WO2023056243A1 - Antibodies targeting baff-r and use thereof - Google Patents
Antibodies targeting baff-r and use thereof Download PDFInfo
- Publication number
- WO2023056243A1 WO2023056243A1 PCT/US2022/077068 US2022077068W WO2023056243A1 WO 2023056243 A1 WO2023056243 A1 WO 2023056243A1 US 2022077068 W US2022077068 W US 2022077068W WO 2023056243 A1 WO2023056243 A1 WO 2023056243A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- seq
- antigen
- binding site
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/15—Natural-killer [NK] cells; Natural-killer T [NKT] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/33—Antibodies; T-cell engagers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68031—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being an auristatin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68033—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a maytansine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68035—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a pyrrolobenzodiazepine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68037—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a camptothecin [CPT] or derivatives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6807—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug or compound being a sugar, nucleoside, nucleotide, nucleic acid, e.g. RNA antisense
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/525—Tumour necrosis factor [TNF]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/5406—IL-4
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/5428—IL-10
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/5434—IL-12
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/5443—IL-15
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/55—IL-2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/555—Interferons [IFN]
- C07K14/56—IFN-alpha
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0646—Natural killers cells [NK], NKT cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
Definitions
- the invention provides proteins with antibody heavy chain and light chain variable domains that can be paired to form an antigen-binding site targeting BAFF-R on a cell, pharmaceutical compositions comprising such proteins, and therapeutic methods using such proteins and pharmaceutical compositions, including for the treatment of cancer or autoimmune disease.
- Cancer continues to be a significant health problem despite the substantial research efforts and scientific advances reported in the literature for treating this disease.
- Some of the most frequently diagnosed cancers in adults include prostate cancer, breast cancer, and lung cancer.
- Current treatment options for these cancers are not effective for all patients and/or can have substantial adverse side effects.
- Other types of cancer also remain challenging to treat using existing therapeutic options.
- BAFF-R also called BAFF receptor, TNF receptor superfamily member 13C (TNFRSF13C), CD268, or BR3, is a type III transmembrane protein of the TNF receptor superfamily.
- BAFF-R is expressed at the late transitional (T2) B-cell stage and on all mature B cells, is downregulated on germinal center B cells, is re-expressed on memory cells, and is absent on plasma cells (Davidson (2012) Curr. Rheumatol. Rep., 14(4): 295-302).
- BAFF-R is a receptor for B cell-activating factor (BAFF), a B cell survival factor.
- BAFF can engage three receptors: BAFF-R, transmembrane activator and CAML interactor (TACI), and B-cell maturation antigen (BCMA).
- BAFF-R is the principal receptor involved in the development of follicular and marginal zone splenic B cells (Schiemann et al. (2001) Science, 293: 2111-14).
- the BAFF/BAFF-R signaling axis may play a role in B cell hyperplasia. Increased expression of BAFF-R, as well as elevated serum levels of BAFF, has been observed in nonHodgkin lymphoma (NHL) patients (Shen et al. (2016) Adv. Clin. Exp. Med., 25(5):837— 44). Certain single nucleotide polymorphisms (SNPs) in BAFF-R are associated with increased risk of chronic lymphocytic leukemia (CLL) (Jesek et al. (2016) Tumour Biol., 37(10): 13617-26).
- CLL chronic lymphocytic leukemia
- the BAFF/BAFF-R axis is also implicated in autoimmune inflammatory diseases (Mackay et al. (1999) J. Exp. Med., 190: 1697-1710).
- SLE systemic lupus erythematosus
- BAFF-R is consistently occupied on blood B cells in SLE (Carter et al. (2005) Arthritis Rheum., 52:3943-54).
- autoreactive B cells have a greater dependency on BAFF for their survival as compared with protective B cells (Lesley et al. (2004) Immunity, 20:441-53)
- abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells.
- the present invention provides antigen-binding sites that bind BAFF-R.
- Proteins and protein conjugates containing such antigen-binding sites for example, antibodies, antibody-drug conjugates, bispecific T-cell engagers (BiTEs), and immunocytokines, as well as immune effector cells (e.g., T cells) expressing a protein containing such an antigen-binding site (e.g., a chimeric antigen receptor (CAR)), are useful for treating BAFF-R-associated diseases such as cancer and autoimmune disease.
- a protein containing such an antigen-binding site e.g., a chimeric antigen receptor (CAR)
- the present invention provides an antigen-binding site that binds or is capable of binding BAFF-R, comprising: a heavy chain variable domain (VH) comprising a complementarity-determining region 1 (CDR1) sequence comprising an amino acid sequence of SEQ ID NO:50, a complementaritydetermining region 2 (CDR2) sequence comprising an amino acid sequence of SEQ ID NO:51, and a complementarity-determining region 3 (CDR3) sequence comprising an amino acid sequence of SEQ ID NO: 52; and a light chain variable domain (VL) comprising a CDR1 sequence comprising an amino acid sequence of SEQ ID NO:4, a CDR2 sequence comprising an amino acid sequence of SEQ ID NO:5, and a CDR3 sequence comprising an amino acid sequence of SEQ ID NO:49.
- VH heavy chain variable domain
- CDR1 complementarity-determining region 1
- CDR2 complementarity-determining region 2
- CDR3 complementarity-determining region 3
- the VH comprises CDR1, CDR2, and CDR3 sequences identical to the amino acid sequences of SEQ ID NOs: 46, 47, and 48, respectively; and the VL comprises CDR1, CDR2, and CDR3 sequences identical to the amino acid sequences of SEQ ID NOs: 4, 5, and 49, respectively;
- the VH comprises CDR1, CDR2, and CDR3 sequences identical to the amino acid sequences of SEQ ID NOs: 1, 2, and 16, respectively; and the VL comprises sequences identical to the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively;
- the VH comprises CDR1, CDR2, and CDR3 sequences identical to the amino acid sequences of SEQ ID NOs: 21, 2, and 22, respectively; and the VL comprises CDR1, CDR2, and CDR3 sequences identical to the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively;
- the VH comprises CDR1, CDR2, and CDR3 sequences identical to the amino acid sequences of SEQ ID NOs: 20, 23, and 26, respectively; and the VL comprises CDR1, CDR2, and CDR3 sequences identical to the amino acid sequences of SEQ ID NOs: : 4, 5, and 6, respectively; or
- an antigen-binding site comprises a VH comprising CDR1, CDR2, and CDR3 sequences identical to the amino acid sequences of SEQ ID NOs: 46, 47, and 48, respectively; and a VL comprising CDR1, CDR2, and CDR3 sequences identical to the amino acid sequences of SEQ ID NOs: 4, 5, and 49, respectively.
- an antigen-binding site comprises a VH comprising CDR1, CDR2, and CDR3 sequences identical to the amino acid sequences of SEQ ID NOs: 1, 23, and 38, respectively; and a VL comprising CDR1, CDR2, and CDR3 sequences identical to the amino acid sequences of SEQ ID NOs: 4, 5, and 39, respectively.
- an antigen-binding site comprises a VH comprising an amino acid sequence at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:40.
- an antigen-binding site comprises a VH comprising a G44C substitution relative to SEQ ID NO:40.
- an antigen-binding site comprises a VH comprising the amino acid sequence of SEQ ID NO:40.
- an antigen-binding site comprises a VH comprising the amino acid sequence of SEQ ID NO:42.
- an antigen-binding site comprises a VL comprising an amino acid sequence at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:41.
- the VL comprises a G100C substitution relative to SEQ ID NO:41.
- the VL comprises the amino acid sequence of SEQ ID NO:41.
- an antigen-binding site comprises a VL comprising the amino acid sequence of SEQ ID NO:43.
- an antigen-binding site comprising a VH comprising the amino acid sequence of SEQ ID NO:40 and a VL comprising the amino acid sequence of SEQ ID NO:41, or a VH comprising the amino acid sequence of SEQ ID NO:42 and a VL comprising the amino acid sequence of SEQ ID NO:43.
- an antigenbinding site comprises a VH comprising the amino acid sequence of SEQ ID NO:40 and a VL comprising the amino acid sequence of SEQ ID NO:41.
- an antigenbinding site comprises a VH comprising the amino acid sequence of SEQ ID NO:42 and a VL comprising the amino acid sequence of SEQ ID NO:43.
- the antigen-binding site is present as a single-chain fragment variable (scFv), a Fab fragment, or a monoclonal antibody.
- the antigen-binding site is present as a single-chain fragment variable (scFv).
- the antigen-binding site is present as an scFv comprising an amino acid sequence at least 90% identical to the sequence of SEQ ID NO:44 or SEQ ID NO:45.
- the scFv comprises an amino acid sequence of SEQ ID NO:44 or SEQ ID NO:45.
- the scFv comprises the amino acid sequence of SEQ ID NO:44.
- the scFv consists of the amino acid sequence of SEQ ID NO:44.
- an antigen-binding site that competes with the antigen-binding site of any of the above embodiments for binding to BAFF-R.
- the antigen-binding site binds human BAFF-R with a dissociation constant (KD) smaller than or equal to 5 nM, as measured by surface plasmon resonance (SPR).
- KD dissociation constant
- the antigen-binding site inhibits (e.g., blocks) binding of BAFF-R to BAFF (e.g., by at least 50%, at least 75%, at least 90%, at least 95% or at least 99% as measured in a competitive binding assay).
- a protein comprising the antigen-binding site of any one of the above embodiments.
- the protein further comprises an antibody heavy chain constant region.
- the antibody heavy chain constant region is a human IgG heavy chain constant region.
- the antibody heavy chain constant region is a human IgGl heavy chain constant region.
- each polypeptide chain of the antibody heavy chain constant region comprises an amino acid sequence at least 90% identical to the amino acid sequence of wild-type human IgGl Fc region.
- At least one polypeptide chain of the antibody heavy chain constant region comprises one or more mutations, relative to the amino acid sequence of wildtype human IgGl Fc region, at one or more positions selected from Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, N390, K392, T394, D399, S400, D401, F405, Y407, K409, T411, and K439, numbered according to the EU numbering system.
- At least one polypeptide chain of the antibody heavy chain constant region comprises one or more mutations, relative to the amino acid sequence of wildtype human IgGl Fc region, selected from Q347E, Q347R, Y349S, Y349K, Y349T, Y349D, Y349E, Y349C, L351K, L351D, L351Y, S354C, E356K, E357Q, E357L, E357W, K360E, K360W, Q362E, S364K, S364E, S364H, S364D, T366V, T366I, T366L, T366M, T366K, T366W, T366S, L368E, L368A, L368D, K370S, N390D, N390E, K392L, K392M, K392V, K392F, K39
- one polypeptide chain of the antibody heavy chain constant region comprises one or more mutations, relative to the amino acid sequence of wild-type human IgGl Fc region, at one or more positions selected from Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, K392, T394, D399, S400, D401, F405, Y407, K409, T411 and K439; and the other polypeptide chain of the antibody heavy chain constant region comprises one or more mutations, relative to the amino acid sequence of wild-type human IgGl Fc region, at one or more positions selected from Q347, Y349, L351, S354, E356, E357, S364, T366, L368, K370, N390, K392, T394, D399, D401, F405, Y407, K409, T411, and K439, numbered according to the EU number
- one polypeptide chain of the antibody heavy chain constant region comprises K360E and K409W substitutions relative to the amino acid sequence of wildtype human IgGl Fc region; and the other polypeptide chain of the antibody heavy chain constant region comprises Q347R, D399V and F405T substitutions relative to the amino acid sequence of wild-type human IgGl Fc region, numbered according to the EU numbering system.
- one polypeptide chain of the antibody heavy chain constant region comprises a Y349C substitution relative to the amino acid sequence of wild-type human IgGl Fc region; and the other polypeptide chain of the antibody heavy chain constant region comprises an S354C substitution relative to the amino acid sequence of wild-type human IgGl Fc region, numbered according to the EU numbering system.
- an antibody-drug conjugate comprising the protein of any one of the above embodiments and a drug moiety.
- the drug moiety is selected from the group consisting of auristatin, N-acetyl-y calicheamicin, maytansinoid, pyrrol Strukturzodiazepine, and SN-38.
- an immunocytokine comprising the antigenbinding site of any one of the above embodiments and a cytokine.
- the cytokine is selected from the group consisting of IL-2, IL-4, IL-10, IL-12, IL-15, TNF, and IFNa.
- a bispecific T-cell engager comprising the antigen-binding site of any one of the above embodiments and an antigen-binding site that binds CD3.
- CAR chimeric antigen receptor
- the transmembrane domain is selected from the transmembrane regions of the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, BAFF-R, CD37, CD64, CD80, CD86, CD134, CD137, CD152, and CD154.
- the intracellular signaling domain comprises a primary signaling domain comprising a functional signaling domain of CD3 zeta, common FcR gamma (FCER1G), Fc gamma Rlla, FcR beta (Fc Epsilon Rib), CD3 gamma, CD3 delta, CD3 epsilon, CD79a, CD79b, DAP10, and DAP12.
- the intracellular signaling domain further comprises a costimulatory signaling domain comprising a functional signaling domain of a costimulatory receptor.
- the costimulatory receptor is selected from the group consisting of 0X40, CD27, CD28, CD30, CD40, PD-1, CD2, CD7, CD258, NKG2C, B7- H3, a ligand that binds to CD83, ICAM-1, LFA-1 (CD1 la/CD18), ICOS and 4-1BB (CD137), or any combination thereof.
- nucleic acid encoding the CAR of any one of the above embodiments.
- an expression vector comprising the isolated nucleic acid of the above aspect.
- an immune effector cell comprising the nucleic acid or the expression vector of the above aspects.
- an immune effector cell expressing the CAR of any one of the above aspects.
- the immune effector cell is a T cell.
- the T cell is a CD8+ T cell, a CD4+ T cell, a y6 T cell, or an NKT cell.
- the immune effector cell is an NK cell.
- a pharmaceutical composition comprising the protein, the antibody-drug conjugate, the immunocytokine, the bispecific T-cell engager, or the immune effector cell of any of the above aspects or embodiments; and a pharmaceutically acceptable carrier.
- a method of treating cancer comprising administering to a subject in need thereof an effective amount of the protein, the antibody-drug conjugate, the immunocytokine, the bispecific T-cell engager, the immune effector cell, or the pharmaceutical composition of any of the above aspects or embodiments.
- the cancer is B-cell non-Hodgkin’s lymphoma (B-NHL), chronic lymphocytic leukemia (CLL), mantle cell lymphoma (MCL), follicular lymphoma (FL), diffuse large B-cell lymphoma (DLBCL), marginal zone lymphoma, mucosa-associated lymphoid tissue (MALT) lymphoma, primary mediastinal B-cell lymphoma, and acute lymphocytic leukemia (ALL).
