Classifications

• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K39/00—Medicinal preparations containing antigens or antibodies
  • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
  • A61K39/39591—Stabilisation, fragmentation
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P35/00—Antineoplastic agents
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P37/00—Drugs for immunological or allergic disorders
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
  • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
  • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
  • C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
  • C07K16/283—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
  • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
  • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
  • C07K16/2851—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the lectin superfamily, e.g. CD23, CD72
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
  • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
  • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
  • C07K16/2875—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF/TNF superfamily, e.g. CD70, CD95L, CD153, CD154
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
  • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
  • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
  • C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K39/00—Medicinal preparations containing antigens or antibodies
  • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K39/00—Medicinal preparations containing antigens or antibodies
  • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
  • A61K2039/507—Comprising a combination of two or more separate antibodies
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K39/00—Medicinal preparations containing antigens or antibodies
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
  • C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
  • C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
  • C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
  • C07K2317/52—Constant or Fc region; Isotype
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
  • C07K2317/52—Constant or Fc region; Isotype
  • C07K2317/524—CH2 domain
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
  • C07K2317/55—Fab or Fab'
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
  • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
  • C07K2317/565—Complementarity determining region [CDR]
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
  • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
  • C07K2317/622—Single chain antibody (scFv)
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
  • C07K2317/64—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
  • C07K2317/71—Decreased effector function due to an Fc-modification
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
  • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
  • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
  • C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
  • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
  • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
  • C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2319/00—Fusion polypeptide
  • C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
  • C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag

