WO2023049999A1 - Binding agents targeting trop2-expressing tumor cells - Google Patents
Binding agents targeting trop2-expressing tumor cells Download PDFInfo
- Publication number
- WO2023049999A1 WO2023049999A1 PCT/CA2022/051437 CA2022051437W WO2023049999A1 WO 2023049999 A1 WO2023049999 A1 WO 2023049999A1 CA 2022051437 W CA2022051437 W CA 2022051437W WO 2023049999 A1 WO2023049999 A1 WO 2023049999A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- seq
- acid sequence
- set forth
- binding agent
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2299/00—Coordinates from 3D structures of peptides, e.g. proteins or enzymes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/53—Hinge
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/77—Internalization into the cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- TITLE BINDING AGENTS TARGETING TROP2-EXPRESSING TUMOR CELLS
- the present disclosure generally relates to binding agents, such as antibodies and antigen binding fragments thereof, that are capable of binding to trophoblast cell surface antigen-2 (TROP2). Also disclosed herein are binding agents that are capable of targeting TROP2-expressing tumor cells and their use for the treatment of cancer. Single domain antibodies that specifically binds to amino acid residues of the extracellular domain of TROP2 are provided.
- Trophoblast cell surface antigen-2 is a membrane-bound protein expressed at low levels in normal adult tissues.
- TROP2 has pleiotropic functions including inducing cell signaling and formation of cell-cell junctions by mediating interactions with extracellular and intracellular proteins.
- TROP2 has an extracellular epidermal growth factor (EGF)-like domain, followed by a 23 amino acids transmembrane domain and the cytoplasmic tail.
- EGF epidermal growth factor
- the EGF-like domain contains a cysteine-rich domain, a thyroglobulin type-1 domain, and a cysteine-poor domain.
- EpCAM which is highly related to TROP2.
- TROP2 is highly expressed in a wide range of late-stage epithelial cancers including breast cancer and pancreatic cancer (Stepan et al., J. Histochem and Cytochem, 2011, the entire content of which is incorporated herein by reference). Overexpression of TROP2 was shown to confer oncogenic behavior in several in vitro and in vivo models. TROP2 upregulation in solid cancers is associated with increased tumor aggressiveness, metastasis, and an overall decreased survival in large groups of difficult-to-treat cancers, making it an attractive target for cancer therapy.
- TROP2 positive cancers have been successfully targeted clinically by antibody-drug conjugates (ADC) but not by naked functional antibodies.
- ADC antibody-drug conjugates
- ADC have associated drug toxicity in healthy tissues, off-target effects, and payload delivery issues.
- ADC dose-limiting side effects, narrow therapeutic windows, and efficacy limitations there is a pressing need to improve anti-TROP2 therapeutics for patients who are poorly served by current therapies, if at all.
- HCAbs functional homodimeric heavy chain only antibodies
- the heavy chains of HCAbs lack the first constant domain (CHI) and differs from classical antibodies by only a few amino acids substitutions normally involved in light chain pairing (Muyldermans et al., 1994; Vu et al., 1997). These substitutions (Val37Phe/Tyr, Gly44Glu, Leu45Arg, and Trp47Gly) are present in framework region 2 (FR2).
- the antigen-binding fragment of HCAbs is referred to as, VHH or nanobody®.
- VHHs have a molecular weight of around 15 kDa which makes them amenable to applications that require enhanced tissue penetration or rapid clearance, such as radioisotope-based imaging.
- VHH half-life usually needs to be increased so as to minimize renal clearance and optimize therapeutic efficacy (De Vlieger et al., Antibodies 8(1), 1-22, 2019).
- methods to increase VHH half-life such as PEGylation, N-glycosylation, HSA or other carrier protein fusions have been exploited, such constructs can introduce immunogenicity or have limited success.
- VHHs have been exploited as building blocks to make bispecific and multispecific antibodies.
- bivalent constructs have been shown to be have increased avidity or affinity compared to the monovalent form (Conrath et al., 2001; Coppieters et al., 2006; Hmila et al., 2008; Simmons et al., 2006 and Hultberg et al., 2011, Jahnichen et al. (2010), Fridy et al., 2014).
- Novel TROP2 binding agents including antibodies and antigen binding fragments thereof such as single domain antibodies and antigen binding fragments thereof are disclosed herein.
- the present disclosure therefore generally relates to a binding agent that is capable, amongst other things, of binding trophoblast cell surface antigen-2 (TROP2). Binding agents of the present disclosure specifically bind to TROP2.
- TROP2 binding trophoblast cell surface antigen-2
- binding agents may have activity against tumor cells when unconjugated
- the present disclosure also encompasses a conjugated form of such binding agents. Binding agents described herein may, in some instances, have no or low activity against tumor cells in a naked form and may thus benefit from being conjugated with a therapeutic moiety.
- the present disclosure therefore provides in some aspects unconjugated binding agents. In other aspects, the present disclosure provides conjugated binding agents.
- Antibodies or antigen binding fragments thereof such as single domain antibodies (sdAbs) or antigen binding fragments that specifically bind to at least one epitope comprising amino acid residues of the extracellular domain (ECD) of TROP2 are provided.
- the single domain antibodies (sdAbs) of the present disclosure have unique binding features and activity.
- the complementarity determining region 3 (CDR3) of the sdAbs forms a loop fitting into a groove within the cysteine rich domain (CRD) of the extracellular domain (ECD) of TROP2.
- CCD cysteine rich domain
- ECD extracellular domain
- FR2 framework region 2
- amino acid residues of TROP2 cysteine rich domain and together form a clip around the CRD as a bi-paratopic antibody.
- anti-TROP2 single domain antibodies of the present disclosure possess anti- tumor activity without drug conjugation.
- the anti-TROP2 single domain antibodies of the present disclosure are capable of inducing antibody-dependent cellular cytotoxicity (ADCC) and/or antibody-dependent cellular phagocytosis (ADCP). Moreover, the anti-TROP2 single domain antibodies of the present disclosure are also capable of internalization making them amenable to deliver drug payloads into the tumor microenvironment or into tumor cells.
- ADCC antibody-dependent cellular cytotoxicity
- ADCP antibody-dependent cellular phagocytosis
- the anti-TROP2 single domain antibodies of the present disclosure are also capable of internalization making them amenable to deliver drug payloads into the tumor microenvironment or into tumor cells.
- the single domain antibodies of the present disclosure also interfere/block TROP2 function.
- Exemplary embodiments of binding agents of the present disclosure therefore include single domain antibodies or antigen binding fragments thereof that specifically binds to at least one epitope comprising amino acids of the cysteine rich domain of TROP2.
- the single domain antibody or antigen binding fragment thereof comprises FR2 amino acid residues and CDR3 amino acid residues that interact with amino acid residues of the CRD of TROP2.
- the single domain antibody or antigen binding fragment thereof may have an affinity of ⁇ 10 " 6 M for human TROP2.
- the single domain antibodies of the present disclosure may be used to treat disorders or diseases associated with expression or overexpression of TROP2, such as cancer.
- sdAbs The binding function of sdAbs is conferred by a single polypeptide chain namely, the heavy chain variable region.
- This unique property provides formatting flexibility.
- multiple sdAbs or sdAb antigen binding domains may be fused into a single polypeptide chain conferring multivalence and/or multispecificity.
- multiple polypeptide chains may be assembled to increase the diversity (multi-paratopic binding) or avidity of interactions with TROP2.
- the sdAbs antigen binding domains may be fused to any type of polypeptide chain including for example and without limitation, fusion with a heavy chain and/or light chain of a native antibody or antigen binding fragment thereof, with protein scaffold, with immune cell modulating agent and the like.
- the present disclosure not only relates to the single domain antibodies disclosed herein but also more generally to binding agents that comprise one or more antigen binding domains of the single domain antibodies disclosed herein.
- the binding agent may comprise an antigen binding domain of a single domain antibody disclosed herein.
- the present disclosure relates to binding agents that compete with the single domain antibodies of the present disclosure.