- B-NHL B-cell non-Hodgkin’s lymphoma
- CLL chronic lymphocytic leukemia
- MCL mantle cell lymphoma
- FL follicular lymphoma
- LLBCL diffuse large B-cell lymphoma
- MALT mucosa-associated lymphoid tissue lymphoma
- ALL acute lymphocytic leukemia
- ALL acute lymphocytic leukemia
- a method of treating an autoimmune inflammatory disease comprising administering to a subject in need thereof an effective amount of the protein, the antibody-drug conjugate, the immunocytokine, the bispecific T-cell engager, the immune effector cell, or the pharmaceutical composition of any of the above aspects or embodiments.
- protein, the antibody-drug conjugate, the immunocytokine, or the bispecific T-cell engager of any of the above aspects or embodiments is a purified antigenbinding site, protein, antibody-drug conjugate, immunocytokine, or bispecific T cell engager.
- the protein, the antibody-drug conjugate, the immunocytokine, or the bispecific T-cell engager of any of the above aspects or embodiments is purified by a method selected from the group consisting of: centrifugation, depth filtration, cell lysis, homogenization, freeze-thawing, affinity purification, gel filtration, ion exchange chromatography, hydrophobic interaction exchange chromatography, and mixed-mode chromatography.
- FIG. 1 is a graph showing fluorescence outputs from a binding assay showing blocking of BAFF-biotin binding to human BAFF-R expressed on CHO cells by the indicated antibodies.
- FIG. 2 is a graph showing fluorescence outputs from a blocking assay of BAFF- biotin binding to BAFF-R expressed on CHO cells by the indicated antibodies.
- FIGs. 3A-3D are graphs of fluorescence outputs from binding assays on CHO cells showing binding of indicated antibodies to BAFF-R (FIG. 3A, FIG. 3B) or from a blocking assay of BAFF-biotin binding to BAFF-R by indicated antibodies (FIG. 3C, FIG. 3D).
- FIGs. 4A-4E are flow cytometry plots showing binding of AB0369scFv expressed on yeast to no antigen control (FIG. 4A), h-BAFF-R-hFc (FIG. 4B), Irrel evant-hFc (FIG. 4C), hBAFF-R-GST (FIG. 4D), or Irrel evant-GST (FIG. 4E).
- Vertical axes indicates scFv expression as measured by detection of the Flag epitope tag; horizonal axes indicate binding of biotinylated control of BAFF-R constructs to scFv as measured by detection of streptavidin-PE.
- FIGs. 5A and 5B are graphs showing binding of AB0369 or indicated controls to human (FIG. 5 A) or cynomolgus monkey (FIG. 5B) BAFF-R.
- FIGs. 6A and 6B detail a poly-specificity assay of a multi-specific binding proteins with a BAFF-R binding site derived from AB0369.
- FIG. 6A is a schematic of the assay.
- FIG. 6B is a schematic of the assay.
- FIG. 6B shows graphs of AB0369 (left panels), trastuzumab negative control (middle panels), or ixekizumab positive control (right panels) in the absence (top panels) or presence (bottom panels) of poly-specificity reagent (PSR).
- PSR poly-specificity reagent
- FIG. 7 is a graph showing a KHYG-l-CD16aV cytotoxicity assay of Ramos cells as induced by a multispecific binding protein with a BAFF-R binding site derived from AB0369.
- FIG. 8 is a graph showing fluorescence outputs from a binding assay showing blockage of BAFF-biotin binding to human BAFF-R expressed on CHO cells by AB0369 or indicated.
- FIGs. 9A-9D are flow cytometry plots showing binding of hBAFF-R-hFc-His to parental AB0369scFv or clones selected from a library produced by affinity maturation expressed on yeast following successive rounds of selection.
- FIG. 9A shows binding to parental AB0369scFv;
- FIG. 9B shows binding to sample from the first round of clone selection;
- FIG. 9C shows binding to sample from the second round of clone selection;
- FIG. 9D shows binding to output from the second round of clone selection.
- FIGs. 10A-10E are flow cytometry plots showing binding of hBAFF-R-hFc-His to AB0369 and affinity-matured scFv clones expressed on yeast.
- FIG. 10A shows binding to parental AB0369;
- FIG. 10B shows binding to AB0605;
- FIG. 10C shows binding to AB0622;
- FIG. 10D shows binding to AB0622;
- FIG. 10E shows binding to an ianalumab-based scFv.
- FIGs. 11A-11C are graphs demonstrating BAFF-R binding and cytotoxicity of multispecific binding proteins developed from affinity maturation of AB0369.
- FIG. 11A-11C are graphs demonstrating BAFF-R binding and cytotoxicity of multispecific binding proteins developed from affinity maturation of AB0369.
- FIG. 11A is a graph showing binding of multi-specific binding proteins with BAFF-R binding sites derived from indicated clones to human BAFF-R expressed on CHO cells.
- FIG. 11B is a graph showing a KHYG-l-CD16aV cytotoxicity assay of Ramos cells as induced by multi-specific binding proteins with BAFF-R binding sites derived from indicated clones.
- FIG. 11C is a graph showing a KHYG-l-CD16aV cytotoxicity assay of Ramos cells as induced by multi-specific binding proteins with BAFF-R binding sites derived from AB0622.
- FIGs. 12A and 12B detail a poly-specificity assay of multi-specific binding proteins with BAFF-R binding sites derived from AB00605 and AB0606.
- FIG. 12A is a schematic of the assay.
- FIG. 12B shows graphs of AB0605 (left panels) or AB0606 (right panels) in the absence (top panels) or presence (bottom panels) of poly-specificity reagent (PSR).
- PSR poly-specificity reagent
- FIGs. 13A-13C are flow cytometry plots showing binding of hBAFF-R-hFc-His to parental AB0369scFv or clones selected from a library produced by affinity maturation and expressed on yeast following successive rounds of selection.
- FIG. 13A shows binding to parental AB0369scFv;
- FIG. 13B shows binding to sample from the first round of clone selection;
- FIG. 13C shows binding to sample from the second round of clone selection.
- FIGs. 14A-14E are flow cytometry plots showing binding of hBAFF-R-hFc-His to AB0369 and affinity-matured scFv clones expressed on yeast.
- FIG. 14A-14E are flow cytometry plots showing binding of hBAFF-R-hFc-His to AB0369 and affinity-matured scFv clones expressed on yeast.
- FIGs. 15A-15C are graphs demonstrating BAFF-R binding to multi-specific binding proteins developed from affinity maturation of AB0369.
- FIG. 15A is a graph showing binding of multi-specific binding proteins with BAFF-R binding sites derived from indicated clones to human BAFF-R expressed on CHO cells.
- FIG. 15A is a graph showing binding of multi-specific binding proteins with BAFF-R binding sites derived from indicated clones to human BAFF-R expressed on CHO cells.
- FIG. 15B is a graph showing binding of multi-specific binding proteins with BAFF-R binding sites derived from indicated clones to cynomolgus monkey BAFF-R expressed on CHO cells.
- FIG. 15C is a graph showing fluorescence outputs from a binding assay showing blockage of BAFF-biotin binding to BAFF-R expressed on CHO cells by the indicated antibodies.
- FIG. 16 is a graph showing a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by multi-specific binding proteins with BAFF-R binding sites derived from AB0679, AB0568, or Tool-F3’ positive control.
- FIGs. 17A-17D are flow cytometry plots showing binding of hBAFF-R-hFc-His to parental AB0369scFv clones selected from a library produced by affinity maturation expressed on yeast following successive rounds of selection.
- FIG. 17A shows binding to parental AB0369scFv;
- FIG. 17B shows binding to sample from the first round of clone selection;
- FIG. 17C shows binding to sample from the second round of clone selection; and
- FIG. 17D shows binding to sample from the third round of clone selection.
- FIGs. 18A-18F are flow cytometry plots showing binding of hBAFF-R-hFc-His to AB0369 and affinity-matured scFv clones expressed on yeast.
- FIG. 18A shows binding to parental AB0369;
- FIG. 18B shows binding to AB0682;
- FIG. 18C shows binding to AB0898;
- FIG. 18D shows binding to AB0899;
- FIG. 18E shows binding to AB0900; and
- FIG. 18F shows binding to an ianalumab-based scFv.
- FIG. 19 is a graph showing a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by multi-specific binding proteins with BAFF-R binding sites derived from AB0898, AB0899, or AB0900.
- FIG. 20 shows graphs of differential scanning calorimetry (DSC) profiles of AB0898 (top panel), AB0899 (center panel), and AB0900 (bottom panel).
- FIG. 21 shows flow cytometry plots of binding of scFv clones expressed on yeast to biotinylated hBAFFR-Fc before (left) and after (right) challenge by incubation with 1 mM nonbiotinylated hBAFFR-Fc.
- FIG. 22 shows flow cytometry plots of binding of scFv clones expressed on yeast to biotinylated hBAFFR-Fc before (top) and after (bottom) challenge by incubation with ImM nonbiotinylated hBAFFR-Fc.
- Clones tested are (left-to-right) AB1080, AB1081, AB1084, AB1085, and ianalumab-based scFv.
- FIGs. 23A and 23B are graphs showing binding of indicated antibody clones to human (FIG. 23 A) or cynomolgus monkey (FIG. 23B) BAFF-R.
- FIGs. 24A and 24B detail a poly-specificity assay of a multi-specific binding proteins with a BAFF-R binding site derived from AB1080 or AB1081.
- FIG. 24A is a schematic of the assay.
- FIG. 24B shows graphs of AB 1080 (left panels), AB 1081 (middle-left panels), trastuzumab negative control (middle-right panels), or ixekizumab positive control (right panels) in the absence (top panels) or presence (bottom panels) of poly-specificity reagent (PSR).
- PSR poly-specificity reagent
- FIGs. 25A and 25B show graphs of a KHYG-l-CD16aV cytotoxicity assay of BJAB cells as induced by multi-specific binding proteins with BAFF-R binding sites derived from AB1080 (FIG. 25A) or AB1085 (FIG. 25B) compared to Tool positive control.
- FIG. 26 is a graph showing fluorescence outputs from a binding assay showing blockage of BAFF-biotin binding to human BAFF-R expressed on CHO cells by the indicated antibody clones.
- FIG. 27 shows graphs of nano-dual scanning fluorimetry (nanoDSF) analysis of multi-specific binding proteins with BAFF-R binding sites derived from AB 1080 (left panel), AB 1081 (center-left panel), AB 1084 (center-right panel), and AB 1085 (right panel).
- FIG. 28 shows a graph of hydrophobic interaction chromatography (HIC) analysis of multi-specific binding proteins with BAFF-R binding sites derived from indicated antibodies.
- HIC hydrophobic interaction chromatography
- FIG. 29 shows a graph of HIC analysis of AB1612 compared to indicated benchmark biologies.
- FIGs. 30A and 30B are graphs showing binding of indicated antibody clones to human (FIG. 30 A) or cynomolgus monkey (FIG. 30B) BAFF-R. DETAILED DESCRIPTION
- the present invention provides antigen-binding sites that bind human BAFF-R.
- Proteins and protein conjugates containing such antigen-binding sites for example, antibodies, antibody-drug conjugates, bispecific T-cell engagers (BiTEs), and immunocytokines, as well as immune effector cells (e.g., T cells) expressing a protein containing such an antigen-binding site (e.g., a chimeric antigen receptor (CAR)), are useful for treating BAFF-R-associated diseases such as cancer and autoimmune disease.
- a protein containing such an antigen-binding site e.g., a chimeric antigen receptor (CAR)
- CAR chimeric antigen receptor
- the term "antigen-binding site” refers to the part of the immunoglobulin molecule that participates in or is capable of antigen binding.
- the antigen-binding site is formed by amino acid residues of the N-terminal variable ("V") regions of the heavy ("H") and light (“L”) chains.
- V N-terminal variable
- H heavy
- L light
- Three highly divergent stretches within the V regions of the heavy and light chains are referred to as “hypervariable regions" which are interposed between more conserved flanking stretches known as “framework regions,” or "FR.”
- FR refers to amino acid sequences which are naturally found between and adjacent to hypervariable regions in immunoglobulins.
- the three hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three dimensional space to form an antigen-binding surface.
- the antigen-binding surface is complementary to the three-dimensional surface of a bound antigen, and the three hypervariable regions of each of the heavy and light chains are referred to as "complementarity-determining regions," or "CDRs.”
- CDRs complementarity-determining regions
- the antigen-binding site is formed by a single antibody chain providing a “single domain antibody.”
- Antigen-binding sites can exist in an intact antibody, in an antigen-binding fragment of an antibody that retains the antigen-binding surface, or in a recombinant polypeptide such as an scFv, using a peptide linker to connect the heavy chain variable domain to the light chain variable domain in a single polypeptide. All the amino acid positions in heavy or light chain variable regions disclosed herein are numbered according
- the CDRs of an antigen-binding site can be determined by the methods described in Kabat et al., J. Biol. Chem. 252, 6609-6616 (1977) and Kabat et al., Sequences of protein of immunological interest. (1991), Chothia et al., J. Mol. Biol. 196:901-917 (1987), and MacCallum et al., J. Mol. Biol. 262:732-745 (1996).
- the CDRs determined under these definitions typically include overlapping or subsets of amino acid residues when compared against each other.
- the term “CDR” is a CDR as defined by MacCallum et al., J. Mol. Biol.
- CDR is a CDR as defined by Kabat et al., J. Biol. Chem. 252, 6609-6616 (1977) and Kabat et al., Sequences of protein of immunological interest. (1991).
- heavy chain CDRs and light chain CDRs of an antibody are defined using different conventions.
- the heavy chain CDRs are defined according to MacCallum (supra), and the light CDRs are defined according to Kabat (supra).
- CDRH1, CDRH2 and CDRH3 denote the heavy chain CDRs
- CDRL1, CDRL2 and CDRL3 denote the light chain CDRs.
- the terms “subject” and “patient” refer to an organism to be treated by the methods and compositions described herein. Such organisms preferably include, but are not limited to, mammals (e.g., murines, simians, equines, bovines, porcines, canines, felines, and the like), and more preferably include humans.
- the term “effective amount” refers to the amount of a compound (e.g., a compound of the present invention) sufficient to effect beneficial or desired results.
- An effective amount can be administered in one or more administrations, applications or dosages and is not intended to be limited to a particular formulation or administration route.
- the term “treating” includes any effect, e.g., lessening, reducing, modulating, ameliorating or eliminating, that results in the improvement of the condition, disease, disorder, and the like, or ameliorating a symptom thereof.
- the term “pharmaceutical composition” refers to the combination of an active agent with a carrier, inert or active, making the composition especially suitable for diagnostic or therapeutic use in vivo or ex vivo.
