wherein the treatment comprises administering a therapeutically effective amount of the anti-sclerostin antibody each month for a period of at least 13 consecutive months, and wherein the antibody binds to the same epitope as an anti-sclerostin antibody that comprises a VH comprising an HCDR1, an HCDR2, and an HCDR3 domain of the VH sequence of SEQ ID NO:70, and a VL comprising an LCDR1, an LCDR2, and an LCDR3 domain of the VL sequence of SEQ ID NO:81.
  • the anti-sclerostin antibody used according to the invention binds sclerostin with an affinity of less than or equal to 10' 11 M (measured by Biacore) and binds to the same epitope an anti-sclerostin antibody that comprises a VH comprising an HCDR1, an HCDR2, and an HCDR3 domain of the VH sequence of SEQ ID NO:70, and a VL comprising an LCDR1, an LCDR2, and an LCDR3 domain of the VL sequence of SEQ ID NO:81.
  • Standard assays to determine the epitope of an antibodies are known in the art, including for example, X-ray crystallography, nuclear magnetic resonance (NMR), hydrogendeuterium exchange coupled to mass spectrometry, peptide-based approaches, or mutagenesisbased approaches (all discussed in Abbott et al. “Current approaches to fine mapping of antigen-antibody interactions.” Immunology vol. 142,4 (2014): 526-35, and references therein).
  • the anti-sclerostin antibody is provided as a pharmaceutical composition.
  • the pharmaceutical composition may be formulated with a pharmaceutically acceptable carrier.
  • the invention provides a pharmaceutical composition comprising an anti-sclerostin antibody as defined herein and a pharmaceutically acceptable carrier for use in the treatment of a bone-related disease, wherein a therapeutically effective amount of the anti-sclerostin antibody is administered each month for a period of at least 13 consecutive months.
  • the antibody comprises a VH comprising an HCDR1, an HCDR2, and an HCDR3 domain of the VH sequence of SEQ ID NO: 70, and a VL comprising an LCDR1, an LCDR2, and an LCDR3 domain of the VL sequence of SEQ ID NO:81.
  • Pharmaceutically acceptable carriers include a sterile aqueous solution.
  • the present invention provides a method for treating 01 in a human patient comprising administering to the human patient a therapeutically effective amount of 150-2500 mg of an anti-scl erostin antibody each month for a period of at least 13 consecutive months up to 18 years.
  • the present invention provides a method for treating OI in a human patient comprising administering to the human patient a therapeutically effective amount of 150-2500 mg of an anti-sclerostin antibody each month for a period of at least 30 consecutive months up to 18 years.
  • the present invention provides a method for treating OI in a human patient aged 0-17 years comprising administering to the human patient a therapeutically effective amount of 20-40 mg/kg of an anti-sclerostin antibody each month for a period of at least 13 consecutive months up to 18 years.
  • the present invention provides a method for treating OI in a human patient aged 0-17 years comprising administering to the human patient a therapeutically effective amount of 20-40 mg/kg of an anti-sclerostin antibody each month for a period of at least 30 consecutive months up to 18 years.
  • the present invention provides a method for treating OI in a human patient comprising administering to the human patient a therapeutically effective amount of 150-2500 mg of an anti-sclerostin antibody each month for a period of at least 13 consecutive months up to 18 years, wherein the anti-sclerostin antibody comprises a VH polypeptide sequence having the amino acid sequence of SEQ ID NO:70 and a VL polypeptide sequence having the amino acid sequence of SEQ ID NO:81.
  • the present invention provides a method for treating OI in a human patient comprising administering to the human patient a therapeutically effective amount of 150-2500 mg of an anti-sclerostin antibody each month for a period of at least 30 consecutive months up to 18 years, wherein the anti-sclerostin antibody comprises a VH polypeptide sequence having the amino acid sequence of SEQ ID NO:70 and a VL polypeptide sequence having the amino acid sequence of SEQ ID NO:81.