- single domain antibodies that compete with one of more single domain antibodies disclosed herein for the binding of at least one epitope comprising amino acid residues of the extracellular domain (ECD) of TROP2 are provided.
- ECD extracellular domain
- the binding agent of the present disclosure binds to human TROP2. In other embodiments, the binding agent of the present disclosure binds to cynomolgus or Rhesus TROP2. Accordingly, the binding agent of the present disclosure may be used in the treatment of human diseases or disorders. Moreover, the pre-clinical development of the binding agents of the present disclosure may be carried out in cynomolgus or Rhesus monkeys and other related non- human primates. In accordance with the present disclosure, the binding agent disclosed herein is capable of targeting tumor cells expressing TROP2.
- the binding agent disclosed herein is capable of causing regression of tumors expressing TROP2.
- the binding agent disclosed herein is also capable of causing growth inhibition of tumors expressing TROP2.
- the binding agent is capable of causing inhibition of tumor growth via antibody-dependent cellular cytotoxicity (ADCC).
- ADCC antibody-dependent cellular cytotoxicity
- the binding agent is capable of causing inhibition of tumor growth via antibody-dependent cellular phagocytosis (ADCP).
- ADCP antibody-dependent cellular phagocytosis
- the binding agent may be used to deliver a payload to tumor cells expressing TROP2. Accordingly, in some embodiments, the binding agent may be used as an antibody drug conjugate (ADC).
- ADC antibody drug conjugate
- the binding agent is capable of causing direct inhibition of tumor growth.
- the activity of the binding agent may be independent of ADCC, ADCP or ADC function.
- the present disclosure relates to a binding agent that comprises one or more antigen binding domains, wherein at least one of the one or more antigen binding domains comprises an antigen binding fragment thereof that is capable of binding to TROP2.
- the antigen binding fragment is from a single domain antibody (heavy chain only antibody) disclosed herein.
- the antigen binding fragment comprises a single domain antibody variable region.
- the antigen binding fragment comprises the CDRs of a single domain antibody.
- the present disclosure relates to a binding agent that comprises one or more antigen binding domains, wherein at least one of the one or more antigen binding domains comprises an antigen binding domain of a single domain antibody that is capable of binding to TROP2.
- the present disclosure also particularly relates to a binding agent that comprises one or more antigen binding domains, wherein at least one of the one or more antigen binding domains specifically binds to human TROP2.
- the binding agent of the present disclosure is essentially polypeptidic.
- the binding agent of the present disclosure is essentially composed of one, two or more than two polypeptide chains.
- the binding agent may comprise non-polypeptidic moieties such as for example, small molecules, sugars, radioactive labels and the like.
- the binding agent is composed of one heavy chain. In some embodiments, the binding agent is composed of two heavy chains. In other embodiments, the binding agent is composed of more than two heavy chains.
- the binding agent of the present disclosure may be capable of binding to the extracellular domain (ECD) of TROP2 (as represented by amino acids 27 to 274 of TROP2 (e.g., SEQ ID NO:39 or SEQ ID NO:40), see Goldenberg et al., 2018, Ikeda, M. et al., 2015, the entire contents of which are incorporated herein by reference).
- ECD extracellular domain
- the binding agent of the present disclosure binds to the extracellular domain of human TROP2.
- the binding agent of the present disclosure may be capable of binding to an epitope comprising amino acids of the extracellular domain of TROP2. In some embodiments, the binding agent of the present disclosure binds to an epitope comprising amino acids of the extracellular domain of human TROP2.
- the binding agent of the present disclosure may be capable of binding to an epitope including amino acid residues comprised within amino acid sequence 27- 274 of TROP2. In some embodiments, the binding agent of the present disclosure binds to an epitope including amino acid residues comprised within amino acid sequence 27-274 of human TROP2.
- the binding agent of the present disclosure may be capable of binding to the cysteine-rich domain (CRD) of TROP2 (as represented by amino acids 27 to 73 of TROP2 (e.g., SEQ ID NO:39 or SEQ ID NO:40)). In some embodiments, the binding agent of the present disclosure binds to the cysteine-rich domain of human TROP2.
- CCD cysteine-rich domain
- the binding agent of the present disclosure may be capable of binding to an epitope comprising amino acids of the cysteine-rich domain of TROP2. In some embodiments, the binding agent of the present disclosure binds to an epitope comprising amino acids of the cysteine-rich domain of human TROP2.
- the binding agent of the present disclosure may be capable of binding to the thyroglobulin type-1 domain of TROP2 (as represented by amino acids 74 to 146 of TROP2 (SEQ ID NO:39 or SEQ ID NO:40)).
- the binding agent of the present disclosure binds to the thyroglobulin type-1 domain of human TROP2.
- the binding agent of the present disclosure may be capable of binding to an epitope comprising amino acids of the thyroglobulin type-1 domain of TROP2. In some embodiments, the binding agent of the present disclosure binds to an epitope comprising amino acids of the thyroglobulin type-1 domain of human TROP2.
- the binding agent, or antigen binding domain(s) of the binding agent may be capable of binding to a polypeptide comprising a human TROP2 amino acid sequence consisting of amino acid residues 27-274 or a fragment thereof.
- the binding agent, or antigen binding domain(s) of the binding agent may be capable of binding to a polypeptide comprising a human TROP2 amino acid sequence consisting of amino acid residues 27-146 or a fragment thereof.
- the binding agent, or antigen binding domain(s) of the binding agent may be capable of binding to a polypeptide comprising a human TROP2 amino acid sequence consisting of amino acid residues 27-73 or a fragment thereof.
- the fragment may comprise at least 10 amino acid residues of human TROP2.
- the binding agent, or antigen binding domain(s) of the binding agent may bind to a fragment of at least 10 amino acid residues of a human TROP2 amino acid sequence consisting of amino acid residues 27-146.
- the fragment may comprise between 10 to 110 amino acid residues, including for example between 10 to 100 amino acid residues, between 10 to 90 amino acid residues, between 10 to 80 amino acid residues, between 10 to 70 amino acid residues, between 10 to 60 amino acid residues, between 10 to 50 amino acid residues, between 10 to 40 amino acid residues, between 10 to 30 amino acid residues, between 10 to 29 amino acid residues, between 10 to 28 amino acid residues, between 10 to 27 amino acid residues, between 10 to 26 amino acid residues, between 10 to 25 amino acid residues, between 10 to 24 amino acid residues, between 10 to 23 amino acid residues, between 10 to 22 amino acid residues, between 10 to 21 amino acid residues, between 10 to 20 amino acid residues, between 10 to 19 amino acid residues, between 10 to 18 amino acid residues, between 10 to 17 amino acid residues, between 10 to 16 amino acid residues, between 10 to 15 amino acid residues, between 10 to 14 amino acid residues, between 10 to 13 amino acid residues, between 10 to 12 amino acid residues, between 10 to 10
- the binding agent, or antigen binding domain(s) of the binding agent may bind to a fragment of at least 10 amino acid residues of a human TROP2 amino acid sequence consisting of amino acid residues 27-73.
- the fragment may comprise of between 10 to 45 amino acid residues, including for example between 10 to 40 amino acid residues, between 10 to 35 amino acid residues, between 10 to 30 amino acid residues, between 10 to 29 amino acid residues, between 10 to 28 amino acid residues, between 10 to 27 amino acid residues, between 10 to 26 amino acid residues, between 10 to 25 amino acid residues, between 10 to 24 amino acid residues, between 10 to 23 amino acid residues, between 10 to 22 amino acid residues, between 10 to 21 amino acid residues, between 10 to 20 amino acid residues, between 10 to 19 amino acid residues, between 10 to 18 amino acid residues, between 10 to 17 amino acid residues, between 10 to 16 amino acid residues, between 10 to 15 amino acid residues, between 10 to 14 amino acid residues, between 10 to 13 amino acid residues, between 10 to 12 amino acid residues between 10 to 11 amino acid residues of a human TROP2 amino acid sequence consisting of amino acid residues 27-73.
- the binding agent, or antigen binding domain(s) of the binding agent may be capable of binding to a polypeptide comprising a human TROP2 amino acid sequence consisting of amino acid residues 27-56 of human TROP2 or a fragment thereof.