- pharmaceutically acceptable carrier refers to any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water, emulsions (e.g., such as an oil/water or water/oil emulsions), and various types of wetting agents.
- the compositions also can include stabilizers and preservatives.
- the term “pharmaceutically acceptable salt” refers to any pharmaceutically acceptable salt (e.g., acid or base) of a compound of the present invention which, upon administration to a subject, is capable of providing a compound of this invention or an active metabolite or residue thereof.
- salts of the compounds of the present invention may be derived from inorganic or organic acids and bases.
- Exemplary acids include, but are not limited to, hydrochloric, hydrobromic, sulfuric, nitric, perchloric, fumaric, maleic, phosphoric, glycolic, lactic, salicylic, succinic, toluene-p-sulfonic, tartaric, acetic, citric, methanesulfonic, ethanesulfonic, formic, benzoic, malonic, naphthalene-2- sulfonic, benzenesulfonic acid, and the like.
- Other acids such as oxalic, while not in themselves pharmaceutically acceptable, may be employed in the preparation of salts useful as intermediates in obtaining the compounds of the present invention and their pharmaceutically acceptable acid addition salts.
- Exemplary bases include, but are not limited to, alkali metal (e.g., sodium) hydroxides, alkaline earth metal (e.g., magnesium) hydroxides, ammonia, and compounds of formula NWf, wherein W is Ci-4 alkyl, and the like.
- alkali metal e.g., sodium
- alkaline earth metal e.g., magnesium
- ammonia e.g., ammonia
- compounds of formula NWf wherein W is Ci-4 alkyl, and the like.
- Exemplary salts include, but are not limited to: acetate, adipate, alginate, aspartate, benzoate, benzenesulfonate, bisulfate, butyrate, citrate, camphorate, camphorsulfonate, cyclopentanepropionate, digluconate, dodecyl sulfate, ethanesulfonate, fumarate, flucoheptanoate, glycerophosphate, hemisulfate, heptanoate, hexanoate, hydrochloride, hydrobromide, hydroiodide, 2-hydroxyethanesulfonate, lactate, maleate, methanesulfonate, 2- naphthalenesulfonate, nicotinate, oxalate, palmoate, pectinate, persulfate, phenylpropionate, picrate, pivalate, propionate, succinate, tartrate,
- salts include anions of the compounds of the present invention compounded with a suitable cation such as Na + , NH4 + , and NW4 + (wherein W is a Ci-4 alkyl group), and the like.
- a suitable cation such as Na + , NH4 + , and NW4 + (wherein W is a Ci-4 alkyl group), and the like.
- salts of the compounds of the present invention are contemplated as being pharmaceutically acceptable. However, salts of acids and bases that are non- pharmaceutically acceptable may also find use, for example, in the preparation or purification of a pharmaceutically acceptable compound.
- BAFF-R also known as BAFF receptor, B-cell activating factor receptor, BR3, TNFRSF13C, tumor necrosis factor receptor superfamily member 13C, TNF receptor superfamily member 13C, CD268, and BLyS receptor 3
- BAFF receptor also known as BAFF receptor, B-cell activating factor receptor, BR3, TNFRSF13C, tumor necrosis factor receptor superfamily member 13C, TNF receptor superfamily member 13C, CD268, and BLyS receptor 3
- BAFF-R also known as BAFF receptor, B-cell activating factor receptor, BR3, TNFRSF13C, tumor necrosis factor receptor superfamily member 13C, TNF receptor superfamily member 13C, CD268, and BLyS receptor 3
- compositions are described as having, including, or comprising specific components, or where processes and methods are described as having, including, or comprising specific steps, it is contemplated that, additionally, there are compositions of the present invention that consist essentially of, or consist of, the recited components, and that there are processes and methods according to the present invention that consist essentially of, or consist of, the recited processing steps.
- compositions specifying a percentage are by weight unless otherwise specified. Further, if a variable is not accompanied by a definition, then the previous definition of the variable controls.
- the present invention provides an antigen-binding site that binds human BAFF-R.
- the VH, VL, CDR, and scFv sequences of exemplary antigen-binding sites are listed in Table 1.
- the CDR sequences are identified according to the Chothia numbering scheme.
- the antigen-binding site of the present invention comprises an antibody heavy chain variable domain (VH) that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH of an antibody disclosed in Table 1, and an antibody light chain variable domain (VL) that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH of the same antibody disclosed in Table 1.
- VH antibody heavy chain variable domain
- VL antibody light chain variable domain
- the antigen-binding site comprises the heavy chain CDR1, CDR2, and CDR3 and the light chain CDR1, CDR2, and CDR3, determined under Kabat (see Kabat et al., (1991) Sequences of Proteins of Immunological Interest, NTH Publication No. 91-3242, Bethesda), Chothia (see, e.g., Chothia C & Lesk A M, (1987), J Mol Biol 196: 901-917), MacCallum (see MacCallum R M et al., (1996) J Mol Biol 262: 732-745), or any other CDR determination method known in the art, of the VH and VL sequences of an antibody discloses in Table 1.
- the antigen-binding site comprises the heavy chain CDR1, CDR2, and CDR3 and the light chain CDR1, CDR2, and CDR3 of an antibody disclosed in Table 1.
- the antigen-binding site of the present invention comprises a VH comprising CDR1, CDR2, and CDR3 amino acid sequences of SEQ ID NO:50, SEQ ID NO:51, and SEQ ID NO:52, respectively.
- the antigen-binding site of the present invention comprises a VL comprising CDR1, CDR2, and CDR3 amino acid sequences of SEQ ID NO:4, SEQ ID NO:5, and SEQ ID NO:49, respectively.
- the antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 50, 51, and 52, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 49, respectively.
- the antigen-binding site of the present invention is derived from AB0369.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:77, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:63.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 1, 2, and 3, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 1, 2, and 3, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site of the present invention is derived from 1203 A01.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 1, 2, and 7, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 8, 9, and 6, respectively.
- the antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 1, 2, and 7, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 8, 9, and 6, respectively.
- the antigen-binding site of the present invention is derived from 1203 A02.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 10, 2, and 11, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 12, respectively.
- the antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 10, 2, and 11, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 12, respectively.
- the antigen-binding site of the present invention comprises a VH comprising CDR1, CDR2, and CDR3 amino acid sequences of SEQ ID NO:1, SEQ ID NO:2, and SEQ ID NO: 16.
- the antigen-binding site of the present invention comprises a VL comprising CDR1, CDR2, and CDR3 amino acid sequences of SEQ ID NO:4, SEQ ID NO:5, and SEQ ID NO:6, respectively.
- the antigenbinding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 1, 2, and 16, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site of the present invention is derived from AB0605scFv.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 64, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:63.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 1, 2, and 13, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 1, 2, and 13, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site of the present invention is derived from AB0606scFv.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:65, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:63.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 1, 2, and 14, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 1, 2, and 14, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site of the present invention is derived from AB0622scFv.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 66, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:63.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 1, 2, and 15, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 1, 2, and 15, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site of the present invention comprises a VH comprising CDR1, CDR2, and CDR3 amino acid sequences of SEQ ID NO:21, SEQ ID NO:2, and SEQ ID NO:22.
- the antigen-binding site of the present invention comprises a VL comprising CDR1, CDR2, and CDR3 amino acid sequences of SEQ ID NON, SEQ ID NO:5, and SEQ ID NO:6, respectively.
- the antigenbinding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 21, 2, and 22, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site of the present invention is derived from AB0679scFv.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 67, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:63.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 17, 2 and 14, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 17, 2, and 14, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site of the present invention is derived from AB0681scFv.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 68, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:63.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 18, 2, and 19, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 18, 2, and 19, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site of the present invention is derived from AB0682scFv.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 69, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:63.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 20, 2, and 14, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 20, 2, and 14, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site of the present invention comprises a VH comprising CDR1, CDR2, and CDR3 amino acid sequences of SEQ ID NO:20, SEQ ID NO:23, and SEQ ID NO:26. In certain embodiments, the antigen-binding site of the present invention comprises a VL comprising CDR1, CDR2, and CDR3 amino acid sequences of SEQ ID NON, SEQ ID NO:5, and SEQ ID N0:6, respectively.
- the antigenbinding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 20, 23, and 26, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site of the present invention is derived from AB0898.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:70, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:63.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 20, 23, and 32, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 20, 23, and 32, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site of the present invention is derived from AB0899.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:71, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:63.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 20, 23, and 24, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 20, 23, and 24, respectively.
- the antigen- binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 20, 23, and 24, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site of the present invention is derived from AB0900.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 72, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:63.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 20, 23, and 25, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 20, 23, and 25, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site of the present invention comprises a VH comprising CDR1, CDR2, and CDR3 amino acid sequences of SEQ ID NO:35, SEQ ID NO:36, and SEQ ID NO:37.
- the antigen-binding site of the present invention comprises a VL comprising CDR1, CDR2, and CDR3 amino acid sequences of SEQ ID NON, SEQ ID NO:5, and SEQ ID NO:49, respectively.
- the antigenbinding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 35, 36, and 37, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site of the present invention is derived from AB1080scFv.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 73, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:43.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 1, 23, and 27, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 39, respectively.
- the antigenbinding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 1, 23, and 27, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 39, respectively.
- the antigen-binding site of the present invention is derived from AB1081scFv.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 74, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:43.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 28, 29, and 30, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 39, respectively.
- the antigenbinding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 28, 29, and 30, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 39, respectively.
- the antigen-binding site of the present invention is derived from AB1084scFv.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:75, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:43.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 31, 23, and 32, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 39, respectively.
- the antigenbinding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 31, 23, and 32, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 39, respectively.
- the antigen-binding site of the present invention is derived from AB1085scFv.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:76, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:63.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 33, 2, and 34, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 33, 2, and 34, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively.
- the antigen-binding site of the present invention comprises a VH comprising CDR1, CDR2, and CDR3 amino acid sequences of SEQ ID NO:46, SEQ ID NO:47, and SEQ ID NO:48.
- the antigen-binding site of the present invention comprises a VL comprising CDR1, CDR2, and CDR3 amino acid sequences of SEQ ID NON, SEQ ID NO:5, and SEQ ID NO:49, respectively.
- the antigen- binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 46, 47, and 48, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 49, respectively.
- the antigen-binding site of the present invention is derived from AB1424 or AB1612.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:40, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:41.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:42, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:43.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 1, 23, and 38, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 39, respectively.
- the antigenbinding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 1, 23, and 38, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 4, 5, and 39, respectively.
- the antigen-binding site is present as an scFv, wherein the scFv comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 44 or 45.
- the scFv comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 44 or 45.
- the antigen-binding site of the present invention is derived from 3 AL
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:54, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:55.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80, 81, and 82, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 83, 84, and 85, respectively.
- the antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80, 81, and 82, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 83, 84, and 85, respectively.
- the antigen-binding site of the present invention is derived from 7G4.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:56, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:57.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80, 86, and 87, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 83, 84, and 85, respectively.
- the antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 80, 86, and 87, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 83, 84, and 85, respectively.
- the antigen-binding site of the present invention is derived from 1B3-A7.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 58, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:59.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 88, 89, and 90, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 91, 92, and 93, respectively.
- the antigenbinding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 88, 89, and 90, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 91, 92, and 93, respectively.
- the antigen-binding site of the present invention is derived from 10H7-C5.
- the antigen-binding site of the present invention comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 60, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:79.
- the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 94, 95, and 96, respectively.
- the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 97, 92, and 53, respectively.
- the antigenbinding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 94, 95, and 96, respectively; and (b) a VL that comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 97, 92, and 53, respectively.
- VH and/or VL sequences that together bind BAFF-R may contain amino acid alterations (e.g., at least 1, 2, 3, 4, 5, or 10 amino acid substitutions, deletions, or additions) in the framework regions of the VH and/or VL without affecting their ability to bind to BAFF-R significantly.
- amino acid alterations e.g., at least 1, 2, 3, 4, 5, or 10 amino acid substitutions, deletions, or additions
- the antigen-binding site of the present invention binds human BAFF-R with a KD (z.e., dissociation constant) of 1 nM or lower, 5 nM or lower, 10 nM or lower, 15 nM or lower, or 20 nM or lower, as measured by surface plasmon resonance (SPR) (e.g., using the method described in Example 1 infra) or by bio-layer interferometry (BLI), and/or binds BAFF-R from a body fluid, tissue, and/or cell of a subject.
- SPR surface plasmon resonance
- BBI bio-layer interferometry
- an antigen-binding site of the present invention has a Kd (z.e., off-rate, also called K O ff) equal to or lower than 1 x 10' 5 , 1 x 10' 4 , 1 x 10' 3 , 5 x 10' 3 , 0.01, 0.02, or 0.05 1/s, as measured by SPR (e.g., using the method described in Example 1 infra) or by BLI.
- Kd z.e., off-rate, also called K O ff
- the antigen-binding site of the present invention binds cynomolgus BAFF-R with a KD (z.e., dissociation constant) of 5 nM or lower, 10 nM or lower, 15 nM or lower, 20 nM or lower, or 30 nM or lower, as measured by surface plasmon resonance (SPR) (e.g., using the method described in Example 1 infra) or by bio-layer interferometry (BLI), and/or binds BAFF-R from a body fluid, tissue, and/or cell of a subject.
- SPR surface plasmon resonance
- BBI bio-layer interferometry
- an antigen-binding site of the present invention has a Kd (z.e., off-rate, also called K O ff) equal to or lower than 1 x 10' 3 , 5 x 10' 3 , 0.01, 0.02, or 0.03 1/s, as measured by SPR (e.g., using the method described in Example 1 infra) or by BLI.
- Kd z.e., off-rate, also called K O ff
- the present invention provides an antigen-binding site that competes for binding to BAFF-R (e.g., human BAFF-R) with an antigen-binding site described above.
- BAFF-R e.g., human BAFF-R
- the antigen-binding site of the present invention competes with an antigen-binding site derived from AB 1424 disclosed above for binding to BAFF-R.
- the antigen-binding site competes with AB 1424 for binding to BAFF-R.
- the antigen-binding site of the present invention competes with an antigen-binding site derived from a humanized AB 1423 disclosed above for binding to BAFF-R.
- the antigen-binding site competes with a humanized AB 1424 for binding to BAFF- R. In certain embodiments, the antigen-binding site of the present invention competes with an antigen-binding site derived from AB1612 disclosed above for binding to BAFF-R. In one embodiment, the antigen-binding site competes with AB 1612 for binding to BAFF-R. In certain embodiments, the antigen-binding site of the present invention competes with an antigen-binding site derived from a humanized AB1612 disclosed above for binding to BAFF-R. In one embodiment, the antigen-binding site competes with a humanized AB 1612 for binding to BAFF- R.