Definitions

• the present application relates to multispecific binding proteins that bind to NKG2D, CD 16, and B cell-activating factor receptor (BAFF-R) on a cell, pharmaceutical compositions comprising such proteins, and therapeutic methods using such proteins and pharmaceutical compositions, including for the treatment of cancer.
• BAFF-R B cell-activating factor receptor
• Cancer immunotherapies are desirable because they are highly specific and can facilitate destruction of cancer cells using the patient’s own immune system. Fusion proteins such as bi-specific T-cell engagers are cancer immunotherapies described in the literature that bind to tumor cells and T-cells to facilitate destruction of tumor cells.
• NK cells Natural killer (NK) cells are a component of the innate immune system and make up approximately 15% of circulating lymphocytes. NK cells infiltrate virtually all tissues and were originally characterized by their ability to kill tumor cells effectively without the need for prior sensitization. Activated NK cells kill target cells by means similar to cytotoxic T cells - /. ⁇ ., via cytolytic granules that contain perforin and granzymes as well as via death receptor pathways. Activated NK cells also secrete inflammatory cytokines such as IFN-y and chemokines that promote the recruitment of other leukocytes to the target tissue.
• cytokines such as IFN-y and chemokines
• NK cells respond to signals through a variety of activating and inhibitory receptors on their surface. For example, when NK cells encounter healthy self-cells, their activity is inhibited through activation of the killer-cell immunoglobulin-like receptors (KIRs). Alternatively, when NK cells encounter foreign cells or cancer cells, they are activated via their activating receptors (e.g., NKG2D, NCRs, DNAM1). NK cells are also activated by the constant region of some immunoglobulins through CD 16 receptors on their surface. The overall sensitivity of NK cells to activation depends on the sum of stimulatory and inhibitory signals.
• KIRs killer-cell immunoglobulin-like receptors
• NKG2D is a type-II transmembrane protein that is expressed by essentially all natural killer cells where NKG2D serves as an activating receptor. NKG2D is also be found on T cells where it acts as a costimulatory receptor. The ability to modulate NK cell function via NKG2D is useful in various therapeutic contexts including malignancy.
• BAFF-R also called BAFF receptor, TNF receptor superfamily member 13C (TNFRSF13C), CD268, or BR3, is a type III transmembrane protein of the TNF receptor superfamily.
• BAFF-R is expressed at the late transitional (T2) B-cell stage and on all mature B cells, is downregulated on germinal center B cells, is re-expressed on memory cells, and is absent on plasma cells (Davidson (2012) Curr. Rheumatol. Rep., 14(4): 295-302).
• BAFF-R is a receptor for B cell-activating factor (BAFF), a B cell survival factor.
• BAFF can engage three receptors: BAFF-R, transmembrane activator and CAML interactor (TACI), and B-cell maturation antigen (BCMA).
• BAFF-R is the principal receptor involved in the development of follicular and marginal zone splenic B cells (Schiemann et al. (2001) Science, 293: 2111-14).
• the BAFF/BAFF-R signaling axis may play a role in B cell hyperplasia. Increased expression of BAFF-R, as well as elevated serum levels of BAFF, has been observed in nonHodgkin lymphoma (NHL) patients (Shen et al. (2016) Adv. Clin. Exp. Med., 25(5):837-44).
• NHL nonHodgkin lymphoma
• SNPs single nucleotide polymorphisms in BAFF-R are associated with increased risk of chronic lymphocytic leukemia (CLL) (Jesek et al. (2016) Tumour Biol., 37(10): 13617-26).
• CLL chronic lymphocytic leukemia
• the BAFF/BAFF-R axis is also implicated in autoimmune inflammatory diseases (Mackay et al. (1999) J. Exp. Med., 190: 1697-1710).
• SLE systemic lupus erythematosus
• the present application provides multispecific binding proteins that bind to the NKG2D receptor and CD 16 receptor on natural killer cells, and BAFF-R. Such proteins can engage more than one kind of NK-activating receptor, and may block the binding of natural ligands to NKG2D.
• the proteins can agonize NK cells in humans.
• the proteins can agonize NK cells in humans and in other species such as rodents and cynomolgus monkeys.
• Formulations containing any one of the proteins disclosed herein; cells containing one or more nucleic acids expressing the proteins, and methods of enhancing tumor cell death using the proteins are also provided.
• the present application provides a protein comprising:
• BAFF-R B cell-activating factor receptor
• the first antigen-binding site that binds NKG2D is a Fab fragment
• the second antigen-binding site that binds BAFF-R is an scFv
• the first antigen-binding site that binds NKG2D is an scFv
• the second antigen-binding site that binds BAFF-R is a Fab fragment.
• the protein further comprises an additional antigen-binding site that binds BAFF-R.
• the first antigenbinding site that binds NKG2D is an scFv
• the second and the additional antigen-binding sites that bind BAFF-R are each a Fab fragment.
• the first antigenbinding site that binds NKG2D is an scFv
• the second and the additional antigen-binding sites that bind BAFF-R are each an scFv.
• the amino acid sequences of the second and the additional antigen-binding sites are identical. In certain embodiments, the amino acid sequences of the second and the additional antigen-binding sites are different.
• the scFv that binds NKG2D is linked to an antibody constant domain or a portion thereof sufficient to bind CD 16, via a hinge comprising Ala-Ser or Gly-Ser, wherein the scFv comprises a heavy chain variable domain and a light chain variable domain.
• each scFv that binds BAFF-R is linked to an antibody constant domain or a portion thereof sufficient to bind CD 16, via a hinge comprising Ala-Ser or Gly-Ser, wherein the scFv comprises a heavy chain variable domain and a light chain variable domain.
• the hinge further comprises an amino acid sequence Thr-Lys-Gly.
• the heavy chain variable domain of the scFv forms a disulfide bridge with the light chain variable domain of the scFv.
• the heavy chain variable domain of the scFv forms a disulfide bridge with the light chain variable domain of the scFv.
• the disulfide bridge is formed between C44 of the heavy chain variable domain and Cl 00 of the light chain variable domain, numbered under the Kabat numbering scheme.
• the heavy chain variable domain is linked to the light chain variable domain via a flexible linker. In some embodiments, within each scFv that binds BAFF-R, the heavy chain variable domain is linked to the light chain variable domain via a flexible linker. In certain embodiments, the flexible linker comprises (GrS In certain embodiments, within the scFv that binds NKG2D, the heavy chain variable domain is positioned at the C-terminus of the light chain variable domain. In certain embodiments, within each scFv that binds BAFF-R, the heavy chain variable domain is positioned at the C-terminus of the light chain variable domain.
• the heavy chain variable domain is positioned at the N-terminus of the light chain variable domain. In certain embodiments, within each scFv that binds BAFF-R, the heavy chain variable domain is positioned at the N-terminus of the light chain variable domain. In certain embodiments, the Fab fragment that binds NKG2D is not positioned between an antigen-binding site and the Fc or the portion thereof. In certain embodiments, no Fab fragment that binds BAFF-R is positioned between an antigen-binding site and the Fc or the portion thereof.
• a protein comprising:
• a second antigen-binding site comprising a single-chain variable fragment (scFv) that binds B cell-activating factor receptor (BAFF-R); and
• an Fc domain comprising a first antibody constant domain and a second antibody constant domain that form a heterodimer that binds CD 16, wherein the scFv is linked to the N-terminus of the first antibody constant domain via a hinge, and the Fab is linked to the N-terminus of the second antibody constant domain.
• the hinge comprises Gly-Ser.
• the first antigen-binding site binds human NKG2D.
• the first antigen-binding site that binds NKG2D comprises a VH comprising complementarity-determining region 1 (CDR1), complementaritydetermining region 2 (CDR2), and complementarity-determining region 3 (CDR3) comprising the amino acid sequences of SEQ ID NOs: 81, 82, and 112, respectively; and a VL comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 86, 77, and 87, respectively.
• the first antigen-binding site that binds NKG2D comprises a VH comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: 81, 82, and 97, respectively; and a VL comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: 86, 77, and 87, respectively.
• the first antigen-binding site that binds NKG2D comprises a VH comprising an amino acid sequence at least 90% identical to SEQ ID NO: 95 and a VL comprising an amino acid sequence at least 90% identical to SEQ ID NO:85.
• the first antigen-binding site that binds NKG2D comprises a VH comprising an amino acid sequence of SEQ ID NO:95 and a VL comprising an amino acid sequence of SEQ ID NO:85.
• the second antigen-binding site comprises a heavy chain variable domain comprising CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 260, 249, and 261, respectively; and a light chain variable domain comprising CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 217, 77, and 259, respectively.
• the second antigen-binding site comprises a heavy chain variable domain comprising CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 214, 233, and 248, respectively; and a light chain variable domain comprising CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 217, 77, and 249, respectively.
• the second antigen-binding site comprises a heavy chain variable domain at least 90% identical to SEQ ID NO:250 and a light chain variable domain at least 90% identical to SEQ ID NO:251.
• the second antigen-binding site comprises a VH with a G44C substitution relative to SEQ ID NO:250, and a VL with a G100C substitution relative to SEQ ID NO:251.
• the second antigen-binding site comprises a VH comprising the amino acid sequence of SEQ ID NO:252 and a VL comprising the amino acid sequence of SEQ ID NO:253, or a VH comprising the amino acid sequence of SEQ ID NO:250 and a VL comprising the amino acid sequence of SEQ ID NO:251.
• the second antigen-binding site comprises a VH comprising the amino acid sequence of SEQ ID NO:252 and a VL comprising the amino acid sequence of SEQ ID NO:253. In some embodiments, the second antigen-binding site comprises a VH comprising the amino acid sequence of SEQ ID NO:250 and a VL comprising the amino acid sequence of SEQ ID NO:251. [0023] In some embodiments of a protein disclosed herein, the second antigen-binding site comprises a single-chain fragment variable (scFv), and the scFv comprises a VH comprising the amino acid sequence of SEQ ID NO:252 and a VL comprising the amino acid sequence of SEQ ID NO:253.
• scFv single-chain fragment variable
• the second antigen-binding site comprises an scFv and the the scFv comprises an amino acid sequence at least 90% identical to a sequence selected from the group consisting of SEQ ID NOs: 254 and 255. In some embodiments, the second antigenbinding site comprises an scFv and the scFv comprises an amino acid sequence at least 90% identical to SEQ ID NO:254. In some embodiments, the second antigen-binding site comprises an scFv and the scFv comprises an amino acid sequence of SEQ ID NO:254.
• the protein comprises an amino acid sequence at least 90% identical to SEQ ID NO:270. In some embodiments, the protein comprises an amino acid sequence of SEQ ID NO:270. In some embodiments, the protein comprises an amino acid sequence at least 90% identical to SEQ ID NO:271. In some embodiments, the protein comprises an amino acid sequence of SEQ ID NO:271.
• the second antigen-binding site binds human BAFF-R with a dissociation constant (KD) smaller than or equal to 5 nM, as measured by surface plasmon resonance (SPR).
• KD dissociation constant
• the second antigen-binding site inhibits (e.g., blocks) binding of BAFF-R to BAFF (e.g., by at least 50%, at least 75%, at least 90%, at least 95% or at least 99% as measured in a competitive binding assay).
• a protein comprising:
• a first antigen-binding site comprising a VH and a VL of an anti-NKG2D antibody, wherein the VH comprises the amino acid sequence of SEQ ID NO:95 and the VL comprises the amino acid sequence of SEQ ID NO:85;
• a second antigen-binding site comprising a VH and a VL of an anti-BAFF-R antibody, wherein the VH comprises the amino acid sequence of SEQ ID NO:252 and the VL comprises the amino acid sequence of SEQ ID NO:253;
• a protein comprising:
• a first antigen-binding site comprising a VH and a VL of an anti-NKG2D antibody, wherein the VH comprises the amino acid sequence of SEQ ID NO:95 and the VL comprises the amino acid sequence of SEQ ID NO:85;
• the antibody Fc domain is a human IgGl antibody Fc domain. In some embodiments, the antibody Fc domain or the portion thereof comprises an amino acid sequence at least 90% identical to SEQ ID NO: 118.
• At least one polypeptide chain of the antibody Fc domain comprises one or more mutations, relative to SEQ ID NO: 118, at one or more positions selected from Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, N390, K392, T394, D399, S400, D401, F405, Y407, K409, T411, and K439, numbered according to the EU numbering system.
• At least one polypeptide chain of the antibody Fc domain comprises one or more mutations, relative to SEQ ID NO:118, selected from Q347E, Q347R, Y349S, Y349K, Y349T, Y349D, Y349E, Y349C, L351K, L351D, L351Y, S354C, E356K, E357Q, E357L, E357W, K360E, K360W, Q362E, S364K, S364E, S364H, S364D, T366V, T366I, T366L, T366M, T366K, T366W, T366S, L368E, L368A, L368D, K370S, N390D, N390E, K392L, K392M, K392V, K392F, K392D, K392E, T394F, D
• one polypeptide chain of the antibody heavy chain constant region comprises one or more mutations, relative to SEQ ID NO: 118, at one or more positions selected from Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, K392, T394, D399, S400, D401, F405, Y407, K409, T411 and K439; and the other polypeptide chain of the antibody heavy chain constant region comprises one or more mutations, relative to SEQ ID NO: 118, at one or more positions selected from Q347, Y349, L351, S354, E356, E357, S364, T366, L368, K370, N390, K392, T394, D399, D401, F405, Y407, K409, T411, and K439, numbered according to the EU numbering system.
• one polypeptide chain of the antibody heavy chain constant region comprises K360E and K409W substitutions relative to SEQ ID NO: 118; and the other polypeptide chain of the antibody heavy chain constant region comprises Q347R, D399V and F405T substitutions relative to SEQ ID NO: 118, numbered according to the EU numbering system.
• one polypeptide chain of the antibody heavy chain constant region comprises an F405L substitution relative to SEQ ID NO: 118; and the other polypeptide chain of the antibody heavy chain constant region comprises a K409R substitution relative to SEQ ID NO: 118, numbered according to the EU numbering system.
• one polypeptide chain of the antibody heavy chain constant region comprises a Y349C substitution relative to SEQ ID NO: 118; and the other polypeptide chain of the antibody heavy chain constant region comprises an S354C substitution relative to SEQ ID NO: 118, numbered according to the EU numbering system.
• the present application provides a protein comprising:
• the present application provides a protein comprising:
• a first polypeptide comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:270;
• a second polypeptide comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 194; and
• a third polypeptide comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 195.
• the protein provided herein comprises:
• the protein provided herein comprises:
• the protein provided herein comprises:
• the protein provided herein comprises:
• the protein provided herein comprises:
• the protein provided herein comprises: (a) a first polypeptide comprising an amino acid sequence at least 99% identical to the amino acid sequence of SEQ ID NO:270;
• the protein provided herein comprises a polypeptide comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:270.
• the protein provided herein comprises a polypeptide comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO:270.
• the protein provided herein comprises a polypeptide comprising an amino acid sequence at least 99% identical to the amino acid sequence of SEQ ID NO:270.
• the protein provided herein comprises a polypeptide comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 194.
• the protein provided herein comprises a polypeptide comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 194.
• the protein provided herein comprises a polypeptide comprising an amino acid sequence at least 99% identical to the amino acid sequence of SEQ ID NO: 194.
• the protein provided herein comprises a polypeptide comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 195.
• the protein provided herein comprises a polypeptide comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 195.
• the protein provided herein comprises a polypeptide comprising an amino acid sequence at least 99% identical to the amino acid sequence of SEQ ID NO: 195.
• the present application provides a protein comprising: (a) a first polypeptide comprising the amino acid sequence of SEQ ID NO:271; (b) a second polypeptide comprising the amino acid sequence of SEQ ID NO:272; and
• the present application provides a pharmaceutical composition comprising a protein disclosed herein and a pharmaceutically acceptable carrier.
• the present application provides a cell comprising one or more nucleic acids encoding a protein disclosed herein.
• the present application provides a method of enhancing tumor cell death, the method comprising exposing the tumor cell and a natural killer cell to an effective amount of a protein disclosed herein or a pharmaceutical composition disclosed herein.
• the present application provides a method of treating cancer, the method comprising administering to a subject in need thereof an effective amount of a protein disclosed herein or a pharmaceutical composition disclosed herein.
• the cancer is selected from the group consisting of B-cell non-Hodgkin’s lymphoma (B-NHL), chronic lymphocytic leukemia (CLL), mantle cell lymphoma (MCL), follicular lymphoma (FL), diffuse large B-cell lymphoma (DLBCL), marginal zone lymphoma, mucosa-associated lymphoid tissue (MALT) lymphoma, primary mediastinal B-cell lymphoma, and acute lymphocytic leukemia (ALL).
• B-NHL B-cell non-Hodgkin’s lymphoma
• CLL chronic lymphocytic leukemia
• MCL mantle cell lymphoma
• FL follicular lymphoma
• DLBCL diffuse large B-cell lymphoma
• MALT
• the present application provides a method of enhancing B cell death, the method comprising exposing the B cell and a natural killer cell to an effective amount of a protein disclosed herein or a pharmaceutical composition disclosed herein.
• the present application provides a method of treating an autoimmune inflammatory disease, the method comprising administering to a subject in need thereof an effective amount of a protein disclosed herein or a pharmaceutical composition disclosed herein.
• the protein is a purified protein.
• the protein is purified using a method selected from the group consisting of: centrifugation, depth filtration, cell lysis, homogenization, freeze-thawing, affinity purification, gel filtration, ion exchange chromatography, hydrophobic interaction exchange chromatography, and mixed-mode chromatography.
• FIG. 1 is a representation of a heterodimeric, multispecific antibody, e.g., a trispecific binding protein (TriNKET).
• TriNKET trispecific binding protein
• Each arm can represent either the NKG2D binding domain, or the BAFF-R binding domain.
• the NKG2D binding domain and the BAFF-R binding domains can share a common light chain.
• FIG. 2A-FIG. 2E illustrate five exemplary formats of a multispecific binding protein, e.g., a trispecific binding protein (TriNKET).
• TriNKET trispecific binding protein
• either the NKG2D- binding domain or the BAFF-R binding domain can take the scFv format (left arm).
• An antibody that contains a NKG2D targeting scFv, a BAFF-R targeting Fab fragment, and a heterodimerized antibody constant region is referred herein as the F3-TriNKET.
• FIG. 2E An antibody that contains a BAFF-R targeting scFv, a NKG2D targeting Fab fragment, and a heterodimerized antibody constant region/domain that binds CD 16 is referred herein as the F3’ -TriNKET (FIG. 2E).
• F3’ -TriNKET FIG. 2E
• both the NKG2D binding domain and BAFF-R binding domain can take the scFv format.
• FIG. 2C-FIG. 2D are illustrations of an antibody with three antigen-binding sites, including two antigen-binding sites that bind BAFF-R, and the NKG2D-binding site fused to the heterodimerized antibody constant region. These antibody formats are referred herein as F4- TriNKET.
• FIG. 1 An antibody that contains a BAFF-R targeting scFv, a NKG2D targeting Fab fragment, and a heterodimerized antibody constant region/domain that binds CD 16 is referred herein as the
• FIG. 2C illustrates that the two BAFF-R binding sites are in the Fab fragment format, and the NKG2D binding site in the scFv format.
• FIG. 2D illustrates that the BAFF-R binding sites are in the scFv format, and the NKG2D binding site is in the scFv format.
• FIG. 2E represents a trispecific antibody (TriNKET) that contains a BAFF-R targeting scFv, a NKG2D targeting Fab fragment, and a heterodimerized antibody constant region/domain (“CD domain”) that binds CD 16.
• the antibody format is referred herein as F3’ -TriNKET.
• heterodimerization mutations on the antibody constant region include K360E and K409W on one constant domain; and Q347R, D399V and F405T on the opposite constant domain (shown as a triangular lock-and-key shape in the CD domains).
• the bold bar between the heavy and the light chain variable domains of the Fab fragments represents a disulfide bond.
• FIG. 3 is a representation of a TriNKET in the Triomab form, which is a trifunctional, bispecific antibody that maintains an IgG-like shape.
• This chimera consists of two half antibodies, each with one light and one heavy chain, that originate from two parental antibodies.
• Triomab form may be a heterodimeric construct containing 1/2 of rat antibody and 1/2 of mouse antibody.
• FIG. 4 is a representation of a TriNKET in the KiH Common Light Chain form, which involves the knobs-into-holes (KIHs) technology.
• KiH is a heterodimer containing 2 Fab fragments binding to target 1 and 2, and an Fc stabilized by heterodimerization mutations.
• TriNKET in the KiH format may be a heterodimeric construct with 2 Fab fragments binding to target 1 and target 2, containing two different heavy chains and a common light chain that pairs with both heavy chains.
• FIG. 5 is a representation of a TriNKET in the dual-variable domain immunoglobulin (DVD-IgTM) form, which combines the target-binding domains of two monoclonal antibodies via flexible naturally occurring linkers, and yields a tetravalent IgG-like molecule.
• DVD-IgTM is a homodimeric construct where variable domain targeting antigen 2 is fused to the N-terminus of a variable domain of Fab fragment targeting antigen 1.
• DVD-IgTM form contains normal Fc.
• FIG. 6 is a representation of a TriNKET in the Orthogonal Fab fragment interface (Ortho-Fab) form, which is a heterodimeric construct that contains 2 Fab fragments binding to target 1 and target 2 fused to Fc.
• Light chain (LC)-heavy chain (HC) pairing is ensured by orthogonal interface.
• Heterodimerization is ensured by mutations in the Fc.
• FIG. 7 is a representation of a TriNKET in the 2-in-l Ig format.
• FIG. 8 is a representation of a TriNKET in the ES form, which is a heterodimeric construct containing two different Fab fragments binding to target 1 and target 2 fused to the Fc. Heterodimerization is ensured by electrostatic steering mutations in the Fc.
• FIG. 9 is a representation of a TriNKET in the Fab Arm Exchange form: antibodies that exchange Fab fragment arms by swapping a heavy chain and attached light chain (halfmolecule) with a heavy-light chain pair from another molecule, resulting in bispecific antibodies.
• Fab Arm Exchange form (cFae) is a heterodimer containing 2 Fab fragments binding to target 1 and 2, and an Fc stabilized by heterodimerization mutations.
• FIG. 10 is a representation of a TriNKET in the SEED Body form, which is a heterodimer containing 2 Fab fragments binding to target 1 and 2, and an Fc stabilized by heterodimerization mutations.
• FIG. 11 is a representation of a TriNKET in the LuZ-Y form, in which a leucine zipper is used to induce heterodimerization of two different HCs.
• the LuZ-Y form is a heterodimer containing two different scFabs binding to target 1 and 2, fused to Fc. Heterodimerization is ensured through leucine zipper motifs fused to C-terminus of Fc.
• FIG. 12 is a representation of a TriNKET in the Cov-X-Body form.
• FIG. 13A and FIG. 13B are representations of TriNKETs in the ick-Body forms, which are heterodimeric constructs with two different Fab fragments fused to Fc stabilized by heterodimerization mutations: one Fab fragment targeting antigen 1 contains kappa LC, and the second Fab fragment targeting antigen 2 contains lambda LC.
• FIG. 13A is an exemplary representation of one form of a KX-Body;
• FIG. 13B is an exemplary representation of another KX- Body.
• FIG. 14 is a representation of an OAsc-Fab heterodimeric construct that includes Fab fragment binding to target 1 and scFab binding to target 2, both of which are fused to the Fc domain. Heterodimerization is ensured by mutations in the Fc domain.
• FIG. 15 is a representation of a DuetMab, which is a heterodimeric construct containing two different Fab fragments binding to antigens 1 and 2, and an Fc that is stabilized by heterodimerization mutations.
• Fab fragments 1 and 2 contain differential S-S bridges that ensure correct light chain and heavy chain pairing.
• FIG. 16 is a representation of a CrossmAb, which is a heterodimeric construct with two different Fab fragments binding to targets 1 and 2, and an Fc stabilized by heterodimerization mutations.
• CL and CHI domains, and VH and VL domains are switched, e.g., CHI is fused in-line with VL, and CL is fused in-line with VH.
• FIG. 17 is a representation of a Fit-Ig, which is a homodimeric construct where Fab fragment binding to antigen 2 is fused to the N-terminus of HC of Fab fragment that binds to antigen 1.
• the construct contains wild-type Fc.
• FIG. 18A-FIG. 18C are line graphs showing binding of BAFF-R-targeting TriNKETs derived from hCOH-2 (FIG. 18A), Genentech Hu9.1-73 (FIG.
• ianalumab-based antigen-binding site the three versions, F3’, 2-Fab, and ianalumab-mAb, do not contain antibody-dependent cellular cytotoxicity-enhancing mutations present in the commercial ianalumab antibody) (FIG. 18C) to BAFF-R-positive RAJI cells.
• FIG. 19A-FIG. 19C are line graphs showing NK cell-mediated lysis of BAFF-R- positive RAJI cells by primary NK cells in the presence of BAFF-R-targeting TriNKETs derived from hCOH-2 (FIG. 19A), Genentech Hu9.1-73 (FIG. 19B), and ianalumab-based antigenbinding site (the three versions, F3’, 2-Fab, and ianalumab-mAb, do not contain antibodydependent cellular cytotoxicity-enhancing mutations present in the commercial ianalumab antibody) (FIG. 19C).
• FIG. 20A-FIG. 20C are line graphs showing NK cell-mediated lysis of BAFF-R- positive RAJI cells by KHYG-CD16V cells in the presence of BAFF-R-targeting TriNKETs derived from hCOH-2 (FIG. 20A), Genentech Hu9.1-73 (FIG. 20B), and ianalumab-based antigen-binding site (the three versions, F3’, 2-Fab, and ianalumab-mAb, do not contain antibody-dependent cellular cytotoxicity-enhancing mutations present in the commercial ianalumab antibody) (FIG. 20C).
• FIG. 21 is a graph showing fluorescence outputs from a blocking assay of BAFF- biotin binding to hBAFF-R expressed on CHO cells by the indicated antibodies.
• FIG. 22A-FIG. 22D are graphs of fluorescence outputs from binding assays on CHO cells showing binding of indicated antibodies to hBAFF-R (FIG. 22A, FIG. 22B) or blocking assays of BAFF-biotin binding to BAFF-R by indicated antibodies (FIG. 22C, FIG. 22D).
• FIG. 23A-FIG. 23E are flow cytometry plots showing binding of AB0369scFv expressed on yeast to no antigen control (FIG. 23 A), h-BAFF-R-hFc (FIG. 23B), Irrel evant-hFc (FIG. 23 C), hBAFF-R-GST (FIG. 23D), or Irrelevant-GST (FIG. 23E).
• Vertical axes indicates scFv expression as measured by detection of the Flag epitope tag; horizonal axes indicate binding of biotinylated control of BAFF-R constructs to scFv as measured by detection of streptavidin-PE.
• FIG. 24A and FIG. 24B are graphs showing binding of AB0369 or indicated controls to human (FIG. 24A) or cynomolgus monkey (FIG. 24B) BAFF-R.
• FIG. 25A-FIG. 25G detail a poly-specificity assay of a multi-specific binding proteins with a BAFF-R binding site derived from AB0369.
• FIG. 25A is a schematic of the assay.
• FIG. 25B-FIG. 25G show graphs of AB0369 (left panels), trastuzumab negative control (middle panels), or ixekizumab positive control (right panels) in the absence (top panels) or presence (bottom panels) of poly-specificity reagent (PSR).
• PSR poly-specificity reagent
• FIG. 26 is a graph showing a KHYG-l-CD16aV cytotoxicity assay of Ramos cells as induced by a multispecific binding protein with a BAFF-R binding site derived from AB0369.
• FIG. 27 is a graph showing fluorescence outputs from a binding assay showing blockage of BAFF-biotin binding to human BAFF-R expressed on CHO cells by AB0369 or indicated.
• FIG. 28A-FIG. 28D are flow cytometry plots showing binding of hBAFF-R-hFc- His to parental AB0369scFv or clones selected from a library produced by affinity maturation expressed on yeast following successive rounds of selection.
• FIG. 28A shows binding to parental AB0369scFv;
• FIG. 28B shows binding to sample from the first round of clone selection;
• FIG. 28C shows binding to sample from the second round of clone selection;
• FIG. 28D shows binding to output from the second round of clone selection.
• FIG. 29A-FIG. 29E are flow cytometry plots showing binding of hBAFF-R-hFc- His to AB0369 and affinity-matured scFv clones expressed on yeast.
• FIG. 29A shows binding to parental AB0369;
• FIG. 29B shows binding to AB0605;
• FIG. 29C shows binding to AB0622;
• FIG. 29D shows binding to AB0622;
• FIG. 29E shows binding to ianalumab-based antigenbinding site.
• FIG. 30A-FIG. 30C are graphs demonstrating BAFF-R binding and cytotoxicity of multi-specific binding proteins developed from affinity maturation of AB0369.
• FIG. 30A is a graph showing binding of multi-specific binding proteins with BAFF-R binding sites derived from indicated clones to human BAFF-R expressed on CHO cells.
• FIG. 30B is a graph showing a KHYG-l-CD16aV cytotoxicity assay of Ramos cells as induced by multi-specific binding proteins with BAFF-R binding sites derived from indicated clones.
• FIG. 30C is a graph showing a KHYG-l-CD16aV cytotoxicity assay of Ramos cells as induced by multi-specific binding proteins with BAFF-R binding sites derived from AB0622.
• FIG. 31A-FIG. 31E detail a poly-specificity assay of multi-specific binding proteins with BAFF-R binding sites derived from AB00605 and AB0606.
• FIG. 31 A is a schematic of the assay.
• FIG. 31B-FIG. 3 IE show graphs of AB0605 (left panels) or AB0606 (right panels) in the absence (top panels) or presence (bottom panels) of poly-specificity reagent (PSR).
• PSR poly-specificity reagent
• FIG. 32A-FIG. 32C are flow cytometry plots showing binding of hBAFF-R-hFc- His to parental AB0369scFv or clones selected from a library produced by affinity maturation and expressed on yeast following successive rounds of selection.
• FIG. 32A shows binding to parental AB0369scFv;
• FIG. 32B shows binding to sample from the first round of clone selection;
• FIG. 32C shows binding to sample from the second round of clone selection.
• FIG. 33A-FIG. 33E are flow cytometry plots showing binding of hBAFF-R-hFc- His to AB0369 and affinity-matured scFv clones expressed on yeast.
• FIG. 33A shows binding to parental AB0369;
• FIG. 33B shows binding to AB0679;
• FIG. 33C shows binding to AB0681;
• FIG. 33D shows binding to AB0682;
• FIG. 33E shows binding to ianalumab-based antigenbinding site.
• FIG. 34A-FIG. 34C are graphs demonstrating BAFF-R binding to multi-specific binding proteins developed from affinity maturation of AB0369.
• FIG. 34A is a graph showing binding of multi-specific binding proteins with BAFF-R binding sites derived from indicated clones to human BAFF-R expressed on CHO cells.
• FIG. 34B is a graph showing binding of multi-specific binding proteins with BAFF-R binding sites derived from indicated clones to cynomolgus monkey BAFF-R expressed on CHO cells.
• FIG. 34C is a graph showing fluorescence outputs from a binding assay showing blockage of BAFF-biotin binding to BAFF-R expressed on CHO cells by the indicated antibodies.
• FIG. 35 is a graph showing a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by multi-specific binding proteins with BAFF-R binding sites derived from AB0679, AB0568, or Tool-F3’ positive control.
• FIG. 36A-FIG. 36D are flow cytometry plots showing binding of hBAFF-R-hFc- His to parental AB0369scFv clones selected from a library produced by affinity maturation expressed on yeast following successive rounds of selection.
• FIG. 36A shows binding to parental AB0369scFv;
• FIG. 36B shows binding to sample from the first round of clone selection;
• FIG. 36C shows binding to sample from the second round of clone selection; and
• FIG. 36D shows binding to sample from the third round of clone selection.
• FIG. 37A-FIG. 37F are flow cytometry plots showing binding of hBAFF-R-hFc- His to AB0369 and affinity-matured scFv clones expressed on yeast.
• FIG. 37A shows binding to parental AB0369;
• FIG. 37B shows binding to AB0682;
• FIG. 37C shows binding to AB0898;
• FIG. 37D shows binding to AB0899;
• FIG. 37E shows binding to AB0900; and
• FIG. 37F shows binding to ianalumab-based antigen-binding site.
• FIG. 38 is a graph showing a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by multi-specific binding proteins with BAFF-R binding sites derived from AB0898, AB0899, or AB0900.
• FIG. 39A-FIG. 39C show graphs of differential scanning calorimetry (DSC) profiles of AB0898 (FIG. 39A), AB0899 (FIG. 39B), and AB0900 (FIG. 39C).
• FIG. 40 shows flow cytometry plots of binding of scFv clones expressed on yeast to biotinylated hBAFFR-Fc before (left) and after (right) challenge by incubation with 1 mM nonbiotinylated hBAFFR-Fc.
• FIG. 41A and FIG. 41B show flow cytometry plots of binding of scFv clones expressed on yeast to biotinylated hBAFFR-Fc before (FIG. 41 A) and after (FIG. 41B) challenge by incubation with 1 mM non-biotinylated hBAFFR-Fc.
• Clones tested are (left-to-right) AB1080, AB1081, AB1084, AB1085, and ianalumab.
• FIG. 42A and FIG. 42B are graphs showing binding of indicated antibody clones to human (FIG. 42 A) or cynomolgus monkey (FIG. 42B) BAFF-R.
• FIG. 43A-FIG. 431 detail a poly-specificity assay of a multi-specific binding proteins with a BAFF-R binding site derived from AB1080 or AB1081.
• FIG. 43A is a schematic of the assay.
• FIG. 43B-FIG. 431 show graphs of AB 1080 (left panels), AB 1081 (middle-left panels), trastuzumab negative control (middle-right panels), or ixekizumab positive control (right panels) in the absence (top panels) or presence (bottom panels) of poly-specificity reagent (PSR).
• PSR poly-specificity reagent
• FIG. 44A and FIG. 44B show graphs of a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by multi-specific binding proteins with BAFF-R binding sites derived from AB1080 (FIG. 44A) or AB1085 (FIG. 44B) compared to Tool positive control.
• FIG. 45 is a graph showing fluorescence outputs from a blocking assay of BAFF- biotin binding to human BAFF-R expressed on CHO cells by the indicated antibody clones.
• FIG. 46A-FIG. 46D show graphs of nano-dual scanning fluorimetry (nanoDSF) analysis of multi-specific binding proteins with BAFF-R binding sites derived from AB1080 (FIG. 46A), AB 1081 (FIG. 46B), AB 1084 (FIG. 46C), and AB 1085 (FIG. 46D).
• FIG. 47 shows a graph of hydrophobic interaction chromatography (HIC) analysis of multi-specific binding proteins with BAFF-R binding sites derived from indicated antibodies.
• HIC hydrophobic interaction chromatography
• FIG. 48 shows a graph of HIC analysis of AB 1612 compared to indicated benchmark biologies.
• FIG. 49A and FIG. 49B are graphs showing binding of indicated antibody clones to cynomolgus monkey (FIG. 49 A) or human (FIG. 49B) BAFF-R.
• FIG. 50 is a graph showing fluorescence outputs from a binding assay showing blockage of BAFF-biotin binding to human BAFF-R expressed on CHO cells by the indicated antibodies.
• FIG. 51A-FIG. 51C show the surface charge distribution of the BAFF-R binding arm of AB1424/1612 F3’ TriNKET. Three orientations are shown: both facades (left panel: front view; center panel: back view) and the antigen-engaging surface (right panel: top view). The positively charged areas are colored blue, negatively charged areas red, and the hydrophobic surface white.
• FIG. 52A-FIG. 52E are graphs showing evaluation of surface patches and CDRs length of the BAFF-R binding arm of AB1424/1612 F3’ TriNKET. Solid lines and corresponding arrows indicate the scoring of the BAFF-R binding arm of AB1424/1612 F3’ TriNKET in reference to a database of 377 late-stage therapeutic antibodies.
• the two inner dashed lines indicate 2 standard deviations (>95% of reference molecules within this region), whereas the two outer most dashed lines indicate 3 standard deviations (>99.7% of reference molecules within this region).
• FIG. 52C-FIG. 52E there are two dashed lines - one closer and the other further to the solid line. The dashed line closer to the solid line indicates 2 standard deviations (>95% of reference molecules within this region), whereas the dashed line further to the solid line indicates 3 standard deviations (>99.7% of reference molecules within this region).
• FIG. 53A-FIG. 53C show the surface charge distribution of the NKG2D binding arm of AB1424/1612 F3’ TriNKET. Three orientations are shown: both facades (left panel: front view; center panel: back view) and the antigen-engaging surface (right panel: top view). The positively charged areas are colored blue, negatively charged areas red, and the hydrophobic surface white.