- the binding agent, or antigen binding domain(s) of the binding agent may be capable of binding to a polypeptide comprising a human TROP2 amino acid sequence consisting of amino acid residues 27-66 of human TROP2 or a fragment thereof.
- the binding agent, or antigen binding domain(s) of the binding agent may be capable of binding to a polypeptide comprising a human TROP2 amino acid sequence consisting of amino acid residues 47-56 of human TROP2 or a fragment thereof.
- the binding agent, or antigen binding domain(s) of the binding agent may be capable of binding to a polypeptide comprising a human TROP2 amino acid sequence consisting of amino acid residues 60-66 of human TROP2 or a fragment thereof.
- the binding agent, or antigen binding domain(s) of the binding agent may be capable of binding to a polypeptide comprising a human TROP2 amino acid sequence consisting of amino acid residues 47-66 of human TROP2 or a fragment thereof.
- the binding agent, or antigen binding domain(s) of the binding agent may be capable of binding to a polypeptide comprising a human TROP2 amino acid sequence consisting of amino acid residues 27-56, 27-66, 28-66, 29-66, 30-66, 31-66, 32-66, 33-66, 34-66, 35-66, 36- 66, 37-66, 38-66, 39-66, 40-66, 41-66, 42-66, 43-66, 44-66, 45-66, 46-66 or 47-66.
- a polypeptide comprising a human TROP2 amino acid sequence consisting of amino acid residues 27-56, 27-66, 28-66, 29-66, 30-66, 31-66, 32-66, 33-66, 34-66, 35-66, 36- 66, 37-66, 38-66, 39-66, 40-66, 41-66, 42-66, 43-66, 44-66, 45-66, 46-66 or 47-66.
- the binding agent, or antigen binding domain(s) of the binding agent may be capable of binding to an epitope consisting of amino acid residues 27-56, 27-66, 28-66, 29-66, 30- 66, 31-66, 32-66, 33-66, 34-66, 35-66, 36-66, 37-66, 38-66, 39-66, 40-66, 41-66, 42-66, 43-66, 44-66, 45-66, 46-66 or 47-66 of TROP2.
- the binding agent of the present disclosure may not be capable of binding to the cysteine-poor domain (CPD) of TROP2 (as represented by amino acids 147 to 274 of TROP2). In some embodiments, the binding agent of the present disclosure does not bind to the cysteine-poor domain (CPD) of human TROP2. In some embodiments, the binding agent of the present disclosure may not be capable of significantly binding to the cysteine-poor domain (CPD) of TROP2. In some embodiments, the binding agent of the present disclosure does not significantly bind to the cysteine-poor domain (CPD) of human TROP2.
- the binding agent, or antigen binding domain(s) or of the binding agent does not significantly bind to or is not capable of binding to a polypeptide that comprises a human TROP2 amino acid sequence consisting of amino acid residues 147-274 or a fragment thereof.
- the binding agent, or antigen binding domain(s) of the binding agent may not be capable of binding to one or more polypeptide selected from polypeptides comprising a human TROP2 amino acid sequence comprising deletion of at least 10 amino acid residues within amino acid residues 27-73.
- the binding agent, or antigen binding domain(s) of the binding agent may not be capable of binding to one or more polypeptide selected from polypeptides comprising a human TROP2 amino acid sequence comprising deletion of amino acid residues 27-36, 27-44, 27-56, 27-66, 47-56, 47-66, 60-66 and/or 27-73.
- the binding agent, or antigen binding domain(s) of the binding agent may have a reduced binding to one or more polypeptide selected from polypeptides comprising a human TROP2 amino acid sequence comprising deletion of amino acid residues 27-36, 27-44, 27-56, 27- 66, 47-56, 47-66, 60-66 and/or 27-73 compared to a human TROP2 polypeptide that does not have such deletion including for example, the full human TROP2 polypeptide (SEQ ID NO:39).
- the binding agent, or antigen binding domain(s) of the binding agent may not be capable of binding to one or more polypeptide selected from polypeptides comprising a human TROP2 amino acid sequence comprising deletion of amino acid residues 28-66, 29-66, 30-66, 31- 66, 32-66, 33-66, 34-66, 35-66, 36-66, 37-66, 38-66, 39-66, 40-66, 41-66, 42-66, 43-66, 44-66, 45-66, 46-66 or 47-66.
- the binding agent, or antigen binding domain(s) of the binding agent may not be capable of binding to a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 149 or have a reduced binding to such polypeptide compared to a human TROP2 polypeptide that does not have such deletion including for example, the full human TROP2 polypeptide (SEQ ID NO:39).
- the binding agent binds to human TROP2 protein (e.g., SEQ ID NO: 39) or to a TROP2 homologue or TROP2 variant having a sequence at least 80% identical to the human TROP2 protein thereof or to a portion of human TROP2 protein (e.g., an extracellular domain of human TROP2: SEQ ID NO: 164), of the homologue or variant thereof.
- human TROP2 protein e.g., SEQ ID NO: 39
- TROP2 homologue or TROP2 variant having a sequence at least 80% identical to the human TROP2 protein thereof or to a portion of human TROP2 protein (e.g., an extracellular domain of human TROP2: SEQ ID NO: 164), of the homologue or variant thereof.
- the TROP2 homologue is a TROP2 sequence or portion thereof of a primate.
- the binding agent, or antigen binding domain(s) of the binding agent of the present disclosure binds to an epitope that is common to human TROP2 and to cynomolgus TROP2.
- the binding agent, or antigen binding domain(s) of the binding agent of the present disclosure binds to an epitope that is similar in human TROP2 and to cynomolgus TROP2.
- the binding agent, or antigen binding domain(s) of the binding agent of the present disclosure is capable of binding human TROP2 and cynomolgus TROP2.
- the binding agent, or antigen binding domain(s) of the binding agent of the present disclosure preferentially binds to human TROP2 over mouse TROP2 or has a better affinity for human TROP2 over mouse TROP2.
- the binding agent, or antigen binding domain(s) of the binding agent of the present disclosure preferentially binds to human TROP2 over rat TROP2 or has a better affinity for human TROP2 over rat TROP2.
- the binding agent, or antigen binding domain(s) of the binding agent of the present disclosure binds to amino acid residues that are common to the extracellular domain of human TROP2 and to the extracellular domain of cynomolgus TROP2.
- the binding agent, or antigen binding domain(s) of the binding agent of the present disclosure binds to amino acid residues that are not present in the extracellular domain of mouse TROP2. In some embodiment, the binding agent, or antigen binding domain(s) of the binding agent of the present disclosure binds to amino acid residues that are not present in the extracellular domain of rat TROP2.
- the binding agent, or antigen binding domain(s) of the binding agent of the present binds to amino acid residues that are present in the extracellular domain of human TROP2, cynomolgus TROP2, mouse TROP2 and rat TROP2.
- the binding agent, or antigen binding domain(s) of the binding agent may be capable of binding to human TROP2 and to cynomolgus TROP2.
- the binding agent, or antigen binding domain(s) of the binding agent may be capable of binding to a denatured form human TROP2.
- the binding agent, or antigen binding domain(s) of the binding agent may be capable of binding to a reduced form of human TROP2.
- the binding agent, or antigen binding domain(s) of the binding agent may be capable of binding to a deglycosylated form of human TROP2.
- the formation of an antigen binding domain may involve amino acid residues of a single polypeptide chain.
- the amino acid residues forming the paratope may be located on a single polypeptide chain that is able to adopt a proper configuration for interacting with the epitope.
- an antigen binding domain may involve amino acid residues of two polypeptide chains.
- a complete antigen binding domain may require the association of two polypeptide chains.
- the amino acid residues forming the paratope may be located on two polypeptide chains that are able to associate and adopt a proper configuration for interacting with the epitope.
- the binding agent, or antigen binding domain(s) of the binding agent comprises an amino acid sequence of one or more CDRs of a single domain antibody (of a heavy chain only antibody).