- the antigen-binding site of the present invention competes with an antigen-binding site derived from AB0369, 1203_A01, 1203_A02, AB0605, AB0606, AB0622, AB0679, AB0681, AB0682, AB0898, AB0899, AB0900, AB1080, AB1081, AB1084, AB1085, 3A1, 7G4, 1B3-A7, or 10H7-C5 disclosed above for binding to BAFF-R.
- the antigen-binding site competes with AB0369, 1203_A01, 1203_A02, AB0605, AB0606, AB0622, AB0679, AB0681, AB0682, AB0898, AB0899, AB0900, AB1080, AB1081, AB1084, AB1085, 3A1, 7G4, 1B3-A7, or 10H7-C5 for binding to BAFF-R.
- An antigen-binding site disclosed herein can be present in an antibody or antigenbinding fragment thereof.
- the antibody can be a monoclonal antibody, a chimeric antibody, a diabody, a Fab fragment, a Fab’ fragment, or F(ab’)2 fragment, an Fv, a bispecific antibody, a bispecific Fab2, a bispecific (mab)2, a humanized antibody, an artificially-generated human antibody, bispecific T-cell engager, bispecific NK cell engager, a single chain antibody (e.g., single-chain Fv fragment or scFv), triomab, knobs-into-holes (kih) IgG with common light chain, crossmab, ortho-Fab IgG, DVD-Ig, 2 in 1-IgG, IgG-scFv, sdFv2-Fc, bi-nanobody, tandAb, dualaffinity retargeting antibody (DART), DART-Fc, DART
- the single-chain variable fragment (scFv) described above includes a heavy chain variable domain and a light chain variable domain.
- the heavy chain variable domain forms a disulfide bridge with the light chain variable domain to enhance stability of the scFv.
- a disulfide bridge can be formed between the C44 residue of the heavy chain variable domain and the Cl 00 residue of the light chain variable domain, the amino acid positions numbered under Kabat.
- the heavy chain variable domain is linked to the light chain variable domain via a flexible linker. Any suitable linker can be used, for example, the (G4S)4 linker ((GlyGlyGlyGlySer)4 (SEQ ID NO:98).
- the heavy chain variable domain is positioned at the N-terminus of the light chain variable domain. In some embodiments of the scFv, the heavy chain variable domain is positioned at the C terminus of the light chain variable domain.
- a VH and a VL can be connected by a linker, e.g., (GlyGlyGlyGlySer)4 i.e. (G4S)4 linker (SEQ ID NO:98).
- a linker e.g., (GlyGlyGlyGlySer)4 i.e. (G4S)4 linker (SEQ ID NO:98).
- G4S G4S
- the length of the linker (e.g., flexible linker) can be “short,” e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 amino acid residues, or “long,” e.g., at least 13 amino acid residues.
- the linker is 10-50, 10-40, 10-30, 10-25, 10-20, 15-50, 15-40, 15-30, 15-25, 15-20, 20-50, 20-40, 20-30, or 20-25 amino acid residues in length.
- the linker comprises or consists of a (GS)n (SEQ ID NO:
- the linker comprises or consists of an amino acid sequence selected from SEQ ID NO:98-108 as listed in Table 2
- an antigen-binding site disclosed herein is linked to an amino acid sequence at least 90% (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to an antibody constant region, e.g., the heavy chain constant regions of IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE; particularly, chosen from, e.g., the (e.g., human) heavy chain constant regions of IgGl, IgG2, IgG3, and IgG4.
- an antibody constant region e.g., the heavy chain constant regions of IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE; particularly, chosen from, e.g., the (e.g., human) heavy chain constant regions of IgGl, IgG2, IgG3,
- an antigen-binding site disclosed herein can be linked to a light chain constant region chosen from, e.g., the (e.g., human) light chain constant regions of kappa or lambda.
- the constant region can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, and/or complement function).
- the antibody has effector function and can fix complement.
- the antibody does not recruit effector cells or fix complement.
- the antibody has reduced or no ability to bind an Fc receptor. For example, it is an isotype or subtype, fragment or other mutant, which does not support binding to an Fc receptor, e.g., it has a mutagenized or deleted Fc receptor binding region.
- the antigen-binding site is linked to an IgG constant region including hinge, CH2 and CH3 domains with or without a CHI domain.
- the amino acid sequence of the constant region is at least 90% (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to a human antibody constant region, such as an human IgGl constant region, a human IgG2 constant region, a human IgG3 constant region, or a human IgG4 constant region.
- the antibody Fc domain or a portion thereof sufficient to bind CD16 comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to wild-type human IgGl Fc sequence DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSPG (SEQ ID NO:61).
- the amino acid sequence of the constant region is at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to an antibody constant region from another mammal, such as rabbit, dog, cat, mouse, or horse.
- One or more mutations can be incorporated into the constant region as compared to human IgGl constant region, for example at Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, N390, K392, T394, D399, S400, D401, F405, Y407, K409, T411 and/or K439.
- substitutions include, for example, Q347E, Q347R, Y349S, Y349K, Y349T, Y349D, Y349E, Y349C, T350V, L351K, L351D, L351Y, S354C, E356K, E357Q, E357L, E357W, K360E, K360W, Q362E, S364K, S364E, S364H, S364D, T366V, T366I, T366L, T366M, T366K, T366W, T366S, L368E, L368A, L368D, K370S, N390D, N390E, K392L, K392M, K392V, K392F, K392D, K392E, T394F, T394W, D399R, D399K, D399V, S400K,
- the antigen-binding site is linked to a portion of an antibody Fc domain sufficient to bind CD16.
- CD16 binding is mediated by the hinge region and the CH2 domain.
- the interaction with CD 16 is primarily focused on amino acid residues Asp 265 - Glu 269, Asn 297 - Thr 299, Ala 327 - He 332, Leu 234 - Ser 239, and carbohydrate residue N-acetyl-D-glucosamine in the CH2 domain (see, Sondermann et al., Nature, 406 (6793):267-273).
- mutations can be selected to enhance or reduce the binding affinity to CD 16, such as by using phage-displayed libraries or yeast surface-displayed cDNA libraries, or can be designed based on the known three-dimensional structure of the interaction.
- mutations that can be incorporated into the CHI of a human IgGl constant region may be at amino acid V125, F126, P127, T135, T139, A140, F170, P171, and/or VI 73.
- mutations that can be incorporated into the CK of a human IgGl constant region may be at amino acid E123, Fl 16, S176, V163, S 174, and/or T 164.
- the antibody constant domain comprises a CH2 domain and a CH3 domain of an IgG antibody, for example, a human IgGl antibody.
- mutations are introduced in the antibody constant domain to enable heterodimerization with another antibody constant domain.
- the antibody constant domain can comprise an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to amino acids 234-332 of a human IgGl antibody, and differs at one or more positions selected from the group consisting of Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, N390, K392, T394, D399, S400, D401, F405, Y407, K409, T411, and K439. All the amino acid positions in an Fc domain or hinge region disclosed herein are numbered according to EU numbering.
- Fc domain heterodimerization is contemplated. Mutations (e.g., amino acid substitutions) in the Fc domain that promote heterodimerization are described, for example, in International Application Publication No. WO2019157366, which is not incorporated herein by reference.
- a first nucleic acid sequence encoding the first immunoglobulin heavy chain can be cloned into a first expression vector; a second nucleic acid sequence encoding the second immunoglobulin heavy chain can be cloned into a second expression vector; a third nucleic acid sequence encoding the first immunoglobulin light chain can be cloned into a third expression vector; a fourth nucleic acid sequence encoding the second immunoglobulin light chain can be cloned into a fourth expression vector; the first, second, third and fourth expression vectors can be stably transfected together into host cells to produce the multimeric proteins.
- Clones can be cultured under conditions suitable for bio-reactor scale-up and maintained for expression of a protein comprising an antigen-binding site disclosed herein.
- the protein can be isolated and purified using methods known in the art including centrifugation, depth filtration, cell lysis, homogenization, freeze-thawing, affinity purification, gel filtration, ion exchange chromatography, hydrophobic interaction exchange chromatography, and mixedmode chromatography.
- the present invention provides one or more isolated nucleic acids comprising sequences encoding an immunoglobulin heavy chain and/or immunoglobulin light chain variable region of any one of the foregoing antibodies.
- the invention provides one or more expression vectors that express the immunoglobulin heavy chain and/or immunoglobulin light chain variable region of any one of the foregoing antibodies.
- the invention provides host cells comprising one or more of the foregoing expression vectors and/or isolated nucleic acids.
- the antibody binds BAFF-R with a KD of 25 nM, 20 nM, 15 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, 1 nM, 0.1 nM or lower, as measured using standard binding assays, for example, surface plasmon resonance or bio-layer interferometry.
- an antibody as disclosed herein binds BAFF-R with a KD less than 5 nM.
- the antibody binds BAFF-R from a body fluid, tissue and/or cell of a subject.
- an antibody as disclosed herein inhibits (e.g., blocks) binding of BAFF-R to BAFF (e.g., by at least 50%, 75%, 90%, 95% or 99% as measured in a competitive binding assay).
- Competition assays for determining whether an antibody binds to the same epitope as, or competes for binding with a disclosed antibody are known in the art.
- Exemplary competition assays include immunoassays (e.g., ELISA assays, RIA assays), surface plasmon resonance (e.g., BIAcore analysis), bio-layer interferometry, and flow cytometry.
- a competition assay involves the use of an antigen (e.g., a human BAFF-R protein or fragment thereof) bound to a solid surface or expressed on a cell surface, a test BAFF- R-binding antibody and a reference antibody.
- an antigen e.g., a human BAFF-R protein or fragment thereof
- the reference antibody is labeled and the test antibody is unlabeled.
- Competitive inhibition is measured by determining the amount of labeled reference antibody bound to the solid surface or cells in the presence of the test antibody.
- test antibody is present in excess (e.g., lx, 5x, lOx, 20x or lOOx).
- Antibodies identified by competition assay include antibodies binding to the same epitope, or similar (e.g., overlapping) epitopes, as the reference antibody, and antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antibody for steric hindrance to occur.
- a competition assay can be conducted in both directions to ensure that the presence of the label does not interfere or otherwise inhibit binding. For example, in the first direction the reference antibody is labeled and the test antibody is unlabeled, and in the second direction, the test antibody is labeled and the reference antibody is unlabeled.
- a test antibody competes with the reference antibody for specific binding to the antigen if an excess of one antibody (e.g., lx, 5x, lOx, 20x or lOOx) inhibits binding of the other antibody, e.g., by at least 50%, 75%, 90%, 95% or 99% as measured in a competitive binding assay.
- one antibody e.g., lx, 5x, lOx, 20x or lOOx
- Two antibodies may be determined to bind to the same epitope if essentially all amino acid mutations in the antigen that reduce or eliminate binding of one antibody reduce or eliminate binding of the other. Two antibodies may be determined to bind to overlapping epitopes if only a subset of the amino acid mutations that reduce or eliminate binding of one antibody reduce or eliminate binding of the other.
- the antibodies disclosed herein may be further optimized (e.g., affinity-matured) to improve biochemical characteristics including affinity and/or specificity, improve biophysical properties including aggregation, stability, precipitation and/or non-specific interactions, and/or to reduce immunogenicity.
- affinity-maturation procedures are within ordinary skill in the art.
- diversity can be introduced into an immunoglobulin heavy chain and/or an immunoglobulin light chain by DNA shuffling, chain shuffling, CDR shuffling, random mutagenesis and/or site-specific mutagenesis.
- isolated human antibodies contain one or more somatic mutations.
- antibodies can be modified to a human germline sequence to optimize the antibody e.g., by a process referred to as germlining).
- an optimized antibody has at least the same, or substantially the same, affinity for the antigen as the non-optimized (or parental) antibody from which it was derived.
- an optimized antibody has a higher affinity for the antigen when compared to the parental antibody.
- the antibody is for use as a therapeutic, it can be conjugated to an effector agent such as a small molecule toxin or a radionuclide using standard in vitro conjugation chemistries. If the effector agent is a polypeptide, the antibody can be chemically conjugated to the effector or joined to the effector as a fusion protein. Construction of fusion proteins is within ordinary skill in the art.
- the antibody can be conjugated to an effector moiety such as a small molecule toxin or a radionuclide using standard in vitro conjugation chemistries. If the effector moiety is a polypeptide, the antibody can be chemically conjugated to the effector or joined to the effector as a fusion protein. Construction of fusion proteins is within ordinary skill in the art.
- CAR T cells BAFF-R/CD3-directed bispecific T-cell engagers, immunocytokines, antibodydrug conjugates, and immunotoxins
- Another aspect of the present invention provides a molecule or complex comprising an antigen-binding site that binds BAFF-R as disclosed herein.
- exemplary molecules or complexes include but are not limited to chimeric antigen receptors (CARs), T-cell engagers (e.g., BAFF-R/CD3 -directed bispecific T-cell engagers), immunocytokines, antibody-drug conjugates, and immunotoxins.
- any antigen-binding site that binds BAFF-R as disclosed herein can be used.
- the VH, VL, and/or CDR sequences of the antigen-binding site that binds BAFF-R are provided in Table 1.
- the antigen-binding site that binds BAFF-R is an scFv.
- the scFv comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) identical to an amino acid sequence selected from SEQ ID NOs: 44 and 45.
- the scFv comprises an amino acid sequence selected from SEQ ID NOs: 44 and 45.
- the antigen-binding site that binds BAFF-R in the molecule or complex comprises a heavy chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: 1, 23, and 38, respectively; and a light chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: 4, 5, and 39, respectively.
- the antigen-binding site comprises a heavy chain variable domain with an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:40 or 42; and a light chain variable domain with an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:41 or 43.
- the antigen-binding site comprises an scFv comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:44 or SEQ ID NO:45.
- the antigen-binding site comprises an scFv comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:44.
- the present invention provides a BAFF-R-targeting CAR comprising an antigen-binding site that binds BAFF-R as disclosed herein (see, e.g., Table 1).
- the BAFF-R-targeting CAR can comprise a Fab fragment or an scFv.
- chimeric antigen receptor or alternatively a “CAR” refers to a recombinant polypeptide construct comprising at least an extracellular antigen binding domain, a transmembrane domain and an intracellular signaling domain comprising a functional signaling domain derived from a stimulatory molecule (also referred to herein as a “primary signaling domain”).
- the CAR comprises an extracellular antigenbinding site that binds BAFF-R as disclosed herein, a transmembrane domain, and an intracellular signaling domain comprising a primary signaling domain.
- the CAR further comprises one or more functional signaling domains derived from at least one costimulatory molecule (also referred to as a “costimulatory signaling domain”).