• FIG. 54A-FIG. 54E are graphs showing evaluation of surface patches and CDRs length of the NKG2D-R binding arm of AB 1424/1612 F3’ TriNKET. Solid lines and corresponding arrows indicate the scoring of the BAFF-R binding arm of AB1424/1612 F3’ TriNKET in reference to a database of 377 late-stage therapeutic antibodies.
• the two inner dashed lines indicate 2 standard deviations (>95% of reference molecules within this region), whereas the two outer most dashed lines indicate 3 standard deviations (>99.7% of reference molecules within this region).
• FIG. 54C-FIG In each plot of FIG. 54C-FIG.
• dashed lines - one closer and the other further to the solid line there are two dashed lines - one closer and the other further to the solid line.
• the dashed line closer to the solid line indicates 2 standard deviations (>95% of reference molecules within this region), whereas the dashed line further to the solid line indicates 3 standard deviations (>99.7% of reference molecules within this region).
• FIG. 55A and FIG. 55B are chromatograms showing HIC analysis of AB1424/1612 F3’ TriNKET (FIG. 55A) and comparison with adalimumab and pembrolizumab (FIG. 55B).
• FIG. 56 is a graph showing capillary isoelectric focusing (cIEF) profiling of AB1424/1612 F3’ TriNKET.
• FIG. 57A and FIG. 57B are graphs showing DSC profiling of AB1424/1612 F3’ TriNKET in PBS pH 7.4 (FIG. 57A) and HST pH 6.0 (FIG. 57B).
• FIG. 58A and FIG. 58B are graphs showing n-curve analysis (FIG. 58A) and confidence interval (FIG. 58B) of AB 1424/1612 F3’ TriNKET binding cell-based BAFF-R by Kinexa.
• FIG. 59A and FIG. 59B are graphs showing binding of AB1424/1612 F3’ TriNKET and corresponding parental mAb to isogenic human (FIG. 59A) and cynomolgus (FIG. 59B) BAFF-R-CHO cells.
• FIG. 60A-FIG. 60F are graphs showing binding of AB1424/1612 F3’ TriNKET to BAFF-R+ tumor cell lines. Titrations were done in the presence of BJAB (FIG. 60A), Raji (FIG. 60B), RL (FIG. 60C), Rs4;l l (FIG. 60D), Jeko-1 (FIG. 60E), SUDHL-6 cells (FIG. 60F).
• FOB fold over background of stained vs. unstained samples.
• FIG. 61A-FIG. 61H are graphs showing surface plasmon resonance (SPR) binding of AB1424/1612 F3’ TriNKET to human NKG2D. Colored lines represent raw data and black traces represent 1 : 1 binding fit (top panel). Corresponding steady state fits (bottom panel). The vertical line denotes steady state KD.
• SPR surface plasmon resonance
• FIG. 62A-FIG. 62H are graphs showing SPR binding of AB1424/1612 F3’ TriNKET to cynomolgus NKG2D. Colored lines represent raw data and black traces represent 1 : 1 binding fit (top panel). Corresponding steady state fits (bottom panel). The vertical line denotes steady state KD.
• FIG. 63A-FIG. 63H are graphs showing SPR binding of AB1424/1612 F3’ TriNKET to human CD16a V158 (top panels) or trastuzumab (bottom panels). Colored lines represent raw data and black traces represent 1 : 1 binding fit.
• FIG. 64A-FIG. 64P are graphs showing SPR binding of AB1424/1612 F3’ TriNKET (top panels) or trastuzumab (bottom panels) to human CD16a F158. Colored lines represent raw data and black traces represent 1 : 1 binding fit (top panel).
• FIG. 65A-FIG. 65H are graphs showing SPR binding of AB1424/1612 F3’ TriNKET to cynomolgus CD 16. Colored lines represent raw data and black traces represent 1 : 1 binding fit (top panel). Corresponding steady state fits (bottom panel). The vertical line denotes steady state KD.
• FIG. 66 is a graph showing SPR binding of AB1424/1612 F3’ TriNKET to NKG2D (brown), CD 16a (purple), or mixed CD 16a and NKG2D (blue) surfaces.
• FIG. 67A and FIG. 67B are sensorgram graphs representing binding of BAFF-R (800 nM) followed by binding of hNKG2D (7 pM) to captured AB1424/1612 F3’ TriNKET (FIG. 67 A) or reverse order of target binding with human NKG2D (7pM) followed by BAFF-R (800 nM) (FIG. 67B).
• FIG. 68A and FIG. 68B are graphs showing SPR analysis of BAFF-R and TACI binding to immobilized AB1424/1612 F3’ TriNKET (FIG. 68A) and specific anti-TACI mAb (FIG. 68B).
• FIG. 69A and FIG. 69B are graphs showing binding of AB1424/1612 F3’ TriNKET to parental cells not expressing BCMA (FIG. 69A) and isogenic BCMA+ cells compared to control mAb specific anti-BCMA (FIG. 69B).
• FIG. 70A and FIG. 70B are graphs showing AB 1424/1612 F3’ TriNKET binding to isogenic BAFFR+ CHO cells (FIG. 70A) and lack of reactivity with parental CHO line (FIG. 70B).
• FIG. 71A-FIG. 71G detail a poly-specificity assay of a AB1424/1612 F3’ TriNKET.
• FIG. 71A is a schematic of the assay.
• FIG. 71B-FIG. 71G show graphs of AB1424/1612 F3’ TriNKET (left panels), trastuzumab negative control (middle panels), or ixekizumab positive control (right panels) in the absence (top panels) or presence (bottom panels) of poly-specificity reagent (PSR).
• PSR poly-specificity reagent
• FIG. 72A-FIG. 72C show graphs of cytotoxicity assays of RL cells as induced by AB1424/1612 F3’ TriNKET (blue) or parental monoclonal antibody (red) using NK cells from three donors.
• FIG. 73A-FIG. 73D show schematic representations of AB 1424/1612 F3’
• TriNKET controls for elucidating mechanism of action.
• FIG. 74 shows a graph of a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by AB1424/1612 F3’ TriNKET (blue), AB1424/1612 F3’ TriNKET lacking NKG2D binding (black), or AB1424/1612 F3’ TriNKET- Fc silenced (red), or palivizumab F3’ TriNKET (grey).
• FIG. 75A-FIG. 75H are sensorgram graphs showing binding of AB 1424/1612 F3’ TriNKET (top panels) and trastuzumab (bottom panels) to human CD64. Raw sensorgrams (colored) with 1 : 1 fitted curves overlaid (black).
• FIG. 76A-FIG. 76H are sensorgram graphs showing binding of AB 1424/1612 F3’ TriNKET (top panels) and trastuzumab (bottom panels) to cynomolgus monkey CD64.
• Raw sensorgrams colored) with 1 : 1 fitted curves overlaid (black).
• FIG. 77A-FIG. 77P are sensorgram graphs showing binding of AB1424/1612 F3’ TriNKET (FIG. 77A-FIG. 77H) and trastuzumab (FIG. 77I-FIG. 77P) to human CD32a H131.
• TriNKET FIG. 77A-FIG. 77H
• trastuzumab FIG. 77I-FIG. 77P
• FIG. 78A-FIG. 78P are sensorgram graphs showing binding of AB 1424/1612 F3’ TriNKET (FIG. 78A-FIG. 78H) and trastuzumab (FIG. 78I-FIG. 78P) to human CD32a R131.
• TriNKET FIG. 78A-FIG. 78H
• trastuzumab FIG. 78I-FIG. 78P
• FIG. 79A-FIG. 79P are sensorgram graphs showing binding of AB 1424/1612 F3’ TriNKET (FIG. 79A-FIG. 79H) and trastuzumab (FIG. 79I-FIG. 79P) to human CD32b.
• TriNKET FIG. 79A-FIG. 79H
• trastuzumab FIG. 79I-FIG. 79P
• FIG. 80A-FIG. 80P are sensorgram graphs showing binding of AB1424/1612 F3’ TriNKET (FIG. 80A-FIG. 80H) and trastuzumab (FIG. 80I-FIG. 80P) to human CD 16b.
• the upper panel represents raw sensorgrams and the lower panel represents the steady state affinity fit.
• FIG. 81A-FIG. 81H are sensorgram graphs showing binding of AB1424/1612 F3’ TriNKET (top panels) and trastuzumab (bottom panels) to cynomolgus monkey CD 16.
• FIG. 82A-FIG. 82P are sensorgram graphs showing binding of AB 1424/1612 F3’ TriNKET (FIG. 82A-FIG. 82H) and trastuzumab (FIG. 82I-FIG. 82P) to human FcRn at pH 6.0.
• the upper panel represents raw sensorgrams and the lower panel represents the steady state affinity fit.
• FIG. 83A-FIG. 83P are sensorgram graphs showing binding of AB 1424/1612 F3’ TriNKET (FIG. 83 A-FIG. 83H) and trastuzumab (FIG. 83I-FIG. 83P) to cynomolgus monkey FcRn at pH 6.0.
• the upper panel represents raw sensorgrams and the lower panel represents the steady state affinity fit.
• FIG. 84A-FIG. 84H are raw sensorgram graphs showing binding of AB 1424/1612 F3’ TriNKET (top panels) and trastuzumab (bottom panels) to human (left panels) and cynomolgus monkey (right panels) FcRn at pH 7.4.
• FIG. 85 shows a graph of a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by two lots of AB1424/1612 F3’ TriNKET (blue and red) or human IgGlk (grey).
• FIG. 86A shows a graph of a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by two lots of AB1424/1612 F3’ TriNKET (blue and red) or human IgGlk (grey).
• FIG. 86B shows a graph of a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by AB1424/1612 F3’ TriNKET at nominal drug concentrations (NDC) of 50% (red), 100% (blue), and 200% (green).
• NDC nominal drug concentrations
• FIG. 87A and FIG. 87B show PEG precipitation Cm plots of AB1424/1612 F3’ TriNKET in histidine (FIG. 87A) and acetate (FIG. 87B).
• FIG. 88A and FIG. 88B show PEG precipitation Cm plots of adalimumab in histidine (FIG. 88A) and acetate (FIG. 88B).
• FIG. 89A-FIG. 89C show ko plots of adalimumab in acetate (FIG. 89A), histidine (FIG. 89B), and phosphate (FIG. 89C).
• FIG. 90A-FIG. 90C show k D plots of AB1424/1612 F3’ TriNKET in acetate (FIG. 90A), histidine (FIG. 90B), and phosphate (FIG. 90C).
• FIG. 91 is a viscosity vs. concentration plot of AB1424/1612 F3’ TriNKET at 25°C.
• FIG. 92 is a chromatogram of size-exclusion chromatography (SEC) analysis of AB1424/1612 F3’ TriNKET after 4 weeks at 40 °C in HST, pH 6.0 compared to control.
• SEC size-exclusion chromatography
• FIG. 93 is a graph of capillary electrophoresis sodium dodecyl sulfate (CE-SDS) analysis of AB1424/1612 F3’ TriNKET after 4 weeks at 40 °C in HST, pH 6.0 compared to control.
• FIG. 94 is a graph showing cIEF profiling of AB1424/1612 F3’ TriNKET in HST, pH 6.0 compared to control.
• FIG. 95A-FIG. 95C show binding of AB1424/1 612 F3’ TriNKET to hBAFF-R, hNKG2D and hCD16aV after 4 weeks at 40°C in HST, pH 6.0 compared to control.
• FIG. 95A is a graph showing binding to BJAB cells (BAFF-R);
• FIG. 95B is a sensorgram showing binding to hNKG2D by SPR.
• FIG. 95C is a sensorgram showing binding to hCD16a V158 by SPR.
• Colored sensorgrams represent raw data and black overlays represent the kinetic fit of the raw data.
• FIG. 96 shows a graph of a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by AB1424/1612 F3’ TriNKET after 1 week (red), 2 weeks (green), 3 weeks (purple) at 40°C in HST, pH 6.0 compared to control (blue).
• FIG. 97A-FIG. 97C show the surface charge distribution of the BAFF-R binding arm of AB1424/1612 F4 TriNKET. Three orientations are shown: both facades (left panel: front view; center panel: back view) and the antigen-engaging surface (right panel: top view). The positively charged areas are colored blue, negatively charged areas red, and the hydrophobic surface white.
• FIG. 98A-FIG. 98E are graphs showing evaluation of surface patches and CDRs length of the BAFF-R binding arm of AB1424/1612 F4 TriNKET. Solid lines and corresponding arrows indicate the scoring of the BAFF-R binding arm of AB 1424/1612 F4 TriNKET in reference to a database of 377 late-stage therapeutic antibodies.
• the two inner dashed lines indicate 2 standard deviations (>95% of reference molecules within this region), whereas the two outer most dashed lines indicate 3 standard deviations (>99.7% of reference molecules within this region).
• FIG. 98C-FIG In each plot of FIG. 98C-FIG.
• FIG. 99A-FIG. 99C shows the surface charge distribution of the NKG2D binding arm of AB1424/1612 F4 TriNKET. Three orientations are shown: both facades (left panel: front view; center panel: back view) and the antigen-engaging surface (right panel: top view). The positively charged areas are colored blue, negatively charged areas red, and the hydrophobic surface white.
• FIG. 100A-FIG. 100E are graphs showing evaluation of surface patches and CDRs length of the NKG2D-R binding arm of AB1424/1612 F4 TriNKET. Solid lines and corresponding arrows indicate the scoring of the BAFF-R binding arm of AB1424/1612 F3’ TriNKET in reference to a database of 377 late-stage therapeutic antibodies.
• the two inner dashed lines indicate 2 standard deviations (>95% of reference molecules within this region), whereas the two outer most dashed lines indicate 3 standard deviations (>99.7% of reference molecules within this region).
• FIG. 100C-FIG In each plot of FIG. 100C-FIG.
• dashed lines - one closer and the other further to the solid line there are two dashed lines - one closer and the other further to the solid line.
• the dashed line closer to the solid line indicates 2 standard deviations (>95% of reference molecules within this region), whereas the dashed line further to the solid line indicates 3 standard deviations (>99.7% of reference molecules within this region).
• FIG. 101A-FIG. 101C are chromatograms of SEC analysis of three lots of AB1424/1612 F4 TriNKET.
• FIG. 102 is a graph showing cIEF profiling of three lots of AB1424/1612 F4 TriNKET.
• FIG. 103A and FIG. 103B are graph of HIC analysis of AB1424/1612 F4 TriNKET compared in indicated benchmark commercial antibodies.
• FIG. 103B is a graph of thermal stability analysis of AB1424/1612 F4 TriNKET by DSC.
• FIG. 104A and FIG. 104B show extracted ion chromatogram (XICs) for the engineered disulfide pair in the Fc (non-reduced and reduced) and the most intense charge state for that peptide pair.
• XICs extracted ion chromatogram
• FIG. 105A and FIG. 105B show XICs for the engineered disulfide pair in the scFv (non-reduced and reduced) and the most intense charge state for that peptide pair.
• FIG. 106 A and FIG. 106B are graphs showing binding of AB 1424/1612 F4 TriNKET, parental mAb, and F4-palivizumab to human (FIG. 106A) and cynomolgus (FIG. 106B) BAFF-R+ isogenic CHO cells.
• FIG. 107A-FIG. 107L are sensorgram graphs of SPR binding of AB1424/1612 F4 TriNKET to human NKG2D.
• FIG. 108A-FIG. 108P are sensorgram graphs showing binding of AB 1424/1612 F4 TriNKET (FIG. 108A-FIG. 108H) and trastuzumab (FIG 108I-FIG. 108P) to human CD32a R131.
• the upper panel represents raw sensorgrams and the lower panel represents the steady state affinity fit.
• FIG. 109A-FIG. 109H are sensorgram graphs showing binding of AB1424/1612 F4 TriNKET (top panels) and trastuzumab (bottom panels) to human CD16a V158.
• the upper panel represents raw sensorgrams and the lower panel represents the steady state affinity fit.
• FIG. 110A-FIG. 110H are sensorgram graphs showing binding of AB1424/1612 F4 TriNKET (top panels) and trastuzumab (bottom panels) to human CD16a V158.
• the upper panel represents raw sensorgrams and the lower panel represents the steady state affinity fit.
• FIG. 111A-FIG. 111H are sensorgram graphs showing binding of AB1424/1612 F4 TriNKET (top panels) and trastuzumab (bottom panels) to human CD64.
• Raw sensorgrams colored
• 1 : 1 fitted curves overlaid black.
• FIG. 112A-FIG. 112H are sensorgram graphs showing binding of AB1424/1612 F4 TriNKET (top panels) and trastuzumab (bottom panels) to cynomolgus CD64.
• Raw sensorgrams colored) with 1 : 1 fitted curves overlaid (black).
• FIG. 113A-FIG. 113P are sensorgram graphs showing binding of AB1424/1612 F4 TriNKET (FIG. 113A-FIG. 113H) and trastuzumab (FIG. 113I-FIG. 113P) to human CD32a H131.
• the upper panel represents raw sensorgrams and the lower panel represents the steady state affinity fit.
• FIG. 114A-FIG. 114P are sensorgram graphs showing binding of AB 1424/1612 F4 TriNKET (FIG. 114A-FIG. 114H) and trastuzumab (FIG. 114I-FIG. 114P) to human CD32b.
• FIG. 115A-FIG. 115P are sensorgram graphs showing binding of AB 1424/1612 F4 TriNKET (FIG. 115A-FIG. 115H) and trastuzumab (FIG. 115I-FIG. 115P) to human CD 16b.
• the upper panel represents raw sensorgrams and the lower panel represents the steady state affinity fit.
• FIG. 116A-FIG. 116P are sensorgram graphs showing binding of AB 1424/1612 F4 TriNKET (FIG. 116A-FIG. 116H) and trastuzumab (FIG. 116I-FIG. 116P) to human FcRn at pH 6.0.
• the upper panel represents raw sensorgrams and the lower panel represents the steady state affinity fit.
• FIG. 117A-FIG. 117P are sensorgram graphs showing binding of AB 1424/1612 F4 TriNKET (FIG. 117A-FIG. 117H) and trastuzumab (FIG. 117I-FIG. 117P) to cynomolgus FcRn at pH 6.0.
• the upper panel represents raw sensorgrams and the lower panel represents the steady state affinity fit.
• FIG. 118A-FIG. 118H are raw sensorgram graphs showing binding of AB1424/1612 F4 TriNKET (top panels) and trastuzumab (bottom panels) to human (left panels) and cynomolgus (right panels) FcRn at pH 7.4.
• FIG. 119 is a graph showing SPR binding of AB1424/1612 F4 TriNKET to NKG2D (brown), CD 16a (purple), or mixed CD 16a and NKG2D (blue) surfaces.
• FIG. 120A and FIG. 120B are graphs showing sequential saturation of BAFF-R and NKG2D by AB1424/1612 F4 TriNKET.
• FIG. 121A-FIG. 1211 detail a poly-specificity assay of AB1424/1612 F4 TriNKET.
• FIG. 121 A is a schematic of the assay.
• FIG. 121B-FIG. 1211 show graphs of AB 1424/1612 F4 TriNKET (left panels), trastuzumab (center-left panels), rituximab (center-right panels), or ixekizumab (right panels) in the absence (top panels) or presence (bottom panels) of polyspecificity reagent (PSR).
• PSR polyspecificity reagent
• FIG. 122 is a graph of a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by AB 1424/1612 F4 TriNKET (blue) and human IgGlk (grey).
• FIG. 123 is a graph of a rested hNK-induced cytotoxicity assay of BJAB cells as induced by AB 1424/1612 F4 TriNKET (blue) and parental mAb (red).
• FIG. 124 is a chromatogram of SEC analysis of AB1424/1612 F4 TriNKET after 4 weeks at 40 °C in HST, pH 6.0 compared to control.
• FIG. 125 is a graph showing reduced CE-SDS analysis of AB1424/1612 F4 TriNKET after 4 weeks at 40 °C in HST, pH 6.0 compared to control.
• FIG. 126 is a graph showing cIEF profiling of AB1424/1612 F4 TriNKET after 4 weeks at 40 °C in HST, pH 6.0 compared to control.
• FIG. 127 is a graph showing binding of AB1424/1612 F4 TriNKET to to hBAFF- R+ cells after 4 weeks at 40 °C in HST, pH 6.0 compared to control.
• FIG. 128A and FIG. 128B are sensorgram graphs showing SPR binding of hCD16aV to AB1424/1612 F4 TriNKET after 4 weeks at 40 °C in HST, pH 6.0 (FIG. 128B) compared to control (FIG. 128A).
• FIG. 129 is a graph of a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by AB 1424/1612 F4 TriNKET after 4 weeks at 40 °C in HST, pH 6.0 (red) compared to control (blue).
• FIG. 130 is a chromatogram of SEC analysis of AB1424/1612 F4 TriNKET after forced oxidation compared to control.
• FIG. 131 is a graph showing reduced CE-SDS analysis of AB1424/1612 F4 TriNKET after forced oxidation compared to control.
• FIG. 132 is a graph showing binding of AB1424/1612 F4 TriNKET to hBAFF-R+ cells after forced oxidation.
• FIG. 133A and FIG. 133B are sensorgram graphs showing SPR binding of hCD16aV to AB1424/1612 F4 TriNKET control (FIG. 133A) and after forced oxidation (FIG. 133B).
• FIG. 134 is a graph of a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by AB 1424/1612 F4 TriNKET after forced oxidation (red) and control (blue).
• FIG. 135 is a chromatogram of SEC analysis of AB 1424/1612 F4 TriNKET after long term low pH stress compared to control.
• FIG. 136 is a graph showing reduced CE-SDS analysis of AB1424/1612 F4 TriNKET after long term low pH stress compared to control.
• FIG. 137 is a graph showing cIEF profiling of AB1424/1612 F4 TriNKET after long term low pH stress compared to control.
• FIG. 138 is a graph showing binding of AB1424/1612 F4 TriNKET to hBAFF-R+ cells after long term low pH stress compared to control.
• FIG. 139A and FIG. 139B are sensorgram graphs showing SPR binding of hCD16aV to AB 1424/1612 F4 TriNKET after long term low pH stress (FIG. 139B) compared to control (FIG. 139A).
• FIG. 140 is a graph of a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by AB 1424/1612 F4 TriNKET after long term low pH stress (red) and control (blue).
• FIG. 141 is a chromatogram of SEC analysis of AB 1424/1612 F4 TriNKET after long term high pH stress compared to control.
• FIG. 142 is a graph showing reduced CE-SDS analysis of AB1424/1612 F4 TriNKET after long term high pH stress compared to control.
• FIG. 143 is a graph showing cIEF profiling of AB1424/1612 F4 TriNKET after long term high pH stress compared to control.
• FIG. 144 is a graph showing binding of AB1424/1612 F4 TriNKET to hBAFF-R+ cells after long term high pH stress (red) compared to control (blue).
• FIG. 145 A and FIG. 145B are sensorgram graphs showing SPR binding of hCD16aV to AB 1424/1612 F4 TriNKET after long term high pH stress (FIG. 145B) compared to control (FIG. 145A).
• FIG. 146 is a graph of a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by AB 1424/1612 F4 TriNKET after long term high pH stress (red) and control (blue).
• FIG. 147 is a chromatogram of SEC analysis of AB1424/1612 F4 TriNKET after 6 freeze/thaw cycles compared to control.
• FIG. 148 is a graph showing reduced CE-SDS analysis of AB1424/1612 F4 TriNKET after 6 freeze/thaw cycles compared to control.
• FIG. 149 is a graph showing binding of AB1424/1612 F4 TriNKET to hBAFF-R+ cells after 6 freeze/thaw cycles (red) compared to control (blue).
• FIG. 150 is a graph of a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by AB 1424/1612 F4 TriNKET after 6 freeze/thaw cycles (red) and control (blue).
• FIG. 151 is a chromatogram of SEC analysis of AB 1424/1612 F4 TriNKET after agitation stress compared to control.
• FIG. 152 is a graph showing reduced CE-SDS analysis of AB1424/1612 F4 TriNKET after agitation stress compared to control.
• FIG. 153 is a graph showing binding of AB1424/1612 F4 TriNKET to hBAFF-R+ cells after agitation stress (red) compared to control (blue).
• FIG. 154 is a graph of a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by AB 1424/1612 F4 TriNKET after agitation stress (red) and control (blue).
• FIG. 155A and FIG. 155B is a chromatogram of SEC analysis of AB1424/1612 F4 TriNKET Protein A eluate pre- (FIG. 155 A) and post- low pH hold (FIG. 155B).
• FIG. 156 is a graph showing cIEF profiling of AB1424/1612 F4 TriNKET after low pH hold compared to control.
• FIG. 157 is a graph showing reduced CE-SDS analysis of AB1424/1612 F4 TriNKET after low pH hold compared to control.
• FIG. 158 is a graph showing binding of AB1424/1612 F4 TriNKET to hBAFF-R+ cells after low pH hold (blue) compared to control (red).
• FIG. 159 is a graph of a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by AB 1424/1612 F4 TriNKET after low pH hold (green) and control (red).
• FIG. 160A and FIG. 160B are graphs showing binding of AB1424/1612 F3’ TriNKET (blue), AB 1424/1612 F4 TriNKET (red), and parental mAb (black) to KHYG-1 (FIG. 160A) and KHYG-1 -CD 16V (FIG. 160B) cell lines.
• FIG. 161A and FIG. 161B are graphs showing percent surface retention of BAFF-R on RL cells exposed to AB1424/1612 F3’ TriNKET (blue), AB1424/1612 F4 TriNKET (red), and parental mAb (black) (FIG. 161 A) and activated with IL-2 (FIG. 16 IB).
• FIG. 162 is a graph showing percent surface retention of BAFF-R on Raji cells exposed to AB1424/1612 F3’ TriNKET (blue), AB1424/1612 F4 TriNKET (red), and parental mAh (black).
• FIG. 163 is a graph of a resting human NK cell-induced cytotoxicity assay of RL cells following incubation with AB 1424/1612 F3’ TriNKET (blue), AB1424/1612 F4 TriNKET (red), parental mAb (black), and human IgGlk (grey).
• FIG. 164A and FIG. 164B are graphs of a rested human NK cell-induced cytotoxicity assay of RL cells following incubation with AB1424/1612 F3’ TriNKET (blue), AB1424/1612 F4 TriNKET (red), F3’ control (black), and F4 control (grey). Cells were cocultured with control (FIG. 164A) or IL-2 (FIG. 164B).
• FIG. 165 is a graph of a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by AB1424/1612 F3’ TriNKET (blue), AB1424/1612 F3’ TriNKET lacking NKG2D binding (black), or AB1424/1612 F3’ TriNKET- Fc silenced (red), or palivizumab F3’ TriNKET (grey).
• FIG. 166 is a graph of a resting human NK cell-induced cytotoxicity assay of BJAB cells as induced by AB1424/1612 F3’ TriNKET (blue), AB1424/1612 F3’ TriNKET lacking NKG2D binding (black), or AB 1424/1612 F3’ TriNKET- Fc silenced (red), or palivizumab F3’ TriNKET (grey).
• FIG. 167 is a graph of a resting human NK cell-induced cytotoxicity assay of RL cells following incubation with AB 1424/1612 F3’ TriNKET (blue), AB1424/1612 F4 TriNKET (red), AB1424/1612 F3’ TriNKET plus soluble MICA (black), and AB1424/1612 F4 TriNKET plus soluble MICA (grey).
• FIG. 168 is a graph of a resting human NK cell-induced cytotoxicity assay of RL cells following incubation with AB 1424/1612 F3’ TriNKET (blue), AB1424/1612 F4 TriNKET (red), AB 1424/1612 F3’ TriNKET plus BAFF (black), and AB 1424/1612 F4 TriNKET plus BAFF (grey).
• FIG. 169 is a graph of interferon gamma (IFNy) and CD 107a production by BJAB cells following incubation with AB 1424/1612 F3’ TriNKET (blue), AB1424/1612 F4 TriNKET (red), parental mAb (black), F3’-palivisumab (light grey), and F4-palivisumab (dark grey).
• IFNy interferon gamma
• FIG. 169 is a graph of interferon gamma (IFNy) and CD 107a production by BJAB cells following incubation with AB 1424/1612 F3’ TriNKET (blue), AB1424/1612 F4 TriNKET (red), parental mAb (black), F3’-palivisumab (light grey), and F4-palivisumab (dark grey).
• FIG. 169 is a graph of interferon gamma (IFNy) and CD 107a production by BJAB cells following incubation
• 170 is a graph of phagocytosis of B JAB cells by M0 macrophages following incubation with AB1424/1612 F3’ TriNKET (blue), AB1424/1612 F4 TriNKET (red), parental mAb (black), and Fc-silenced AB1424/1612 F3’ TriNKET (pink).
• FIG. 171 is a graph of a human serum-induced cytotoxicity assay of Raji cells following incubation with rituximab (black), AB1424/1612 F3’ TriNKET (blue), or AB1424/1612 F3’ TriNKET.
• FIG. 172A-FIG. 172E are histograms showing flow cytometry analysis of binding of AB1424/1612 F3’ TriNKET (blue) and F3’-palivizumab (red) to indicated BAFF-R+ cells in PBMCs.
• FIG. 173A-FIG. 173F are histograms showing flow cytometry analysis of binding of AB1424/1612 F3’ TriNKET (blue) and F3’-palivizumab (red) to indicated cell types in human blood.
• FIG. 174A-FIG. 174C are histograms showing flow cytometry analysis of binding of AB1424/1612 F3’ TriNKET (blue) and F3’-palivizumab (red) to human red blood cells.
• FIG. 175A-FIG. 175F are graphs showing flow cytometry analysis of binding of (from left to right) AB1424/1612 F3’ TriNKET, F3’-palivizumab, AB1424/1612 F4 TriNKET, F4-palivizumab, and rituximab to indicated human donor PBMCs.
• FIG. 176A-FIG. 176F are histograms showing flow cytometry analysis of binding of AB1424/1612 F3’ TriNKET (blue) and F3’-palivizumab (red) to indicated PBMCs from cynomolgus whole blood donor CYN317060.
• FIG. 177A-FIG. 177F are graphs showing flow cytometry analysis of binding of (from left to right) AB1424/1612 F3’ TriNKET, F3’-palivizumab, AB1424/1612 F4 TriNKET, F4-palivizumab, and rituximab to indicated human donor PBMCs.
• FIG. 178 is a graph showing CD 107a positivity of CD 16+ CD8+ NK cells in a coculture of BJAB cells with PBMCs from cynomolgus whole blood donor CYN317060.
• the present application provides multispecific binding proteins that bind the NKG2D receptor and CD 16 receptor on natural killer cells, and BAFF-R on a cancer cell or a B cell.
• the multispecific proteins further include an additional antigenbinding site that binds BAFF-R.
• the application also provides pharmaceutical compositions comprising such multispecific binding proteins, and therapeutic methods using such multispecific proteins and pharmaceutical compositions, for purposes such as treating autoimmune diseases and cancer.
• Various aspects of the multispecific binding proteins described in the present application are set forth below in sections; however, aspects of the multispecific binding proteins described in one particular section are not to be limited to any particular section.
• the term “antigen-binding site” refers to the part of the immunoglobulin molecule that participates in antigen binding.
• the antigen binding site is formed by amino acid residues of the N-terminal variable (“V”) regions of the heavy (“H”) and light (“L”) chains.
• V N-terminal variable
• L light
• Three highly divergent stretches within the V regions of the heavy and light chains are referred to as “hypervariable regions” which are interposed between more conserved flanking stretches known as “framework regions,” or “FR .”
• FR refers to amino acid sequences which are naturally found between and adjacent to hypervariable regions in immunoglobulins.
• the three hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three-dimensional space to form an antigen-binding surface.
• the antigen-binding surface is complementary to the three-dimensional surface of a bound antigen, and the three hypervariable regions of each of the heavy and light chains are referred to as “complementarity-determining regions,” or “CDRs.”
• CDRs complementarity-determining regions
• the antigen-binding site is formed by a single antibody chain providing a “single domain antibody.”
• Antigen-binding sites can exist in an intact antibody, in an antigen-binding fragment of an antibody that retains the antigen-binding surface, or in a recombinant polypeptide such as an scFv, using a peptide linker to connect the heavy chain variable domain to the light chain variable domain in a single polypeptide.
• tumor-associated antigen means any antigen including but not limited to a protein, glycoprotein, ganglioside, carbohydrate, or lipid that is associated with cancer. Such antigen can be expressed on malignant cells or in the tumor microenvironment such as on tumor-associated blood vessels, extracellular matrix, mesenchymal stroma, or immune infiltrates.
• tumor-associated antigen refers to BAFF-R, which is targeted by the second and/or the additional antigen-binding site present in a multispecific binding proteins of the present disclosure. It is understood, however, that BAFF-R may also be associated with diseases and disorders that are not tumor or cancer.
• the terms “subject” and “patient” refer to an organism to be treated by the methods and compositions described herein. Such organisms preferably include, but are not limited to, mammals (e.g., murines, simians, equines, bovines, porcines, canines, felines, and the like), and more preferably include humans.
• the term “effective amount” refers to the amount of a compound (e.g., a compound of the present application) sufficient to effect beneficial or desired results.
• An effective amount can be administered in one or more administrations, applications or dosages and is not intended to be limited to a particular formulation or administration route.
• the term “treating” includes any effect, e.g., lessening, reducing, modulating, ameliorating or eliminating, that results in the improvement of the condition, disease, disorder, and the like, or ameliorating a symptom thereof.
• composition refers to the combination of an active agent with a carrier, inert or active, making the composition especially suitable for diagnostic or therapeutic use in vivo or ex vivo.
• the term “pharmaceutically acceptable carrier” refers to any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water, emulsions (e.g., such as an oil/water or water/oil emulsions), and various types of wetting agents.
• the compositions also can include stabilizers and preservatives.
• stabilizers and adjuvants see e.g., Martin, Remington's Pharmaceutical Sciences, 15th Ed., Mack Publ.
• the term “pharmaceutically acceptable salt” refers to any pharmaceutically acceptable salt (e.g., acid or base) of a compound described in the present application which, upon administration to a subject, is capable of providing a compound described in this application or an active metabolite or residue thereof.
• salts of the compounds described in the present application may be derived from inorganic or organic acids and bases.
• Exemplary acids include, but are not limited to, hydrochloric, hydrobromic, sulfuric, nitric, perchloric, fumaric, maleic, phosphoric, glycolic, lactic, salicylic, succinic, toluene-p-sulfonic, tartaric, acetic, citric, methanesulfonic, ethanesulfonic, formic, benzoic, malonic, naphthalene-2-sulfonic, benzenesulfonic acid, and the like.
• Other acids such as oxalic, though not in themselves pharmaceutically acceptable, may be employed in the preparation of salts useful as intermediates in obtaining the compounds described in the application and their pharmaceutically acceptable acid addition salts.
• Exemplary bases include, but are not limited to, alkali metal (e.g., sodium) hydroxides, alkaline earth metal (e.g., magnesium) hydroxides, ammonia, and compounds of formula NWf, wherein W is Ci-4 alkyl, and the like.
• alkali metal e.g., sodium
• alkaline earth metal e.g., magnesium
• ammonia e.g., ammonia
• compounds of formula NWf wherein W is Ci-4 alkyl, and the like.
• Exemplary salts include, but are not limited to: acetate, adipate, alginate, aspartate, benzoate, benzenesulfonate, bisulfate, butyrate, citrate, camphorate, camphorsulfonate, cyclopentanepropionate, digluconate, dodecyl sulfate, ethanesulfonate, fumarate, flucoheptanoate, glycerophosphate, hemisulfate, heptanoate, hexanoate, hydrochloride, hydrobromide, hydroiodide, 2-hydroxyethanesulfonate, lactate, maleate, methanesulfonate, 2- naphthalenesulfonate, nicotinate, oxalate, palmoate, pectinate, persulfate, phenylpropionate, picrate, pivalate, propionate, succinate, tartrate
• salts of the compounds described in the present application are contemplated as being pharmaceutically acceptable.
• salts of acids and bases that are non-pharmaceutically acceptable may also find use, for example, in the preparation or purification of a pharmaceutically acceptable compound.
• BAFF-R also known as BAFF receptor, B-cell activating factor receptor, BR3, TNFRSF13C, tumor necrosis factor receptor superfamily member 13C, TNF receptor superfamily member 13C, CD268, and BLyS receptor 3
• BAFF receptor also known as BAFF receptor, B-cell activating factor receptor, BR3, TNFRSF13C, tumor necrosis factor receptor superfamily member 13C, TNF receptor superfamily member 13C, CD268, and BLyS receptor 3
• BAFF-R also known as BAFF receptor, B-cell activating factor receptor, BR3, TNFRSF13C, tumor necrosis factor receptor superfamily member 13C, TNF receptor superfamily member 13C, CD268, and BLyS receptor 3
• compositions are described as having, including, or comprising specific components, or where processes and methods are described as having, including, or comprising specific steps, it is contemplated that, additionally, there are compositions described in the present application that consist essentially of, or consist of, the recited components, and that there are processes and methods according to the present application that consist essentially of, or consist of, the recited processing steps.
• compositions specifying a percentage are by weight unless otherwise specified. Further, if a variable is not accompanied by a definition, then the previous definition of the variable controls.
• the present application provides multispecific binding proteins that bind to the NKG2D receptor and CD16 receptor on natural killer cells, and BAFF-R on a cancer cell.
• the multispecific binding proteins are useful in the pharmaceutical compositions and therapeutic methods described herein. Binding of the multispecific binding proteins to the NKG2D receptor and CD 16 receptor on a natural killer cell enhances the activity of the natural killer cell toward destruction of tumor cells expressing BAFF-R antigen. Binding of the multispecific binding proteins to BAFF-R-expressing cells brings the cancer cells into proximity with the natural killer cell, which facilitates direct and indirect destruction of the tumor cells by the natural killer cell.
• Multispecific binding proteins that bind NKG2D, CD 16, and another target are disclosed in International Application Publication Nos. WO2018148445 and WO2019157366, which are not incorporated herein by reference. Further description of some exemplary multispecific binding proteins is provided below.
• the first component of the multispecific binding protein is an antigen-binding site that binds to NKG2D receptor-expressing cells, which can include but are not limited to NK cells, y6 T cells and CD8 + aP T cells. Upon NKG2D binding, the multispecific binding proteins may block natural ligands, such as ULBP6 and MICA, from binding to NKG2D and activating NK cells.
• the second component of the multispecific binding protein is an antigen-binding site that binds to BAFF-R.
• B-cell non-Hodgkin’s lymphoma such as chronic lymphocytic leukemia (CLL), mantle cell lymphoma (MCL), follicular lymphoma (FL), diffuse large B-cell lymphoma (DLBCL), marginal zone lymphoma, mucosa-associated lymphoid tissue (MALT) lymphoma, primary mediastinal B-cell lymphoma, acute lymphocytic leukemia (ALL); and autoimmune inflammatory diseases.
• CLL chronic lymphocytic leukemia
• MCL mantle cell lymphoma
• FL follicular lymphoma
• DLBCL diffuse large B-cell lymphoma
• MALT mucosa-associated lymphoid tissue lymphoma
• ALL acute lymphocytic leukemia
• ALL acute lymphocytic leukemia
• the third component of the multispecific binding proteins is an antibody Fc domain or a portion thereof, or an antigen-binding site that binds to cells expressing CD16, an Fc receptor on the surface of leukocytes including natural killer cells, macrophages, neutrophils, eosinophils, mast cells, and follicular dendritic cells.
• An additional antigen-binding site of the multispecific binding proteins may bind BAFF-R.
• the first antigen-binding site that binds NKG2D is an scFv
• the second and the additional antigen-binding sites that bind BAFF-R are each a Fab fragment.
• the first antigen-binding site that binds NKG2D is an scFv
• the second and the additional antigen-binding sites that bind BAFF-R are each an scFv.
• the first antigen-binding site that binds NKG2D is a Fab fragment
• the second and the additional antigen-binding sites that bind BAFF-R are each an scFv.
• the first antigen-binding site that binds NKG2D is a Fab
• the second and the additional antigen-binding sites that bind BAFF-R are each a Fab fragment.
• the multispecific binding proteins described herein can take various formats.
• one format is a heterodimeric, multispecific antibody including a first immunoglobulin heavy chain, a first immunoglobulin light chain, a second immunoglobulin heavy chain and a second immunoglobulin light chain (FIG. 1).
• the first immunoglobulin heavy chain includes a first Fc (hinge-CH2-CH3) domain, a first heavy chain variable domain and optionally a first CHI heavy chain domain.
• the first immunoglobulin light chain includes a first light chain variable domain and optionally a first light chain constant domain.
• the first immunoglobulin light chain, together with the first immunoglobulin heavy chain forms an antigen-binding site that binds NKG2D.
• the second immunoglobulin heavy chain comprises a second Fc (hinge-CH2-CH3) domain, a second heavy chain variable domain and optionally a second CHI heavy chain domain.
• the second immunoglobulin light chain includes a second light chain variable domain and optionally a second light chain constant domain.