- the binding agent, or the antigen binding domain(s) may comprise the amino acid sequence of a CDR1, CDR2, CDR3, FR2 or combination thereof of a heavy chain only antibody.
- the binding agent, or the antigen binding domain(s) may comprise the amino acid sequence of the CDR3 of single domain antibody (of a heavy chain only antibody).
- the binding agent, or the antigen binding domain(s) may comprise the amino acid sequence of FR2 and CDR3 of a heavy chain only antibody.
- the FR2 and CDR3 amino acid sequence may be on same polypeptide chain.
- the FR2 and CDR3 amino acid sequence may be on separate polypeptide chains.
- the binding agent, or the antigen binding domain(s) may comprise the amino acid sequence of FR2 and CDR3 of a heavy chain only antibody and optionally the amino acid sequence of CDR1 and/or CDR2.
- the order of CDR1, CDR2, CDR3, and/or FR2 amino acid sequence of the antigen binding domain may be the same as that of a single domain antibody.
- the antigen binding domain comprises in a N- to C- terminal fashion CDR1, FR2, CDR2 and/or CDR3 amino acid sequences.
- the antigen binding domain comprises in a N- to C- terminal fashion FR2 and CDR3 amino acid sequences.
- the antigen binding domain comprises in a N- to C- terminal fashion CDR1, FR2 and CDR3 amino acid sequences.
- the antigen binding domain comprises in a N- to C- terminal fashion CDR2, FR2 and CDR3 amino acid sequences.
- the antigen binding domain comprises in a N- to C- terminal fashion CDR1, CDR2, FR2 and CDR3 amino acid sequences.
- the antigen binding domain(s) may comprise an amino acid sequence of the variable region of a heavy chain only antibody.
- the antigen binding domain(s) may comprise an amino acid sequence of a camelid VH or VHH. In other embodiments, the antigen binding domain(s) may comprise an amino acid sequence of a mouse VH. In yet other embodiments, the antigen binding domain(s) may comprise an amino acid sequence of human VH. In a further embodiment, the antigen binding domain(s) may comprise an amino acid sequence of humanized VH or VHH (e.g., a humanized camelid VH or VHH, or a humanized mouse VH).
- the binding agent, or antigen binding domain(s) of the binding agent may come from various sources including from transgenic animals or non-transgenic animals, from screening of an antibody library etc.
- antibodies may be obtained from hybridoma after immunization of rodents (mouse, rats etc.) or from larger mammals such as camelids.
- the animal may be immunized with a TROP2 antigen.
- the amino acid sequence or nucleotide sequence of an antigen binding domain is obtained by immunization of a transgenic animal modified to express heavy chain only antibodies.
- the sequence of the antigen binding domain is obtained from a transgenic mouse carrying modification at an IgH locus allowing expression of heavy chain only antibodies (see for example, WO2022/011457 Al, the entire content of which is incorporated herein by reference).
- the transgenic animal may be immunized with a TROP2 antigen.
- the binding agent or the antigen binding domain(s) of the binding agent may comprise an amino acid sequence of a CDR1, CDR2 and/or CDR3 of a heavy chain variable region and/or an amino acid sequence of a CDR1, CDR2 and/or CDR3 of a light chain variable region.
- the binding agent or the antigen binding domain(s) of the binding agent may comprise an amino acid sequence of a CDR1, CDR2 and CDR3 of a heavy chain variable region and an amino acid sequence of a CDR1, CDR2 and CDR3 of a light chain variable region.
- amino acid sequence of a CDR1, CDR2 and CDR3 of the heavy chain variable region and the amino acid sequence of a CDR1, CDR2 and CDR3 of the light chain variable region are on same polypeptide chain.
- the amino acid sequence of CDR1, CDR2 and CDR3 of the heavy chain variable region and the amino acid sequence of CDR1, CDR2 and CDR3 of the light chain variable region are on separate polypeptide chains.
- the binding agent or the antigen binding domain(s) of the binding agent may comprise a heavy chain variable region and a light chain variable region of an antibody.
- the heavy chain variable region and the light chain variable region are on same polypeptide chain.
- the heavy chain variable region and the light chain variable region are on separate polypeptide chains.
- the CDRs may be identified using the Kabat numbering scheme (e.g., Kabat, J Immunol., 147: 1709-19 (1991); Chothia C, Lesk AM, J Mol Biol. Aug 20;196(4):901-17 (1987)).
- the CDRs may be identified using the IMGT numbering scheme (e.g., Lefranc, M.-P., The Immunologist, 7, 132-136 (1999)).
- IMGT numbering scheme e.g., Lefranc, M.-P., The Immunologist, 7, 132-136 (1999)
- the CDR1, CDR2, CDR3 and/or FR2 correspond to the Kabat CDR1, CDR2, CDR3 and/or FR2.
- the CDR1, CDR2, CDR3 and/or FR2 correspond to the IMGT CDR1, CDR2, CDR3 and/or FR2.
- the binding agent is expressed as a polypeptide chain that comprises in a N- to C-terminal fashion, a) an antigen binding domain that includes an antigen binding fragment of a single domain antibody, b) a linker and c) a dimerization domain.
- the binding agent is expressed as a polypeptide chain that comprises in aN- to C-terminal fashion, a) an antigen binding domain of a single domain antibody, b) a linker and c) a dimerization domain.
- the binding agent is expressed as a polypeptide chain that comprises in a N- to C-terminal fashion, a) a dimerization domain, b) a linker and c) an antigen binding domain that includes an antigen binding fragment of a single domain antibody.
- the binding agent is expressed as a polypeptide chain that comprises in a N- to C-terminal fashion, a) a dimerization domain, b) a linker and c) an antigen binding domain of a single domain antibody.
- the binding agent is expressed as a polypeptide chain that comprises in a N- to C-terminal fashion, a) an antigen binding domain of a single domain antibody, b) a linker, c) a dimerization domain, d) a linker and e) an antigen binding domain of a single domain antibody.
- the antigen binding domain of a) and the antigen binding domain of e) are different.
- the antigen binding domain of a) and the antigen binding domain of e) are the same.
- the linker of b) and the linker of d) are the same.
- the linker of b) and the linker of d) are different.
- the binding agent may comprise additional amino acid sequence or moieties (small molecules, labels and the like) at an N- and/or C-terminus.
- the binding agent may comprise additional antigen binding domain(s) of single domain antibody(ies) at an N- or C-terminus.
- the additional antigen binding domain(s) may be separated from the core by one or more linkers.
- polypeptide chain may comprise additional sequences, including without limitations, additional antigen binding domains or additional linkers.
- the linker is an amino acid sequence of at least 5, 10, 15, 20, 25, 30, 35, 40, 45 or 50 amino acid residues in length.
- the linker is non-cleavable.
- the linker comprises one or more units of GGGGS.
- the linker may comprise the formula (X(PAPAP)) n KA wherein n is an integer selected from 1 to 10, wherein X is present or absent and is A. In some embodiments, the linker may comprise the sequence set forth in SEQ ID NO: 163.
- the linker is an antibody hinge or a portion thereof.
- the linker may comprise human IgGl hinge sequence or a portion thereof.
- the linker may comprise human IgG2 hinge sequence or a portion thereof.
- the linker may comprise human IgG3 hinge sequence or a portion thereof.
- the linker may comprise human IgG4 hinge sequence or a portion thereof.
- the binding agent or antigen binding domain may comprise a sequence as set forth herein.
- the binding agent, or antigen binding domain(s) of the binding agent may have the amino acid sequence set forth in SEQ ID NO: 143.
- any of X 1a to X 1r is each independently any (e.g., naturally occurring) amino acid residue.
- any of X 1a to X 1r is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NO:23 or SEQ ID NOs:73-93, or conservative amino acid substitutions or non-conservative amino acid substitutions thereof.
- any of X 1a to X 1r is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 or SEQ ID NO:26 or conservative amino acid substitutions or non-conservative amino acid substitutions thereof.
- any X 1a to X 1r is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NO:23 or SEQ ID Nos: 73 -93.
- any X 1a to X 1r is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 to SEQ ID NO:26.