- the CAR comprises a chimeric fusion protein comprising an antigen-binding site that binds BAFF-R (e.g., BAFF-R-binding scFv) disclosed herein as an extracellular antigen binding domain, a transmembrane domain, and an intracellular signaling domain comprising a primary signaling domain.
- BAFF-R e.g., BAFF-R-binding scFv
- the CAR comprises a chimeric fusion protein comprising an antigen-binding site that binds BAFF-R (e.g., BAFF-R- binding scFv) disclosed herein as an extracellular antigen binding domain, a transmembrane domain, and an intracellular signaling domain comprising a costimulatory signaling domain and a primary signaling domain.
- BAFF-R e.g., BAFF-R- binding scFv
- the CAR comprises a chimeric fusion protein comprising an antigen-binding site that binds BAFF-R (e.g., BAFF-R-binding scFv) disclosed herein as an extracellular antigen binding domain, a transmembrane domain, and an intracellular signaling domain comprising two costimulatory signaling domains and a primary signaling domain.
- BAFF-R e.g., BAFF-R-binding scFv
- the CAR comprises a chimeric fusion protein comprising an antigen-binding site that binds BAFF-R (e.g., BAFF-R-binding scFv) disclosed herein as an extracellular antigen binding domain, a transmembrane domain, and an intracellular signaling domain comprising at least two costimulatory signaling domains and a primary signaling domain.
- BAFF-R e.g., BAFF-R-binding scFv
- the extracellular antigen binding domain comprises an antigen-binding site (e.g., an scFv) comprising a heavy chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: 1, 23, and 38, respectively; and a light chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: 4, 5, and 39, respectively.
- an antigen-binding site e.g., an scFv
- a heavy chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: 1, 23, and 38, respectively
- a light chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: 4, 5, and 39, respectively.
- the antigen-binding site comprises a heavy chain variable domain with an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:40 or 42; and a light chain variable domain with an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:41 or 43.
- the antigen-binding site comprises an scFv comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:44 or SEQ ID NO:45.
- the antigen-binding site comprises an scFv comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO:44.
- the CAR is designed to comprise a transmembrane domain that is fused to the extracellular domain of the CAR.
- the transmembrane domain is one that naturally is associated with one of the domains in the CAR.
- the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
- the transmembrane domain is capable of homodimerization with another CAR on the CAR T cell surface.
- the amino acid sequence of the transmembrane domain may be modified or substituted so as to minimize interactions with the binding domains of the native binding partner present in the same CAR T cell.
- the transmembrane domain may be derived from any naturally occurring membranebound or transmembrane protein.
- the transmembrane region is capable of signaling to the intracellular domain(s) whenever the CAR has bound to a target.
- the transmembrane domain comprises the transmembrane region(s) of one or more proteins selected from the group consisting of TCR a chain, TCR P chain, TCR C, chain, CD28, CD3s, CD45, CD4, CD5, CD8, CD9, CD16, CD22, BAFF-R, CD37, CD64, CD80, CD86, CD134, CD137, and CD154.
- the transmembrane domain comprises the transmembrane region(s) of one or more proteins selected from the group consisting of KIRDS2, 0X40, CD2, CD27, LFA-1 (CDl la, CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD 160, CD 19, IL2Rp, ZL2Ry, IL7Ra, ITGA1, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CDl ld, ITGAE, CD103, ITGAL, CDl la, LFA-1, ITGAM, CDl lb, ITGAX, CDl lc, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, TNFR2, DNAM1 (
- the extracellular BAFF-R-binding domain (e.g., BAFF-R-binding scFv domain) domain can be connected to the transmembrane domain by a hinge region.
- a variety of hinges can be employed, including but not limited to the human Ig (immunoglobulin) hinge (e.g., an IgG4 hinge, an IgD hinge), a Gly-Ser linker, a (G4S)4 linker, a KIR2DS2 hinge, and a CD8a hinge.
- the intracellular signaling domain of the CAR of the present invention is responsible for activation of at least one of the specialized functions of the immune cell (e.g., cytolytic activity or helper activity, including the secretion of cytokines, of a T cell) in which the CAR has been placed in.
- the term “intracellular signaling domain” refers to the portion of a protein which transduces an effector function signal and directs the cell to perform a specialized function.
- the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain.
- intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
- the intracellular signaling domain of the CAR comprises a primary signaling domain (i.e., a functional signaling domain derived from a stimulatory molecule) and one or more costimulatory signaling domains (i.e., functional signaling domains derived from at least one costimulatory molecule).
- a primary signaling domain i.e., a functional signaling domain derived from a stimulatory molecule
- costimulatory signaling domains i.e., functional signaling domains derived from at least one costimulatory molecule
- the term “stimulatory molecule” refers to a molecule expressed by an immune cell, e.g., a T cell, an NK cell, or a B cell, that provide the cytoplasmic signaling sequence(s) that regulate activation of the immune cell in a stimulatory way for at least some aspect of the immune cell signaling pathway.
- the signal is a primary signal that is initiated by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with a peptide, and which leads to mediation of a T cell response, including, but not limited to, proliferation, activation, differentiation, and the like.
- Primary signaling domains that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or IT AMs.
- IT AM containing cytoplasmic signaling sequences that are of particular use in the present invention include those derived from CD3 zeta, common FcR gamma (FCER1G), Fc gamma Rlla, FcR beta (Fc Epsilon Rib), CD3 gamma, CD3 delta, CD3 epsilon, CD79a, CD79b, DAP10, and DAP12.
- the primary signaling domain in any one or more CARs of the present invention comprises a cytoplasmic signaling sequence derived from CD3- zeta.
- the primary signaling domain is a functional signaling domain of TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, CD66d, 4-1BB, and/or CD3-zeta.
- the intracellular signaling domain comprises a functional signaling domain of CD3 zeta, common FcR gamma (FCER1G), Fc gamma Rlla, FcR beta (Fc Epsilon Rib), CD3 gamma, CD3 delta, CD3 epsilon, CD79a, CD79b, DAP10, and/or DAP12.
- the primary signaling domain is a functional signaling domain of the zeta chain associated with the T cell receptor complex.
- costimulatory molecule refers to a cognate binding partner on a T cell that specifically binds with a costimulatory ligand, thereby mediating a costimulatory response by the T cell, such as, but not limited to, proliferation.
- a costimulatory molecule is a cell surface molecule other than an antigen receptor or its ligands that is required for an efficient response of lymphocytes to an antigen.
- Examples of such molecules include CD27, CD28, 4- 1BB (CD137), 0X40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1, CD1 la/CD18), CD2, CD7, CD258 (LIGHT), NKG2C, B7-H3, and a ligand that specifically binds with CD83, and the like.
- costimulatory molecules include CD5, ICAM-1, GITR, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD160, CD19, CD4, CD8alpha, CD8beta, IL2Rbeta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CDl ld, ITGAE, CD103, ITGAL, CDl la, LFA-1, ITGAM, CDl lb, ITGAX, CDl lc, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, NKG2D, NKG2C, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile
- the costimulatory signaling domain of the CAR is a functional signaling domain of a costimulatory molecule described herein, e.g., 0X40, CD27, CD28, CD30, CD40, PD-1, CD2, CD7, CD258, NKG2C, B7-H3, a ligand that binds to CD83, ICAM-1, LFA-1 (CD1 la/CD18), ICOS and 4- 1BB (CD137), or any combination thereof.
- a costimulatory molecule described herein e.g., 0X40, CD27, CD28, CD30, CD40, PD-1, CD2, CD7, CD258, NKG2C, B7-H3, a ligand that binds to CD83, ICAM-1, LFA-1 (CD1 la/CD18), ICOS and 4- 1BB (CD137), or any combination thereof.
- signaling domain refers to the functional portion of a protein which acts by transmitting information within the cell to regulate cellular activity via defined signaling pathways by generating second messengers or functioning as effectors by responding to such messengers.
- cytoplasmic signaling sequences within the cytoplasmic signaling portion of the CAR of the present invention may be linked to each other in a random or specified order.
- a short oligo- or polypeptide linker for example, between 2 and 10 amino acids in length may form the linkage.
- Another aspect of the present invention provides a nucleic acid encoding a BAFF-R- targeting CAR disclosed herein.
- the nucleic acid is useful for expressing the CAR in an effector cell e.g., T cell) by introducing the nucleic acid to the cell.
- Modifications may be made in the sequence to create an equivalent or improved variant of the present invention, for example, by changing one or more of the codons according to the codon degeneracy table.
- a DNA codon degeneracy table is provided in Table 3.
- the nucleic acid is a DNA molecule (e.g., a cDNA molecule).
- the nucleic acid further comprises an expression control sequence (e.g., promoter and/or enhancer) operably linked to the CAR coding sequence.
- the present invention provides a vector comprising the nucleic acid.
- the vector can be a viral vector (e.g., AAV vector, lentiviral vector, or adenoviral vector) or a non-viral vector (e.g., plasmid).
- the nucleic acid is an RNA molecule (e.g., an mRNA molecule).
- a method for generating mRNA for use in transfection can involve in vitro transcription of a template with specially designed primers, followed by polyA addition, to produce an RNA construct containing 3' and 5' untranslated sequences, a 5' cap and/or Internal Ribosome Entry Site (IRES), the nucleic acid to be expressed, and a polyA tail, typically 50- 2000 bases in length.
- the RNA molecule can be further modified to increase translational efficiency and/or stability, e.g., as disclosed in U.S. Patent Nos. 8,278,036; 8,883,506, and 8,716,465. RNA molecules so produced can efficiently transfect different kinds of cells.
- the nucleic acid encodes an amino acid sequence comprising a signal peptide at the amino-terminus of the CAR.
- signal peptide can facilitate the cell surface localization of the CAR when it is expressed in an effector cell, and is cleaved from the CAR during cellular processing.
- the nucleic acid encodes an amino acid sequence comprising a signal peptide at the N-terminus of the extracellular BAFF-R-binding domain (e.g., BAFF-R-binding scFv domain).
- RNA or DNA can be introduced into target cells using any of a number of different methods, for instance, commercially available methods which include, but are not limited to, electroporation, cationic liposome mediated transfection using lipofection, polymer encapsulation, peptide mediated transfection, or biolistic particle delivery systems such as “gene guns” (see, for example, Nishikawa, et al. Hum Gene Then, 12(8):861-70 (2001)).
- Another aspect of the present invention provides an immune effector cell expressing the BAFF-R-targeting CAR. Also provided is an immune effector cell comprising the nucleic acid encoding the BAFF-R-targeting CAR.
- the immune effector cells include but are not limited to T cells and NK cells.
- the T cell is selected from a CD8 + T cell, a CD4 + T cell, and an NKT cell.
- the T cell or NK cell can be a primary cell or a cell line.
- the immune effector cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors, by methods known in the art.
- the immune effector cells can also be differentiated in vitro from a pluripotent or multipotent cell (e.g., a hematopoietic stem cell).
- the present invention provides a pluripotent or multipotent cell (e.g., a hematopoietic stem cell) expressing the BAFF- R-targeting CAR (e.g., expressing the CAR on the plasma membrane) or comprising a nucleic acid disclosed herein.
- a pluripotent or multipotent cell e.g., a hematopoietic stem cell
- BAFF- R-targeting CAR e.g., expressing the CAR on the plasma membrane
- nucleic acid disclosed herein e.g., a hematopoietic stem cell
- the immune effector cells are isolated and/or purified.
- regulatory T cells can be removed from a T cell population using a CD25-binding ligand.
- Effector cells expressing a checkpoint protein e.g., PD-1, LAG-3, or TIM-3 can be removed by similar methods.
- the effector cells are isolated by a positive selection step.
- a population of T cells can be isolated by incubation with anti- CD3/anti-CD28-conjugated beads.
- cell surface markers such as IFN-7, TNF-a, IL-17A, IL-2, IL-3, IL-4, GM-CSF, IL-10, IL-13, granzyme B, and perforin, can also be used for positive selection.
- Immune effector cells may be activated and expanded generally using methods known in the art, e.g., as described in U.S. Patent Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; and U.S. Patent Application Publications Nos. 2006/0121005 and 2016/0340406.
- T cells can be expanded and/or activated by contact with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells.
- the cells can be expanded in culture for a period of several hours (e.g., about 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 18, 21 hours) to about 14 days (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 days).
- the cells are expanded for a period of 4 to 9 days. Multiple cycles of stimulation may be desirable for prolonged cell culture (e.g., culture for a period of 60 days or more).
- the cell culture comprises serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN-y, IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, TGFp, TNF-a, or a combination thereof.
- serum e.g., fetal bovine or human serum
- IL-2 interleukin-2
- insulin IFN-y, IL-4, IL-7
- GM-CSF GM-CSF
- IL-10 interleukin-12
- IL-15 IL-15
- TGFp TNF-a
- TNF-a TNF-a
- the immune effector cell of the present invention is a cell obtained from in vitro expansion.
- BAFF-R-targeting CAR e.g., regulatable CAR
- nucleic acid encoding the CAR e.g., nucleic acid encoding the CAR
- effector cells expressing the CAR or comprising the nucleic acid are provided in U.S. Patent Nos. 7,446,190 and 9,181,527, U.S. Patent Application Publication Nos. 2016/0340406 and 2017/0049819, and International Patent Application Publication No.
- the present invention provides a BAFF-R/CD3 -directed bispecific T-cell engager comprising an antigen-binding site that binds BAFF-R disclosed herein.
- the BAFF-R/CD3 -directed bispecific T-cell engager comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to an amino acid sequence selected from SEQ ID NOs: 44 and 45.
- the cytokine is connected to the Fc domain directly or via a linker.
- the BAFF-R/CD3-directed bispecific T-cell engager further comprises an antigen-binding site that binds CD3.
- antigen-binding sites that bind CD3 are disclosed in International Patent Application Publication Nos. WO2014/051433 and WO20 17/097723.
- nucleic acid encoding at least one polypeptide of the BAFF-R/CD3 -directed bispecific T-cell engager, wherein the polypeptide comprises an antigen-binding site that binds BAFF-R.
- the nucleic acid further comprises a nucleotide sequence encoding a signal peptide that, when expressed, is at the N-terminus of one or more of the polypeptides of the BAFF-R/CD3 -directed bispecific T-cell engager.
- a vector e.g., a viral vector
- a producer cell comprising the nucleic acid or vector
- a producer cell expressing the BAFF-R/CD3- directed bispecific T-cell engager
- the present invention provides an immunocytokine comprising an antigen-binding site that binds BAFF-R disclosed herein and a cytokine.
- cytokine e.g., pro-inflammatory cytokines
- Any cytokine e.g., pro-inflammatory cytokines known in the art can be used, including but not limited to IL-2, IL-4, IL-10, IL-12, IL-15, TNF, IFNa, IFNy, and GM-CSF. More exemplary cytokines are disclosed in U.S. Patent No. 9,567,399.