• the second immunoglobulin light chain, together with the second immunoglobulin heavy chain forms an antigen-binding site that binds BAFF-R.
• the first Fc domain and second Fc domain together are able to bind to CD 16 (FIG. 1).
• the first immunoglobulin light chain is identical to the second immunoglobulin light chain.
• the antigen-binding sites may each incorporate an antibody heavy chain variable domain and an antibody light chain variable domain (e.g., arranged as in an antibody, or fused together to form an scFv), or one or more of the antigen-binding sites may be a single domain antibody, such as a VHH antibody like a camelid antibody or a VNAR antibody like those found in cartilaginous fish.
• the second antigen-binding site incorporates a light chain variable domain having an amino acid sequence identical to the amino acid sequence of the light chain variable domain present in the first antigen-binding site.
• Another exemplary format involves a heterodimeric, multispecific antibody including a first immunoglobulin heavy chain, a second immunoglobulin heavy chain and an immunoglobulin light chain (e.g., FIG. 2A).
• the first immunoglobulin heavy chain includes a first Fc (hinge-CH2-CH3) domain fused via either a linker or an antibody hinge to a single-chain variable fragment (scFv) composed of a heavy chain variable domain and light chain variable domain which pair and bind NKG2D, or bind BAFF-R.
• the second immunoglobulin heavy chain includes a second Fc (hinge-CH2-CH3) domain, a second heavy chain variable domain and a CHI heavy chain domain.
• the immunoglobulin light chain includes a light chain variable domain and a light chain constant domain.
• the second immunoglobulin heavy chain pairs with the immunoglobulin light chain and binds to NKG2D or binds BAFF-R with the proviso that when the first Fc domain is fused to an scFv that binds NKG2D, the second immunoglobulin heavy chain paired with the immunoglobulin light chain binds BAFF-R but not NKG2D, and vice versa.
• the scFv in the first immunoglobulin heavy chain binds BAFF-R; and the heavy chain variable domain in the second immunoglobulin heavy chain and the light chain variable domain in the immunoglobulin light chain, when paired, bind NKG2D (e.g., FIG. 2E). In some embodiments, the scFv in the first immunoglobulin heavy chain binds NKG2D; and the heavy chain variable domain in the second immunoglobulin heavy chain and the light chain variable domain in the immunoglobulin light chain, when paired, bind BAFF-R. In some embodiments, the first Fc domain and the second Fc domain together are able to bind to CD 16 (e.g., FIG. 2A). In some embodiments, the first Fc domain and the second Fc domain together are able to bind to CD 16 (e.g., FIG. 2A).
• Another exemplary format involves a heterodimeric, multispecific antibody including a first immunoglobulin heavy chain, and a second immunoglobulin heavy chain (e.g., FIG. 2B).
• the first immunoglobulin heavy chain includes a first Fc (hinge-CH2-CH3) domain fused via either a linker or an antibody hinge to a single-chain variable fragment (scFv) composed of a heavy chain variable domain and light chain variable domain, which pair and bind NKG2D, or bind BAFF-R.
• the second immunoglobulin heavy chain includes a second Fc (hinge-CH2-CH3) domain fused via either a linker or an antibody hinge to a single-chain variable fragment (scFv) composed of a heavy chain variable domain and light chain variable domain which pair and bind NKG2D or bind BAFF-R, with the proviso that when the first Fc domain is fused to an scFv that binds NKG2D, the second Fc domain fused to an scFv binds BAFF-R, but not NKG2D, and vice versa.
• the first Fc domain and the second Fc domain together are able to bind to CD 16 (e.g., FIG. 2B)
• the single-chain variable fragment (scFv) described above is linked to the antibody constant domain via a hinge sequence.
• the hinge comprises amino acids Ala-Ser or Gly-Ser.
• the hinge comprises amino acids Ala-Ser or Gly-Ser.
• the hinge connecting an scFv (e.g., an scFv that binds NKG2D or an scFv that binds BAFF-R) and the antibody heavy chain constant domain comprises amino acids Ala-Ser.
• the hinge connecting an scFv (e.g., an scFv that binds NKG2D or an scFv that binds BAFF-R) and the antibody heavy chain constant domain comprises amino acids Gly-Ser. In some other embodiments, the hinge comprises amino acids Ala-Ser and Thr-Lys-Gly.
• the hinge sequence can provide flexibility of binding to the target antigen, and balance between flexibility and optimal geometry.
• the single-chain variable fragment (scFv) described above includes a heavy chain variable domain and a light chain variable domain. In some embodiments, the heavy chain variable domain forms a disulfide bridge with the light chain variable domain to enhance stability of the scFv.
• a disulfide bridge can be formed between the C44 residue of the heavy chain variable domain and the Cl 00 residue of the light chain variable domain, the amino acid positions numbered under Kabat.
• the heavy chain variable domain is linked to the light chain variable domain via a flexible linker. Any suitable linker can be used, for example, the (G4S)4 linker ((GlyGlyGlyGlySer)4 (SEQ ID NO: 119)).
• the heavy chain variable domain is positioned at the N-terminus of the light chain variable domain.
• the heavy chain variable domain is positioned at the C terminus of the light chain variable domain.
• the multispecific binding proteins described herein can further include one or more additional antigen-binding sites.
• the additional antigen-binding site(s) may be fused to the N- terminus of the constant region CH2 domain or to the C-terminus of the constant region CH3 domain, optionally via a linker sequence.
• the additional antigen-binding site(s) takes the form of a single-chain variable region (scFv) that is optionally disulfide- stabilized, resulting in a tetravalent or trivalent multispecific binding protein.
• a multispecific binding protein includes a first antigen-binding site that binds NKG2D, a second antigen-binding site that binds BAFF-R, an additional antigen-binding site that binds BAFF-R, and an antibody constant region or a portion thereof sufficient to bind CD 16 or a fourth antigenbinding site that binds CD 16.
• Any one of these antigen binding sites can either take the form of a Fab fragment or an scFv, such as an scFv described above.
• the additional antigen-binding site binds a different epitope of BAFF-R from the second antigen-binding site. In some embodiments, the additional antigenbinding site binds the same epitope as the second antigen-binding site. In some embodiments, the additional antigen-binding site comprises the same heavy chain and light chain CDR sequences as the second antigen-binding site. In some embodiments, the additional antigen-binding site comprises the same heavy chain and light chain variable domain sequences as the second antigen-binding site. In some embodiments, the additional antigen-binding site has the same amino acid sequence(s) as the second antigen-binding site.
• the additional antigen-binding site comprises heavy chain and light chain variable domain sequences that are different from the heavy chain and light chain variable domain sequences of the second antigenbinding site.
• the additional antigen-binding site has an amino acid sequence that is different from the sequence of the second antigen-binding site.
• the second antigen-binding site and the additional antigen-binding site bind different tumor-associated antigens.
• the second antigen-binding site and the additional antigen-binding site binds different antigens. Exemplary formats are shown in FIG. 2C and FIG. 2D. Accordingly, the multispecific binding proteins can provide bivalent engagement of BAFF-R.
• Bivalent engagement of BAFF-R by the multispecific proteins can stabilize BAFF-R on the tumor cell surface and enhance cytotoxicity of NK cells towards the tumor cells.
• Bivalent engagement of BAFF-R by the multispecific proteins can confer stronger binding of the multispecific proteins to the tumor cells, thereby facilitating stronger cytotoxic response of NK cells towards the tumor cells, especially towards tumor cells expressing a low level of BAFF-R.
• the multispecific binding proteins can take additional formats.
• the multispecific binding protein is in the Triomab form, which is a trifunctional, bispecific antibody that maintains an IgG-like shape. This chimera consists of two half antibodies, each with one light and one heavy chain, that originate from two parental antibodies.
• the multispecific binding protein is in a KiH Common Light Chain (LC) form, which incorporates the knobs-into-holes (KiH) technology (e.g., the multispecific binding protein represented in FIG. 21).
• the KiH Common LC form is a heterodimer comprising a Fab which binds to a first target, a Fab which binds to a second target, and an Fc domain stabilized by heterodimerization mutations.
• the two Fabs each comprise a heavy chain and light chain, wherein the heavy chain of each Fab differs from the other, and the light chain that pairs with each respective heavy chain is common to both Fabs.
• the multispecific binding protein is the KiH form, which involves the knobs-into-holes (KiHs) technology.
• KiH involves engineering CH3 domains to create either a “knob” or a “hole” in each heavy chain to promote heterodimerization.
• the concept behind the “Knobs-into-Holes (KiH)” Fc technology was to introduce a “knob” in one CH3 domain (CH3A) by substitution of a small residue with a bulky one (e.g., T366WCH3A in EU numbering).
• a complementary “hole” surface was created on the other CH3 domain (CH3B) by replacing the closest neighboring residues to the knob with smaller ones (e.g., T366S/L368A/Y407VCH3B).
• the “hole” mutation was optimized by structured-guided phage library screening (Atwell S, Ridgway JB, Wells JA, Carter P., Stable heterodimers from remodeling the domain interface of a homodimer using a phage display library, J. Mol. Biol. (1997) 270(l):26-35).
• the multispecific binding protein is in the dual-variable domain immunoglobulin (DVD-IgTM) form, which combines the target binding domains of two monoclonal antibodies via flexible naturally occurring linkers, and yields a tetravalent IgG-like molecule.
• DVD-IgTM dual-variable domain immunoglobulin
• the multispecific binding protein is in the Orthogonal Fab interface (Ortho-Fab) form.
• Orthogonal Fab interface Ortho-Fab
• structure-based regional design introduces complementary mutations at the LC and HCVH-CHI interface in only one Fab fragment, without any changes being made to the other Fab fragment.
• the multispecific binding protein is in the 2-in-l Ig format. In some embodiments, the multispecific binding protein is in the ES form, which is a heterodimeric construct containing two different Fab fragments binding to targets 1 and target 2 fused to the Fc. Heterodimerization is ensured by electrostatic steering mutations in the Fc.
• the multispecific binding protein is in the i ⁇ k-Body form, which is a heterodimeric construct with two different Fab fragments fused to Fc stabilized by heterodimerization mutations: Fab fragment 1 targeting antigen 1 contains kappa LC, and Fab fragment 2 targeting antigen 2 contains lambda LC.
• FIG. 13A is an exemplary representation of one form of a i ⁇ k-Body;
• FIG. 13B is an exemplary representation of another i ⁇ A-Body.
• the multispecific binding protein is in Fab Arm Exchange form (antibodies that exchange Fab fragment arms by swapping a heavy chain and attached light chain (half-molecule) with a heavy -light chain pair from another molecule, which results in bispecific antibodies).
• the multispecific binding protein is in the SEED Body form.
• the strand-exchange engineered domain (SEED) platform was designed to generate asymmetric and bispecific antibody-like molecules, a capability that expands therapeutic applications of natural antibodies.
• This protein engineering platform is based on exchanging structurally related sequences of immunoglobulin within the conserved CH3 domains.
• the SEED design allows efficient generation of AG/GA heterodimers, whereas disfavoring homodimerization of AG and GA SEED CH3 domains. (Muda M. et al., Protein Eng. Des. Sei. (2011, 24(5):447-54)).
• the multispecific binding protein is in the LuZ-Y form, in which a leucine zipper is used to induce heterodimerization of two different HCs. (Wranik, BJ. et al., J. Biol. Chem. (2012), 287:43331-9).
• the multispecific binding protein is in the Cov-X-Body form.
• CovX-Bodies two different peptides are joined together using a branched azetidinone linker and fused to the scaffold antibody under mild conditions in a site-specific manner. Whereas the pharmacophores are responsible for functional activities, the antibody scaffold imparts long half-life and Ig-like distribution.
• the pharmacophores can be chemically optimized or replaced with other pharmacophores to generate optimized or unique bispecific antibodies. (Doppalapudi VR et al., PNAS (2010), 107(52);22611-22616).
• the multispecific binding protein is in an OAsc-Fab heterodimeric form that includes Fab fragment binding to target 1, and scFab binding to target 2 fused to Fc. Heterodimerization is ensured by mutations in the Fc.
• the multispecific binding protein is in a DuetMab form, which is a heterodimeric construct containing two different Fab fragments binding to antigens 1 and 2, and Fc stabilized by heterodimerization mutations.
• Fab fragments 1 and 2 contain differential S-S bridges that ensure correct LC and HC pairing.
• the multispecific binding protein is in a CrossmAb form, which is a heterodimeric construct with two different Fab fragments binding to targets 1 and 2, fused to Fc stabilized by heterodimerization.
• CL and CHI domains and VH and VL domains are switched, e.g., CHI is fused in-frame with VL, and CL is fused in-frame with VH.
• the multispecific binding protein is in a Fit-Ig form, which is a homodimeric construct where Fab fragment binding to antigen 2 is fused to the N terminus of HC of Fab fragment that binds to antigen 1.
• the construct contains wild-type Fc.
• the multispecific binding proteins can engage more than one kind of NK-activating receptor, and may block the binding of natural ligands to NKG2D.
• the proteins can agonize NK cells in humans.
• the proteins can agonize NK cells in humans and in other species such as rodents and cynomolgus monkeys.
• the proteins can agonize NK cells in humans and in other species such as cynomolgus monkeys.
• Table 1 lists peptide sequences of heavy chain variable domains and light chain variable domains that, in combination, can bind to NKG2D.
• the heavy chain variable domain and the light chain variable domain are arranged in Fab format.
• the heavy chain variable domain and the light chain variable domain are fused together to form an scFv.
• NKG2D binding sites listed in Table 1 can vary in their binding affinity to NKG2D, nevertheless, they all activate human NK cells.
• the first antigen-binding site that binds NKG2D comprises an antibody heavy chain variable domain (VH) that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH of an antibody disclosed in Table 1, and an antibody light chain variable domain (VL) that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL of the same antibody disclosed in Table 1.
• VH antibody heavy chain variable domain
• VL antibody light chain variable domain
• the first antigenbinding site comprises the heavy chain CDR1, CDR2, and CDR3 and the light chain CDR1, CDR2, and CDR3, determined under Kabat (see Kabat et al., (1991) Sequences of Proteins of Immunological Interest, NIH Publication No. 91-3242, Bethesda), Chothia (see, e.g., Chothia C & Lesk A M, (1987), J. Mol. Biol. 196: 901-917), MacCallum (see MacCallum R M et al., (1996) J. Mol. Biol. 262: 732-745), or any other CDR determination method known in the art, of the VH and VL sequences of an antibody discloses in Table 1.
• the first antigen-binding site comprises the heavy chain CDR1, CDR2, and CDR3 and the light chain CDR1, CDR2, and CDR3 of an antibody disclosed in Table 1.
• the first antigen-binding site that binds to NKG2D comprises a heavy chain variable domain derived from SEQ ID NO: 1, such as by having an amino acid sequence at least 90% (e.g., at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 1, and/or incorporating amino acid sequences identical to the CDR1 (SEQ ID NO:2), CDR2 (SEQ ID NO:3), and CDR3 (SEQ ID NO:4) sequences of SEQ ID NO: 1.
• the heavy chain variable domain related to SEQ ID NO: 1 can be coupled with a variety of light chain variable domains to form an NKG2D binding site.
• the first antigen-binding site that incorporates a heavy chain variable domain related to SEQ ID NO: 1 can further incorporate a light chain variable domain selected from the sequences derived from SEQ ID NOs: 5, 6, 7, 8, 9, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, and 46.
• the first antigen-binding site incorporates a heavy chain variable domain with amino acid sequences at least 90% (e.g., at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 1 and a light chain variable domain with amino acid sequences at least 90% (e.g., at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to any one of the sequences selected from SEQ ID NOs: 5, 6, 7, 8, 9, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, and 46.
• the first antigen-binding site that binds NKG2D comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:26, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:32.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 27 or 28, 29, and 30 or 31, respectively (e.g., SEQ ID NOs: 27, 29, and 30, respectively, or SEQ ID NOs: 28, 29, and 31, respectively).
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 33, 34, and 35, respectively.
• the first antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 27 or 28, 29, and 30 or 31, respectively e.g., SEQ ID NOs: 27, 29, and 30, respectively, or SEQ ID NOs: 28, 29, and 31, respectively); and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 33, 34, and 35, respectively.
• the first antigen-binding site that binds NKG2D comprises a VH that comprises an amino acid sequence at least 90% (e.g, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:36, and a VL that comprises an amino acid sequence at least 90% (e.g, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:42.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 37 or 38, 39, and 40 or 41, respectively (e.g., SEQ ID NOs: 37, 39, and 40, respectively, or SEQ ID NOs: 38, 39, and 41, respectively).
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 43, 44, and 45, respectively.
• the first antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 37 or 38, 39, and 40 or 41, respectively (e.g., SEQ ID NOs: 37, 39, and 40, respectively, or SEQ ID NOs: 38, 39, and 41, respectively); and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 43, 44, and 45, respectively.
• the first antigen-binding site that binds NKG2D comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:47, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:49.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 27, 29, and 48, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 50, 34, and 51, respectively.
• the first antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 27, 29, and 48, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 50, 34, and 51, respectively.
• the first antigen-binding site that binds NKG2D comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:52, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:58.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 53 or 54, 55, and 56 or 57, respectively (e.g., SEQ ID NOs: 53, 55, and 56, respectively, or SEQ ID NOs: 54, 55, and 57, respectively).
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 59, 60, and 61, respectively.
• the first antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 53 or 54, 55, and 56 or 57, respectively (e.g., SEQ ID NOs: 53, 55, and 56, respectively, or SEQ ID NOs: 54, 55, and 57, respectively); and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 59, 60, and 61, respectively.
• the first antigen-binding site that binds NKG2D comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:62, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:68.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 63 or 64, 65, and 66 or 67, respectively (e.g., SEQ ID NOs: 63, 65, and 66, respectively, or SEQ ID NOs: 64, 65, and 67, respectively).
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 59, 60, and 69, respectively.
• the first antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 63 or 64, 65, and 66 or 67, respectively (e.g., SEQ ID NOs: 63, 65, and 66, respectively, or SEQ ID NOs: 64, 65, and 67, respectively); and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 59, 60, and 69, respectively.
• the first antigen-binding site that binds NKG2D comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:89, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:92.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 53 or 54, 55, and 90 or 91, respectively (e.g., SEQ ID NOs: 53, 55, and 90, respectively, or SEQ ID NOs: 54, 55, and 91, respectively).
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 93, 44, and 94, respectively.
• the first antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 53 or 54, 55, and 90 or 91, respectively (e.g., SEQ ID NOs: 53, 55, and 90, respectively, or SEQ ID NOs: 54, 55, and 91, respectively); and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 93, 44, and 94, respectively.
• the first antigen-binding site that binds NKG2D comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:70, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:75.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 71 or 115, 72, and 73 or 74, respectively (e.g., SEQ ID NOs: 71, 72, and 73, respectively, or SEQ ID NOs: 115, 72, and 74, respectively).
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 76, 77, and 78, respectively.
• the first antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 71 or 115, 72, and 73 or 74, respectively e.g., SEQ ID NOs: 71, 72, and 73, respectively, or SEQ ID NOs: 115, 72, and 74, respectively); and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 76, 77, and 78, respectively.
• the first antigen-binding site that binds NKG2D comprises a VH that comprises an amino acid sequence at least 90% (e.g, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:79, and a VL that comprises an amino acid sequence at least 90% (e.g, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:85.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80 or 81, 82, and 83 or 84, respectively (e.g., SEQ ID NOs: 80, 82, and 83, respectively, or SEQ ID NOs: 81, 82, and 84, respectively).
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 86, 77, and 87, respectively.
• the first antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80 or 81, 82, and 83 or 84 respectively (e.g., SEQ ID NOs: 80, 82, and 83, respectively, or SEQ ID NOs: 81, 82, and 84, respectively); and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 86, 77, and 87, respectively.
• the first antigen-binding site that binds NKG2D comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:95, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:85.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80 or 81, 82, and 96 or 97, respectively (e.g., SEQ ID NOs: 80, 82, and 96, respectively, or SEQ ID NOs: 81, 82, and 97, respectively).
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 86, 77, and 87, respectively.
• the first antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80 or 81, 82, and 96 or 97, respectively (e.g., SEQ ID NOs: 80, 82, and 96, respectively, or SEQ ID NOs: 81, 82, and 97, respectively); and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 86, 77, and 87, respectively.
• the first antigen-binding site that binds NKG2D comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:98, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:85.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80 or 81, 82, and 99 or 100, respectively (e.g., SEQ ID NOs: 80, 82, and 99, respectively, or SEQ ID NOs: 81, 82, and 100, respectively).
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 86, 77, and 87, respectively.
• the first antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80 or 81, 82, and 99 or 100, respectively (e.g., SEQ ID NOs: 80, 82, and 99, respectively, or SEQ ID NOs: 81, 82, and 100, respectively); and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 86, 77, and 87, respectively.
• the first antigen-binding site that binds NKG2D comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 101, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:85.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80 or 81, 82, and 102 or 103, respectively (e.g., SEQ ID NOs: 80, 82, and 102, respectively, or SEQ ID NOs: 81, 82, and 103, respectively).
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 86, 77, and 87, respectively.
• the first antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80 or 81, 82, and 102 or 103, respectively (e.g., SEQ ID NOs: 80, 82, and 102, respectively, or SEQ ID NOs: 81, 82, and 103, respectively); and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 86, 77, and 87, respectively.
• the first antigen-binding site that binds NKG2D comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 104, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:85.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80 or 81, 82, and 105 or 106, respectively (e.g., SEQ ID NOs: 80, 82, and 105, respectively, or SEQ ID NOs: 81, 82, and 106, respectively).
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 86, 77, and 87, respectively.
• the first antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80 or 81, 82, and 105 or 106, respectively (e.g., SEQ ID NOs: 80, 82, and 105, respectively, or SEQ ID NOs: 81, 82, and 106, respectively); and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 86, 77, and 87, respectively.
• the first antigen-binding site that binds NKG2D comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 107, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:85.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80 or 81, 82, and 108 or 109, respectively (e.g., SEQ ID NOs: 80, 82, and 108, respectively, or SEQ ID NOs: 81, 82, and 109, respectively).
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 86, 77, and 87, respectively.
• the first antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80 or 81, 82, and 108 or 109, respectively (e.g., SEQ ID NOs: 80, 82, and 108, respectively, or SEQ ID NOs: 81, 82, and 109, respectively); and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 86, 77, and 87, respectively.
• the first antigen-binding site that binds NKG2D comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 110, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:85.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80 or 81, 82, and 111 or 112, respectively (e.g., SEQ ID NOs: 80, 82, and 111, respectively, or SEQ ID NOs: 81, 82, and 112, respectively).
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 86, 77, and 87, respectively.
• the first antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80 or 81, 82, and 111 or 112, respectively (e.g., SEQ ID NOs: 80, 82, and 111, respectively, or SEQ ID NOs: 81, 82, and 112, respectively); and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 86, 77, and 87, respectively.
• the first antigen-binding site that binds NKG2D comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 113, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 114.
• the first antigen-binding site that binds NKG2D comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 116, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 117.
• the multispecific binding proteins can bind to NKG2D-expressing cells, which include but are not limited to NK cells, y6 T cells and CD8 + aP T cells. Upon NKG2D binding, the multispecific binding proteins may block natural ligands, such as ULBP6 and MICA, from binding to NKG2D and activating NK cells.
• NKG2D-expressing cells include but are not limited to NK cells, y6 T cells and CD8 + aP T cells.
• the multispecific binding proteins may block natural ligands, such as ULBP6 and MICA, from binding to NKG2D and activating NK cells.
• the multispecific binding proteins binds to cells expressing CD 16, an Fc receptor on the surface of leukocytes including natural killer cells, macrophages, neutrophils, eosinophils, mast cells, and follicular dendritic cells.
• a protein of the present disclosure binds to NKG2D with an affinity of KD of 2 nM to 120 nM, e.g., 2 nM to 110 nM, 2 nM to 100 nM, 2 nM to 90 nM, 2 nM to 80 nM, 2 nM to 70 nM, 2 nM to 60 nM, 2 nM to 50 nM, 2 nM to 40 nM, 2 nM to 30 nM, 2 nM to 20 nM, 2 nM to 10 nM, about 15 nM, about 14 nM, about 13 nM, about 12 nM, about 11 nM, about 10 nM, about 9 nM, about 8 nM, about 7 nM, about 6 nM, about 5 nM, about 4.5 nM, about 4 nM, about 3.5 nM, about 3 nM, about 2.5 nM, about 2 nM, about 1.5
• the BAFF-R site of the multispecific binding protein disclosed herein comprises a heavy chain variable domain and a light chain variable domain.
• the present disclosure provides multispecific binding proteins that bind to the NKG2D receptor and CD 16 receptor on natural killer cells, and BAFF-R.
• Table 2 lists some exemplary sequences of heavy chain variable domains and light chain variable domains that, in combination, can bind to BAFF-R.
• the second antigen-binding site that binds BAFF-R comprises an antibody heavy chain variable domain (VH) that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH of an antibody disclosed in Table 2, and an antibody light chain variable domain (VL) that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL of the same antibody disclosed in Table 2.
• VH antibody heavy chain variable domain
• VL antibody light chain variable domain
• the second antigenbinding site comprises the heavy chain CDR1, CDR2, and CDR3 and the light chain CDR1, CDR2, and CDR3, determined under Kabat (see Kabat et al., (1991) Sequences of Proteins of Immunological Interest, NIH Publication No. 91-3242, Bethesda), Chothia (see, e.g., Chothia C & Lesk A M, (1987), J Mol Biol 196: 901-917), MacCallum (see MacCallum R M et al., (1996) J Mol Biol 262: 732-745), or any other CDR determination method known in the art, of the VH and VL sequences of an antigen-binding site disclosed in Table 2.
• the second antigen-binding site comprises the heavy chain CDR1, CDR2, and CDR3 and the light chain CDR1, CDR2, and CDR3 of an antibody disclosed in Table 2.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 145, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 146.
• VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 146.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 157 or 135, 158 or 136, and 159 or 137, respectively e.g., SEQ ID NOs: 157, 158, and 159, respectively; or SEQ ID NOs: 135, 136, and 137, respectively).
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 160, 161, and 162, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 157 or 135, 158 or 136, and 159 or 137, respectively (e.g., SEQ ID NOs: 157, 158, and 159, respectively; or SEQ ID NOs: 135, 136, and 137, respectively); and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 160, 161, and 162, respectively.
• the second antigen-binding site is present as an scFv, wherein the scFv comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 207 or 138.
• the scFv comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 207 or 138.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 147, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 148.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 163, 164, and 165, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 166, 167, and 168, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 163, 164, and 165, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 166, 167, and 168, respectively.
• the second antigen-binding site is present as an scFv, wherein the scFv comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 139 or 140.
• the scFv comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 139 or 140.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 147, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 150.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 163, 164, and 165, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 169, 170, and 168, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 163, 164, and 165, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 169, 170, and 168, respectively.
• the second antigen-binding site is present as an scFv, wherein the scFv comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 141 or 142.
• the scFv comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 141 or 142.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 151, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 152.
• VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 152.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 171, 172, and 173, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 174, 175, and 176, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 171, 172, and 173, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 174, 175, and 176, respectively.
• the second antigen-binding site is present as an scFv, wherein the scFv comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 143 or 144.
• the scFv comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 143 or 144.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 153, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 154.
• VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 154.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 177 or 178, 179 or 180, and 181 or 182, respectively e.g., SEQ ID NOs: 177, 179, and 181, respectively; or SEQ ID NOs: 178, 180, and 182, respectively).
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 183 or 184, 185 or 186, and 187, respectively (e.g, SEQ ID NOs: 183, 185, and 187, respectively; or SEQ ID NOs: 184, 186, and 187, respectively).
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 177 or 178, 179 or 180, and 181 or 182, respectively (e.g, SEQ ID NOs: 177, 179, and 181, respectively; or SEQ ID NOs: 178, 180, and 182, respectively); and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 183 or 184, 185 or 186, and 187, respectively (e.g., SEQ ID NOs: 183, 185, and 187, respectively; or SEQ ID NOs: 184, 186, and 187, respectively).
• the second antigen-binding site is present as an scFv, wherein the scFv comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 149 or 190.
• the scFv comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 149 or 190.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 155, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 156.
• VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 156.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 177 or 178, 179 or 180, and 181 or 182, respectively e.g., SEQ ID NOs: 177, 179, and 181, respectively; or SEQ ID NOs: 178, 180, and 182, respectively).
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 183 or 188, 185 or 186, and 187, respectively (e.g., SEQ ID NOs: 183, 185, and 187, respectively; or SEQ ID NOs: 188, 186, and 187, respectively).
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 177 or 178, 179 or 180, and 181 or 182, respectively (e.g, SEQ ID NOs: 177, 179, and 181, respectively; or SEQ ID NOs: 178, 180, and 182, respectively); and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 183 or 188, 185 or 186, and 187, respectively (e.g., SEQ ID NOs: 183, 185, and 187, respectively; or SEQ ID NOs: 188, 186, and 187, respectively).
• the second antigen-binding site is present as an scFv, wherein the scFv comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 191 or 192.
• the scFv comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 191 or 192.
• the VH of the second antigen-binding site that binds BAFF-R comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 260, 249, and 261, respectively.
• the VL of the second antigenbinding site that binds BAFF-R comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 259, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 260, 249 and 261, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 259, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 310, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 214, 215, and 216, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 214, 215, and 216, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 59, 60, and 218, respectively.
• the second antigen-binding site that binds BAFF-R comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 214, 215, and 219, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 59, 60, and 218, respectively.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 220, 215, and 221, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 222, respectively.
• the second antigenbinding site that binds BAFF-R comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 220, 215, and 221, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 222, respectively.
• the VH of the second antigen-binding site that binds BAFF-R comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 214, 215, and 226, respectively.
• the VL of the second antigenbinding site that binds BAFF-R comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs:217, 77, and 218, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 214, 215, and 226, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:277, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 214, 215, and 223, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs:217, 77, and 218, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 214, 215, and 223, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs:217, 77, and 218, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:278, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 214, 215, and 224, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs:217, 77, and 218, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 214, 215, and 224, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:279, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 214, 215, and 225, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 214, 215, and 225, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the VH of the second antigen-binding site that binds BAFF-R comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 231, 215, and 232, respectively.