- any of X 1a to X 1r is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NOs: 73, 75, 76, 77, 78, 81, 82, 83, 85, 89 or 91, or conservative amino acid substitutions or non-conservative amino acid substitutions thereof.
- any X 1a to X 1r is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NOs: 73, 75, 76, 77, 78, 81, 82, 83, 85, 89 or 91.
- X 1a is Q or E; X 1b is Q, V or L; X 1c is M or L; X 1d is V or P; X 1e is G or Q; X 1f is P, L or R; X 1g is Y or V; X 1h is D, N, E; X 1i is P or A; X 1j is S or T; X 1k is A or S; X 1l is L or Q; X 1m is N or S; X 1n is K or R; X 1o is P or A; X 1p is L or V; X 1q is R or Y; and/or X 1r is Q or M.
- X 1a is Q or E; X 1b is Q, V or L; X 1c is M or L; X 1d is V or P; X 1e is G or Q; X 1f is P, L or R; X 1g is Y; X 1h is D, X 1i is P or A; X 1j is S or T; X 1k is A or S; X 1l is L or Q; X 1m is N or S; X 1n is K or R; X 10 is P or A; X 1p is L or V; X 1q is R or Y; and/or X 1r is Q or M.
- the binding agent, or antigen binding domain(s) of the binding agent may have the amino acid sequence set forth in SEQ ID NO: 144.
- any of X 2a to X 2p is each independently any (e.g., naturally occurring) amino acid residue.
- any of X 2a to X 2p is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NO:26 or SEQ ID NO:94-114 or conservative amino acid substitutions or non-conservative amino acid substitutions thereof.
- any of X 2a to X 2p is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 or SEQ ID NO:26 or conservative amino acid substitutions or non- conservative amino acid substitutions thereof.
- any X 2a to X 2p is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NO:26 or SEQ ID NO:94-114.
- any X 2a to X 2p is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 to SEQ ID NO:26.
- any of X 2a to X 2p is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NOs: 94, 95, 96, 97, 98, 100, 101, 102, 103, 104, 105, 106, 107 or 108 or conservative amino acid substitutions or non- conservative amino acid substitutions thereof.
- any X 2a to X 2p is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NOs: 94,
- any of X 2a to X 2p is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NOs: 94, 95, 96, 97, 100, 102, 103, 104, 105, 106, 108, 112 or 114 or conservative amino acid substitutions or non-conservative amino acid substitutions thereof.
- any X 2a to X 2p is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NOs: 94, 95, 96, 97, 100, 102, 103, 104, 105, 106, 108, 112 or 114.
- any of X 2a to X 2p is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NOs: 94, 95, 96, 97, 98, 99, 100, 101, 102, 104, 105, 112, 113 or 114 or conservative amino acid substitutions or non- conservative amino acid substitutions thereof.
- any X 2a to X 2p is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NOs: 94, 95, 96, 97, 98, 99, 100, 101, 102, 104, 105, 112, 113 or 114.
- any of X 2a to X 2p is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NOs: 94, 95, 96, 97, 102 or 105 or conservative amino acid substitutions or non-conservative amino acid substitutions thereof.
- any X 2a to X 2p is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NOs: 94, 95,
- the binding agent, or antigen binding domain(s) of the binding agent may have the amino acid sequence set forth in SEQ ID NO: 145.
- SEQ ID NO: 145 (Consensus from KD001 to KD005 heavy chains) Q V QL QESGGGX 3a VX 3b X 3c GX 3d SLRLSCAASGFX 3e FSX 3f X 3g DMSWVRQAPGKGPE WVSYIX 3h X 3i X 3j X 3k X 3l X 3m .TX 3n YPDSVKGRFTX 3o SRDNAKNX 3P LYLX 3q MNX 3r LX 3s PX 3t DTALYRCAX 3u X 3v X 3w LTDX 3x HYVEDX 3y WGQGTQVTVS SEQ ID NO: 145 (Consensus from KD001 to KD005 heavy chains) Q V QL QESGGGX 3a VX 3b X 3c GX 3d SLRLSCAASGFX 3e FSX 3f X 3g DMSWVRQAPGKGPE WVSY
- any of X 3a to X 3y is each independently any (e.g., naturally occurring) amino acid residue.
- any of X 3a to X 3y is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 or SEQ ID NO:26 or conservative amino acid substitutions or non- conservative amino acid substitutions thereof.
- any of X 3a to X 3y is each independently an amino acid residue most frequently found in the group consisting of SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 to SEQ ID NO:26.
- X 3a is M or L; X 3b is Q, H or E; X 3c is V, P or A; X 3d is G or R; X 3e is P or T; X 3f is S, N or G; X 3g is A, Y or S; X 3h is N or T; X 3i is A, S or G; X 3j is D, G or S; X 3k is G or absent; X 3l is S or G; X 3m is K, N or T; X 3n is Y or D; X 3o is I or T; X 3p is T or M; X 3 q is L or Q; X 3r is N or S; X 3s is K or T; X 3t is E or D; X 3u is R or K; X 3v is A or S; X 3w is K or R; X 3x is T or S; and/or X 3y is Y or A.
- X 3a is M or L; X 3b is Q, H or E; X 3c is V, P or A; X 3d is G or R; X 3e is P or T; X 3f is S, N or G; X 3g is A, Y or S; X 3h is N or T; X 3i is A, S or G; X 3j is D, G or S; X 3k is G or absent; X 3l is S or G; X 3m is K, N or T; X 3n is Y; X 3o is I or T; X 3p is T or M; X 3q is L or Q; X 3r is N or S; X 3s is K or T; X 3t is E or D; X 3u is R or K; X 3v is A or S; X 3w is R; X 3x is S; and/or X 3y is A.
- Table 1 Position of amino acid residues with reference to SEQ ID NO: 145.
- the binding agent, or antigen binding domain(s) of the binding agent may have the amino acid sequence set forth in SEQ ID NO: 146.
- SEQ ID NO: 146 (Consensus for KD001-KD005 and selected variants heavy chains) X 4a VQLX 4b ESGGGX 4c X 4d X 4e X 4f GX 4g SLRLSCAASGFX 4h FSX 4i X 4j DMX 4k WX 4 l RQAP GKX 4m X 4n X 4o WVSX 4p IX 4q X 4r X 4s GX 4t X 4u TX 4v YX 4w DX 4x VKGRFTX 4y SRDNX 4z KNX 5a LYLX 5b MNX 5c LX 5 dX 5e X 5f DTAX 5g YX 5h CAX 5i X 5j X 5k LTDX 5l HYVEDX 5m WGQGTX 5n V TVSS.
- any of X 4a to X 5n is each independently any (e.g., naturally occurring) amino acid residue.
- any of X 4a to X 5n is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NOs:22-26, SEQ ID Nos:73-114 or conservative amino acid substitutions or non-conservative amino acid substitutions thereof.
- any of X 4a to X 5n is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 or SEQ ID NO:26 or conservative amino acid substitutions or non- conservative amino acid substitutions thereof.
- any of X 4a to X 5n is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NOs:22-26, SEQ ID Nos:73-114.
- any of X 4a to X 5n is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 to SEQ ID NO:26.
- X 4a is Q or E
- X 4b is Q, L or V
- X 4c is M or L
- X 4d is V or I
- X 4e is Q
- X 4f is P
- X 4g is G or R
- X 4h is P or T
- X 4i is G, S or N
- X 4j is A or S
- X 4k is S or H
- X 4i is V or Y
- X 4m is G or Q
- X 4n is P, L or R
- X 4o is E or V
- X 4p is Y
- X 4q is T or N
- X 4r is A, S or G
- X 4s is G, S, D, N or E
- X 4t is absent or S
- X 4u is K or T
- X 4v is Y
- X 4w is P or A
- the amino acid substitution is a conservative amino acid substitution.
- a binding agent that comprises one or more antigen binding domains, wherein at least one of the one or more antigen binding domains is capable of binding to human trophoblast cell surface antigen-2 (human TROP2) and comprises an amino acid sequence at least 65% identical to the amino acid sequence set forth in any one of SEQ ID NOs:22-26, or SEQ ID NOs: 71-115.