  • the present invention provides a method for treating 01 in a human patient aged 0-17 years comprising administering to the human patient a therapeutically effective amount of 20-40 mg/kg of an anti-sclerostin antibody each month for a period of at least 13 consecutive months up to 18 years, wherein the anti-sclerostin antibody comprises a VH polypeptide sequence having the amino acid sequence of SEQ ID NO:70 and a VL polypeptide sequence having the amino acid sequence of SEQ ID NO:81.
  • the present invention provides a method for treating OI in a human patient aged 0-17 years comprising administering to the human patient a therapeutically effective amount of 20-40 mg/kg of an anti-sclerostin antibody each month for a period of at least 30 consecutive months up to 18 years, wherein the anti-sclerostin antibody comprises a VH polypeptide sequence having the amino acid sequence of SEQ ID NO:70 and a VL polypeptide sequence having the amino acid sequence of SEQ ID NO:81.
  • the present invention provides a method for treating OI in a human patient comprising administering to the human patient a therapeutically effective amount of 150-2500 mg of an anti-sclerostin antibody each month for a period of at least 13 consecutive months up to 18 years, wherein the anti-sclerostin antibody comprises a VH polypeptide sequence comprising the amino acid sequence of SEQ ID NO: 198 and a VL polypeptide sequence comprising the amino acid sequence of SEQ ID NO: 199.
  • the present invention provides a method for treating OI in a human patient comprising administering to the human patient a therapeutically effective amount of 150-2500 mg of an anti-sclerostin antibody each month for a period of at least 30 consecutive months up to 18 years, wherein the anti-sclerostin antibody comprises a VH polypeptide sequence comprising the amino acid sequence of SEQ ID NO: 198 and a VL polypeptide sequence comprising the amino acid sequence of SEQ ID NO: 199.
  • the present invention provides a method for treating OI in a human patient aged 0-17 years comprising administering to the human patient a therapeutically effective amount of 20-40 mg/kg of an anti-sclerostin antibody each month for a period of at least 13 consecutive months up to 18 years, wherein the anti-sclerostin antibody comprises a VH polypeptide sequence comprising the amino acid sequence of SEQ ID NO: 198 and a VL polypeptide sequence comprising the amino acid sequence of SEQ ID NO: 199.
  • the present invention provides a method for treating 01 in a human patient aged 0-17 years comprising administering to the human patient a therapeutically effective amount of 20-40 mg/kg of an anti-sclerostin antibody each month for a period of at least 30 consecutive months up to 18 years, wherein the anti-sclerostin antibody comprises a VH polypeptide sequence comprising the amino acid sequence of SEQ ID NO: 198 and a VL polypeptide sequence comprising the amino acid sequence of SEQ ID NO: 199.
  • the present invention provides a method for treating OI in a human patient comprising administering to the human patient a therapeutically effective amount of 150-2500 mg of an anti-sclerostin antibody each month for a period of at least 13 consecutive months up to 18 years, wherein the anti-sclerostin antibody comprises a VH polypeptide sequence comprising the amino acid sequence of SEQ ID NO: 202 and a VL polypeptide sequence comprising the amino acid sequence of SEQ ID NO: 203.
  • the present invention provides a method for treating OI in a human patient comprising administering to the human patient a therapeutically effective amount of 150-2500 mg of an anti-sclerostin antibody each month for a period of at least 30 consecutive months up to 18 years, wherein the anti-sclerostin antibody comprises a VH polypeptide sequence comprising the amino acid sequence of SEQ ID NO: 202 and a VL polypeptide sequence comprising the amino acid sequence of SEQ ID NO: 203.
  • the present invention provides a method for treating OI in a human patient aged 0-17 years comprising administering to the human patient a therapeutically effective amount of 20-40 mg/kg of an anti-sclerostin antibody each month for a period of at least 13 consecutive months up to 18 years, wherein the anti-sclerostin antibody comprises a VH polypeptide sequence comprising the amino acid sequence of SEQ ID NO: 202 and a VL polypeptide sequence comprising the amino acid sequence of SEQ ID NO: 203.