• the VL of the second antigenbinding site that binds BAFF-R comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 231, 215, and 232, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:280, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 227, 215, and 224, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 227, 215, and 224, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:281, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 228, 215, and 229, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 228, 215, and 229, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:282, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 230, 215, and 224, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 230, 215, and 224, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the VH of the second antigen-binding site that binds BAFF-R comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 230, 233, and 236, respectively.
• the VL of the second antigenbinding site that binds BAFF-R comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 230, 233, and 236, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:283, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 230, 233, and 242, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 230, 233, and 242, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:284, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 230, 233, and 234, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 230, 233, and 234, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:285, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:276.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 230, 233, and 235, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 230, 233, and 235, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 218, respectively.
• the VH of the second antigen-binding site that binds BAFF-R comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 245, 246, and 247, respectively.
• the VL of the second antigenbinding site that binds BAFF-R comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 259, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 245, 246, and 247, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 259, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:286, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:253.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 214, 233, and 237, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 249, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 214, 233, and 237, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 249, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:287, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:253.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 238, 239, and 240, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 249, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 238, 239, and 240, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 249, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:288, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:253.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 241, 233, and 242, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 249, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 241, 233, and 242, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 249, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:289, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:289.
• VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:289.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 243, 215, and 244, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 249, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 243, 215, and 244, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 249, respectively.
• the VH of the second antigen-binding site that binds BAFF-R comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 256, 257 and 258, respectively.
• the VL of the second antigenbinding site that binds BAFF-R comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 259, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 256, 257 and 258, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 259, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 250 or 252, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:251 or 253.
• VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 214, 233, and 248, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 249, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 214, 233, and 248, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 217, 77, and 249, respectively.
• the second antigen-binding site is present as an scFv, wherein the scFv comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:254 or 255.
• the scFv comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:254 or 255.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:263, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:264.
• VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:264.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 291, 292, and 293, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 294, 295, and 296, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 291, 292, and 293, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 294, 295, and 296, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:265, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:266.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 291, 297, and 298, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 294, 295, and 296, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 291, 297, and 298, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 294, 295, and 296, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:267, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:268.
• VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:268.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 299, 300, and 301, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 302, 303, and 304, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 299, 300, and 301, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 302, 303, and 304, respectively.
• the second antigen-binding site that binds BAFF-R comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:269, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:262.
• the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 305, 306, and 307, respectively.
• the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 308, 303, and 309, respectively.
• the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 305, 306, and 307, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 308, 303, and 309, respectively.
• the second antigen-binding site that binds BAFF-R is an scFv.
• the second antigen-binding site comprises the amino acid sequence of SEQ ID NO: 207, 138, 139, 140, 141, 142, 143, 144, 149, 190, 191, 192, 254 or 255.
• novel antigen-binding sites that can bind to BAFF-R can be identified by screening for binding to the amino acid sequence defined by binding to the amino acid sequence defined by SEQ ID NO: 189, a variant thereof, a mature extracellular fragment thereof or a fragment containing a domain of BAFF-R.
• a VH and a VL can be connected by a linker, e.g., (GlyGlyGlyGlySer)4 i.e. (G4S)4 linker (SEQ ID NO: 119).
• a linker e.g., (GlyGlyGlyGlySer)4 i.e. (G4S)4 linker (SEQ ID NO: 119).
• G4S G4S4 linker
• the scFv, VH and/or VL sequences that bind BAFF-R may contain amino acid alterations (e.g., at least 1, 2, 3, 4, 5, or 10 amino acid substitutions, deletions, or additions) in the framework regions of the VH and/or VL without affecting their ability to BAFF-R.
• amino acid alterations e.g., at least 1, 2, 3, 4, 5, or 10 amino acid substitutions, deletions, or additions
• scFv, VH and/or VL sequences that bind BAFF-R may contain cysteine heterodimerization mutations, facilitating formation of a disulfide bridge between the VH and VL of the scFv.
• the second antigen-binding site competes for binding to BAFF-R with a corresponding antigen-binding site described above.
• the second antigen-binding site blocks interaction of BAFF-R with BAFF ligand.
• CD16 binding is mediated by the hinge region and the CH2 domain.
• the interaction with CD16 is primarily focused on amino acid residues Asp 265 - Glu 269, Asn 297 - Thr 299, Ala 327 - He 332, Leu 234 - Ser 239, and carbohydrate residue N-acetyl-D-glucosamine in the CH2 domain (see, Sondermann et al., Nature, 406 (6793):267-273).
• mutations can be selected to enhance or reduce the binding affinity to CD 16, such as by using phage-displayed libraries or yeast surface-displayed cDNA libraries, or can be designed based on the known three- dimensional structure of the interaction.
• the antibody Fc domain or the portion thereof comprises a hinge and a CH2 domain.
• the assembly of heterodimeric antibody heavy chains can be accomplished by expressing two different antibody heavy chain sequences in the same cell, which may lead to the assembly of homodimers of each antibody heavy chain as well as assembly of heterodimers. Promoting the preferential assembly of heterodimers can be accomplished by incorporating different mutations in the CH3 domain of each antibody heavy chain constant region as shown in US13/494870, US16/028850, US11/533709, US12/875015, US13/289934, US14/773418, US12/811207, US13/866756, US14/647480, US13/642253, and US14/830336.
• mutations can be made in the CH3 domain based on human IgGl and incorporating distinct pairs of amino acid substitutions within a first polypeptide and a second polypeptide that allow these two chains to selectively heterodimerize with each other.
• the positions of amino acid substitutions illustrated below are all numbered according to the EU index as in Kabat (Kabat et al., 1991, Sequences of Proteins of Immunological Interest, 5th Ed., United States Public Health Service, National Institutes of Health, Bethesda, entirely incorporated by reference).
• Kabat Kabat
• an amino acid substitution in the first polypeptide replaces the original amino acid with a larger amino acid, selected from arginine (R), phenylalanine (F), tyrosine (Y) or tryptophan (W), and at least one amino acid substitution in the second polypeptide replaces the original amino acid(s) with a smaller amino acid(s), chosen from alanine (A), serine (S), threonine (T), or valine (V), such that the larger amino acid substitution (a protuberance) fits into the surface of the smaller amino acid substitutions (a cavity).
• one polypeptide can incorporate a T366W substitution, and the other can incorporate three substitutions including T366S, L368A, and Y407V.
• An antibody heavy chain variable domain described in the application can optionally be coupled to an amino acid sequence at least 90% identical to an antibody constant region, such as an IgG constant region including hinge, CH2 and CH3 domains with or without CHI domain.
• an antibody constant region such as an IgG constant region including hinge, CH2 and CH3 domains with or without CHI domain.
• the amino acid sequence of the constant region is at least 90% identical to a human antibody constant region, such as a human IgGl constant region, an IgG2 constant region, IgG3 constant region, or IgG4 constant region.
• the antibody Fc domain or a portion thereof sufficient to bind CD 16 comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to wild-type human IgGl Fc sequence
• the amino acid sequence of the constant region is at least 90% identical to an antibody constant region from another mammal, such as rabbit, dog, cat, mouse, or horse.
• the antibody constant domain linked to the scFv or the Fab fragment is able to bind to CD 16.
• the protein incorporates a portion of an antibody Fc domain (for example, a portion of an antibody Fc domain sufficient to bind CD16), wherein the antibody Fc domain comprises a hinge and a CH2 domain (for example, a hinge and a CH2 domain of a human IgGl antibody), and/or amino acid sequences at least 90% identical to amino acid sequence 234-332 of a human IgG antibody.
• One or more mutations can be incorporated into the constant region as compared to human IgGl constant region, for example at Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, N390, K392, T394, D399, S400, D401, F405, Y407, K409, T411 and/or K439.
• substitutions include, for example, Q347E, Q347R, Y349S, Y349K, Y349T, Y349D, Y349E, Y349C, T350V, L351K, L351D, L351Y, S354C, E356K, E357Q, E357L, E357W, K360E, K360W, Q362E, S364K, S364E, S364H, S364D, T366V, T366I, T366L, T366M, T366K, T366W, T366S, L368E, L368A, L368D, K370S, N390D, N390E, K392L, K392M, K392V, K392F, K392D, K392E, T394F, T394W, D399R, D399K, D399V, S400K,
• mutations that can be incorporated into the CHI of a human IgGl constant region may be at amino acid V125, F126, P127, T135, T139, A140, F170, P171, and/or VI 73.
• mutations that can be incorporated into the CK of a human IgGl constant region may be at amino acid E123, Fl 16, S176, V163, S174, and/or T164.
• amino acid substitutions could be selected from the following sets of substitutions shown in Table 3.
• amino acid substitutions could be selected from the following sets of substitutions shown in Table 4.
• amino acid substitutions could be selected from the following sets of substitutions shown in Table 5.
• At least one amino acid substitution in each polypeptide chain could be selected from Table 6.
• At least one amino acid substitution could be selected from the following sets of substitutions in Table 7, where the position(s) indicated in the First Polypeptide column is replaced by any known negatively-charged amino acid, and the position(s) indicated in the Second Polypeptide Column is replaced by any known positively-charged amino acid.
• At least one amino acid substitution could be selected from the following set in Table 8, where the position(s) indicated in the First Polypeptide column is replaced by any known positively-charged amino acid, and the position(s) indicated in the Second Polypeptide Column is replaced by any known negatively-charged amino acid.
• amino acid substitutions could be selected from the following sets in
• the structural stability of a hetero-multimeric protein may be increased by introducing S354C on either of the first or second polypeptide chain, and Y349C on the opposing polypeptide chain, which forms an artificial disulfide bridge within the interface of the two polypeptides.
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at position T366, and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of T366, L368 and Y407.
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of T366, L368 and Y407, and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at position T366.
• an IgGl e.g., human IgGl
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of E357, K360, Q362, S364, L368, K370, T394, D401, F405, and T411 and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of Y349, E357, S364, L368, K370, T394, D401, F405 and T411.
• an IgGl e.g., human IgGl
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of Y349, E357, S364, L368, K370, T394, D401, F405 and T411 and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of E357, K360, Q362, S364, L368, K370, T394, D401, F405, and T411.
• an IgGl e.g., human IgGl
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of L351, D399, S400 and Y407 and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of T366, N390, K392, K409 and T411.
• an IgGl e.g., human IgGl
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of T366, N390, K392, K409 and T411 and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of L351, D399, S400 and Y407.
• IgGl e.g., human IgGl
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of Q347, Y349, K360, and K409, and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of Q347, E357, D399 and F405.
• an IgGl e.g., human IgGl
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of Q347, E357, D399 and F405, and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of Y349, K360, Q347 and K409.
• IgGl e.g., human IgGl
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of K370, K392, K409 and K439, and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of D356, E357 and D399.
• an IgGl e.g., human IgGl
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of D356, E357 and D399, and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of K370, K392, K409 and K439.
• IgGl e.g., human IgGl
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of L351, E356, T366 and D399, and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of Y349, L351, L368, K392 and K409.
• IgGl e.g., human IgGl
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of Y349, L351, L368, K392 and K409, and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region at one or more positions selected from the group consisting of L351, E356, T366 and D399.
• an IgGl e.g., human IgGl
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by an S354C substitution and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by a Y349C substitution.
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by a Y349C substitution and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by an S354C substitution.
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by K360E and K409W substitutions and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by Q347R, D399V and F405T substitutions.
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by Q347R, D399V and F405T substitutions and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by K360E and K409W substitutions.
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by a T366W substitutions and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by T366S, T368A, and Y407V substitutions.
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by T366S, T368A, and Y407V substitutions and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by a T366W substitution.
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by T350V, L351Y, F405A, and Y407V substitutions and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by T350V, T366L, K392L, and T394W substitutions.
• an IgGl e.g., human IgGl
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by T350V, T366L, K392L, and T394W substitutions and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by T350V, L351Y, F405A, and Y407V substitutions.
• an IgGl e.g., human IgGl
• the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by an F405L substitution and wherein the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl (e.g., human IgGl) constant region by a K409R substitution.
• TriNKETs comprising an antigen-binding site that binds BAFF-R and an antigen-binding site that binds NKG2D each linked to an antibody constant region, wherein the antibody constant regions include mutations that enable heterodimerization of two Fc chains.
• Exemplary BAFF-R-targeting TriNKETs are contemplated in the F3’, F4, and 2- Fab formats.
• the antigen-binding site that binds BAFF-R is an scFv and the antigen-binding site that binds NKG2D is a Fab.
• the antigen binding-sites that bind BAFF-R are Fab fragments and the antigen-binding site that binds NKG2D is an scFv.
• the scFv may comprise substitution of Cys in the VH and VL regions, facilitating formation of a disulfide bridge between the VH and VL of the scFv.
• both the antigen-binding site that binds BAFF-R and the antigen-binding site that binds NKG2D are Fabs.
• the VH and VL of an scFv can be connected via a linker, e.g., a peptide linker.
• the peptide linker is a flexible linker.
• the amino acid composition of the linker peptides are selected with properties that confer flexibility, do not interfere with the structure and function of the other domains of the proteins described in the present application, and resist cleavage from proteases. For example, glycine and serine residues generally provide protease resistance.
• the VL is linked N-terminal or C- terminal to the VH via a (GlyGlyGlyGlySer)4 ((G4S)4) linker (SEQ ID NO: 119).
• the length of the linker (e.g., flexible linker) can be “short,” e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 amino acid residues, or “long,” e.g., at least 13 amino acid residues.
• the linker is 10-50, 10-40, 10-30, 10-25, 10-20, 15-50, 15-40, 15-30, 15- 25, 15-20, 20-50, 20-40, 20-30, or 20-25 amino acid residues in length.
• the linker comprises or consists of a (GS)n (SEQ ID NO: 120), (GGS)n(SEQ ID NO: 121), (GGGS)n(SEQ ID NO: 122), (GGSG)n(SEQ ID NO: 123), (GGSGG)n(SEQ ID NO:124), and (GGGGS)n(SEQ ID NO:125) sequence, wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
• the linker comprises or consists of an amino acid sequence selected from SEQ ID NO: 119 and SEQ ID NO: 126-134, as listed in Table 10.
• the BAFF-R binding scFv is linked to the N-terminus of an Fc via an Ala-Ser or Gly-Ser linker.
• the Ala-Ser or Gly-Ser linker is included at the elbow hinge region sequence to balance between flexibility and optimal geometry.
• an additional amino acid sequence Thr-Lys-Gly can be added N-terminal or C-terminal to the Ala- Ser or Gly-Ser sequence at the hinge.
• the NKG2D-binding scFv is linked to the C-terminus of an Fc via a short linker comprising the amino acid sequence SGSGGGGS (SEQ ID NO:274).
• an Fc includes an antibody hinge, CH2, and CH3.
• the Fc domain linked to an scFv comprises the mutations of Q347R, D399V, and F405T
• the Fc domain linked to a Fab comprises matching mutations K360E and K409W for forming a heterodimer.
• the Fc domain linked to the scFv further includes an S354C substitution in the CH3 domain, which forms a disulfide bond with a Y349C substitution on the Fc linked to the Fab. These substitutions are bold in the sequences described in this subsection.
• a TriNKET described in the present disclosure is ianalumab-F3'.
• Ianalumab-F3' includes (a) a BAFF-R-binding scFv sequence comprising the VH and VL sequences of ianalumab described of Table 2, in the orientation of VH positioned C-terminal to VL, linked to an Fc domain and (b) an NKG2D-binding Fab fragment derived from A49MI, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to the Fc domain.
• Ianalumab-F3' includes three polypeptides: scFv-ianalumab-VL-VH-Fc (SEQ ID NO: 193), A49MI-VH-CH1-Fc (SEQ ID NO: 194), and A49MLVL-CL (SEQ ID NO: 195).
• scFv-ianalumab-VL-VH-Fc (SEQ ID NO: 193) represents the full sequence of a BAFF-R binding scFv linked to an Fc domain via a hinge comprising Ala-Ser.
• the Fc domain linked to the scFv includes Q347R, D399V, and F405T substitutions for heterodimerization and an S354C substitution for forming a disulfide bond with a Y349C substitution in A49MI-VH- CHl-Fc as described below.
• the scFv has the amino acid sequence of SEQ ID NO:207, which includes a heavy chain variable domain of ianalumab connected to the C-terminus of a light chain variable domain of ianalumab via a (G4S)4 linker.
• the scFv comprises substitution of Cys in the VH and VL regions at G44 and QI 00, facilitating formation of a disulfide bridge between the VH and VL of the scFv.
• A49MI-VH-CH1-Fc represents the heavy chain portion of the Fab fragment, which comprises a heavy chain variable domain of NKG2D-binding A49MI (SEQ ID NO:95) and a CHI domain, connected to an Fc domain.
• the Fc domain in A49MI-VH-CH1- Fc includes a Y349C substitution in the CH3 domain, which forms a disulfide bond with an S354C substitution on the Fc in scFv-ianalumab-VL-VH-Fc.
• the Fc domain also includes K360E and K409W substitutions for heterodimerization with the Fc in scFv-ianalumab-VL-VH-Fc.
• A49MI-VL-CL (SEQ ID NO: 195) represents the light chain portion of the Fab fragment comprising a light chain variable domain of NKG2D-binding A49MI (SEQ ID NO:85) and a light chain constant domain.
• Ianalumab-2-Fab includes (a) a BAFF-R-binding Fab fragment comprising a VH sequence and a VL sequences of ianalumab described in Table 2, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to an Fc domain (which does not include antibody-dependent cellular cytotoxicity-enhancing mutations present in the commercial ianalumab antibody); (b) an NKG2D-binding Fab fragment derived from A49MI, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to the Fc domain.
• Ianalumab-2- Fab includes four polypeptides: ianalumab-VH-CHl-Fc-Genmab, ianalumab-VL-CL, A49MI- VH-CHl-Fc, and A49MI-VL-CL-Genmab.
• lanalumab-VL-CL (SEQ ID NO : 197)
• lanalumab-VH-CHl-Fc-Genmab represents the heavy chain portion of the Fab fragment, which comprises a heavy chain variable domain (SEQ ID NO: 145) of BAFF-R-binding ianalumab and a CHI domain, connected to an Fc domain.
• the Fc domain in ianalumab-VH-CHl-Fc-Genmab includes an F405L substitution for heterodimerization with the Fc in A49MI-VH-CH1-Fc-Genmab, which includes a K409R substitution.
• lanalumab-VL-CL represents the light chain portion of the Fab fragment comprising a light chain variable domain of BAFF-R-binding ianalumab (SEQ ID NO: 146) and a light chain constant domain.
• A49MI-VH-CH1-Fc-Genmab (SEQ ID NO:213) comprises a heavy chain variable domain of NKG2D-binding A49MI (SEQ ID NO:95) and a CHI domain, connected to an Fc domain.
• the Fc domain in A49MI-VH-CH1-Fc-Genmab includes a K409R substitution for heterodimerization with the Fc in ianalumab-VH-CHl-Fc-Genmab, which includes an F405L substitution.
• A49MI-VL-CL (SEQ ID NO: 195), as described above, comprises a light chain variable domain of NKG2D-binding A49MI (SEQ ID NO:85) and a light chain constant domain.
• hCOH-l-F3 TriNKET.
• hCOH-l-F3’ includes (a) a BAFF-R-binding scFv sequence derived from hCOH-1 of Table 2, in the orientation of VH positioned C-terminal to VL, linked to an Fc domain and (b) an NKG2D-binding Fab fragment derived from A49MI, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to the Fc domain.
• hCOH-1 -F3' includes three polypeptides: scFv-hCOH-l-VL-VH-Fc, A49MI- VH-CHl-Fc, and A49MI-VL-CL.
• EIVLTQSPATLSLSPGERATLSCRASESVDNYGISFLNWFQQKPGQAPRLLIYAASNRATG IPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQSKEVPWTFGCGTKVEIKGGGGSGGGGS GGGGSGGGGSQVQLQESGPGLVKPSQTLSLTCTVSGDSITSGYWNWIRQHPGKCLEYIG YISYSGSTYYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCASPNYPFYAMDYW GQGTLVTVSSASDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVI ⁇ FNWYVDGVEVHNAI ⁇ TI ⁇ PREEQYNSTYRVVSVLTVLHQDWLNGI ⁇ EYI ⁇ CI ⁇ VS NKALPAPIEKTISKAKGQPREPRVYTLPPCRDELTKNQVSLTCLVKGFYPSDIAVEWESN
• scFv-hCOH-l-VL-VH-Fc (SEQ ID NO: 198) represents the full sequence of a BAFF- R binding scFv linked to an Fc domain via a hinge comprising Ala-Ser.
• the Fc domain linked to the scFv includes Q347R, D399V, and F405T substitutions for heterodimerization and an S354C substitution for forming a disulfide bond with a Y349C substitution in A49MI-VH-CH1-Fc as described below.
• the scFv has the amino acid sequence of SEQ ID NO: 149, which includes a heavy chain variable domain of hCOH-1 connected to the C-terminus of a light chain variable domain of hCOH-1 via a (G4S)4 linker.
• the scFv comprises substitution of Cys in the VH and VL regions at G44 and G100, facilitating formation of a disulfide bridge between the VH and VL of the scFv.
• A49MI-VH-CH1-Fc (SEQ ID NO: 194), as described above, comprises a heavy chain variable domain of NKG2D-binding A49MI (SEQ ID NO:95) and a CHI domain, connected to an Fc domain.
• the Fc domain in A49MI-VH-CH1-Fc includes a Y349C substitution in the CH3 domain, which forms a disulfide bond with an S354C substitution on the Fc in scFv-hCOH-l-VL-VH-Fc.
• the Fc domain also includes K360E and K409W substitutions for heterodimerization with the Fc in scFv-hCOH-l-VL-VH-Fc.
• A49MI-VL-CL (SEQ ID NO: 195), as described above, comprises a light chain variable domain of NKG2D-binding A49MI (SEQ ID NO:85) and a light chain constant domain.
• hCOH-1-2- Fab includes (a) a BAFF-R-binding Fab fragment derived from hCOH-1, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to an Fc domain; (b) an NKG2D-binding Fab fragment derived from A49MI, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to the Fc domain.
• hCOH-l-2-Fab includes four polypeptides: hCOH-1 -VH-CHl-Fc-Genmab, hCOH-l-VL-CL, A49MI-VH-CH1- Fc-Genmab, and A49MI-VL-CL.
• hCOH-l-VH-CHl-Fc-Genmab represents the heavy chain portion of the Fab fragment, which comprises a heavy chain variable domain of BAFF-R-binding hCOH-1 (SEQ ID NO: 153) and a CHI domain, connected to an Fc domain.
• the Fc domain in hCOH-l-VH-CHl-Fc-Genmab includes an F405L substitution for heterodimerization with the
• hCOH-l-VL-CL represents the light chain portion of the Fab fragment comprising a light chain variable domain of BAFF-R-binding hCOH-1 (SEQ ID NO: 154) and a light chain constant domain.
• A49MI-VH-CH1-Fc-Genmab (SEQ ID NO:213) comprises a heavy chain variable domain of NKG2D-binding A49MI (SEQ ID NO:95) and a CHI domain, connected to an Fc domain.
• the Fc domain in A49MI-VH-CH1-Fc-Genmab includes a K409R substitution for heterodimerization with the Fc in hCOH-l-VH-CHl-Fc-Genmab, which includes an F405L substitution.
• A49MI-VL-CL (SEQ ID NO: 195) comprises a light chain variable domain of NKG2D-binding A49MI (SEQ ID NO:85) and a light chain constant domain.
• hCOH-2-F3 Another exemplary TriNKET described in the present disclosure is hCOH-2-F3’.
• hCOH-2-F3’ includes (a) a BAFF-R-binding scFv sequence derived from hCOH-2 of Table 2, in the orientation of VH positioned C-terminal to VL, linked to an Fc domain and (b) an NKG2D- binding Fab fragment derived from A49MI, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to the Fc domain.
• hCOH-2-F3' includes three polypeptides: scFv-hCOH-l-VL-VH-Fc, A49MI-VH- CHl-Fc, and A49MI-VL-CL.
• scFv-hCOH-2-VL-VH-Fc (SEQ ID NO:210) represents the full sequence of a BAFF-R binding scFv linked to an Fc domain via a hinge comprising Ala-Ser.
• the Fc domain linked to the scFv includes Q347R, D399V, and F405T substitutions for heterodimerization and an S354C substitution for forming a disulfide bond with a Y349C substitution in A49MI-VH- CHl-Fc as described below.
• the scFv has the amino acid sequence of SEQ ID NO: 191, which includes a heavy chain variable domain of hCOH-2 connected to the C-terminus of a light chain variable domain of hCOH-2 via a (G4S)4 linker.
• the scFv comprises substitution of Cys in the VH and VL regions at G44 and G100, facilitating formation of a disulfide bridge between the VH and VL of the scFv.
• A49MI-VH-CH1-Fc (SEQ ID NO: 194) represents the heavy chain portion of the
• Fab fragment which comprises a heavy chain variable domain of NKG2D-binding A49MI (SEQ ID NO:95) and a CHI domain, connected to an Fc domain.
• the Fc domain in A49MI-VH-CH1- Fc includes a Y349C substitution in the CH3 domain, which forms a disulfide bond with an S354C substitution on the Fc in scFv-hCOH-2-VL-VH-Fc.
• the Fc domain also includes K360E and K409W substitutions for heterodimerization with the Fc in scFv-hCOH-2-VL-VH-Fc.
• A49MI-VL-CL (SEQ ID NO: 195) represents the light chain portion of the Fab fragment comprising a light chain variable domain of NKG2D-binding A49MI (SEQ ID NO:85) and a light chain constant domain.
• hCOH-2-2-Fab includes (a) a BAFF-R-binding Fab fragment derived from hCOH-2, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to an Fc domain; (b) an NKG2D-binding Fab fragment derived from A49MI, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to the Fc domain.
• hCOH-2-2-Fab includes four polypeptides: hCOH-2-VH-CHl-Fc-Genmab, hCOH-2-VL-CL, A49MI-VH-CH1- Fc-Genmab, and A49MI-VL-CL.
• hCOH-2-VH-CHl-Fc-Genmab (SEQ ID NO: 199) EVQLQESGPGLVKPSQTLSLTCTVSGDSITSGYWNWIRQHPGKGLEYIGYISYSGSTYYN PSLKSRVTISRDTSKNQYSLKLSSVTAADTAVYYCASPNYPFYAMDYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGF
• hCOH-2-VL-CL (SEQ ID NO:200) DIVLTQSPATLSLSPGERATLSCRASESVDNYGISFMNWFQQKPGQAPRLLIYAASNRAT GIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQSKEVPWTFGGGTKVEIKRTVAAPSVFI FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
• hCOH-2-VH-CHl-Fc-Genmab (SEQ ID NO: 199) represents the heavy chain portion of the Fab fragment, which comprises a heavy chain variable domain of BAFF-R-binding hCOH-2 (SEQ ID NO: 155) and a CHI domain, connected to an Fc domain.
• the Fc domain in hCOH-2-VH-CHl-Fc-Genmab includes an F405L substitution for heterodimerization with the Fc in A49MI-VH-CH1-Fc-Genmab, which includes a K409R substitution.
• hCOH-2-VL-CL represents the light chain portion of the Fab fragment comprising a light chain variable domain of BAFF-R-binding hCOH-2 (SEQ ID NO: 156) and a light chain constant domain.
• A49MI-VH-CH1-Fc-Genmab (SEQ ID NO:213) comprises a heavy chain variable domain of NKG2D-binding A49MI (SEQ ID NO:95) and a CHI domain, connected to an Fc domain.
• the Fc domain in A49MI-VH-CH1-Fc-Genmab includes a K409R substitution for heterodimerization with the Fc in hCOH-2-VH-CHl-Fc-Genmab, which includes an F405L substitution.
• A49MI-VL-CL (SEQ ID NO: 195) comprises a light chain variable domain of NKG2D-binding A49MI (SEQ ID NO:85) and a light chain constant domain.
• V3-46s-F3 includes (a) a BAFF-R-binding scFv sequence derived from V3-46s of Table 2, in the orientation of VH positioned C-terminal to VL, linked to an Fc domain and (b) an NKG2D- binding Fab fragment derived from A49MI, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to the Fc domain.
• V3-46s-F3' includes three polypeptides: scFv-hCOH-l-VL-VH-Fc, A49MI-VH- CHl-Fc, and A49MI-VL-CL.
• scFv-V3-46s-VL-VH-Fc (SEQ ID NO:201) (“Chain S”) DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPSR FSGSGSGTDFTLTISSLQPEDFATYYCQQSQISPPTFGCGTKVEIKGGGGSGGGGSGGGGS GGGGSEVQLVESGGGLVQPGGSLRLSCAASGFTISSSSIHWVRQAPGKCLEWVAWVLPS VGFTDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARRVCYNRLGVCAGGM DYWGQGTLVTVSSASDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVI ⁇ FNWYVDGVEVHNAI ⁇ TI ⁇ PREEQYNSTYRVVSVLTVLHQDWLNGI ⁇ EYI ⁇ C K
• the Fc domain linked to the scFv includes Q347R, D399V, and F405T substitutions for heterodimerization and an S354C substitution for forming a disulfide bond with a Y349C substitution in A49MI-VH-CH1-Fc as described below.
• the scFv has the amino acid sequence of SEQ ID NO: 139, which includes a heavy chain variable domain of V3-46s connected to the C-terminus of a light chain variable domain of V3-46s via a (G4S)4 linker.
• the scFv comprises substitution of Cys in the VH and VL regions at G44 and QI 00, facilitating formation of a disulfide bridge between the VH and VL of the scFv.
• A49MI-VH-CH1-Fc represents the heavy chain portion of the Fab fragment, which comprises a heavy chain variable domain of NKG2D-binding A49MI (SEQ ID NO:95) and a CHI domain, connected to an Fc domain.
• the Fc domain in A49MI-VH-CH1- Fc includes a Y349C substitution in the CH3 domain, which forms a disulfide bond with an S354C substitution on the Fc in scFv-V3-46s-VL-VH-Fc.
• the Fc domain also includes K360E and K409W substitutions for heterodimerization with the Fc in scFv-V3- 46s-VL-VH-Fc.
• A49MI-VL-CL (SEQ ID NO: 195) represents the light chain portion of the Fab fragment comprising a light chain variable domain of NKG2D-binding A49MI (SEQ ID NO:85) and a light chain constant domain.
• V3-46s-2-Fab includes (a) a BAFF-R-binding Fab fragment derived from V3-46s, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to an Fc domain; (b) an NKG2D-binding Fab fragment derived from A49MI, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to the Fc domain.
• V3-46s-2-Fab includes four polypeptides: V3-46s-VH-CHl-Fc-Genmab, V3-46s-VL-CL, A49MI-VH-CH1-Fc- Genmab, and A49MI-VL-CL. [00431] V3-46s-VH-CHl-Fc-Genmab (SEQ ID NO:202)
• V3-46s-VL-CL (SEQ ID NO:203)
• V3-46s-VH-CHl-Fc-Genmab (SEQ ID NO:202) represents the heavy chain portion of the Fab fragment, which comprises a heavy chain variable domain of BAFF-R-binding V3- 46s (SEQ ID NO: 147) and a CHI domain, connected to an Fc domain.
• the Fc domain in V3- 46s-VH-CHl-Fc-Genmab includes an F405L substitution for heterodimerization with the Fc in A49MI-VH-CH1-Fc-Genmab, which includes a K409R substitution.
• V3-46s-VL-CL represents the light chain portion of the Fab fragment comprising a light chain variable domain of BAFF-R-binding V3-46s (SEQ ID NO: 148) and a light chain constant domain.
• A49MI-VH-CH1-Fc-Genmab (SEQ ID NO:213) comprises a heavy chain variable domain of NKG2D-binding A49MI (SEQ ID NO:95) and a CHI domain, connected to an Fc domain.
• the Fc domain in A49MI-VH-CH1-Fc-Genmab includes a K409R substitution for heterodimerization with the Fc in V3-46s-VH-CHl-Fc-Genmab, which includes an F405L substitution.
• A49MI-VL-CL (SEQ ID NO: 195) comprises a light chain variable domain of NKG2D-binding A49MI (SEQ ID NO:85) and a light chain constant domain.
• Another exemplary TriNKET described in the present disclosure is V3-46s-42-F3’.
• V3-46s-42-F3’ includes (a) a BAFF-R-binding scFv sequence derived from V3-46s-42 of Table 2, in the orientation of VH positioned C-terminal to VL, linked to an Fc domain and (b) an NKG2D-binding Fab fragment derived from A49MI, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to the Fc domain.
• V3-46s-42-F3' includes three polypeptides: scFv-V3-46s-42-VL-VH-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL.
• scFv-V3-46s-42-VL-VH-Fc represents the full sequence of a BAFF-R binding scFv linked to an Fc domain via a hinge comprising Ala-Ser.
• the Fc domain linked to the scFv includes Q347R, D399V, and F405T substitutions for heterodimerization and an S354C substitution for forming a disulfide bond with a Y349C substitution in A49MI-VH- CHl-Fc as described below.
• the scFv has the amino acid sequence of SEQ ID NO: 141, which includes a heavy chain variable domain of V3-46s-42 connected to the C-terminus of a light chain variable domain of V3-46s-42 via a (G4S)4 linker.
• the scFv comprises substitution of Cys in the VH and VL regions at G44 and QI 00, facilitating formation of a disulfide bridge between the VH and VL of the scFv.
• A49MI-VH-CH1-Fc represents the heavy chain portion of the Fab fragment, which comprises a heavy chain variable domain of NKG2D-binding A49MI (SEQ ID NO:95) and a CHI domain, connected to an Fc domain.
• the Fc domain in A49MI-VH-CH1- Fc includes a Y349C substitution in the CH3 domain, which forms a disulfide bond with an S354C substitution on the Fc in scFv-V3-46s-42-VL-VH-Fc.
• the Fc domain also includes K360E and K409W substitutions for heterodimerization with the Fc in scFv- V3 -46s-42- VL- VH-Fc.
• A49MI-VL-CL (SEQ ID NO: 195) represents the light chain portion of the Fab fragment comprising a light chain variable domain of NKG2D-binding A49MI (SEQ ID NO:85) and a light chain constant domain.