- the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical to SEQ ID NO:22. More particularly, the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence at least 95% identical, at least 99% identical or identical to SEQ ID NO:22. In an embodiment, the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence identical to SEQ ID NO:22.
- the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical to SEQ ID NO:23. More particularly, the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence at least 95% identical, at least 99% identical or identical to SEQ ID NO:23. In an embodiment, the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence identical to SEQ ID NO:23.
- the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical to SEQ ID NO:24. More particularly, the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence at least 95% identical, at least 99% identical or identical to SEQ ID NO:24. In an embodiment, the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence identical to SEQ ID NO:24.
- the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical to SEQ ID NO:25. More particularly, the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence at least 95% identical, at least 99% identical or identical to SEQ ID NO:25. In an embodiment, the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence identical to SEQ ID NO:25.
- the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical to SEQ ID NO:26. More particularly, the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence at least 95% identical, at least 99% identical or identical to SEQ ID NO:26. In an embodiment, the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence identical to SEQ ID NO:26.
- the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical to SEQ ID NOs: 71-115. More particularly, the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence at least 95% identical, at least 99% identical or identical to SEQ ID NOs: 71-115. In an embodiment, the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence identical to any one of SEQ ID NOs:71-115.
- the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical to SEQ ID NOs: 73-114. More particularly, the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence at least 95% identical, at least 99% identical or identical to SEQ ID NOs: 73-114. In an embodiment, the binding agent or antigen binding domain(s) of the binding agent may comprise an amino acid sequence identical to any one of SEQ ID NOs:73-114.
- the binding agent or antigen binding domain(s) of the binding agent may have a sequence as set forth herein, wherein the amino acid residue at position 1 is Q, the amino acid residue at position 2 is V, the amino acid residue at position 3 is Q, the amino acid residue at position 4 is L, the amino acid residue at position 37 is V, the amino acid residue at position 39 is Q, the amino acid residue at position 45 is P, the amino acid residue at position 46 is E, the amino acid residue at position 47 is W, the amino acid residue at position 50 is Y, the amino acid residue at position 58 is Y, the amino acid residue at position 99 is R, the amino acid residue at position 100 is L, the amino acid residue at position 101 is T, the amino acid residue at position 102 is D, the amino acid residue at position 103 is S, the amino acid residue at position 104 is H, the amino acid residue at position 105 is Y, the amino acid residue at position 106 is V, the amino acid residue at position 107 is E, the amino acid residue at position 108 is
- the binding agent, or antigen binding domain(s) of the binding agent may have an amino acid sequence as defined in any one of SEQ ID Nos:22-26, 73-114, or 143 to 146 and may comprise from one to five amino acid deletions or from one to five amino acid additions.
- the deletion or additions are consecutive.
- the deletion or additions are non-consecutives.
- the deletion or additions are at the N-terminus.
- the deletion or additions are at the C-terminus.
- the deletion or additions are outside of an IMGT CDR3 sequence and/or IMGT FR2 sequence.
- the deletion or additions are outside of a Kabat CDR3 sequence and/or Kabat FR2 sequence.
- the binding agent or antigen binding domain(s) thereof may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 126.
- the binding agent or antigen binding domain(s) thereof may comprise the amino acid sequence of the FR2 set forth in SEQ ID NO: 121. In another exemplary embodiment, the binding agent or antigen binding domain(s) thereof may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 126 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 121.
- amino acid sequence of the CDR3 and the amino acid sequence of the FR2 are on a same polypeptide chain.
- the amino acid sequence of the CDR3 and the amino acid sequence of the FR2 are on separate polypeptide chains.
- amino acid sequence of the CDR3 is as set forth in SEQ ID NO:48, SEQ ID NO:51, SEQ ID NO: 54 or SEQ ID NO:61.
- amino acid sequence of the FR2 is as set forth in SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 119 or SEQ ID NO: 120.
- the binding agent or antigen binding domain may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO: 122.
- amino acid sequence of the CDR1 is as set forth in SEQ ID NO:52, SEQ ID NO:55 or SEQ ID NO:56.
- the binding agent or antigen binding domain may comprise the amino acid sequence of the CDR2 set forth in SEQ ID NO: 125.
- amino acid sequence of the CDR2 is as set forth in SEQ ID NO:47, SEQ ID NO:50, SEQ ID NO:57, SEQ ID NO:60, SEQ ID NO: 123 or SEQ ID NO: 124.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in any one of SEQ ID NO:48, SEQ ID NO:51, SEQ ID NO:54, SEQ ID NO:58 or SEQ ID NO:61 and the amino acid sequence of the FR2 set forth in any one of SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 119 or SEQ ID NO: 120.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in any one of SEQ ID NO:48, SEQ ID NO:51, SEQ ID NO: 54, SEQ ID NO: 58 or SEQ ID NO: 61, the amino acid sequence of the FR2 set forth in any one of SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 119 or SEQ ID NO: 120, the amino acid sequence of the CDR1 set forth in any one of SEQ ID NO: 52, SEQ ID NO: 55, SEQ ID NO:59, SEQ ID NO: 52 or SEQ ID NO: 62 and the amino acid sequence of the CDR2 set forth in any one of SEQ ID NO: 47, SEQ ID NO:50, SEQ ID NO:53, SEQ ID NO: 57, SEQ ID NO: 60, SEQ ID NO: 123 or SEQ ID NO: 124.
- the binding agent or antigen binding domain(s) thereof may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 142.
- the binding agent or antigen binding domain(s) thereof may comprise the amino acid sequence of the FR2 set forth in SEQ ID NO: 175.
- the binding agent or antigen binding domain(s) thereof may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 142 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 175.
- amino acid sequence of the CDR3 and the amino acid sequence of the FR2 are on a same polypeptide chain.
- the amino acid sequence of the CDR3 and the amino acid sequence of the FR2 are on separate polypeptide chains.
- amino acid sequence of the CDR3 is as set forth in SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO: 12, SEQ ID NO:15 or SEQ ID NO: 141.
- amino acid sequence of the FR2 is as set forth in SEQ ID NO: 170, SEQ ID NO: 171, SEQ ID NO: 172, SEQ ID NO: 173 or SEQ ID NO: 174.
- amino acid sequence of the FR2 is as set forth in SEQ ID NO: 170 or SEQ ID NO: 171.
- the binding agent or antigen binding domain may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO: 128.
- amino acid sequence of the CDR1 is as set forth in SEQ ID NO:1, SEQ ID NO:4, SEQ ID NO:7 or SEQ ID NO: 127.
- the binding agent or antigen binding domain may comprise the amino acid sequence of the CDR2 set forth in SEQ ID NO: 140.