- the antigenbinding site is connected to the cytokine by chemical conjugation (e.g., covalent or noncovalent chemical conjugation).
- the antigen-binding site is connected to the cytokine by fusion of polypeptide.
- the immunocytokine can further comprise an Fc domain connected to the antigen-binding site that binds BAFF-R.
- the immunocytokine comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to an amino acid sequence selected from SEQ ID NOs: 44 and 45.
- the cytokine is connected to the Fc domain directly or via a linker.
- nucleic acid encoding at least one polypeptide of the immunocytokine, wherein the polypeptide comprises an antigen-binding site that binds BAFF-R.
- the nucleic acid further comprises a nucleotide sequence encoding a signal peptide that, when expressed, is at the N-terminus of one or more of the polypeptides of the immunocytokine.
- a vector e.g., a viral vector comprising the nucleic acid, a producer cell comprising the nucleic acid or vector, and a producer cell expressing the immunocytokine.
- the present invention provides an antibody-drug conjugate comprising an antigen-binding site that binds BAFF-R disclosed herein and a cytotoxic drug moiety.
- cytotoxic drug moieties are disclosed in International Patent Application Publication Nos. W02014/160160 and WO2015/143382.
- the cytotoxic drug moiety is selected from auristatin, N-acetyl-y calicheamicin, maytansinoid, pyrrolobenzodiazepine, and SN-38.
- the antigen-binding site can be connected to the cytotoxic drug moiety by chemical conjugation (e.g., covalent or noncovalent chemical conjugation).
- the antibody-drug conjugate further comprises an Fc domain connected to the antigen-binding site that binds BAFF-R.
- the antibody-drug conjugate comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to an amino acid sequence selected from SEQ ID NOs: 44 and 45.
- the cytotoxic drug moiety is connected to the Fc domain directly or via a linker.
- the present invention provides an immunotoxin comprising an antigen-binding site that binds BAFF-R disclosed herein and a cytotoxic peptide moiety.
- a cytotoxic peptide moiety known in the art can be used, including but not limited to ricin, Diphtheria toxin, and Pseudomonas exotoxin A. More exemplary cytotoxic peptides are disclosed in International Patent Application Publication Nos. WO2012/154530 and WO2014/164680.
- the cytotoxic peptide moiety is connected to the protein by chemical conjugation (e.g., covalent or noncovalent chemical conjugation).
- the cytotoxic peptide moiety is connected to the protein by fusion of polypeptide.
- the immunotoxin can further comprise an Fc domain connected to the antigen-binding site that binds BAFF-R.
- the immunotoxin comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to an amino acid sequence selected from SEQ ID NOs: 44 and 45.
- the cytotoxic peptide moiety is connected to the Fc domain directly or via a linker.
- nucleic acid encoding at least one polypeptide of the immunotoxin, wherein the polypeptide comprises an antigen-binding site that binds BAFF-R.
- the nucleic acid further comprises a nucleotide sequence encoding a signal peptide that, when expressed, is at the N-terminus of one or more of the polypeptides of the immunotoxin.
- a vector e.g., a viral vector comprising the nucleic acid, a producer cell comprising the nucleic acid or vector, and a producer cell expressing the immunotoxin.
- the present invention provides methods for treating cancer or autoimmune disease using a protein, conjugate, or cells comprising an antigen-binding site disclosed herein and/or a pharmaceutical composition described herein.
- the methods may be used to treat a variety of cancers which express BAFF-R by administering to a patient in need thereof a therapeutically effective amount of a protein, conjugate, or cells comprising an antigen-binding site disclosed herein.
- the therapeutic method can be characterized according to the cancer to be treated.
- the cancer to be treated can be characterized according to the presence of a particular antigen expressed on the surface of the cancer cell, e.g., BAFF-R.
- BAFF-R a particular antigen expressed on the surface of the cancer cell
- B-NHL B- cell non-Hodgkin’s lymphoma
- CLL chronic lymphocytic leukemia
- MCL mantle cell lymphoma
- FL follicular lymphoma
- DLBCL diffuse large B-cell lymphoma
- MALT mucosa-associated lymphoid tissue
- ALL acute lymphocytic leukemia
- ALL acute lymphocytic leukemia
- the protein, conjugate, cells, and/or pharmaceutical compositions described in the present disclosure can be used to treat a variety of cancers, not limited to cancers in which the cancer cells or the cells in the cancer microenvironment express BAFF-R.
- the cancer is a solid tumor.
- the cancer is brain cancer, bladder cancer, breast cancer, cervical cancer, colon cancer, colorectal cancer, endometrial cancer, esophageal cancer, leukemia, lung cancer, liver cancer, melanoma, ovarian cancer, pancreatic cancer, prostate cancer, rectal cancer, renal cancer, stomach cancer, testicular cancer, or uterine cancer.
- the cancer is a vascularized tumor, squamous cell carcinoma, adenocarcinoma, small cell carcinoma, melanoma, glioma, neuroblastoma, sarcoma (e.g., an angiosarcoma or chondrosarcoma), larynx cancer, parotid cancer, biliary tract cancer, thyroid cancer, acral lentiginous melanoma, actinic keratoses, acute lymphocytic leukemia, acute myeloid leukemia, adenoid cystic carcinoma, adenomas, adenosarcoma, adenosquamous carcinoma, anal canal cancer, anal cancer, anorectum cancer, astrocytic tumor, Bartholin gland carcinoma, basal cell carcinoma, biliary cancer, bone cancer, bone marrow cancer, bronchial cancer, bronchial gland carcinoma, carcinoid, cholangiocarcinoma,
- the cancer is a hematologic malignancy.
- the hematologic malignancy is leukemia.
- leukemia selected from the group consisting of acute myeloid leukemia (AML), acute lymphoblastic leukemia (ALL), myelodysplasia, myelodysplastic syndromes, acute T-lymphoblastic leukemia, or acute promyelocytic leukemia, chronic myelomonocytic leukemia, or myeloid blast crisis of chronic myeloid leukemia.
- the present application provides methods for treating an autoimmune inflammatory disease using a protein described herein and/or a pharmaceutical composition described herein.
- the methods may be used to treat a variety of BAFF-R-expressing B cell-associated autoimmune inflammatory diseases, including, without limitation, multiple sclerosis, systemic lupus erythematosus, Graves’ disease, Hashimoto’s thyroiditis, rheumatoid arthritis, inflammatory bowel disease, type I diabetes, Guillain-Barre syndrome, chronic inflammatory demyelinating polyneuropathy, psoriasis, myasthenia gravis, and vasculitis.
- BAFF-R-expressing B cell-associated autoimmune inflammatory diseases including, without limitation, multiple sclerosis, systemic lupus erythematosus, Graves’ disease, Hashimoto’s thyroiditis, rheumatoid arthritis, inflammatory bowel disease, type I diabetes, Guillain-Barre syndrome, chronic inflammatory demye
- a protein described herein can be used in combination with additional therapeutic agents to treat autoimmune disease or to treat cancer.
- exemplary therapeutic agents that may be used as part of a combination therapy in treating autoimmune inflammatory diseases are described in Li et al. (2017) Front. Pharmacol., 8:460, and include, for example, non-steroidal anti-inflammatory drugs (NSAIDs) (e.g., COX-2 inhibitors), glucocorticoids (e.g., prednisone/prednisolone, methylprednisolone, and the fluorinated glucocorticoids such as dexamethasone and betamethasone), disease-modifying antirheumatic drugs (DMARDs) (e.g., methotrexate, leflunomide, gold compounds, sulfasalazine, azathioprine, cyclophosphamide, antimalarials, D-penicillamine, and cyclosporine), anti-TNF biologies (e.g., infliximab, etanercept, adalimumab
- Exemplary therapeutic agents that may be used as part of a combination therapy in treating cancer include, for example, radiation, mitomycin, tretinoin, ribomustin, gemcitabine, vincristine, etoposide, cladribine, mitobronitol, methotrexate, doxorubicin, carboquone, pentostatin, nitracrine, zinostatin, cetrorelix, letrozole, raltitrexed, daunorubicin, fadrozole, fotemustine, thymalfasin, sobuzoxane, nedaplatin, cytarabine, bicalutamide, vinorelbine, vesnarinone, aminoglutethimide, amsacrine, proglumide, elliptinium acetate, ketanserin, doxifluridine, etretinate, isotretinoin, strept
- An additional class of agents that may be used as part of a combination therapy in treating cancer is immune checkpoint inhibitors.
- exemplary immune checkpoint inhibitors include agents that inhibit one or more of (i) cytotoxic T lymphocyte-associated antigen 4 (CTLA4), (ii) programmed cell death protein 1 (PD1), (iii) PDL1, (iv) LAG3, (v) B7-H3, (vi) B7-H4, and (vii) TIM3.
- CTLA4 inhibitor ipilimumab has been approved by the United States Food and Drug Administration for treating melanoma.
- agents that may be used as part of a combination therapy in treating cancer are monoclonal antibody agents that target non-checkpoint targets (e.g., herceptin) and non-cytotoxic agents (e.g., tyrosine-kinase inhibitors).
- non-checkpoint targets e.g., herceptin
- non-cytotoxic agents e.g., tyrosine-kinase inhibitors
- anti-cancer agents include, for example: (i) an inhibitor selected from an ALK Inhibitor, an ATR Inhibitor, an A2A Antagonist, a Base Excision Repair Inhibitor, a Bcr-Abl Tyrosine Kinase Inhibitor, a Bruton's Tyrosine Kinase Inhibitor, a CDC7 Inhibitor, a CHK1 Inhibitor, a Cyclin-Dependent Kinase Inhibitor, a DNA-PK Inhibitor, an Inhibitor of both DNA-PK and mTOR, a DNMT1 Inhibitor, a DNMT1 Inhibitor plus 2-chloro- deoxyadenosine, an HD AC Inhibitor, a Hedgehog Signaling Pathway Inhibitor, an IDO Inhibitor, a JAK Inhibitor, a mTOR Inhibitor, a MEK Inhibitor,
- Proteins of the present disclosure can also be used as an adjunct to surgical removal of the primary lesion.
- the amount of protein and additional therapeutic agent, and the relative timing of administration may be selected in order to achieve a desired combined therapeutic effect.
- the therapeutic agents in the combination, or a pharmaceutical composition or compositions comprising the therapeutic agents may be administered in any order such as, for example, sequentially, concurrently, together, simultaneously and the like.
- a protein may be administered during a time when the additional therapeutic agent(s) exerts its prophylactic or therapeutic effect, or vice versa.
- compositions that contain a therapeutically effective amount of a protein described herein.
- the composition can be formulated for use in a variety of drug delivery systems.
- One or more physiologically acceptable excipients or carriers can also be included in the composition for proper formulation.
- Suitable formulations for use in the present disclosure are found in Remington's Pharmaceutical Sciences, Mack Publishing Company, Philadelphia, Pa., 17th ed., 1985.
- Langer Science 249: 1527-1533, 1990).
- the present disclosure provides a formulation of a protein, which contains a BAFF-R-binding site described herein, and a pharmaceutically acceptable carrier.
- the pharmaceutical composition includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:40, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:41.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:42, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:43.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 54, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 55.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:56, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:57.
- a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:57.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:59, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:59.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 60, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:79.
- a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:79.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:77, and a light chain variable domain having an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 63.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 64, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 63.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:65, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:63.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 66, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 63.
- a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 63.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 67, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 63.
- a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 63.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 68, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:63.
- a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:63.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 69, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 63.
- a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 63.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:70, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 63.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:71, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:63.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 72, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 63.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 73, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 63.
- a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 63.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 74, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:63.
- a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:63.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:75, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 63.
- the formulation includes a protein that includes an antigen-binding site with a heavy chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:76, and a light chain variable domain having an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 63.
- the composition can be formulated for use in a variety of drug delivery systems.
- compositions for proper formulation can be included in the composition for proper formulation.
- suitable formulations for use in the present disclosure are found in Remington's Pharmaceutical Sciences, Mack Publishing Company, Philadelphia, Pa., 17th ed., 1985. For a brief review of methods for drug delivery, see, e.g., Langer (Science 249: 1527-1533, 1990).
- this present disclosure could exist in an aqueous pharmaceutical formulation including a therapeutically effective amount of the protein in a buffered solution forming a formulation.
- Aqueous carriers can include sterile water for injection (SWFI), bacteriostatic water for injection (BWFI), a pH buffered solution (e.g.
- an aqueous formulation is prepared including the protein disclosed herein in a pH-buffered solution.
- the pH of the preparations typically will be between 3 and 11, more preferably between 5 and 9 or between 6 and 8, and most preferably between 7 and 8, such as 7 to 7.5. Ranges intermediate to the above recited pH's are also intended to be part of this disclosure. For example, ranges of values using a combination of any of the above recited values as upper and/or lower limits are intended to be included.
- the buffer system includes citric acid monohydrate, sodium citrate, di sodium phosphate dihydrate, and/or sodium dihydrogen phosphate dihydrate.
- the buffer system includes about 1.3 mg/mL of citric acid (e.g., 1.305 mg/mL), about 0.3 mg/mL of sodium citrate (e.g., 0.305 mg/mL), about 1.5 mg/mL of disodium phosphate dihydrate (e.g.
- the buffer system includes 1-1.5 mg/mL of citric acid, 0.25 to 0.5 mg/mL of sodium citrate, 1.25 to 1.75 mg/ml of disodium phosphate dihydrate, 0.7 to 1.1 mg/mL of sodium dihydrogen phosphate dihydrate, and 6.0 to 6.4 mg/mL of sodium chloride.
- the pH of the liquid formulation may be set by addition of a pharmaceutically acceptable acid and/or base.
- the pharmaceutically acceptable acid may be hydrochloric acid.
- the base may be sodium hydroxide.
- the formulation include an aqueous carrier, which is pharmaceutically acceptable (safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation.
- aqueous carrier which is pharmaceutically acceptable (safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation.
- aqueous carrier include sterile water for injection (SWFI), bacteriostatic water for injection (BWFI), a pH buffered solution (e.g., phosphate- buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
- a polyol which acts as a tonicifier and may stabilize the antibody, may also be included in the formulation.
- the polyol is added to the formulation in an amount which may vary with respect to the desired isotonicity of the formulation.
- the aqueous formulation may be isotonic.
- the amount of polyol added may also be altered with respect to the molecular weight of the polyol. For example, a lower amount of a monosaccharide (e.g., mannitol) may be added, compared to a disaccharide (such as trehalose).
- the polyol which may be used in the formulation as a tonicity agent is mannitol.