• V3-46s-42-2-Fab includes (a) a BAFF-R-binding Fab fragment derived from V3-46s-42, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to an Fc domain; (b) an NKG2D-binding Fab fragment derived from A49MI, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to the Fc domain.
• V3-46s-42-2- Fab includes four polypeptides: V3-46s-42-VH-CHl-Fc-Genmab, V3-46s-42-VL-CL, A49MI- VH-CHl-Fc-Genmab, and A49MI-VL-CL.
• V3-46s-42-VH-CHl-Fc-Genmab (SEQ ID NO :202)
• V3-46s-42-VL-CL (SEQ ID NO:206)
• V3-46s-42-VH-CHl-Fc-Genmab (SEQ ID NO:205) represents the heavy chain portion of the Fab fragment, which comprises a heavy chain variable domain of BAFF-R-binding V3-46s-42 (SEQ ID NO: 147) and a CHI domain, connected to an Fc domain.
• the Fc domain in V3-46s-42-VH-CHl-Fc includes an F405L substitution for heterodimerization with the Fc in A49MI-VH-CH1-Fc-Genmab, which includes a K409R substitution.
• V3-46s-42-VL-CL represents the light chain portion of the Fab fragment comprising a light chain variable domain of BAFF-R-binding V3-46s-42 (SEQ ID NO: 150) and a light chain constant domain.
• A49MI-VH-CH1-Fc-Genmab (SEQ ID NO:213) comprises a heavy chain variable domain of NKG2D-binding A49MI (SEQ ID NO:95) and a CHI domain, connected to an Fc domain.
• the Fc domain in A49MI-VH-CH1-Fc-Genmab includes a K409R substitution for heterodimerization with the Fc in V3-46s-42-VH-CHl-Fc-Genmab, which includes an F405L substitution.
• A49MI-VL-CL (SEQ ID NO: 195) comprises a light chain variable domain of NKG2D-binding A49MI (SEQ ID NO:85) and a light chain constant domain.
• Hu9.1-73-F3 TriNKET
• Hu9.1-73-F3’ TriNKET includes (a) a BAFF-R-binding scFv sequence derived from Hu9.1-73 of Table 2, in the orientation of VH positioned C-terminal to VL, linked to an Fc domain and (b) an NKG2D-binding Fab fragment derived from A49MI, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to the Fc domain.
• Hu9.1-73-F3' includes three polypeptides: scFv-Hu9.1- 73-VL-VH-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL.
• scFv-Hu9.1-73-VL-VH-Fc (SEQ ID NO:211) represents the full sequence of a
• the Fc domain linked to the scFv includes Q347R, D399V, and F405T substitutions for heterodimerization and an S354C substitution for forming a disulfide bond with a Y349C substitution in A49MI-VH- CHl-Fc as described below.
• the scFv has the amino acid sequence of SEQ ID NO: 143, which includes a heavy chain variable domain of scFv-Hu9.1-73 connected to the C-terminus of a light chain variable domain of scFv-Hu9.1-73 via a (G4S)4 linker.
• the scFv comprises substitution of Cys in the VH and VL regions at G44 and QI 00, facilitating formation of a disulfide bridge between the VH and VL of the scFv.
• A49MI-VH-CH1-Fc represents the heavy chain portion of the Fab fragment, which comprises a heavy chain variable domain of NKG2D-binding A49MI (SEQ ID NO:95) and a CHI domain, connected to an Fc domain.
• the Fc domain in A49MI-VH-CH1- Fc includes a Y349C substitution in the CH3 domain, which forms a disulfide bond with an S354C substitution on the Fc in scFv-Hu9.1-73-VL-VH-Fc.
• the Fc domain also includes K360E and K409W substitutions for heterodimerization with the Fc in scFv-Hu9.1-73-VL-VH-Fc.
• A49MI-VL-CL (SEQ ID NO: 195) represents the light chain portion of the Fab fragment comprising a light chain variable domain of NKG2D-binding A49MI (SEQ ID NO:85) and a light chain constant domain.
• Hu9.1-73-2 -Fab Another TriNKET described in the present disclosure is Hu9.1-73-2 -Fab.
• Hu9.1-73- 2-Fab includes (a) a BAFF-R-binding Fab fragment derived from Hu9.1-73, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to an Fc domain; (b) an NKG2D-binding Fab fragment derived from A49MI, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to the Fc domain.
• Hu9.1-73-2-Fab includes four polypeptides: Hu9.1-73-VH-CHl-Fc-Genmab, Hu9.1-73-VL-CL, A49MI-VH- CHl-Fc-Genmab, and A49MI-VL-CL.
• DIQMTQSPS SLS AS VGDRVTITCKS SQ SLL YS SNQNNYL AWYQQKPGKAPKLLIYWAQH LDSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYYTYPYTFGQGTKVEIKRTVAAP SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDST YSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
• Hu9.1-73-VH-CHl-Fc-Genmab represents the heavy chain portion of the Fab fragment, which comprises a heavy chain variable domain of BAFF-R-binding Hu9.1-73 (SEQ ID NO:151) and a CHI domain, connected to an Fc domain.
• the Fc domain in Hu9.1-73-VH-CHl-Fc includes an F405L substitution for heterodimerization with the Fc in A49MI-VH-CH1-Fc-Genmab, which includes a K409R substitution.
• Hu9.1-73-VL-CL represents the light chain portion of the Fab fragment comprising a light chain variable domain of BAFF-R-binding Hu9.1-73 (SEQ ID NO: 152) and a light chain constant domain.
• A49MI-VH-CH1-Fc-Genmab (SEQ ID NO:213) comprises a heavy chain variable domain of NKG2D-binding A49MI (SEQ ID NO:95) and a CHI domain, connected to an Fc domain.
• the Fc domain in A49MI-VH-CH1-Fc-Genmab includes a K409R substitution for heterodimerization with the Fc in Hu9.1-73-VH-CHl-Fc-Genmab, which includes an F405L substitution.
• A49MI-VL-CL (SEQ ID NO: 195) comprises a light chain variable domain of
• NKG2D-binding A49MI (SEQ ID NO:85) and a light chain constant domain.
• AB1424/1612-F3' includes (a) a BAFF-R-binding scFv sequence derived from AB1424/1612 (with cysteine heterodimerization mutations for disulfide bridge formation) of Table 2, in the orientation of VH positioned N-terminal to VL, linked to an Fc domain and (b) an NKG2D-binding Fab fragment derived from A49MI, including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to the Fc domain.
• AB1424/1612-F3' includes three polypeptides: scFv- AB1424/1612-VL-VH-Fc (SEQ ID NO: 193), A49MI-VH-CH1-Fc (SEQ ID NO: 194), and A49MI-VL-CL (SEQ ID NO: 195).
• A49MI-VH-CH1-Fc (SEQ ID NO: 194) (“Chain H”) EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVROAPGKGLEWVSSISSSSSYIY YADSVKGRFTISRDNAKNSLYLOMNSLRAEDTAVYYCARGAPIGAAAGWFDPWGOGT LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VC TLPPSRDELTENQVSLTCLVKGFYPSDIAVE
• A49MI-VL-CL (SEQ ID NO: 195) (“Chain L”) DIOMTOSPSSVSASVGDRVTITCRASOGISSWLAWYOOKPGKAPKLLIYAASSLQSGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCQQGVSFPRTFGGGTKVEIKRTVAAPSVFIFPPSD EQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
• scFv- AB 1424/1612- VH-VL-Fc (SEQ ID NO:270) represents the full sequence of a
• the Fc domain linked to the scFv includes Q347R, D399V, and F405T substitutions for heterodimerization and an S354C substitution for forming a disulfide bond with a Y349C substitution in A49MI-VH- CHl-Fc as described below.
• the scFv has the amino acid sequence of SEQ ID NO:254, which includes a heavy chain variable domain of AB 1424/1612 connected to the C-terminus of a light chain variable domain of AB 1424/1612 via a (G4S)4 linker.
• the scFv comprises substitution of cysteine in the VH and VL regions at G44 and G100, facilitating formation of a disulfide bridge between the VH and VL of the scFv.
• A49MI-VH-CH1-Fc represents the heavy chain portion of the Fab fragment, which comprises a heavy chain variable domain of NKG2D-binding A49MI (SEQ ID NO:95) and a CHI domain, connected to an Fc domain.
• the Fc domain in A49MI-VH-CH1- Fc includes a Y349C substitution in the CH3 domain, which forms a disulfide bond with an S354C substitution on the Fc in scFv-AB1424/1612-VL-VH-Fc.
• the Fc domain also includes K360E and K409W substitutions for heterodimerization with the Fc in scFv- AB1424/1612-VL-VH-Fc.
• A49MI-VL-CL (SEQ ID NO: 195) represents the light chain portion of the Fab fragment comprising a light chain variable domain of NKG2D-binding A49MI (SEQ ID NO:85) and a light chain constant domain.
• TriNKET Another example of a TriNKET described in the present disclosure is
• AB1424/1612-F4 includes (a) two BAFF-R-binding Fab fragments derived from AB1424/1612 of Table 2, each including a heavy chain portion comprising a heavy chain variable domain and a CHI domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CHI domain is connected to the Fc domain and (b) an NKG2D-binding scFv sequence derived from A49MI linked to the C- terminus of the Fc domain, in the orientation of VH positioned C-terminal to VL.
• AB1424/1612- F4 includes four polypeptides: a first polypeptide comprising AB 1424/1612-VH-CH1-CH2- CH3-A49MI-scFv (SEQ ID NO:271), a second polypeptide comprising AB- 1424/1612-VH- CH1-CH2-CH3 (SEQ ID NO:272), and a third and fourth polypeptide each comprising AB1424/1612-VL-CL (SEQ ID NO:273).
• AB1424/1612-VH-CHl-CH2-CH3-A49MI-scFv represents the heavy chain portion of the Fab fragment, which comprises a heavy chain variable domain of BAFF-R-binding AB 1424/1612 (SEQ ID NO:250) and a CHI domain, connected to an Fc domain, further connected to an scFv.
• the scFv has the amino acid sequence of SEQ ID NO:275, which comprises a heavy chain variable domain of NKG2D-binding A49MI (SEQ ID NO:95) connected to the C-terminus of a light chain variable domain of A49MI (SEQ ID NO:85) via a (G4S)4 linker.
• the scFv also comprises substitution of Cys in the VH and VL regions at G44 and G100, facilitating formation of a disulfide bridge between the VH and VL of the scFv.
• the scFv of AB1424/1612-VH-CHl-CH2-CH3-A49MI-scFv is linked to the C-terminus of the CH3 domain by a short SGSGGGGS (SEQ ID NO:274) linker.
• the Fc domain in AB 1424/1612- VH- CHl-CH2-CH3-A49MI-scFv includes Q347R, D399V, and F405T substitutions for heterodimerization and an S354C substitution for forming a disulfide bond with a Y349C substitution in AB-1424/1612-VH-CH1-CH2-CH3 as described below.
• AB1424/1612-VH-CH1-CH2-CH3 represents the heavy chain portion of the Fab fragment, which comprises a heavy chain variable domain of BAFF-R-binding AB1424/1612 (SEQ ID NO:250) and a CHI domain, connected to an Fc domain.
• the Fc domain in A49MI-VH-CH1-Fc includes a Y349C substitution in the CH3 domain, which forms a disulfide bond with an S354C substitution on the Fc in AB 1424/1612-VH-CH1-CH2-CH3 - A49MI-scFv.
• the Fc domain also includes K360E and K409W substitutions for heterodimerization with the Fc in AB 1424/1612- VH-CH1-CH2-CH3- A49MI-scFv.
• AB1424/1612-VL-CL (SEQ ID NO:273) represents the light chain portion of the
• an F3’ TriNKET described in the present disclosure is identical to one of the exemplary TriNKETs described above, except that (a) the Fc domain linked to the NKG2D-binding Fab fragment includes Q347R, D399V, and F405T substitutions in the CH3 domain for heterodimerization, and the Fc domain linked to the BAFF-R-binding scFv includes matching K360E and K409W substitution in the CH3 domain; and/or (b) the Fc domain linked to the NKG2D-binding Fab fragment includes an S354C substitution in the CH3 domain, and the Fc domain linked to the BAFF-R-binding scFv includes a matching Y349C substitution in the CH3 domain for forming a disulfide bond.
• a 2-Fab TriNKET described in the present disclosure is identical to one of the exemplary TriNKETs described above, except that the Fc domain linked to the NKG2D-binding Fab fragment includes a F405L substitution in the CH3 domain for heterodimerization, and the Fc domain linked to the BAFF-R-binding Fab fragment includes a matching K409R substitution in the CH3 domain.
• N-terminal glutamate (E) or glutamine (Q) can be cyclized to form a lactam (e.g., spontaneously or catalyzed by an enzyme present during production and/or storage).
• N-terminal residue of an amino acid sequence of a polypeptide is E or Q
• a corresponding amino acid sequence with the E or Q replaced with pyroglutamate is also contemplated herein.
• the C-terminal lysine (K) of a protein can be removed (e.g., spontaneously or catalyzed by an enzyme present during production and/or storage). Such removal of K is often observed with proteins that comprise an Fc domain at its C-terminus. Accordingly, in some embodiments where the C-terminal residue of an amino acid sequence of a polypeptide (e.g., an Fc domain sequence) is K, a corresponding amino acid sequence with the K removed is also contemplated herein.
• the multispecific proteins described above can be made using recombinant DNA technology well known to a skilled person in the art.
• a first nucleic acid sequence encoding the first immunoglobulin heavy chain can be cloned into a first expression vector
• a second nucleic acid sequence encoding the second immunoglobulin heavy chain can be cloned into a second expression vector
• a third nucleic acid sequence encoding the immunoglobulin light chain can be cloned into a third expression vector
• the first, second, and third expression vectors can be stably transfected together into host cells to produce the multimeric proteins.
• Clones can be cultured under conditions suitable for bio-reactor scale-up and maintained expression of the multispecific protein.
• the multispecific proteins can be isolated and purified using methods known in the art including centrifugation, depth filtration, cell lysis, homogenization, freeze-thawing, affinity purification, gel filtration, ion exchange chromatography, hydrophobic interaction exchange chromatography, and mixed-mode chromatography.
• the multispecific proteins described herein include an NKG2D-binding site, a BAFF-R binding site, and an antibody Fc domain or a portion thereof sufficient to bind CD 16, or an antigen-binding site that binds CD 16.
• the multispecific proteins contains an additional antigen-binding site that binds BAFF-R, as exemplified in the F4- TriNKET format e.g., FIGs. 2C and 2D).
• the multispecific proteins display similar thermal stability to the corresponding monoclonal antibody, i.e., a monoclonal antibody containing the same BAFF- R binding site as the one incorporated in the multispecific proteins.
• the multispecific proteins simultaneously bind to cells expressing NKG2D and/or CD16, such as NK cells, and cells expressing BAFF-R, such as certain tumor cells. Binding of the multispecific proteins to NK cells can enhance the activity of the NK cells toward destruction of the BAFF-R expressing cells (e.g., BAFF-R expressing tumor cells). It has been reported that NK cells exhibit more potent cytotoxicity against target cells that are stressed (see Chan et al., (2014) Cell Death Differ. 21(1):5-14).
• NK cells when NK cells are engaged to a population of cells by a TriNKET, the NK cells may selectively kill the target cells that are stressed (e.g., malignant cells and cells in a tumor microenvironment). This mechanism could contribute to increased specificity and reduced toxicity of TriNKETs, making it possible to selectively clear the stressed cells even if expression of BAFF-R is not limited to the desired target cells.
• stressed e.g., malignant cells and cells in a tumor microenvironment
• the multispecific proteins bind to BAFF-R with a similar affinity to the corresponding the anti-BAFF-R monoclonal antibody (i.e., a monoclonal antibody containing the same BAFF-R binding site as the one incorporated in the multispecific proteins). In some embodiments, the multispecific proteins are more effective in killing the tumor cells expressing BAFF-R than the corresponding monoclonal antibodies.
• the multispecific proteins described herein which include a binding site for BAFF-R, activate primary human NK cells when co-culturing with cells expressing BAFF-R. NK cell activation is marked by the increase in CD107a degranulation and IFN-y cytokine production. Furthermore, compared to a corresponding anti-BAFF-R monoclonal antibody, the multispecific proteins can show superior activation of human NK cells in the presence of cells expressing BAFF-R.
• the multispecific proteins described herein which include a binding site for BAFF-R, enhance the activity of rested and IL-2-activated human NK cells when co-culturing with cells expressing BAFF-R.
• the multispecific proteins offer an advantage in targeting tumor cells that express medium and low levels of BAFF-R.
• the bivalent F4 format of the TriNKETs i.e., TriNKETs include an additional antigen-binding site that binds to BAFF-R) improve the avidity with which the TriNKETs bind to BAFF-R, which in effect stabilizes expression and maintenance of high levels of BAFF-R on the surface of the tumor cells.
• the F4-TriNKETs mediate more potent killing of tumor cells than the corresponding F3-TriNKETs or F3’- TriNKETs.
• the present application also describes methods for treating autoimmune disease or cancer using a multispecific binding protein described herein and/or a pharmaceutical composition described herein.
• the methods may be used to treat a variety of cancers or autoimmune diseases expressing BAFF-R.
• the therapeutic method can be characterized according to the cancer to be treated.
• the cancer to be treated can be characterized according to the presence of a particular antigen expressed on the surface of the cancer cell, e.g., BAFF-R.
• B-cell non-Hodgkin’s lymphoma such as chronic lymphocytic leukemia (CLL), mantle cell lymphoma (MCL), follicular lymphoma (FL), diffuse large B-cell lymphoma (DLBCL), marginal zone lymphoma, mucosa-associated lymphoid tissue (MALT) lymphoma, primary mediastinal B-cell lymphoma, acute lymphocytic leukemia (ALL); and autoimmune inflammatory diseases.
• CLL chronic lymphocytic leukemia
• MCL mantle cell lymphoma
• FL follicular lymphoma
• DLBCL diffuse large B-cell lymphoma
• MALT mucosa-associated lymphoid tissue lymphoma
• ALL acute lymphocytic leukemia
• ALL acute lymphocytic leukemia
• the protein, conjugate, cells, and/or pharmaceutical compositions described in the present disclosure can be used to treat a variety of cancers, not limited to cancers in which the cancer cells or the cells in the cancer microenvironment express BAFF-R.
• the cancer is a solid tumor.
• the cancer is brain cancer, bladder cancer, breast cancer, cervical cancer, colon cancer, colorectal cancer, endometrial cancer, esophageal cancer, leukemia, lung cancer, liver cancer, melanoma, ovarian cancer, pancreatic cancer, prostate cancer, rectal cancer, renal cancer, stomach cancer, testicular cancer, or uterine cancer.
• the cancer is a vascularized tumor, squamous cell carcinoma, adenocarcinoma, small cell carcinoma, melanoma, glioma, neuroblastoma, sarcoma e.g., an angiosarcoma or chondrosarcoma), larynx cancer, parotid cancer, biliary tract cancer, thyroid cancer, acral lentiginous melanoma, actinic keratoses, acute lymphocytic leukemia, acute myeloid leukemia, adenoid cystic carcinoma, adenomas, adenosarcoma, adenosquamous carcinoma, anal canal cancer, anal cancer, anorectum cancer, astrocytic tumor, Bartholin gland carcinoma, basal cell carcinoma, biliary cancer, bone cancer, bone marrow cancer, bronchial cancer, bronchial gland carcinoma, carcinoid, cholangiocarcinoma,
• the cancer is a hematologic malignancy.
• the hematologic malignancy is leukemia.
• leukemia selected from the group consisting of acute myeloid leukemia (AML), acute lymphoblastic leukemia (ALL), myelodysplasia, myelodysplastic syndromes, acute T-lymphoblastic leukemia, or acute promyelocytic leukemia, chronic myelomonocytic leukemia, or myeloid blast crisis of chronic myeloid leukemia.
• the present application provides methods for treating an autoimmune inflammatory disease using a multispecific binding protein described herein and/or a pharmaceutical composition described herein.
• the methods may be used to treat a variety of BAFF-R-expressing B cell-associated autoimmune inflammatory diseases, including, without limitation, multiple sclerosis, systemic lupus erythematosus, Graves’ disease, Hashimoto’s thyroiditis, rheumatoid arthritis, inflammatory bowel disease, type I diabetes, Guillain-Barre syndrome, chronic inflammatory demyelinating polyneuropathy, psoriasis, myasthenia gravis, and vasculitis.
• a multispecific binding protein described herein can be used in combination with additional therapeutic agents to treat autoimmune disease or to treat cancer.
• exemplary therapeutic agents that may be used as part of a combination therapy in treating autoimmune inflammatory diseases are described in Li et al. (2017) Front. Pharmacol., 8:460, and include, for example, non-steroidal anti-inflammatory drugs (NSAIDs) (e.g., COX-2 inhibitors), glucocorticoids (e.g., prednisone/prednisolone, methylprednisolone, and the fluorinated glucocorticoids such as dexamethasone and betamethasone), disease-modifying antirheumatic drugs (DMARDs) (e.g., methotrexate, leflunomide, gold compounds, sulfasalazine, azathioprine, cyclophosphamide, antimalarials, D-penicillamine, and cyclosporine), anti-TNF biologies (e.g., infliximab, etanercept, adalimuma
• Exemplary therapeutic agents that may be used as part of a combination therapy in treating cancer include, for example, radiation, mitomycin, tretinoin, ribomustin, gemcitabine, vincristine, etoposide, cladribine, mitobronitol, methotrexate, doxorubicin, carboquone, pentostatin, nitracrine, zinostatin, cetrorelix, letrozole, raltitrexed, daunorubicin, fadrozole, fotemustine, thymalfasin, sobuzoxane, nedaplatin, cytarabine, bicalutamide, vinorelbine, vesnarinone, aminoglutethimide, amsacrine, proglumide, elliptinium acetate, ketanserin, doxifluridine, etretinate, isotretinoin, str
• An additional class of agents that may be used as part of a combination therapy in treating cancer is immune checkpoint inhibitors.
• exemplary immune checkpoint inhibitors include agents that inhibit one or more of (i) cytotoxic T lymphocyte-associated antigen 4 (CTLA4), (ii) programmed cell death protein 1 (PD1), (iii) PDL1, (iv) LAG3, (v) B7-H3, (vi) B7-H4, and (vii) TIM3.
• CTLA4 inhibitor ipilimumab has been approved by the United States Food and Drug Administration for treating melanoma.
• agents that may be used as part of a combination therapy in treating cancer are monoclonal antibody agents that target non-checkpoint targets (e.g., herceptin) and non-cytotoxic agents e.g., tyrosine-kinase inhibitors).
• non-checkpoint targets e.g., herceptin
• non-cytotoxic agents e.g., tyrosine-kinase inhibitors
• anti-cancer agents include, for example: (i) an inhibitor selected from an ALK Inhibitor, an ATR Inhibitor, an A2A Antagonist, a Base Excision Repair Inhibitor, a Bcr-Abl Tyrosine Kinase Inhibitor, a Bruton's Tyrosine Kinase Inhibitor, a CDC7 Inhibitor, a CHK1 Inhibitor, a Cyclin-Dependent Kinase Inhibitor, a DNA-PK Inhibitor, an Inhibitor of both DNA-PK and mTOR, a DNMT1 Inhibitor, a DNMT1 Inhibitor plus 2-chloro- deoxyadenosine, an HD AC Inhibitor, a Hedgehog Signaling Pathway Inhibitor, an IDO Inhibitor, a JAK Inhibitor, a mTOR Inhibitor, a MEK Inhibitor
• Proteins of the present application can also be used as an adjunct to surgical removal of the primary lesion.
• the amount of multispecific binding protein and additional therapeutic agent, and the relative timing of administration may be selected in order to achieve a desired combined therapeutic effect.
• the therapeutic agents in the combination, or a pharmaceutical composition or compositions comprising the therapeutic agents may be administered in any order such as, for example, sequentially, concurrently, together, simultaneously and the like.
• a multispecific binding protein may be administered during a time when the additional therapeutic agent(s) exerts its prophylactic or therapeutic effect, or vice versa.
• compositions that contain a therapeutically effective amount of a protein described herein.
• the composition can be formulated for use in a variety of drug delivery systems.
• One or more physiologically acceptable excipients or carriers can also be included in the composition for proper formulation.
• Suitable formulations for use in the present disclosure are found in Remington's Pharmaceutical Sciences, Mack Publishing Company, Philadelphia, Pa., 17th ed., 1985.
• Langer Science 249: 1527-1533, 1990).
• the intravenous drug delivery formulation described in the present application may be contained in a bag, a pen, or a syringe.
• the bag may be connected to a channel comprising a tube and/or a needle.
• the formulation may be a lyophilized formulation or a liquid formulation.
• the formulation may be freeze-dried (lyophilized) and contained in about 12-60 vials.
• the formulation may be freeze-dried and 45 mg of the freeze-dried formulation may be contained in one vial.
• the about 40 mg to about 100 mg of freeze-dried formulation may be contained in one vial.
• freeze-dried formulation from 12, 27, or 45 vials are combined to obtain a therapeutic dose of the protein in the intravenous drug formulation.
• the formulation may be a liquid formulation and stored as about 250 mg/vial to about 1000 mg/vial. In certain embodiments, the formulation may be a liquid formulation and stored as about 600 mg/vial. In certain embodiments, the formulation may be a liquid formulation and stored as about 250 mg/vial.
• the protein could exist in a liquid aqueous pharmaceutical formulation including a therapeutically effective amount of the protein in a buffered solution forming a formulation.
• compositions may be sterilized by conventional sterilization techniques, or may be sterile filtered.
• the resulting aqueous solutions may be packaged for use as-is, or lyophilized, the lyophilized preparation being combined with a sterile aqueous carrier prior to administration.
• the pH of the preparations typically will be between 3 and 11, for example between 5 and 9 or between 6 and 8, and in certain embodiments, between 7 and 8, such as 7 to 7.5.
• the resulting compositions in solid form may be packaged in multiple single dose units, each containing a fixed amount of the above-mentioned agent or agents.
• the composition in solid form can also be packaged in a container for a flexible quantity.
• the present application describes a formulation with an extended shelf life including a multispecific binding protein as described herein, in combination with mannitol, citric acid monohydrate, sodium citrate, disodium phosphate dihydrate, sodium dihydrogen phosphate dihydrate, sodium chloride, polysorbate 80, water, and sodium hydroxide.
• an aqueous formulation is prepared including a protein of the present disclosure in a pH-buffered solution.
• the buffer of the formulation may have a pH ranging from about 4 to about 8, e.g., from about 4.5 to about 6.0, or from about 4.8 to about 5.5, or may have a pH of about 5.0 to about 5.2.
• Ranges intermediate to the above recited pH's are also intended to be part of this disclosure. For example, ranges of values using a combination of any of the above recited values as upper and/or lower limits are intended to be included.
• the formulation includes a buffer system which contains citrate and phosphate to maintain the pH in a range of about 4 to about 8.
• the pH range may be from about 4.5 to about 6.0, or from about pH 4.8 to about 5.5, or in a pH range of about 5.0 to about 5.2.
• the buffer system includes citric acid monohydrate, sodium citrate, di sodium phosphate dihydrate, and/or sodium dihydrogen phosphate dihydrate.
• the buffer system includes about 1.3 mg/mL of citric acid (e.g., 1.305 mg/mL), about 0.3 mg/mL of sodium citrate (e.g., 0.305 mg/mL), about 1.5 mg/mL of disodium phosphate dihydrate (e.g., 1.53 mg/mL), about 0.9 mg/mL of sodium dihydrogen phosphate dihydrate (e.g., 0.86 mg/mL), and about 6.2 mg/mL of sodium chloride (e.g., 6.165 mg/mL).
• citric acid e.g., 1.305 mg/mL
• sodium citrate e.g. 0.305 mg/mL
• 1.5 mg/mL of disodium phosphate dihydrate e.g., 1.53 mg/mL
• about 0.9 mg/mL of sodium dihydrogen phosphate dihydrate e.g., 0.86 mg/mL
• sodium chloride e.g., 6.165 mg/mL
• the buffer system includes about 1 to about 1.5 mg/mL of citric acid, about 0.25 to about 0.5 mg/mL of sodium citrate, about 1.25 to about 1.75 mg/mL of disodium phosphate dihydrate, about 0.7 to about 1.1 mg/mL of sodium dihydrogen phosphate dihydrate, and about 6.0 to about 6.4 mg/mL of sodium chloride.
• the pH of the formulation is adjusted with sodium hydroxide.
• a polyol which acts as a tonicifier and may stabilize the antibody, may also be included in the formulation.
• the polyol is added to the formulation in an amount which may vary with respect to the desired isotonicity of the formulation.
• the aqueous formulation may be isotonic.
• the amount of polyol added may also be altered with respect to the molecular weight of the polyol. For example, a lower amount of a monosaccharide (e.g., mannitol) may be added, compared to a disaccharide (such as trehalose).
• the polyol which may be used in the formulation as a tonicity agent is mannitol.
• the mannitol concentration may be about 5 to about 20 mg/mL. In certain embodiments, the concentration of mannitol may be about 7.5 to about 15 mg/mL. In certain embodiments, the concentration of mannitol may be about 10 to about 14 mg/mL. In certain embodiments, the concentration of mannitol may be about 12 mg/mL. In certain embodiments, the polyol sorbitol may be included in the formulation.
• a detergent or surfactant may also be added to the formulation.
• exemplary detergents include nonionic detergents such as polysorbates (e.g., polysorbates 20, 80 etc.) or pol oxamers (e.g., pol oxamer 188).
• the amount of detergent added is such that it reduces aggregation of the formulated antibody and/or minimizes the formation of particulates in the formulation and/or reduces adsorption.
• the formulation may include a surfactant which is a polysorbate.
• the formulation may contain the detergent polysorbate 80 or Tween 80.
• Tween 80 is a term used to describe polyoxyethylene (20) sorbitanmonooleate (see Fiedler, Lexikon der Hifsstoffe, Editio Cantor Verlag Aulendorf, 4th ed., 1996).
• the formulation may contain between about 0.1 mg/mL and about 10 mg/mL of polysorbate 80, or between about 0.5 mg/mL and about 5 mg/mL. In certain embodiments, about 0.1% polysorbate 80 may be added in the formulation.
• a multispecific binding protein as described in the present application is formulated as a liquid formulation.
• the liquid formulation may be presented at a 10 mg/mL concentration in either a USP / Ph Eur type I 50R vial closed with a rubber stopper and sealed with an aluminum crimp seal closure.
• the stopper may be made of elastomer complying with USP and Ph Eur.
• vials may be filled with 61.2 mL of the protein product solution in order to allow an extractable volume of 60 mL.
• the liquid formulation may be diluted with 0.9% saline solution.
• the liquid formulation as described in this application may be prepared as a 10 mg/mL concentration solution in combination with a sugar at stabilizing levels.
• the liquid formulation may be prepared in an aqueous carrier.
• a stabilizer may be added in an amount no greater than that which may result in a viscosity undesirable or unsuitable for intravenous administration.
• the sugar may be a disaccharide, e.g., sucrose.
• the liquid formulation may also include one or more of a buffering agent, a surfactant, and a preservative.
• the pH of the liquid formulation may be set by addition of a pharmaceutically acceptable acid and/or base.
• the pharmaceutically acceptable acid may be hydrochloric acid.
• the base may be sodium hydroxide.
• deamidation is a common product variant of peptides and proteins that may occur during fermentation, harvest/cell clarification, purification, drug substance/drug product storage and during sample analysis.
• Deamidation is the loss of NH3 from a protein forming a succinimide intermediate that can undergo hydrolysis.
• the succinimide intermediate results in a 17 dalton mass decrease of the parent peptide.
• the subsequent hydrolysis results in an 18 dalton mass increase.
• Isolation of the succinimide intermediate is difficult due to instability under aqueous conditions. As such, deamidation is typically detectable as 1 dalton mass increase. Deamidation of an asparagine results in either aspartic or isoaspartic acid.
• the parameters affecting the rate of deamidation include pH, temperature, solvent dielectric constant, ionic strength, primary sequence, local polypeptide conformation and tertiary structure.
• the amino acid residues adjacent to Asn in the peptide chain affect deamidation rates. Gly and Ser following an Asn in protein sequences results in a higher susceptibility to deamidation.
• the liquid formulation as described in this application may be preserved under conditions of pH and humidity to prevent deamination of the protein product.
• the aqueous carrier of interest herein is one which is pharmaceutically acceptable (safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation.
• Illustrative carriers include sterile water for injection (SWFI), bacteriostatic water for injection (BWFI), a pH buffered solution (e.g., phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
• a preservative may be optionally added to the formulations described herein to reduce bacterial action.
• the addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation.
• Intravenous (IV) formulations may be an administration route in particular instances, such as when a patient is in the hospital after transplantation receiving all drugs via the IV route.
• the liquid formulation is diluted with 0.9% Sodium Chloride solution before administration.
• the diluted drug product for injection is isotonic and suitable for administration by intravenous infusion.
• a salt or buffer components may be added in an amount of 10 mM - 200 mM.
• the salts and/or buffers are pharmaceutically acceptable and are derived from various known acids (inorganic and organic) with “base forming” metals or amines.
• the buffer may be phosphate buffer.
• the buffer may be glycinate, carbonate, citrate buffers, in which case, sodium, potassium or ammonium ions can serve as counterion.
• a multispecific binding protein as described in the present application could exist in a lyophilized formulation including the proteins and a lyoprotectant.
• the lyoprotectant may be a sugar, e.g., a disaccharide.
• the lyoprotectant may be sucrose or maltose.
• the lyophilized formulation may also include one or more of a buffering agent, a surfactant, a bulking agent, and/or a preservative.
• the amount of sucrose or maltose useful for stabilization of the lyophilized drug product may be in a weight ratio of at least 1 :2 protein to sucrose or maltose.
• the protein to sucrose or maltose weight ratio may be of from 1 :2 to 1 :5.
• the pH of the formulation, prior to lyophilization may be set by addition of a pharmaceutically acceptable acid and/or base.
• the pharmaceutically acceptable acid may be hydrochloric acid.
• the pharmaceutically acceptable base may be sodium hydroxide.
• the pH of the solution containing a protein of the present disclosure may be adjusted between 6 to 8.
• the pH range for the lyophilized drug product may be from 7 to 8.
• a salt or buffer components may be added in an amount of 10 mM - 200 mM.
• the salts and/or buffers are pharmaceutically acceptable and are derived from various known acids (inorganic and organic) with “base forming” metals or amines.
• the buffer may be phosphate buffer.
• the buffer may be glycinate, carbonate, citrate buffers, in which case, sodium, potassium or ammonium ions can serve as counterion.
• a “bulking agent” may be added.
• a “bulking agent” is a compound which adds mass to a lyophilized mixture and contributes to the physical structure of the lyophilized cake (e.g., facilitates the production of an essentially uniform lyophilized cake which maintains an open pore structure).
• Illustrative bulking agents include mannitol, glycine, polyethylene glycol and sorbitol.
• the lyophilized formulations of the multispecific binding proteins described in the present application may contain such bulking agents.
• a preservative may be optionally added to the formulations herein to reduce bacterial action.
• the addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation.
• the lyophilized drug product may be constituted with an aqueous carrier.
• the aqueous carrier of interest herein is one which is pharmaceutically acceptable (e.g., safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation, after lyophilization.
• Illustrative diluents include sterile water for injection (SWFI), bacteriostatic water for injection (BWFI), a pH buffered solution (e.g., phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
• the lyophilized drug product is reconstituted with either Sterile Water for Injection, USP (SWFI) or 0.9% Sodium Chloride Injection, USP.
• SWFI Sterile Water for Injection
• USP 0.9% Sodium Chloride Injection
• the lyophilized protein product is constituted to about 4.5 mL water for injection and diluted with 0.9% saline solution (sodium chloride solution).
• the specific dose can be a uniform dose for each patient, for example, 50-5000 mg of protein.
• a patient’s dose can be tailored to the approximate body weight or surface area of the patient.
• Other factors in determining the appropriate dosage can include the disease or condition to be treated or prevented, the severity of the disease, the route of administration, and the age, sex and medical condition of the patient. Further refinement of the calculations necessary to determine the appropriate dosage for treatment is routinely made by those skilled in the art, especially in light of the dosage information and assays disclosed herein.
• the dosage can also be determined through the use of known assays for determining dosages used in conjunction with appropriate dose-response data. An individual patient's dosage can be adjusted as the progress of the disease is monitored.
• Blood levels of the targetable construct or complex in a patient can be measured to see if the dosage needs to be adjusted to reach or maintain an effective concentration.
• Pharmacogenomics may be used to determine which targetable constructs and/or complexes, and dosages thereof, are most likely to be effective for a given individual (Schmitz et al., Clinica Chimica Acta 308: 43-53, 2001; Steimer el al., Clinica Chimica Acta 308: 33-41, 2001).
• dosages based on body weight are from about 0.01 pg to about 100 mg per kg of body weight, such as about 0.01 pg to about 100 mg/kg of body weight, about 0.01 pg to about 50 mg/kg of body weight, about 0.01 pg to about 10 mg/kg of body weight, about 0.01 pg to about 1 mg/kg of body weight, about 0.01 pg to about 100 pg/kg of body weight, about 0.01 pg to about 50 pg/kg of body weight, about 0.01 pg to about 10 pg/kg of body weight, about 0.01 gg to about 1 gg/kg of body weight, about 0.01 gg to about 0.1 gg/kg of body weight, about 0.1 gg to about 100 mg/kg of body weight, about 0.1 gg to about 50 mg/kg of body weight, about 0.1 gg to about 10 mg/kg of body weight, about 0.1 gg to about 1 mg/kg of body weight, about 0.1 gg to about 100 mg/kg of body weight, about
• Doses may be given once or more times daily, weekly, monthly or yearly, or even once every 2 to 20 years. Persons of ordinary skill in the art can easily estimate repetition rates for dosing based on measured residence times and concentrations of the targetable construct or complex in bodily fluids or tissues.