- the amino acid sequence of the CDR2 is as set forth in SEQ ID NO:2, SEQ ID NO:5, SEQ ID NO:8, SEQ ID NO: 11, SEQ ID NO: 129, SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135, SEQ ID NO: 136, SEQ ID NO: 137, SEQ ID NO: 138 or SEQ ID NO: 139.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in any one of SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO: 12, SEQ ID NO: 15 or SEQ ID NO:141 and the amino acid sequence of the FR2 set forth in any one of SEQ ID NO: 170, SEQ ID NO: 171, SEQ ID NO: 172, SEQ ID NO: 173 or SEQ ID NO: 174.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in any one of SEQ ID NO:3, SEQ ID NO: 6, SEQ ID NO: 12, SEQ ID NO: 15 or SEQ ID NO: 141, the amino acid sequence of the FR2 set forth in any one of SEQ ID NO: 170, SEQ ID NO: 171, SEQ ID NO: 172, SEQ ID NO: 173 or SEQ ID NO: 174, the amino acid sequence of the CDR1 set forth in any one of SEQ ID NO: 1, SEQ ID NO:4, SEQ ID NO:7 or SEQ ID NO: 127 and the amino acid sequence of the CDR2 set forth in any one of SEQ ID NO:2, SEQ ID NO:5, SEQ ID NO:8, SEQ ID NO: 11, SEQ ID NO: 129, SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in any one of SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO: 12, SEQ ID NO: 15 or SEQ ID NO: 141, the amino acid sequence of the FR2 set forth in any one of SEQ ID NO: 170 or SEQ ID NO: 171, the amino acid sequence of the CDR1 set forth in any one of SEQ ID NO: 1, SEQ ID NO:4, SEQ ID NO: 7 or SEQ ID NO: 127 and the amino acid sequence of the CDR2 set forth in any one of SEQ ID NO:2, SEQ ID NO:5, SEQ ID NO:8, SEQ ID NO: 11, SEQ ID NO: 129, SEQ ID NO: 130, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 135, SEQ ID NO: 136, SEQ ID NO: 137, SEQ ID
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:54 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:52 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:53.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:55 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:47.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:58 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:56 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:57.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:61 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:59 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:60.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:62 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:50.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:55 and/or the amino acid sequence of the CDR2 set forth in 47.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 117 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:55 and/or the amino acid sequence of the CDR2 set forth in 47.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 118 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:55 and/or the amino acid sequence of the CDR2 set forth in 47.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 119 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:55 and/or the amino acid sequence of the CDR2 set forth in 47.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 117 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:55 and/or the amino acid sequence of the CDR2 set forth in 124.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 117 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:55 and/or the amino acid sequence of the CDR2 set forth in 123.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:62 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:50.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 117 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:62 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:50.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 118 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:62 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:50.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 120 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:62 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:50.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO :5.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 130.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 131.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:133.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 131.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 132.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:133.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 172 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:133.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 134.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 135.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 174 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 127 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 129.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 14.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 137.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 138.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 136.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 137.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 138.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 139.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 173 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 137.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:52, the amino acid sequence of the CDR2 set forth in SEQ ID NO:53, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 54 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:55, the amino acid sequence of the CDR2 set forth in SEQ ID NO:47, the amino acid sequence of the CDR3 set forth in SEQ ID NO:48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:56, the amino acid sequence of the CDR2 set forth in SEQ ID NO:57, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 58 and the amino acid sequence of the FR2 set forth in SEQ ID NO:116.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:59, the amino acid sequence of the CDR2 set forth in SEQ ID NO:60, the amino acid sequence of the CDR3 set forth in SEQ ID NO:61 and the amino acid sequence of the FR2 set forth in SEQ ID NO:116.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:62, the amino acid sequence of the CDR2 set forth in SEQ ID NO:50, the amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO:116.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:55, the amino acid sequence of the CDR2 set forth in SEQ ID NO:47, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:55, the amino acid sequence of the CDR2 set forth in SEQ ID NO:47, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 117.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:55, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 47, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 118.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:55, the amino acid sequence of the CDR2 set forth in SEQ ID NO:47, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO:119.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:55, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 124, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 117.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:55, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 123, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 117.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:62, the amino acid sequence of the CDR2 set forth in SEQ ID NO:50, the amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:62, the amino acid sequence of the CDR2 set forth in SEQ ID NO:50, the amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 117.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:62, the amino acid sequence of the CDR2 set forth in SEQ ID NO:50, amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 118.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:62, the amino acid sequence of the CDR2 set forth in SEQ ID NO:50, amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 120.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO:5, the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 130, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 131, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 133, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 131, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 132, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 133, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 133, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 172.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 134, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 135, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO: 127, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 129, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 174.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 14, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 137, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 138, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 136, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 137, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 138, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 139, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the binding agent or antigen binding domain(s) of the binding agent may comprise the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 137, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 173.
- the amino acid sequence of the CDR1, CDR2, CDR3 and/or FR2 are on a single polypeptide chain.
- amino acid sequence of the CDR3 and the amino acid sequence of the FR2 are on a same polypeptide chain.
- amino acid sequence of the CDR1, CDR2, CDR3 and FR2 are on a same polypeptide chain.
- amino acid sequence of the CDR3 and the amino acid sequence of the FR2 are on two polypeptide chains.
- the present disclosure also relates to binding agent that is capable of binding to TROP2 comprising one or more antigen binding domains or at least one antigen binding fragment of a single domain antibody, wherein at least one of the one or more antigen binding domains or at least one antigen binding fragment comprises: a. a heavy chain complementarity determining region 1 (CDRH1) having the amino acid sequence set forth in SEQ ID NO: 1, a heavy chain complementarity determining region 2 (CDRH2) having the amino acid sequence set forth in SEQ ID NO:2 and a heavy chain complementarity determining region 3 (CDRH3) having the amino acid sequence set forth in SEQ ID NO :3; b.
- CDRH1 heavy chain complementarity determining region 1
- CDRH2 heavy chain complementarity determining region 2
- CDRH3 heavy chain complementarity determining region 3
- a CDRH1 having the amino acid sequence set forth in SEQ ID NO:4 a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 5 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 6; c. a CDRH1 having the amino acid sequence set forth in SEQ ID NO:7, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 8 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 9; d.
- a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 10 a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 11 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 12; e. a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 13, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 14 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 15; f.
- a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 16 a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 17 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 18; g. a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 19, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:20 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:21; h.
- variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95% identical to the amino acid sequence set forth in SEQ ID NO:27; ff a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95% identical to the amino acid sequence set forth in SEQ ID NO:28; gg. a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95% identical to the amino acid sequence set forth in any one of SEQ ID NOs:73 to 114.
- the present disclosure relates to a binding agent that is capable of binding to trophoblast cell surface antigen-2 (TROP2) and that comprises at least one antigen binding fragment of a single domain antibody.
- TROP2 trophoblast cell surface antigen-2
- the binding agent, or antigen binding domain(s) of the binding agent comprises: a. a variable region having an amino acid sequence as set forth in SEQ ID NO:22; b. a variable region having an amino acid sequence as set forth in SEQ ID NO:23; c. a variable region having an amino acid sequence as set forth in SEQ ID NO:24; d. a variable region having an amino acid sequence as set forth in SEQ ID NO:25; e. a variable region having an amino acid sequence as set forth in SEQ ID NO:26; f. a variable region having an amino acid sequence as set forth in SEQ ID NO:27 g. a variable region having an amino acid sequence as set forth in SEQ ID NO:28 or; h. a variable region having an amino acid sequence as set forth in any one of SEQ ID Nos:73-114.
- the binding agent comprises: a. an amino acid sequence at least 75%, 80% 85%, 90%, 95% identical to the amino acid sequence set forth in SEQ ID NO:29; b. an amino acid sequence at least 75%, 80% 85%, 90%, 95% identical to the amino acid sequence set forth in SEQ ID NO: 30; c. an amino acid sequence at least 75%, 80% 85%, 90%, 95% identical to the amino acid sequence set forth in SEQ ID NO: 31; d. an amino acid sequence at least 75%, 80% 85%, 90%, 95% identical to the amino acid sequence set forth in SEQ ID NO:32; e.
- the binding agent comprises: a. an amino acid sequence as set forth in SEQ ID NO:29; b. an amino acid sequence as set forth in SEQ ID NO: 30; c. an amino acid sequence as set forth in SEQ ID NO: 31; d. an amino acid sequence as set forth in SEQ ID NO:32; e. an amino acid sequence as set forth in SEQ ID NO:33; f. an amino acid sequence as set forth in SEQ ID NO:34; g. an amino acid sequence as set forth in SEQ ID NO:35; h. an amino acid sequence as set forth in SEQ ID NO:44 or, i. an amino acid sequence as set forth in SEQ ID NO:45.
- the antigen binding domain is a heavy chain variable region.
- the heavy chain variable region is a camelid VH or VHH. In some embodiments, the heavy chain variable region is a human VH.
- the heavy chain variable region is a mouse VH.
- the heavy chain variable region is a rat VH.
- the heavy chain variable region is a humanized VH or VHH.
- the heavy chain variable region may be a humanized camelid VH or VHH.
- the heavy chain variable region may be a humanized mouse VH.
- the heavy chain variable region may be a humanized rat VH.
- the antigen binding domain is a heavy chain.