- the mannitol concentration may be about 5 to about 20 mg/mL. In certain embodiments, the concentration of mannitol may be about 7.5 to about 15 mg/mL. In certain embodiments, the concentration of mannitol may be about 10 to about 14 mg/mL. In certain embodiments, the concentration of mannitol may be about 12 mg/mL. In certain embodiments, the polyol sorbitol may be included in the formulation.
- a detergent or surfactant may also be added to the formulation.
- exemplary detergents include nonionic detergents such as polysorbates (e.g., polysorbates 20, 80 etc.) or pol oxamers (e.g., pol oxamer 188).
- the amount of detergent added is such that it reduces aggregation of the formulated antibody and/or minimizes the formation of particulates in the formulation and/or reduces adsorption.
- the formulation may include a surfactant which is a polysorbate.
- the formulation may contain the detergent polysorbate 80 or Tween 80.
- Tween 80 is a term used to describe polyoxyethylene (20) sorbitanmonooleate (see Fiedler, Lexikon der Hifsstoffe, Editio Cantor Verlag Aulendorf, 4th edi., 1996).
- the formulation may contain between about 0.1 mg/mL and about 10 mg/mL of polysorbate 80, or between about 0.5 mg/mL and about 5 mg/mL. In certain embodiments, about 0.1% polysorbate 80 may be added in the formulation.
- the liquid formulation of the disclosure may be prepared as a 10 mg/mL concentration solution in combination with a sugar at stabilizing levels.
- the liquid formulation may be prepared in an aqueous carrier.
- a stabilizer may be added in an amount no greater than that which may result in a viscosity undesirable or unsuitable for intravenous administration.
- the sugar may be disaccharides, e.g., sucrose.
- the liquid formulation may also include one or more of a buffering agent, a surfactant, and a preservative, which is added to the formulations herein to reduce bacterial action.
- the present disclosure provides a formulation with an extended shelf life including the protein of the present disclosure, in combination with mannitol, citric acid monohydrate, sodium citrate, di sodium phosphate dihydrate, sodium dihydrogen phosphate dihydrate, sodium chloride, polysorbate 80, water, and sodium hydroxide.
- Deamidation is a common product variant of peptides and proteins that may occur during fermentation, harvest/cell clarification, purification, drug substance/drug product storage and during sample analysis. Deamidation is the loss of NH3 from a protein forming a succinimide intermediate that can undergo hydrolysis. The succinimide intermediate results in a 17 dalton mass decrease of the parent peptide. The subsequent hydrolysis results in an 18 dalton mass increase. Isolation of the succinimide intermediate is difficult due to instability under aqueous conditions. As such, deamidation is typically detectable as 1 dalton mass increase. Deamidation of an asparagine results in either aspartic or isoaspartic acid.
- the parameters affecting the rate of deamidation include pH, temperature, solvent dielectric constant, ionic strength, primary sequence, local polypeptide conformation and tertiary structure.
- the amino acid residues adjacent to Asn in the peptide chain affect deamidation rates. Gly and Ser following an Asn in protein sequences results in a higher susceptibility to deamidation.
- the liquid formulation of the present disclosure may be preserved under conditions of pH and humidity to prevent deamination of the protein product.
- the formulation is a lyophilized formulation.
- the formulation is freeze-dried (lyophilized) and contained in about 12-60 vials.
- the formulation is freeze-dried and 45 mg of the freeze-dried formulation may be contained in one vial.
- the about 40 mg - about 100 mg of freeze-dried formulation is contained in one vial.
- freeze dried formulation from 12, 27, or 45 vials are combined to obtained a therapeutic dose of the protein in the intravenous drug formulation.
- the formulation may be a liquid formulation.
- a liquid formulation is stored as about 250 mg/vial to about 1000 mg/vial.
- the liquid formulation is stored as about 600 mg/vial.
- the liquid formulation is stored as about 250 mg/vial.
- the lyophilized formulation includes the proteins described herein and a lyoprotectant.
- the lyoprotectant may be sugar, e.g., disaccharides.
- the lyoprotectant may be sucrose or maltose.
- the lyophilized formulation may also include one or more of a buffering agent, a surfactant, a bulking agent, and/or a preservative.
- the amount of sucrose or maltose useful for stabilization of the lyophilized drug product may be in a weight ratio of at least 1 :2 protein to sucrose or maltose.
- the protein to sucrose or maltose weight ratio may be of from 1 :2 to 1 :5.
- the pH of the formulation, prior to lyophilization may be set by addition of a pharmaceutically acceptable acid and/or base.
- the pharmaceutically acceptable acid may be hydrochloric acid.
- the pharmaceutically acceptable base may be sodium hydroxide.
- the pH of the solution containing the protein of the present disclosure may be adjusted between 6 to 8.
- the pH range for the lyophilized drug product may be from 7 to 8.
- a “bulking agent” may be added.
- a “bulking agent” is a compound which adds mass to a lyophilized mixture and contributes to the physical structure of the lyophilized cake (e.g., facilitates the production of an essentially uniform lyophilized cake which maintains an open pore structure).
- Illustrative bulking agents include mannitol, glycine, polyethylene glycol and sorbitol. The lyophilized formulations of the present disclosure may contain such bulking agents.
- the lyophilized protein product is constituted with an aqueous carrier.
- the aqueous carrier of interest herein is one which is pharmaceutically acceptable (e.g., safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation, after lyophilization.
- diluents include sterile water for injection (SWFI), bacteriostatic water for injection (BWFI), a pH buffered solution (e.g., phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
- the lyophilized drug product of the current disclosure is reconstituted with either Sterile Water for Injection, USP (SWFI) or 0.9% Sodium Chloride Injection, USP.
- SWFI Sterile Water for Injection
- USP 0.9% Sodium Chloride Injection
- the lyophilized powder dissolves into a solution.
- the lyophilized protein product of the instant disclosure is constituted to about 4.5 mL water for injection and diluted with 0.9% saline solution (sodium chloride solution).
- the protein compositions may be sterilized by conventional sterilization techniques, or may be sterile filtered.
- the resulting aqueous solutions may be packaged for use as-is, or lyophilized, the lyophilized preparation being combined with a sterile aqueous carrier prior to administration.
- the resulting compositions in solid form may be packaged in multiple single dose units, each containing a fixed amount of the above-mentioned agent or agents.
- the composition in solid form can also be packaged in a container for a flexible quantity.
- the specific dose can be a uniform dose for each patient, for example, 50-5000 mg of protein.
- a patient’s dose can be tailored to the approximate body weight or surface area of the patient.
- Other factors in determining the appropriate dosage can include the disease or condition to be treated or prevented, the severity of the disease, the route of administration, and the age, sex and medical condition of the patient. Further refinement of the calculations necessary to determine the appropriate dosage for treatment is routinely made by those skilled in the art, especially in light of the dosage information and assays disclosed herein.
- the dosage can also be determined through the use of known assays for determining dosages used in conjunction with appropriate dose-response data. An individual patient's dosage can be adjusted as the progress of the disease is monitored.
- Blood levels of the targetable construct or complex in a patient can be measured to see if the dosage needs to be adjusted to reach or maintain an effective concentration.
- Pharmacogenomics may be used to determine which targetable constructs and/or complexes, and dosages thereof, are most likely to be effective for a given individual (Schmitz et a!.. Clinica. Chimica. Acta. 308: 43-53, 2001; Steimer et a!.. Clinica. Chimica. Acta. 308: 33-41, 2001).
- dosages based on body weight are from about 0.01 pg to about 100 mg per kg of body weight, such as about 0.01 pg to about 100 mg/kg of body weight, about 0.01 pg to about 50 mg/kg of body weight, about 0.01 pg to about 10 mg/kg of body weight, about 0.01 pg to about 1 mg/kg of body weight, about 0.01 pg to about 100 pg/kg of body weight, about 0.01 pg to about 50 pg/kg of body weight, about 0.01 pg to about 10 pg/kg of body weight, about 0.01 pg to about 1 pg/kg of body weight, about 0.01 pg to about 0.1 pg/kg of body weight, about 0.1 pg to about 100 mg/kg of body weight, about 0.1 pg to about 50 mg/kg of body weight, about 0.1 pg to about 10 mg/kg of body weight, about 0.1 pg to about 1 mg/kg of body weight, about 0.01 pg to about
- Doses may be given once or more times daily, weekly, monthly or yearly, or even once every 2 to 20 years. Persons of ordinary skill in the art can easily estimate repetition rates for dosing based on measured residence times and concentrations of the targetable construct or complex in bodily fluids or tissues.
- Administration of the present disclosure could be intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, intrapleural, intrathecal, intracavitary, by perfusion through a catheter or by direct intralesional injection. This may be administered once or more times daily, once or more times weekly, once or more times monthly, and once or more times annually.
- compositions are described as having, including, or comprising specific components, or where processes and methods are described as having, including, or comprising specific steps, it is contemplated that, additionally, there are compositions of the present disclosure that consist essentially of, or consist of, the recited components, and that there are processes and methods according to the present disclosure that consist essentially of, or consist of, the recited processing steps.
- an element or component is said to be included in and/or selected from a list of recited elements or components, it should be understood that the element or component can be any one of the recited elements or components, or the element or component can be selected from a group consisting of two or more of the recited elements or components.
- This Example describes two antibody discovery campaigns conducted to identify binders of BAFF-R.
- One binder was chosen for further development using yeast display technology, multiple rounds of affinity maturation (CDRH3 focused and CDRH1/CDRH2 focused), sequence liability correction, off-rate pressure optimization and site directed mutagenesis to improve biological properties.
- CDRH3 focused and CDRH1/CDRH2 focused sequence liability correction
- sequence liability correction off-rate pressure optimization
- site directed mutagenesis to improve biological properties.
- BAFF-R-specific antibodies were generated by immunizing four different strains of mice (H2L2, NZBW, BALB-C, and SJL/J) with hBAFF-R-hFc-His fusion protein. Based on antisera titers, a total of seven mice from across the four different strains were selected for hybridoma fusion. Splenocytes from a subset of mice from each immunization arm were reserved for immune library generation; however, only splenocytes from H2L2 mice were used for yeast display mAb discovery.
- mice fusions from five mice fusions (splenocytes from two mice were pooled for H2L2 fusion and splenocytes from two mice were pooled for SJL/J fusion), sixteen 96-well plates per hybridoma fusion were analyzed by specificity ELISA, in which binding to human and cynomolgus monkey BAFF-R-hFc-His and binding to irrelevant-hFc-His protein was compared. Supernatants from 33 BAFF-R positive and specific hybridomas were selected for further analysis. Supernatants were tested for binding to BAFF-R+ isogenic CHO cells, and 16 positive hybridomas were further subcloned.
- mice DNA immunization of two groups of SWR/J mice each was performed. One group was immunized with a full-length human BAFF-R cDNA construct, and the other with a mixture of full-length human BAFF-R and human BAFF-R extracellular domain cDNA constructs. Based on antisera titers, mice were pooled, and subsequently selected for single B cell sorting and another pool used for hybridoma fusion.
- Yeast display was used to build scFv libraries from the splenocytes obtained from humanized H2L2 mice immunized with recombinant human hBAFF-R-hFc-His protein as described above. Three rounds of selection were carried out with biotinylated hBAFF-R-hFc- His at 5 nM. Individual yeast colonies were picked, sequenced, and sequences analyzed. Negative selection was performed to remove non-specific binders. Sequence convergence indicated the selection process was successful in enriching for binders and was therefore complete. Unique sequences were selected for further characterization. Three BAFF-R specific scFvs were discovered from one library (Table 4). However, these sequences were very similar to each other, and therefore only sequence 1129 A01 (also referred to as AB0369scFv) was selected for further study.
- 1129 A01 (AB0369 scFv) was converted into a multispecific binding protein comprising the scFv, and two non-BAFF-R binders, to yield AB0369.
- AB0369 was further analyzed for its abilities to bind to human (hBAFF-R-CHO) BAFF-R + cells (FIG. 5A) and cynomolgus monkey (cBAFF-R-CHO) BAFF-R + cells (FIG. 5B), lack non-specific interactions by polyspecificity reagent (PSR) assay (FIG. 6A, FIG. 6B), lyse BAFF-R + Ramos cancer cells (FIG. 7 and Table 5) and block BAFF-BAFF-R interactions (FIG. 8).
- AB0369 bound to both human and cynomolgus monkey BAFF-R on the surface of isogenic CHO cells, and BAFF-R binding was with ECso about 10 nM, making it a good choice for further development.
- AB0369 The ability of AB0369 to block BAFF-R-BAFF interactions was tested in a cell-based blocking assay. Briefly, CHO cells expressing human BAFF-R were harvested, washed in cold FACS buffer, and seeded at a density of 100,000 cells per well. Test articles were diluted in FACS buffer, and 50 pL of diluted multispecific binding protein or mAb was added to cells, incubated on ice for 60 minutes, then washed with FACS buffer. 12 nM BAFF-biotin was diluted into FACS buffer, and 100 pL was added per well, incubated for 60 minutes on ice, then washed with FACS buffer.
- AB0369 demonstrated specific binding to BAFF-R expressing cells.
- a yeast display affinity maturation library was created by mutating the CDRH3 residue (RFTMLRGLIIEDYGMDV (SEQ ID NO:3) of AB0369.
- RFTMLRGLIIEDYGMDV SEQ ID NO:3
- scFvs that have higher affinity towards hBAFF-R
- two rounds of selection were carried out with biotinylated hBAFF-R-hFc-His at 1 nM (FIGs. 9A-9D).
- the affinities between the parental clone AB0369 and representative individual library clones were compared.
- the scFvs with highest hBAFF-R binding affinity were converted into multispecific binding proteins comprising the scFv, and two non-BAFF-R binders, expressed in Expi293 cells, and further analyzed for their ability to bind to BAFF-R expressing cells (FIG. 11A) and ability to lyse BAFF-R expressing Ramos cancer cells (FIG. 11B, FIG. 11C). All multispecific binding proteins scored negatively in a poly-specificity assay, suggesting that the improved binding affinity was BAFF-R specific (FIGs. 12A-12B). Further studies demonstrated greater than threefold improvement in BAFF-R binding, which translated into six to ten-fold improvement in potency as measured by ECso (Table 7). Maximum lysis remained unchanged, suggesting that the improvement in BAFF-R binding affinity was the key driver of this improvement in potency.
- Table 7 Summary of cell binding and cytolysis demonstrated by multispecific binding proteins based on HCDR3 affinity matured variants compared to parental AB0369.
- CDRH1 and CDRH2 sequences were selected for affinity maturation (CDRH1 : GFTFSSY (SEQ ID NO: 1) and CDRH2: WYDGSN (SEQ ID NO:2)) using the matured CDRH3 backbone.
- the goal was to engineer and select binders with improved affinity over the parental clone (AB0369 scFv) or the CDRH3 optimized variants described above. This created a library with a randomized CDRH1 and CDRH2 while retaining an optimized CDRH3.