• Administration of the multispecific binding proteins described in the present application could be intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, intrapleural, intrathecal, intracavitary, by perfusion through a catheter or by direct intralesional injection. This may be administered once or more times daily, once or more times weekly, once or more times monthly, and once or more times annually.
• the BAFF-R positive human B lymphoblastoid RAJI cell line was used to assess TriNKET binding to cell surface BAFF-R.
• Certain BAFF-R TriNKETs in the 2-Fab and F3’ formats, as described in the “exemplary multispecific binding proteins” subsection above, were diluted and incubated with Raji cells. Binding patterns of TriNKETs and parental monoclonal antibodies were detected using a fluorophore conjugated anti-human IgG secondary antibody. The cells were then incubated with a fluorophore conjugated anti-human IgG secondary antibody and were analyzed by flow cytometry. The mean fluorescence intensity (MFI) values were normalized to secondary antibody only controls to obtain fold over background (FOB) values.
• MFI mean fluorescence intensity
• BAFF-R TriNKETs containing a BAFF-R binding site derived from hCOH-2 (FIG. 18A), Hu9.1-73 (FIG. 18B), and ianalumab-based antigen-binding site (the three versions, F3’, 2-Fab, and ianalumab-mAb, do not contain antibody-dependent cellular cytotoxicity-enhancing mutations present in the commercial ianalumab antibody) (FIG. 18C) bind with subnanomolar concentration and with similar or higher maximum MFI than the corresponding parental control antibodies, which does not contain ADCC-enhancing mutations used in ianalumab.
• the ECso values of these TriNKETs binding BAFF-R are shown in Table 11. Similar results were obtained with a second BAFF-R positive cell line, Ramos (data not shown).
• the ianalumab constructs do not include antibody-dependent cellular cytotoxicity-enhancing mutations present in the commercial ianalumab antibody.
• NK cells were isolated from human peripheral blood buffy coats using density gradient centrifugation, washed, and prepared for NK cell isolation.
• NK cells were isolated using a negative selection technique with magnetic beads. Purity of isolated NK cells was typically >90% CD3'CD56 + .
• Isolated NK cells were rested overnight and harvested from culture. The cells were then washed and resuspended at concentrations of 10 5 -2.0xl0 6 /mL in culture media for an effector-to-target (E:T) ratio of 5: 1.
• E:T effector-to-target
• 50 pl of NK cells were added to each well of the plate for a total of 200 pl culture volume. The plate was incubated at 37 °C with 5% CO2 for 2-3 hours.
• the plate was removed from the incubator and the cells were pelleted by centrifugation at 200x g for 5 minutes. 20 pl of culture supernatant were transferred to a clean microplate and 200 pl of room temperature europium solution (Perkin Elmer C135- 100) were added to each well. The plate was protected from light and incubated on a plate shaker at 250 rpm for 15 minutes, then read using SpectraMax i3X instruments.
• FIG. 19A-FIG. 19C show NK cell-mediated lysis of BAFF-R-positive RAJI cells by primary NK cells in the presence of BAFF-R-targeting TriNKETs derived from hCOH-2 (FIG. 19A), Genentech Hu9.1-73 (FIG. 19B), and ianalumab-based antigen-binding site (the three versions, F3’, 2-Fab, and ianalumab-mAb, do not contain antibody-dependent cellular cytotoxicity-enhancing mutations present in the commercial ianalumab antibody) (FIG. 19C).
• Parental BAFF-R targeted monoclonal antibodies showed little enhancement of NK cell mediated lysis of RAJI target cells.
• an NK cell line KHYG-l-CD16aV was engineered to stably express CD16aV and NKG2D, and the assay was conducted as described above. Cytotoxicity was measured for TriNKETs and parental mAbs derived from hCOH-2 (FIG. 20A), Hu9.1-73 (FIG. 20B) and ianalumab-based antigen-binding site (the three versions, F3’, 2-Fab, and ianalumab-mAb, do not contain antibody-dependent cellular cytotoxicityenhancing mutations present in the commercial ianalumab antibody) (FIG. 20C).
• BAFF-R-specific antibodies were generated by immunizing four different strains of mice (H2L2, NZBW, BALB-C, and SJL/J) with hBAFF-R-hFc-His fusion protein. Based on antisera titers, a total of seven mice from across the four different strains were selected for hybridoma fusion. Splenocytes from a subset of mice from each immunization arm were reserved for immune library generation; however, only splenocytes from H2L2 mice were used for yeast display mAb discovery.
• mice fusions from five mice fusions (splenocytes from two mice were pooled for H2L2 fusion and splenocytes from two mice were pooled for SJL/J fusion), sixteen 96-well plates per hybridoma fusion were analyzed by specificity ELISA, in which binding to human and cynomolgus monkey BAFF-R-hFc-His and binding to irrelevant-hFc-His protein was compared. Supernatants from 33 BAFF-R positive and specific hybridomas were selected for further analysis. Supernatants were tested for binding to BAFF-R+ isogenic CHO cells, and 16 positive hybridomas were further subcloned.
• mice DNA immunization of two groups of SWR/J mice each was performed. One group was immunized with a full-length human BAFF-R cDNA construct, and the other with a mixture of full-length human BAFF-R and human BAFF-R extracellular domain cDNA constructs. Based on antisera titers, mice were pooled, and subsequently selected for single B cell sorting and another pool used for hybridoma fusion.
• Yeast display was used to build scFv libraries from the splenocytes obtained from humanized H2L2 mice immunized with recombinant human hBAFF-R-hFc-His protein as described above. Three rounds of selection were carried out with biotinylated hBAFF-R-hFc- His at 5 nM. Individual yeast colonies were picked, sequenced, and sequences analyzed. Sequence convergence indicated the selection process was successful in enriching for binders and was therefore complete. Unique sequences were selected for further characterization. Three BAFF-R specific scFvs were discovered from one library (Table 14). However, these sequences were very similar to each other, and therefore only sequence 1129 A01 (also referred to as AB0369scFv) was selected for further study.
• Flow cytometry was used to assess specificity of binding of AB0369scFv to hBAFF-R-hFc-His, hBAFF-R-GST-His, and negative control proteins with hFc tag or GST tag while displayed on yeast.
• AB0369scFv demonstrated medium to weak affinity towards hBAFF- R; however, it did not show binding to the negative control, thus suggesting high specificity for BAFF-R (FIG. 23).
• 1129 A01 (AB0369 scFv) was converted into a multispecific binding protein comprising the scFv, and two non-BAFF-R binders, to yield AB0369.
• AB0369 was further analyzed for its abilities to bind to human (hBAFF-R-CHO) and cynomolgus monkey (cBAFF- R-CHO) BAFF-R + cells (FIG. 24A, FIG. 24B), lack non-specific interactions by polyspecificity reagent (PSR) assay (FIG. 25A-FIG. 25G), lyse BAFF-R + Ramos cancer cells (FIG. 26 and Table 15) and block BAFF-BAFF-R interactions (FIG. 27).
• AB0369 bound to both human and cynomolgus monkey BAFF-R on the surface of isogenic CHO cells, and BAFF-R binding was with ECso about 10 nM, making it a good choice for further development.
• AB0369 The ability of AB0369 to block BAFF-R-BAFF interactions was tested in a cellbased blocking assay. Briefly, CHO cells expressing human BAFF-R were harvested, washed in cold FACS buffer, and seeded at a density of 100,000 cells per well. Test articles were diluted in FACS buffer, and 50 pL of diluted multispecific binding protein or mAb was added to cells, incubated on ice for 60 minutes, then washed with FACS buffer. 12 nM BAFF-biotin was diluted into FACS buffer, and 100 pL was added per well, incubated for 60 minutes on ice, then washed with FACS buffer.
• AB0369 demonstrated specific binding to BAFF-R expressing cells.
• a yeast display affinity maturation library was created by mutating the CDRH3 residue (RFTMLRGLIIEDYGMDV (SEQ ID NO:216)) of AB0369.
• RFTMLRGLIIEDYGMDV SEQ ID NO:216
• two rounds of selection were carried out with biotinylated hBAFF-R-hFc-His at 1 nM (FIG. 28A- FIG. 28D).
• the affinities between the parental clone AB0369 and representative individual library clones were compared.
• the scFvs with highest hBAFF-R binding affinity were converted into multispecific binding proteins comprising the scFv and two non-BAFF-R binders, expressed in Expi293 cells, and further analyzed for their ability to bind to BAFF-R expressing cells (FIG. 10A) and ability to lyse BAFF-R expressing Ramos cancer cells (FIG. 30B, FIG. 30C). All multispecific binding proteins scored negatively in a poly-specificity assay, suggesting that the improved binding affinity was BAFF-R specific (FIG. 31A-FIG. 31E).
• Table 17 Summary of cell binding and cytolysis demonstrated by multispecific binding proteins based on HCDR3 affinity matured variants compared to parental AB0369.
• CDRH1 and CDRH2 sequences were selected for affinity maturation (CDRH1 : GFTFSSY (SEQ ID NO:214) and CDRH2: WYDGSN (SEQ ID NO:215)) using the matured CDRH3 backbone.
• the goal was to engineer and select binders with improved affinity over the parental clone (AB0369 scFv) or the CDRH3 optimized variants described above. This created a library with a randomized CDRH1 and CDRH2 while retaining an optimized CDRH3.
• RFTMLRGQYIEDYGMDV (SEQ ID NO:223)); RFTMLRGWIIEDYGMDV(SEQ ID NO:225)) on the optimized CDRH3 backbone showed a significant improvement in hBAFF-R affinity compared to parental AB0369scFv (1129 A01) (FIG. 33A-FIG. 33D) or to an ianalumab-based scFv benchmark control (the scFv includes a VH and a VL that are based on the VH and VL sequences of ianalumab , but does not contain ADCC-enhancing mutations used in the parent antibody.) (FIG. 33E).
• the scFvs with the highest hBAFF-R binding affinities were converted into multispecific binding proteins comprising the scFv and two non-BAFF-R binders, expressed in Expi293 cells, and further analyzed for their ability to bind to human BAFF-R expressing cells (FIG. 34 A), to bind to cynomolgus BAFF-R + cells (FIG. 34B), and to inhibit BAFF-R-BAFF interactions (FIG. 34C and Table 18).
• Tested multispecific binding proteins showed improvement in all three of these criteria and demonstrated efficient killing of BAFF-R + BJAB cells in a KHYG-l-CD16a-mediated cytotoxicity assay (FIG. 35, Table 19).
• affinity-matured clones contained amino acids in their CDRs that could negatively impact protein expression, stability, or immunogenicity
• additional libraries were constructed to select for clones without these amino acids.
• Three rounds of selection were performed with 1 nM biotinylated hBAFF-R-hFc-His protein leading to enrichment of high affinity binders (FIG. 36A-FIG. 36D).
• 23 binders were identified altogether, 12 of which were predicted to be free of undesirable amino acids (“liability-corrected”).
• Preferred clones from these libraries included AB0898, (the liability-corrected version of AB0682 described above), AB0899, and AB0900, which were successfully identified and tested for their binding to hBAFF-R while displayed on yeast. All clones showed higher affinity towards hBAFF-R than the parent, AB0369scFv (FIG. 37A-FIG. 37F).
• Table 20 Summary of characterization of multispecific binding proteins expressing sequence liability corrected BAFF-R binders.
• CDRH1 and CDRH2 sequences (CDRH1 : GFTFSSY (SEQ ID NO:214) and CDRH2: WYDGSN (SEQ ID NO:215)) were affinity matured into the liability-corrected CDRH3 backbone, and off-rate pressure was applied to select high affinity clones.
• clones were preincubated with biotinylated hBAFF-R-hFc-His at 100 pM concentration, and then challenged with 1 pM non-biotinylated hBAFF-R-hFc-His for 2 hours.
• Yeast displaying anti- BAFF-R scFvs that remained bound to biotinylated hBAFF-R-hFc-His were sorted and the process was repeated three times to enrich for high affinity binders with slower off-rate. As shown in FIG.
• ianalumab-based benchmark scFv exhibited loss of binding to biotinylated hBAFF-R- hFc-His after the challenge (FIG. 41A and FIG. 41B).
• Several of the clones were eliminated from further consideration because they contained additional undesirable amino acids or properties. Sequences of selected clones from the above studies are shown in Table 21.
• Selected clones from the off-rate challenge studies described above were produced as multispecific binding proteins comprising an scFv of the respective binders and two non- BAFF-R binders, expressed in Expi293 cells, and characterized by binding to hBAFF-R expressing cells and cynomolgus BAFF-R expressing cells, ability to lyse BAFF-R expressing cancer cells in a KHYG-l-CD16aV-mediated cytotoxicity assay, ability to block BAFF-BAFF-R interactions, thermostability (differential scanning fluorimetry, DSF) and hydrophobicity (HIC) (results are summarized in Table 22).
• Binding affinity of AB 1080, AB 1081, and AB 1085 to BAFF-R + cells was improved as compared to the parental clones (FIG. 42A and FIG. 42B as compared to Table 20). Additionally, binding affinity to cynoBAFF-R was similar to binding affinity to hBAFF-R (FIG. 42A and FIG. 42B). Lack of polyspecificity was confirmed by a PSR assay (FIG. 43A-FIG. 431). AB 1084 was removed from further study due to long retention time on HIC and subsequent potential for higher aggregation propensity. Improved multispecific binding proteins demonstrated vastly higher potency than the multispecific binding protein based on the ianalumab sequence (FIG. 44A and FIG. 44B).
• thermostability as compared to controls adalimumab (Humira) and pembrolizumab (Keytruda) (FIG. 46).
• HIC chromatograms revealed that AB 1080 and AB 1081 had retention times of 11.4 and 11.5 min, respectively.
• AB 1085 demonstrated a retention time of 9.5 minutes, which is at the lower edge among approved and late-stage therapeutic antibodies, suggesting very favorable hydrophobic behavior (FIG. 46A-FIG. 46D).
• AB1080 and AB1081 showed improved binding to BAFF-R and did not contain any sequence liabilities in the CDR sequences, however, their hydrophobicity was high compared to a panel of benchmarked therapeutic antibodies.
• AB 1085 demonstrated desired hydrophobicity and affinity, but contained potential sequence liabilities in the CDRH2 and CDRH3 sequences (FIG. 47). Sequences of AB1080, AB1081, and AB1085 were compared, and the AB1080 sequence was analyzed and further corrected, with a hydrophobicity reducing mutation W to Q generated (CDRH3: RFTMLRGWYIEDYGMDV (SEQ ID NO:224) to RFTMLRGQYIEDYGMDV (SEQ ID NO:223)).
• the resulting AB1424/AB1612 multispecific binding protein demonstrated favorable low hydrophobicity that falls within the range of well- behaved biologies (FIG. 48) while maintaining the same high affinity for BAFF-R (Table 23, FIG. 49A and FIG. 49B), potent BAFF-R-BAFF binding blocking (FIG. 50), and comprising a liability-free sequence that is characteristic for parental AB1080 (Table 24).
• AB1424/AB1612 F3’ TriNKET is an F3’ format TriNKET as described above, comprising three polypeptides (anti-BAFF-R scFv-CH2-CH3 “Chain S,” SEQ ID NO:270; anti- NKG2D VH-CH1-CH2-CH3, “Chain H,” SEQ ID NO: 194; and anti-NKG2D VL-CL, “Chain L,” SEQ ID NO: 195).
• the primary sequence of AB1424/AB1612 F3’ TRINKET was evaluated for the presence of putative sequence liabilities in the CDRs, such as N-linked glycosylation sites, Cys residues, sites of potential deamidation (Asn), oxidation (Met and Trp), isomerization (Asp), and chemically labile bonds (DP). These modifications can impact product efficacy, safety, stability, consistency, or manufacturability.
• BAFF-R binding Chain S does not contain any predicted sequence liabilities.
• NKG2D binding Chain L does not contain any predicted sequence liabilities.
• NKG2D binding Chain H contains a potential sequence liability that may be prone to truncation in CDRH3. Confirmatory testing demonstrated that AB 1424/ AB 1612 F3’ TriNKET did not show any fragmentation under the conditions of accelerated stability or forced degradation, where the molecule was subjected to thermal, chemical, and mechanical stress, suggesting that the sequence is stable.
• TAP Therapeutic Antibody Profiler
• FIG. 51A-FIG. 51C is a model of the variable fragment (Fv) of the BAFF-R binding arm of AB1424/AB1612 F3’ TriNKET in three different orientations (upper panel) and the corresponding surface charge distribution of the same orientation (lower panel).
• FIG. 52A- FIG.52E show the total CDR length and surface feature analyses of the BAFF-R binding arm of AB1424/AB1612 F3’ TriNKET.
• TriNKET Therapeutic Antibody Profiles
• hydrophobicity of a monoclonal antibody is an important biophysical property relevant for its developability into a therapeutic.
• Hydrophobic patch analysis of the BAFF-R binding arm of AB1424/AB1612 F3’ TriNKET demonstrated that the molecule benchmarks with the vast majority of therapeutic mAbs (FIG. 52A-FIG.52E).
• Surface patches of positive and negative charge have been associated with adverse impacts on mAb expression and accelerated in vivo clearance.
• the positively charged patches, negatively charged patches, and charge symmetry were consistent with the majority of reference mAbs (FIG. 52A-FIG.52E).
• FIG. 53A-FIG.53C The NKG2D-binding Fab arm was modeled and depicted in three different orientations (FIG. 53A-FIG.53C, upper panel), and the corresponding surface charge distribution is shown (FIG. 53A-FIG.53C, lower panel).
• the surface charge distribution of the NKG2D arm appears to be evenly distributed across the modeled paratope.
• FIG. 54A-FIG.54E shows the total CDR length and surface feature analyses of the NKG2D binding arm of AB1424/AB1612 F3’ TriNKET. Analysis was performed using TAP (Raybould, 2019). Total CDR length, hydrophobicity, the positive/negative charge distributions, and the Fv charge symmetry all compared favorably to therapeutic mAb reference data. In summary, there were neither unusual surface charge properties nor unusual patches of surface hydrophobicity identified in these analyses.
• the gradient was run from 0% low salt buffer (100 mM sodium phosphate, pH 6.5) to 100% low salt buffer over 6.5 minutes at a flow rate of 1.0 mL/minute. Chromatograms were monitored at 280 nm. Retention times of AB1424/AB1612 F3’ TriNKET on the analytical HIC column is shown in Table 26 and HIC profile in FIG. 55A and FIG. 55B. Commercial adalimumab and pembrolizumab were used as an example of well-behaved biologies and functioned as internal controls for the assay.
• AB1424/AB1612 F3’ TRINKET had a retention time of 9.7 minutes, compared to 11.3 minutes for pembrolizumab and 8.8 for adalimumab.
• experimental hydrophobicity analysis suggested that the hydrophobic properties of AB1424/AB1612 F3’ TriNKET were acceptable for further development.
• TriNKET The thermal stability of AB1424/AB1612 F3’ TriNKET was assessed by differential scanning calorimetry (DSC) in PBS pH 7.4 or in HST comprising 20 mM histidine, 250 mM sucrose, 0.01% tween-80 at pH 6.0.
• DSC differential scanning calorimetry
• TriNKETs were diluted to 0.5 mg/mL with PBS. 325 pL were added to a 96-well deep well plate along with a matching buffer blank. Thermograms were generated using a MicroCai PEAQ DSC (Malvern, PA). Temperature was ramped from 20-100 °C at 90 °C/hour. Raw thermograms were background subtracted, the baseline model was splined, and data were fitted using a non-two state model.
• AB1424/AB1612 F3’ TriNKET is an engineered molecule based on the backbone of a monoclonal IgGl antibody. While a typical IgGl contains 16 disulfide bonds, the F3’ format of AB1424/AB1612 F3’ TriNKET contains only 15 disulfide bonds.
• FIG. 58A and FIG. 58B demonstrates that AB1424/AB1612 F3’ TriNKET binds to BAFF-R expressed on the surface of isogenic BAFF-R-CHO cells with a 2.55 nM affinity.
• Isogenic cell lines overexpressing human and cynomolgus BAFF-R on the backbone of CHO cell line were designed.
• AB1424/AB1612 F3’ TriNKET was compared to a corresponding parental antibody (AB1753).
• AB1424/AB1612 F3’ TriNKET and AB1753 demonstrated a similar dose-response in binding to human and cynomolgus BAFF-R (FIG. 59A and FIG. 59B).
• the ECso was nearly identical for AB1424/AB1612 F3’ TriNKET and AB1753 when comparing binding to human and cynomolgus BAFF-R (Table 31).
• the fold over background (FOB) was greater for AB1424/AB1612 F3’ TriNKET than AB1753 across both human and cynomolgus BAFF-R cells (FIG. 59A and FIG. 59B and Table 31). Without wishing to be bound by theory, it is hypothesized that this may be attributed to the altered format of AB1424/AB1612 F3’ TRINKET, where antigen engagement is monovalent (rather than bivalent for AB1753) and there is potential for higher loading of the TriNKET on the cell.
• the dissociation rate constant was 1. l ⁇ 0.0 x 10" 1 s' 1 and 1. l ⁇ 0.0 x 10' 1 s' 1 for human NKG2D and cynomolgus target, respectively.
• Equilibrium affinity constants (KD) obtained by kinetics fit and steady state affinity fit were very similar for human NKG2D, 455.8 ⁇ 12.7 nM and 456.4 ⁇ 13.9 nM, respectively (Table 32), and cynomolgus NKG2D: 517.0 ⁇ 13.6 nM and 520.5 ⁇ 15.5 nM, respectively (Table 33).
• Table 35 Steady state affinity of AB1424/AB1612 F3’ TriNKET binding to human CD16a F158.
• Table 36 Kinetic parameters and binding affinities of AB1424/AB1612 F3’ TriNKET for cynomolgus CD 16,
• FIG. 71A-FIG. 71G a flow cytometry-based PSR assay to measure binding to a preparation of detergent solubilized CHO cell membrane proteins was performed (FIG. 71A-FIG. 71G).
• the PSR assay correlates well with cross-interaction chromatography, a surrogate for antibody solubility, as well as with baculovirus particle enzyme-linked immunosorbent assay, a surrogate for in vivo clearance (Xu et. al (2013). Addressing polyspecificity of antibodies selected from an in vitro yeast presentation system: a FACS-based, high-throughput selection and analytical tool. Protein engineering design and selection, 26, 663-670).
• a secondary FACS reagent to detect binding of biotinylated PSR reagent to TriNKETs or control mAbs, was made as follows: 1 :250 pL of Streptavidin-PE (Biolegend, catalog # 405204) and 1 : 100 donkey anti-human Fc were combined in PBSF. To each sample, 100 pL of the secondary reagents were added and allowed to incubate for 20 minutes on ice. The beads were washed twice with 100 pL PBSF, and samples were analyzed on a FACS Celesta (BD).
• BD FACS Celesta
• trastuzumab served as a negative control.
• Ixekizumab served as positive control, with increasing propensity for interaction with PSR by flow cytometry.
• AB1424/AB1612 F3’ TriNKET was negative for binding to PSR and was most comparable to the PSR negative control, trastuzumab.
• the potency of AB1424/AB1612 F3’ TriNKET in stimulating KHYG-l-CD16aV mediated cytolysis of BAFF-R+ BJAB cells was determined in a cytotoxicity assay using KHYG-l-CD16a cells engineered to express CD16a in addition to NKG2D. Lysis of target cells was measured by the DELFIA cytotoxicity assay. Briefly, human cancer cell lines expressing BAFF-R were harvested from culture, washed with HBS, and resuspended in growth media at 10 6 /mL for labeling with BATDA reagent (Perkin Elmer ADO 116). Manufacturer instructions were followed for labeling of the target cells.
• NK cells were isolated from human peripheral blood buffy coats using density gradient centrifugation, washed, and prepared for NK cell isolation.
• NK cells were isolated using a negative selection technique with magnetic beads. Purity of isolated NK cells was typically >90% CD3-CD56+. Isolated NK cells were rested overnight and harvested from culture. The cells were then washed and resuspended at concentrations of 10 5 -2.0xl0 6 /mL in culture media for an effector-to-target (E:T) ratio of 5: 1. 50 pl of NK cells were added to each well of the plate for a total of 200 pl culture volume. The plate was incubated at 37° C with 5% CO2 for 2-3 hours.
• E:T effector-to-target
• the plate was removed from the incubator, and the cells were pelleted by centrifugation at 200 xg for 5 minutes. 20 pl of culture supernatant were transferred to a clean microplate and 200 pl of room temperature europium solution (Perkin Elmer C135- 100) were added to each well. The plate was protected from light and incubated on a plate shaker at 250 rpm for 15 minutes, then read using SpectraMax i3X instruments. BJAB cells were labeled with BATDA reagent. After labeling, cells were washed and resuspended in primary cell culture media.
• BATDA labeled cells AB1424/AB1612 F3’ TRINKET, and rested KHYG-1- CD16V cells were added to the wells of a 96-well plate. Additional wells were prepared for maximum lysis of target cells by addition of 1% Triton-X. Spontaneous release was monitored from wells with only BATDA-labeled cells. After three hours of culture, the cells were pelleted, the culture supernatant was transferred to a clean microplate, and room temperature europium solution was added to each well. The plate was protected from light and incubated on a plateshaker at 250 rpm for 15 minutes. Plates were read using a SpectraMax i3X instrument. The % Specific lysis was calculated as follows:
• AB1424/AB1612 F3’ TriNKET exhibited comparable sub-nanomolar potency and effective maximum cell killing (Table 38).
• AB1424/AB1612 F3’ TriNKET was highly potent in driving the lysis of BJAB cells, and there was strong correlation of potency across production lots of AB1424/AB1612 F3’ TriNKET.
• Table 39 Potency of AB1424/AB1612 F3’ TriNKET and parental mAb in the presence of primary NK cells and BAFF-R+ tumor cell line.
• TriNKET Potency of AB1424/AB1612 F3 ’ TriNKET requires both NKG2D and CD16a engagement
• AB1424/AB1612 F3’ TriNKET-mediated cytotoxicity a panel of control TriNKETs was generated.
• TRINKET NKG2Dsi is a variant of AB1424/AB1612 F3’ TriNKET where the light chain of the NKG2D- binding arm was substituted, rendering the arm incapable of binding to NKG2D.
• TriNKET FcyRsi is an effector-silenced version of AB1424/AB1612 F3’ TriNKET, bearing the Fc silencing mutations: L234A, L235A, and P329G (according to EU numbering).
• the F3’ isotype control was constructed by substituting the BAFF-R-binding arm with the variable domain of palivizumab, which binds to non-human antigen, formatted as a disulfide-stabilized scFv (FIG. 73A-FIG. 71D).
• AB1424/AB1612 F3’ TriNKET bound with high affinity to human and cynomolgus BAFF-R, with low affinity to human and cynomolgus NKG2D, and with low affinity to human and cynomolgus CD 16a.
• the AB1424/AB1612 F3’ TriNKET did not display any spurious off-target interactions.
• AB1424/AB1612 F3’ TriNKET bound tightly to and was highly potent against BAFF-R+ cells.
• TriNKET could simultaneously bind to BAFF-R and NKG2D and exhibit robust synergy between the NK engager arms, and its efficacy required tripartite binding to BAFF-R, NKG2D, and CD 16a, highlighting the mechanism of action of the TriNKET.
• Binding analyses as described in this Example were performed using SPR, as described in Example 4. Binding of AB1424/AB1612 F3’ TriNKET to human CD64 (FcyRI) was measured and is shown in FIG. 75A-FIG. 75H. Table 42 summarizes kinetic rates and human CD64 affinity values determined from the sensorgrams for AB 1424/ AB 1612 F3’ TriNKET and trastuzumab.
• Binding to human CD32a Hl 31 was measured and is shown in FIG. 77A-FIG. 77P.
• Table 46 Affinity values of human CD32b for AB1424/AB1612 F3’ TriNKET and trastuzumab.
• Binding of AB1424/AB1612 F3’ TriNKET to cynomolgus CD16 was measured and is shown in FIG. 81A-FIG. 81H.
• the resulting affinity values determined from the sensorgrams are summarized in Table 48.
• Binding of AB1424/AB1612 F3’ TriNKET to human FcRn was measured at pH 6.0 and is shown in FIG. 82A-FIG. 82P.
• the resulting affinity values determined from the sensorgrams are summarized in Table 49.
• Binding of AB1424/AB1612 F3’ TriNKET to cynomolgus FcRn was measured and is shown in FIG. 83A-FIG. 83P.
• the resulting affinity values determined from the sensorgrams are summarized in Table 50.
• AB1424/AB1612 F3’ TriNKET and an IgGl isotype control trastuzumab did not demonstrate physiologically meaningful differences (less than 3 -fold different) and are comparable in their binding to human and cynomolgus CD64 (FcyRI) and CD 16 (FcyRIII) recombinant receptors tested (Table 50).
• AB1424/AB1612 F3’ TriNKET and trastuzumab are similar (less than 1.2-fold different) in their binding to human CD32 (FcyRII) receptors (Table 51).
• AB1424/AB1612 F3’ TriNKET is similar to trastuzumab in its affinity for human and cynomolgus FcRn at pH 6.0.
• AB1424/AB1612 F3’ TriNKET, and trastuzumab did not demonstrate any detectable binding at the concentrations tested at pH 7.4
• Table 52 Table 52. Summary of AB1424/AB1612 F3’ TriNKET and trastuzumab binding human and cynomolgus FcRn.
• KHYG-1 CD 16V mediated cytotoxicity assays were performed as described in Example 4.
• the relative potencies of 200% AB1424/AB1612 F3’ TriNKET and 50% AB1424/AB1612 F3’ TriNKET were calculated by normalizing ECso values to the ECso of 100% AB1424/AB1612 F3’ TriNKET.
• a PEG precipitation study was conducted to determine stability of AB1424/AB1612 F3’ TriNKET. Briefly, colloidal stability was evaluated in 10 mM acetate pH 5.0 and 20 mM histidine pH 6.0. For each buffer, a 40% w/v stock solution of PEG-6000 was made, and pH was adjusted to 5.0 for acetate containing solution and pH 6.0 for histidine containing solution. A PEG-6000 titration curve was generated from the PEG stock, buffer stock, and protein stock solutions (at 36.9 mg/mL or 34.4 mg/mL in PBS), and no buffer exchange was necessary due to high dilution factor to 1 mg/mL).
• the PEG titration curve covered concentrations from 0 to 30% w/v PEG-6000, and each point was prepared in triplicate for adalimumab control or AB1424/AB1612 F3’ TriNKET in each buffer. After mixing solutions, samples were incubated at 5 °C overnight and centrifuged at 15,000 rpm for 10 minutes (in a pre-cooled, 5 °C centrifuge) to remove precipitated protein. The supernatant was then removed, and concentration was read by absorbance at 280 nm. The concentrations were then plotted against PEG concentration to determine midpoints (Cm); Cm > 20% PEG-6000 was considered good colloidal stability.
• Adalimumab was used as an example of a well-behaved commercial biologic known to be capable of formulation and administration at high concentration.
• acetate and histidine exhibited strong positive values, whereas phosphate exhibited negative or slightly positive values as shown in FIG. 89A, FIG. 89B, FIG. 90A, FIG. 90B, and Table 56.
• AB1424/AB1612 F3’ TriNKET exhibited equivalent or better ko compared to adalimumab, as judged by the magnitude of the positive value.
• TriNKET concentration feasibility study, performed at small scale, indicated AB1424/AB1612 F3’ TriNKET could be concentrated to about 150 mg/mL. Overall, the yield was 88.5% based on starting/ending quantity of protein as shown in Table 57. The samples were of high purity and matched expected molecular weight as shown by SEC-MALS in Table 58.
• Table 58 Summary of Feasibility Material SEC-MALS Analysis. a Theoretical Mw based on sequence is —125 kDa
• Viscosity of the formulation was determined across a concentration range of 0 to 140 mg/mL of AB1424/AB1612 F3’ TriNKET, formulated in HST buffer at 25 °C.
• the viscosity of AB1424/AB1612 F3’ TriNKET formulated at a concentration range from 5 to
• cIEF was performed as described in Example 4.
• the charge profile as determined by cIEF demonstrated an acidic shift from 55.7% main peak in the control to 44.3% main peak after 4 weeks at 40°C in HST (FIG. 94 and Table 65).
• Table 65 Summary of AB1424/AB1612 F3’ TriNKET iCIEF Results After Incubation at
• Table 67 Summary of High Concentration AB1424/AB1612 F3’ TriNKET ECso and Maximum Lysis After 4 Weeks in HST, pH 6.0.
• AB1424/AB1612 F4 TriNKET is an F4 format TriNKET.
• AB 1424/1612 F4 TriNKET (AB1424/1612-F4) includes four polypeptides: a first polypeptide comprising AB 1424/1612- VH-CHl-CH2-CH3-A49MI-scFv (SEQ ID NO:271) (“Chain M”), a second polypeptide comprising AB-1424/1612-VH-CH1-CH2-CH3 (SEQ ID NO:272) (“Chain H”), and a third and fourth polypeptide each comprising AB 1424/1612- VL-CL (SEQ ID NO:273) (“Chain L”).
• TAP Therapeutic Antibody Profiler
• FIG. 97A-FIG. 97C is a model of the variable domains of the BAFF-R Fab binding arm of AB1424/AB1612 F4 TriNKET in three different orientations (upper panel) and the corresponding surface charge distribution of the same orientation (lower panel).
• the surface charge distribution of the CDR interface is predominately negatively charged (“top view,” lower panel) with some clusters of hydrophobic residues.
• the surface charge distribution of the BAFF- R arm was evenly distributed across the modeled paratope.
• Hydrophobic patch analysis of the BAFF-R binding arm of AB1424/AB1612 F4 TriNKET benchmarks with the vast majority of therapeutic mAbs (FIG. 98A-FIG. 98E).
• FIG. 99A-FIG. 99C For the BAFF-R binding arm of AB1424/AB1612 F4 TriNKET, the positively charged patches, negatively charged patches, and charge symmetry are akin to the majority of reference mAbs (FIG. 99A-FIG. 99C).
• the NKG2D binding arm was modeled and depicted in three different orientations and their corresponding surface charge distribution is shown (FIG. 99A-FIG. 99C).
• the surface charge distribution of the NKG2D arm was evenly distributed across the modeled paratope
• FIG. 100A-FIG. 100E show the total CDR length and surface feature analyses of the NKG2D binding arm of AB1424/AB1612 F4 TriNKET. In summary, there were neither unusual surface charge properties nor unusual patches of surface hydrophobicity identified.
• AB1424/AB1612 F4 TriNKET Expression and Purification [00642] AB1424/AB1612 F4 TriNKET was expressed in ExpiCHO cells and purified. The purity of AB 1424/ AB 1612 F4 TriNKET was determined by size exclusion chromatography (SEC) and capillary electrophoresis sodium dodecyl sulfate (CE-SDS). AB1424/AB1612 F4 TriNKET exhibited high monomer content (>98.6% as shown in FIG. 101A-FIG. 101C), and no major impurities were observed under CE-SDS. The purity of three lots of AB1424/AB1612 F4 TriNKET as determined by SEC and CE-SDS is summarized in Table 68.
• hydrophobicity prediction data was confirmed by investigating AB1424/AB1612 F4 TriNKET behavior with analytical Hydrophobic Interactions Chromatography (HIC), a technique that relies upon proteins with significant patches of exposed hydrophobic patches being more prone to aggregation.
• HIC Hydrophobic Interactions Chromatography
• Retention times of AB1424/AB1612 F4 TriNKET on the analytical HIC column is shown in Table 70 and HIC profile in FIG. 103A.
• Commercial adalimumab and pembrolizumab were used as examples of well-behaved biologies and functioned as internal controls for the assay.
• AB1424/AB1612 F4 TriNKET has a retention time of 9.7 minutes, compared to 11.2 minutes for pembrolizumab and 8.7 for adalimumab.
• experimental hydrophobicity analysis suggests that the hydrophobic properties of AB1424/AB1612 F4 TriNKET are acceptable for further development.
• AB1424/AB1612 F4 TriNKET was constructed as an engineered molecule based on the backbone of a monoclonal IgGl antibody. While a typical IgGl contains 16 disulfide bonds, the F4 format of AB1424/AB1612 F4 TriNKET was constructed with 20 disulfide bonds.
• FIG. 104A and FIG. 104B show extracted ion chromatograms (XICs) for the engineered disulfide pair in the Fc (non-reduced and reduced) and the most intense charge state for that peptide pair. Similarly, XICs in FIG. 105A and FIG.
• Binding characteristics of AB1424/AB1612 F4 TriNKET [00649] Isogenic cell lines overexpressing human and cynomolgus BAFF-R were developed from CHO cells. Binding of AB1424/AB1612 F4 TriNKET to the cell surface-expressed BAFF- R was compared to the parental BAFF-R specific antibody as well as to an F4 format control that does not contain a BAFF-R binder (F4-palivizumab). AB1424/AB1612 F4 TriNKET and its parental mAb demonstrated a similar dose-response in binding to human and cynomolgus BAFF- R (FIG. 106A and FIG. 106B). The ECso and maximal FOB was nearly identical for AB1424/AB1612 F4 TriNKET and parental mAb when comparing binding to human and cynomolgus BAFF-R (Table 73).
• Binding of AB1424/AB1612 F4 TriNKET to a subset of BAFF-R + cancer cell lines was assessed by flow cytometry.
• AB1424/AB1612 F4 TriNKET bound with low nanomolar ECso to cell-surface BAFF-R on BJAB, Raji, RL, Rs4;l 1, Jeko-1 and SUDHL-6 cells.
• the EC50 was comparable amongst the BAFF-R + cancer cell lines (Table 74).
• Binding of AB1424/AB1612 F4 TriNKET to human and cynomolgus NKG2D was assessed by SPR (FIG. 107A-FIG. 107L).
• NKG2D is a native dimer, therefore recombinant mFc-tagged NKG2D dimer was used for this experiment.
• the steady state affinities to human and cynomolgus NKG2D are shown in Table 75.
• the affinities of AB1424/AB1612 F4 TriNKET for human and cynomolgus NKG2D were comparable.
• AB1424/AB1612 F4 TriNKET was constructed with a human IgGl Fc meant to maintain interactions with Fc receptors. Engagement of CD16a is a key driver of the TriNKET mechanism of action. Binding to both human CD 16a VI 58 and Fl 58 alleles, as well as to cynomolgus CD 16 was assessed as part of the full FcR panel analysis by SPR as presented in Table 76 and demonstrated that AB 1424/ AB 1612 F4 TriNKET binds human and cynomolgus CD16 comparably to IgGl isotype control trastuzumab.
• FIG. 108A-FIG. 108P, FIG. 109A- FIG. 109H, and FIG. 110A-FIG. 110H represent raw data and fitted sensorgrams for CD 16a V158, F158 and cynomolgus CD16, respectively. As such, AB1424/AB1612 F4 TriNKET demonstrates good binding to CD 16.
• AB1424/AB1612 F4 TriNKET binds human and cynomolgus Fey receptors with affinities comparable to trastuzumab, a marketed IgGl biologic that served an experimental control.
• Table 76 represents the summary of affinity values for the FcyRs tested.
• FIG. 115A-FIG. 115P, FIG. 116A-FIG. 116P, FIG. 117A-FIG. 117P, and FIG. 118A-FIG. 118H represent raw and fitted sensorgrams.
• Table 76 Summary of affinities of AB1424/AB1612 F4 TriNKET and trastuzumab for human and cynomolgus FcyR.
• FIG. 116A-FIG. 116P and FIG. 117A-FIG. 117P represent steady-state fit and binding sensorgrams for human and cynomolgus FcRn binding, respectively, at pH 6.0.
• FIG. 118A-FIG. 118H demonstrate that, similar to IgGl isotype control trastuzumab, AB1424/AB1612 F4 TriNKET lacked significant binding to human and cynomolgus FcRn at pH 7.4.