  • the present invention provides a method for treating OI in a human patient aged 0-17 years comprising administering to the human patient a therapeutically effective amount of 20-40 mg/kg of an anti-sclerostin antibody each month for a period of at least 30 consecutive months up to 18 years, wherein the anti-sclerostin antibody comprises a VH polypeptide sequence comprising the amino acid sequence of SEQ ID NO: 202 and a VL polypeptide sequence comprising the amino acid sequence of SEQ ID NO: 203.
  • This example describes a 12-month, randomized, double-blind, Phase 2b clinical study including 60 adults diagnosed with type I, III or IV Osteogenesis Imperfecta (01) and a confirmed COL1 A1/COL1 A2 mutation who have fractured over the previous 5 years. Patients received each month either 8 mg/kg or 20 mg/kg doses of setrusumab for a period of 12 months. Setrusumab was administered intravenously by infusion. The study measured percentage change from baseline at 6 and 12 months for areal bone mineral density (BMD) at the lumbar spine, as measured by DXA. Procollagen IN-terminal propeptide (PINP), a biomarker of bone formation, and C-terminal telopeptide (CTX-1), a biomarker of bone resorption, were also measured at 1, 3, 6, 9, and 12 months.
  • BMD bone mineral density
  • Table 2 Baseline Patient Characteristics by Treatment Group
  • Table 3 Baseline Medical History by Treatment Group
  • CTX-1 bone resorption marker
  • Figure 3 shows that improvements in lumbar spine BMD above baseline were continuous with setrusumab therapy.
  • lumbar spine BMD (as measured by DXA) increased by about 4% after six months, and 8.5% after 12 months.
  • lumbar spine BMD (as measured by DXA) increased by about 4.7% after six months, and 6.8% after 12 months.
  • setrusumab provides continuous increase in BMD in 01 patients even though biomarkers appear to show a waning effect of setrusumab with long-term use. Surprisingly, these results show that the response analysed by biomarkers was distinct from the effect on BMD. Observed improvements in BMD were continuous, with comparable gains achieved in the first six months and second six months of treatment. In contrast, temporal changes were observed in biomarkers, with the biomarker response peaking in the first month of setrusumab therapy, and then rapidly waning even though therapy was continued.
  • Bone turnover markers P1NP and CTx were evaluated in serum of patients throughout the course of the 12-month treatment with setrusumab (20 mg/kg) and following the treatment until month 18 (for a total of 6 months post-setrusumab treatment). Patients received zoledronic acid or none according to physician recommendation. Serum P1NP (indicative of bone formation) dropped in patients irrespective of treatment with zoledronic acid (ZOL) ( Figure 5 A). On the other hand, serum CTx (indicative of bone resorption) increased in patients not receiving zoledronic acid.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biophysics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Biochemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Genetics & Genomics (AREA)
  • Rheumatology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2022/077259 2021-09-30 2022-09-29 Methods of using anti-sclerostin antibodies in treatment of osteogenesis imperfecta Ceased WO2023056355A2 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
AU2022357544A AU2022357544A1 (en) 2021-09-30 2022-09-29 Methods of using anti-sclerostin antibodies in treatment of osteogenesis imperfecta
CA3233220A CA3233220A1 (en) 2021-09-30 2022-09-29 Methods of using anti-sclerostin antibodies in treatment of osteogenesis imperfecta
KR1020247013976A KR20240082380A (ko) 2021-09-30 2022-09-29 골형성 부전증의 치료에 항-스클레로스틴 항체를 사용하는 방법
JP2024518919A JP2024536106A (ja) 2021-09-30 2022-09-29 骨形成不全症の治療における抗スクレロスチン抗体の使用方法
MX2024003828A MX2024003828A (es) 2021-09-30 2022-09-29 Métodos de uso de anticuerpos antiesclerostina en el tratamiento de osteogénesis imperfecta.
US18/696,578 US20250011407A1 (en) 2021-09-30 2022-09-29 Methods of using anti-sclerostin antibodies in treatment of osteogenesis imperfecta
EP22877568.0A EP4408884A4 (en) 2021-09-30 2022-09-29 Method for using anti-sclerostin antibodies in the treatment of osteogenesis imperfecta