- Two rounds of FACS were performed to enrich for high affinity binders (FIGs. 13A-13C).
- RFTMLRGQYIEDYGMDV (SEQ ID NO:13); RFTMLRGWIIEDYGMDV(SEQ ID NO:15)) on the optimized CDRH3 backbone showed a significant improvement in hBAFF-R affinity compared to parental AB0369scFv (1129 A01) (FIGs. 14A-14D) or to an ianalumab-based scFv benchmark control (FIG. 14E).
- the scFvs with the highest hBAFF-R binding affinities were converted into multispecific binding proteins comprising the scFv, and two non-BAFF-R binders, expressed in Expi293 cells, and further analyzed for their ability to bind to human BAFF-R expressing cells (FIG. 15A), to bind to cynomolgus BAFF-R + cells (FIG. 15B), and to inhibit BAFF-R-BAFF interactions (FIG. 15C and Table 8) Tested multispecific binding proteins showed improvement in all three of these criteria and demonstrated efficient killing of BAFF-R + BJAB cells in a KHYG-l-CD16a mediated cytotoxicity assay (FIG. 16, Table 9).
- Table 9 Potency of representative multispecific binding proteins based on CDRH1 and CDRH2 affinity maturation in a KHYG-1-CD16V cytolysis assay.
- affinity matured clones contained amino acids in their CDRs that could negatively impact protein expression, stability, or immunogenicity
- additional libraries were constructed to select clones without these amino acids.
- Three rounds of selection were performed with 1 nM biotinylated hBAFF-R-hFc-His protein leading to enrichment of high affinity binders (FIGs. 17A-17D). 23 binders were identified altogether, 12 of which were predicted to be free of undesirable amino acids (“liability-corrected”).
- Preferred clones lacking potential sequence liabilities from these libraries included AB0898, (the liability corrected version of AB0682 described above), AB0899, and AB0900, which were successfully identified and tested for their binding to hBAFF-R while displayed on yeast. All clones showed higher affinity towards hBAFF-R than the parent, AB0369scFv (FIGs.
- Table 10 Summary of characterization of multispecific binding proteins expressing sequence liability corrected BAFF-R binders.
- CDRH1 and CDRH2 sequences (CDRH1 : GFTFSSY (SEQ ID NO:1) and CDRH2: WYDGSN (SEQ ID NO:2)) were affinity matured into the liability-corrected CDRH3 backbone, and off-rate pressure was applied to select high affinity clones.
- clones were preincubated with biotinylated hBAFF-R-hFc-His at 100 pM concentration, and then challenged with 1 pM non-biotinylated hBAFF-R-hFc-His for 2 hours.
- Yeast displaying anti-BAFF-R scFvs that remained bound to biotinylated hBAFF-R-hFc-His were sorted and the process was repeated three times to enrich for high affinity binders with slower off-rate. As shown in FIG.
- Binding affinity of AB1080, AB1081, and AB1085 to BAFF-R + cells was improved as compared to the parental clones (FIGs. 23A-23B as compared to Table 12). Additionally, binding affinity to cynoBAFF-R was similar to binding affinity to hBAFF-R (FIGs. 23A-23B). Lack of polyspecificity was confirmed by a PSR assay (FIGs. 24A-24B). AB 1084 was removed from further study, due to long retention time on HIC and subsequent potential for higher aggregation propensity. Improved multispecific binding proteins demonstrated vastly higher potency than the multispecific binding protein based on the ianalumab sequence (FIGs. 25A-25B).
- thermostability as compared to controls adalimumab (Humira) and pembrolizumab (Keytruda) (FIG. 27).
- HIC chromatograms revealed that AB 1080 and AB 1081 had retention times of 11.4 and 11.5 min, respectively.
- AB 1085 demonstrated a retention time of 9.5 minutes, which is at the lower edge among approved and late-stage therapeutic antibodies, suggesting very favorable hydrophobic behavior (FIG. 27).
- AB1080 and AB1081 showed improved binding to BAFF-R and did not contain any sequence liabilities in the CDR sequences; however, their hydrophobicity was high as compared to a panel of benchmarked therapeutic antibodies.
- AB 1085 demonstrated desired hydrophobicity and affinity, but contained potential sequence liabilities in the CDRH2 and CDRH3 sequences (FIG. 28). Sequences of AB 1080, AB 1081 and AB 1085 were compared and the AB 1080 sequence was analyzed and further corrected, with a hydrophobicity reducing mutation W to Q generated (CDRH3: RFTMLRGWYIEDYGMDV (SEQ ID NO: 14) to RFTMLRGQYIEDYGMDV (SEQ ID NO: 13)).
- the resulting AB1424/AB1612 multispecific binding protein demonstrated favorable low hydrophobicity that falls within the range of well- behaved biologies (FIG. 29) while maintaining the same high affinity for BAFF-R (Table 13, FIG. 30A-30B), potent BAFF-R-BAFF binding blocking (FIG. 1) and comprising a liability free sequence that is characteristic for parental AB 1080 (Table 14).
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicinal Chemistry (AREA)
- Genetics & Genomics (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- Pharmacology & Pharmacy (AREA)
- Biomedical Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Cell Biology (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Hematology (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2022354054A AU2022354054A1 (en) | 2021-09-29 | 2022-09-27 | Antibodies targeting baff-r and use thereof |
| IL311600A IL311600A (en) | 2021-09-29 | 2022-09-27 | Antibodies targeting BAFF-R and their use |
| EP22877491.5A EP4408891A4 (en) | 2021-09-29 | 2022-09-27 | ANTIBODIES TARGETING BAFF-R AND THEIR USE |
| CN202280064772.4A CN118317975A (zh) | 2021-09-29 | 2022-09-27 | 靶向baff-r的抗体及其用途 |
| CA3233246A CA3233246A1 (en) | 2021-09-29 | 2022-09-27 | Antibodies targeting baff-r and use thereof |
| JP2024519268A JP2024537772A (ja) | 2021-09-29 | 2022-09-27 | Baff-rを標的化する抗体及びその使用 |
| MX2024003913A MX2024003913A (es) | 2021-09-29 | 2022-09-27 | Anticuerpos dirigidos al receptor del factor activador de celulas b (baff-r) y uso de los mismos. |
| KR1020247013643A KR20240069787A (ko) | 2021-09-29 | 2022-09-27 | 항체 표적화 baff-r 및 이의 사용 |
| US18/620,375 US20240228645A1 (en) | 2021-09-29 | 2024-03-28 | Antibodies targeting baff-r and use thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163250092P | 2021-09-29 | 2021-09-29 | |
| US63/250,092 | 2021-09-29 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US18/620,375 Continuation US20240228645A1 (en) | 2021-09-29 | 2024-03-28 | Antibodies targeting baff-r and use thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023056243A1 true WO2023056243A1 (en) | 2023-04-06 |
Family
ID=85780903
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/077068 Ceased WO2023056243A1 (en) | 2021-09-29 | 2022-09-27 | Antibodies targeting baff-r and use thereof |
Country Status (12)
| Country | Link |
|---|---|
| US (1) | US20240228645A1 (https=) |
| EP (1) | EP4408891A4 (https=) |
| JP (1) | JP2024537772A (https=) |
| KR (1) | KR20240069787A (https=) |
| CN (1) | CN118317975A (https=) |
| AR (1) | AR127163A1 (https=) |
| AU (1) | AU2022354054A1 (https=) |
| CA (1) | CA3233246A1 (https=) |
| IL (1) | IL311600A (https=) |
| MX (1) | MX2024003913A (https=) |
| TW (1) | TW202330604A (https=) |
| WO (1) | WO2023056243A1 (https=) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12264200B2 (en) | 2018-02-08 | 2025-04-01 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| WO2025067496A1 (zh) * | 2023-09-28 | 2025-04-03 | 南京驯鹿生物技术股份有限公司 | 靶向baff-r的全人源抗体、car-t细胞及其应用 |
| US12275791B2 (en) | 2018-08-08 | 2025-04-15 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind HER2, NKG2D, and CD16, and methods of use |
| US12378318B2 (en) | 2018-08-08 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and a tumor-associated antigen |
| US12377144B2 (en) | 2021-03-03 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Methods of treating cancer using multi-specific binding proteins that bind NKG2D, CD16 and a tumor-associated antigen |
| US12384851B2 (en) | 2018-08-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind BCMA, NKG2D and CD16, and methods of use |
| US12384847B2 (en) | 2018-02-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Cancer therapy involving an anti-PD1 antibody and a multi-specific binding protein that binds NKG2D, CD16, and a tumor-associated antigen |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009120922A2 (en) * | 2008-03-27 | 2009-10-01 | Zymogenetics, Inc. | Compositions and methods for inhibiting pdgfrbeta and vegf-a |
| WO2010072741A1 (en) * | 2008-12-23 | 2010-07-01 | Astrazeneca Ab | TARGETED BINDING AGENTS DIRECTED TO α5β1 AND USES THEREFOR |
| US20180251564A1 (en) * | 2012-06-12 | 2018-09-06 | Novartis Ag | Methods of Treatment by Administering an Anti-BAFFR Antibody Therapeutic Formulation |
| US20200190204A1 (en) * | 2016-06-06 | 2020-06-18 | City Of Hope | Baff-r antibodies and uses thereof |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101120021A (zh) * | 2004-12-31 | 2008-02-06 | 基因技术公司 | 结合br3的多肽及其用途 |
| SI2315780T1 (sl) * | 2008-07-17 | 2015-11-30 | Novartis Ag | Sestavki in postopki uporabe za terapevtska protitelesa |
| WO2021163989A1 (en) * | 2020-02-21 | 2021-08-26 | Yinnuolai Biotech Ltd. | Anti-baff receptor antibodies and uses thereof |
-
2022
- 2022-09-27 AR ARP220102598A patent/AR127163A1/es unknown
- 2022-09-27 JP JP2024519268A patent/JP2024537772A/ja active Pending
- 2022-09-27 EP EP22877491.5A patent/EP4408891A4/en active Pending
- 2022-09-27 MX MX2024003913A patent/MX2024003913A/es unknown
- 2022-09-27 IL IL311600A patent/IL311600A/en unknown
- 2022-09-27 TW TW111136545A patent/TW202330604A/zh unknown
- 2022-09-27 CA CA3233246A patent/CA3233246A1/en active Pending
- 2022-09-27 CN CN202280064772.4A patent/CN118317975A/zh active Pending
- 2022-09-27 AU AU2022354054A patent/AU2022354054A1/en active Pending
- 2022-09-27 WO PCT/US2022/077068 patent/WO2023056243A1/en not_active Ceased
- 2022-09-27 KR KR1020247013643A patent/KR20240069787A/ko active Pending
-
2024
- 2024-03-28 US US18/620,375 patent/US20240228645A1/en active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009120922A2 (en) * | 2008-03-27 | 2009-10-01 | Zymogenetics, Inc. | Compositions and methods for inhibiting pdgfrbeta and vegf-a |
| WO2010072741A1 (en) * | 2008-12-23 | 2010-07-01 | Astrazeneca Ab | TARGETED BINDING AGENTS DIRECTED TO α5β1 AND USES THEREFOR |
| US20180251564A1 (en) * | 2012-06-12 | 2018-09-06 | Novartis Ag | Methods of Treatment by Administering an Anti-BAFFR Antibody Therapeutic Formulation |
| US20200190204A1 (en) * | 2016-06-06 | 2020-06-18 | City Of Hope | Baff-r antibodies and uses thereof |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP4408891A4 * |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12264200B2 (en) | 2018-02-08 | 2025-04-01 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US12384847B2 (en) | 2018-02-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Cancer therapy involving an anti-PD1 antibody and a multi-specific binding protein that binds NKG2D, CD16, and a tumor-associated antigen |
| US12275791B2 (en) | 2018-08-08 | 2025-04-15 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind HER2, NKG2D, and CD16, and methods of use |
| US12378318B2 (en) | 2018-08-08 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and a tumor-associated antigen |
| US12384851B2 (en) | 2018-08-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind BCMA, NKG2D and CD16, and methods of use |
| US12377144B2 (en) | 2021-03-03 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Methods of treating cancer using multi-specific binding proteins that bind NKG2D, CD16 and a tumor-associated antigen |
| WO2025067496A1 (zh) * | 2023-09-28 | 2025-04-03 | 南京驯鹿生物技术股份有限公司 | 靶向baff-r的全人源抗体、car-t细胞及其应用 |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2022354054A1 (en) | 2024-03-28 |
| EP4408891A1 (en) | 2024-08-07 |
| IL311600A (en) | 2024-05-01 |
| MX2024003913A (es) | 2024-04-26 |
| EP4408891A4 (en) | 2025-08-13 |
| TW202330604A (zh) | 2023-08-01 |
| CN118317975A (zh) | 2024-07-09 |
| CA3233246A1 (en) | 2023-04-06 |
| JP2024537772A (ja) | 2024-10-16 |
| US20240228645A1 (en) | 2024-07-11 |
| AR127163A1 (es) | 2023-12-27 |
| KR20240069787A (ko) | 2024-05-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20250154261A1 (en) | Multi-specific binding proteins that bind cd33, nkg2d, and cd16, and methods of use | |
| JP7539840B2 (ja) | Cd33を標的とする抗体可変ドメイン及びその使用 | |
| US20240228645A1 (en) | Antibodies targeting baff-r and use thereof | |
| US20220025037A1 (en) | Antibody variable domains targeting dll3, and use thereof | |
| AU2021320253A1 (en) | Antibodies targeting EGFR and use thereof | |
| US20230220084A1 (en) | Antibodies Targeting CLEC12A and Use Thereof | |
| WO2021076554A1 (en) | Antibodies targeting flt3 and use thereof | |
| WO2023056252A9 (en) | Proteins binding nkg2d, cd16 and baff-r | |
| EA049630B1 (ru) | Мультиспецифические связывающие белки, которые связывают cd33, nkg2d и cd16, и способы применения |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22877491 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202490466 Country of ref document: EA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022354054 Country of ref document: AU Ref document number: AU2022354054 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 311600 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3233246 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280064772.4 Country of ref document: CN |
|
| ENP | Entry into the national phase |
Ref document number: 2024519268 Country of ref document: JP Kind code of ref document: A Ref document number: 2022354054 Country of ref document: AU Date of ref document: 20220927 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112024006282 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20247013643 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202417033613 Country of ref document: IN |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202401839Q Country of ref document: SG |
|
| ENP | Entry into the national phase |
Ref document number: 2022877491 Country of ref document: EP Effective date: 20240429 |
|
| ENP | Entry into the national phase |
Ref document number: 112024006282 Country of ref document: BR Kind code of ref document: A2 Effective date: 20240328 |