Landscapes

• Health & Medical Sciences (AREA)
• Chemical & Material Sciences (AREA)
• Immunology (AREA)
• Organic Chemistry (AREA)
• Medicinal Chemistry (AREA)
• Life Sciences & Earth Sciences (AREA)
• General Health & Medical Sciences (AREA)
• Biophysics (AREA)
• Genetics & Genomics (AREA)
• Molecular Biology (AREA)
• Proteomics, Peptides & Aminoacids (AREA)
• Biochemistry (AREA)
• Pharmacology & Pharmacy (AREA)
• Veterinary Medicine (AREA)
• Public Health (AREA)
• Animal Behavior & Ethology (AREA)
• Chemical Kinetics & Catalysis (AREA)
• General Chemical & Material Sciences (AREA)
• Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
• Bioinformatics & Cheminformatics (AREA)
• Engineering & Computer Science (AREA)
• Epidemiology (AREA)
• Mycology (AREA)
• Microbiology (AREA)
• Peptides Or Proteins (AREA)
• Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
• Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
• Micro-Organisms Or Cultivation Processes Thereof (AREA)

Priority Applications (12)

Applications Claiming Priority (2)

Related Child Applications (2)

Publications (2)

Family

ID=85780907

Family Applications (1)

Country Status (15)

Cited By (8)

Citations (7)

Family Cites Families (3)

• 2022
  • 2022-09-27 AR ARP220102597A patent/AR127162A1/es unknown
  • 2022-09-27 CN CN202280064771.XA patent/CN118317978A/zh active Pending
  • 2022-09-27 PE PE2024000614A patent/PE20241584A1/es unknown
  • 2022-09-27 CA CA3233377A patent/CA3233377A1/en active Pending
  • 2022-09-27 IL IL311617A patent/IL311617A/en unknown
  • 2022-09-27 KR KR1020247013645A patent/KR20240087855A/ko active Pending
  • 2022-09-27 AU AU2022358500A patent/AU2022358500A1/en active Pending
  • 2022-09-27 MX MX2024003993A patent/MX2024003993A/es unknown
  • 2022-09-27 EP EP22877499.8A patent/EP4408896A4/en active Pending
  • 2022-09-27 WO PCT/US2022/077083 patent/WO2023056252A1/en not_active Ceased
  • 2022-09-27 JP JP2024519378A patent/JP2024537779A/ja active Pending
  • 2022-09-27 TW TW111136528A patent/TW202330603A/zh unknown
• 2024
  • 2024-03-27 CO CONC2024/0003967A patent/CO2024003967A2/es unknown
  • 2024-03-27 CL CL2024000922A patent/CL2024000922A1/es unknown
  • 2024-03-28 US US18/620,824 patent/US20240270861A1/en not_active Abandoned
  • 2024-03-29 US US18/622,766 patent/US20240360223A1/en active Pending

Patent Citations (7)

Non-Patent Citations (1)

Also Published As

Similar Documents

Legal Events