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202163250918P 2021-09-30 2021-09-30
US63/250,918 2021-09-30
US202263374982P 2022-09-08 2022-09-08
US63/374,982 2022-09-08

Publications (2)

Publication Number Publication Date
WO2023056355A2 true WO2023056355A2 (en) 2023-04-06
WO2023056355A3 WO2023056355A3 (en) 2023-05-19

Family

ID=85783647

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/077259 Ceased WO2023056355A2 (en) 2021-09-30 2022-09-29 Methods of using anti-sclerostin antibodies in treatment of osteogenesis imperfecta

Country Status (9)

Country Link
US (1) US20250011407A1 (cg-RX-API-DMAC7.html)
EP (1) EP4408884A4 (cg-RX-API-DMAC7.html)
JP (1) JP2024536106A (cg-RX-API-DMAC7.html)
KR (1) KR20240082380A (cg-RX-API-DMAC7.html)
AU (1) AU2022357544A1 (cg-RX-API-DMAC7.html)
CA (1) CA3233220A1 (cg-RX-API-DMAC7.html)
MX (1) MX2024003828A (cg-RX-API-DMAC7.html)
TW (1) TW202323278A (cg-RX-API-DMAC7.html)
WO (1) WO2023056355A2 (cg-RX-API-DMAC7.html)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025212547A1 (en) * 2024-04-05 2025-10-09 Amgen Inc. Methods of treating osteogenesis imperfecta

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2011517672A (ja) * 2008-03-24 2011-06-16 アボツト・バイオテクノロジー・リミテツド 骨損失を治療するための方法及び組成物
MA41142A (fr) * 2014-12-12 2017-10-17 Amgen Inc Anticorps anti-sclérostine et utilisation de ceux-ci pour traiter des affections osseuses en tant qu'élements du protocole de traitement
KR20190037261A (ko) * 2016-08-08 2019-04-05 암젠 인크 항-스클레로스틴 항체를 사용한 결합 조직 부착 개선 방법
MX2019007161A (es) * 2016-12-21 2020-02-12 Mereo Biopharma 3 Ltd Uso de anticuerpos anti-esclerostina en el tratamiento de osteogenesis imperfecta.
US10961305B2 (en) * 2016-12-21 2021-03-30 Mereo Biopharma 3 Limited Use of anti-sclerostin antibodies in the treatment of osteogenesis imperfecta
GB201810746D0 (en) * 2018-06-29 2018-08-15 Mereo Biopharma 3 Ltd Use of sclerostin antagonist

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025212547A1 (en) * 2024-04-05 2025-10-09 Amgen Inc. Methods of treating osteogenesis imperfecta

Also Published As

Publication number Publication date
JP2024536106A (ja) 2024-10-04
EP4408884A2 (en) 2024-08-07
TW202323278A (zh) 2023-06-16
AU2022357544A1 (en) 2024-04-11
CA3233220A1 (en) 2023-04-06
MX2024003828A (es) 2024-05-10
US20250011407A1 (en) 2025-01-09
EP4408884A4 (en) 2025-04-23
KR20240082380A (ko) 2024-06-10
WO2023056355A3 (en) 2023-05-19

Similar Documents

Publication Publication Date Title
US12582712B2 (en) Method of making anti-pro/latent myostatin antibodies
US11925683B2 (en) Compositions for making and using anti-Myostatin antibodies
JP6353500B2 (ja) Dkk1抗体およびその使用方法
US20100221263A1 (en) Anti-Sclerostin Antibodies
JP7591092B2 (ja) 乾癬性関節炎患者における構造的損傷の進行を阻害するためのil-17アンタゴニストの使用
US20250011407A1 (en) Methods of using anti-sclerostin antibodies in treatment of osteogenesis imperfecta
AU2023203922B2 (en) Anti-pro/latent-Myostatin antibodies and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22877568

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 2022357544

Country of ref document: AU

Ref document number: AU2022357544

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 2024518919

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 3233220

Country of ref document: CA

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112024006149

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2022357544

Country of ref document: AU

Date of ref document: 20220929

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20247013976

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2022877568

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022877568

Country of ref document: EP

Effective date: 20240430

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22877568

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 112024006149

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20240327