- the binding agent may comprise two heavy chain variable regions. Each heavy chain variable regions may be on separate heavy chains. Accordingly, the binding agent may comprise two heavy chains.
- the binding agent of the present disclosure may be, for example, a single domain antibody (heavy chain only antibody).
- the binding agent is a heavy chain only antibody that comprises a heavy chain complementarity determining region 1 (CDRH1) having the amino acid sequence set forth in SEQ ID NO:1, a heavy chain complementarity determining region 2 (CDRH2) having the amino acid sequence set forth in SEQ ID NO:2 and a heavy chain complementarity determining region 3 (CDRH3) having the amino acid sequence set forth in SEQ ID NO:3.
- CDRH1 heavy chain complementarity determining region 1
- CDRH2 heavy chain complementarity determining region 2
- CDRH3 heavy chain complementarity determining region 3
- the binding agent is a heavy chain only antibody that comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:4, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 5 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:6.
- the binding agent is a heavy chain only antibody that comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:7, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 8 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:9.
- the binding agent is a heavy chain only antibody that comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 10, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 11 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 12.
- the binding agent is a heavy chain only antibody that comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 13, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 14 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 15.
- the binding agent is a heavy chain only antibody that comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 16, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 17 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 18.
- the binding agent is a heavy chain only antibody that comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 19, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:20 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:21.
- the binding agent is a heavy chain only antibody that comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:46, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:47 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:48.
- the binding agent is a heavy chain only antibody that comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:55, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:47 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:48.
- the binding agent is a heavy chain only antibody that comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:49, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:50 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:51.
- the binding agent is a heavy chain only antibody that comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:62, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:50 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:51.
- the binding agent is a heavy chain only antibody that comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:52, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:53 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:54.
- the binding agent is a heavy chain only antibody that comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:56, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:57 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:58.
- the binding agent is a heavy chain only antibody that comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:59, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:60 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:61.
- the binding agent is a heavy chain only antibody that comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:63, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:64 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:65.
- the binding agent is a heavy chain only antibody that comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:66, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:67 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:68.
- the binding agent is a heavy chain only antibody that comprises the CDRH1, CDRH2 and CDRH3 of SEQ ID NO: 152.
- the binding agent is a heavy chain only antibody that comprises the CDRH1, CDRH2 and CDRH3 of SEQ ID NO: 153. In other exemplary embodiments, the binding agent is a heavy chain only antibody that comprises the CDRH1, CDRH2 and CDRH3 of SEQ ID NO: 154.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:22.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:23.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:24.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:25.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:26.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:27.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:28.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:71. In additional exemplary embodiments, the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:72.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:73.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:74.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 75.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:76.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NOs77.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:78.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:79.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:80. In additional exemplary embodiments, the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:81.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:82.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95% identical to the amino acid sequence set forth in SEQ ID NO: 83.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:84.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:85.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:86.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:87.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:88.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:89. In additional exemplary embodiments, the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:90.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95% identical to the amino acid sequence set forth in SEQ ID NO:91.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:92.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:93.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:94.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 95.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, v identical to the amino acid sequence set forth in SEQ ID NO:96.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:97.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 98. In additional exemplary embodiments, the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:99.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 100.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 101.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 102.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 103.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 104.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 105.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 106.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 107. In additional exemplary embodiments, the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95% identical to the amino acid sequence set forth in SEQ ID NO: 108.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 109.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 110.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 111.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 112.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 113.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95% , 99% identical to the amino acid sequence set forth in SEQ ID NO: 114.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the variable region of SEQ ID NO: 152.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the variable region of SEQ ID NO: 153. In additional exemplary embodiments, the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the variable region of SEQ ID NO: 154.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:29.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:30.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 31.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:32.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:33.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:34.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence at least 75%, 80% 85%, 90%, 95% , 99% identical to the amino acid sequence set forth in SEQ ID NO:35.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO:44. In other exemplary embodiments, the binding agent is a heavy chain only antibody that comprises an amino acid sequence at least 75%, 80% 85%, 90%, 95% identical to the amino acid sequence set forth in SEQ ID NO:45.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 152.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 153.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence at least 75%, 80% 85%, 90%, 95%, 99% identical to the amino acid sequence set forth in SEQ ID NO: 154.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence as set forth in SEQ ID NO:22.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence as set forth in SEQ ID NO:23.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence as set forth in SEQ ID NO:24.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence as set forth in SEQ ID NO:25.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence as set forth in SEQ ID NO:26.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence as set forth in SEQ ID NO:27.
- the binding agent is a heavy chain only antibody that comprises a variable region having an amino acid sequence as set forth in SEQ ID NO:28.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:29. In another exemplary embodiments, the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:73.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:74.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:75.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:76.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:77.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:78.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:79.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:80.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:81.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:82.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:83.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:84.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:85. In another exemplary embodiments, the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:86.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:87.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:88.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:89.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:90.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:91.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:92.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:93.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:94.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:95.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:96.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:97.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:98. In another exemplary embodiments, the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:99.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO: 100.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO: 101.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO: 102.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO: 103.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO: 104.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO: 105.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO: 106.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO: 107.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO: 108.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO: 109.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:110.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO: 111. In another exemplary embodiments, the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:112.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:113.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO: 114.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:30.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:31.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:32.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:33.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:34.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:35.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:44.
- the binding agent is a heavy chain only antibody that comprises an amino acid sequence as set forth in SEQ ID NO:45.
- the heavy chain only antibody comprises a dimerization domain as described herein.
- the heavy chain only antibody may comprise a constant region of a human IgG or a portion thereof.
- the heavy chain only antibody may thus be engineered. Accordingly, the heavy chain only antibody may be non-naturally occurring.
- the constant region or portion thereof is from an IgG1, an IgG2, an IgG3 or an IgG4.
- the constant region or portion thereof is from a IgG1, an IgG2, an IgG3 or an IgG4 heavy chain.
- the constant region or portion thereof is from a human IgG1.
- the constant region or portion thereof is from a IgG1 heavy chain.
- the constant region or portion thereof comprises a hinge.
- the constant region or portion thereof comprises a peptidic linker.
- the heavy chain only antibody comprises two heavy chains.
- the two chains of the heavy chain only antibody may be for example, identical.
- the binding agent or at least one of the one or more antigen binding domains may have an affinity of ⁇ 10 -6 M for human TROP2.
- the binding agent or at least one of the one or more antigen binding domains may have an affinity of ⁇ 10 -7 M for human TROP2.
- the binding agent or at least one of the one or more antigen binding domains may have an affinity of ⁇ 10 -8 M for human TROP2.
- the binding agent or at least one of the one or more antigen binding domains may have an affinity of ⁇ 10 -9 M for human TROP2.
- the binding agent or at least one of the one or more antigen binding domains may have an affinity of ⁇ 10 - 10 M for human TROP2.
- the binding agent or at least one of the one or more antigen binding domains may have an affinity of ⁇ 10 -11 M for human TROP2.
- the binding agent or at least one of the one or more antigen binding domains may have an affinity of ⁇ 10 -12 M for human TROP2.
- the heavy chain only antibody has an affinity for human TROP2 in the picomolar range.
- the KD value of the heavy chain only antibody is lower than 10E-11 for human TROP2.
- the binding agent or at least one of the one or more antigen binding domains may have an affinity of 1 x10 -10 M or lower for human TROP2.
- the binding agent or at least one of the one or more antigen binding domains may have an affinity of at between 1 x10 -10 M and 1 x10 -12 for human TROP2.
- the binding agent or at least one of the one or more antigen binding domains may have an affinity of at between 1 x10 -10 M and 1 x10 -11 for human TROP2.
- the binding agent or at least one of the one or more antigen binding domains may have a dissociation rate of between 1 x 10 -6 to 1 x 10 -4 for human TROP2.
- the binding agent or at least one of the one or more antigen binding domains may have a dissociation rate of between 1 x 10 -5 to 1 x 10 -4 for human TROP2.
- the binding agent or antigen binding domain(s) of the present disclosure may have ADCP activity towards cells expressing human TROP2.
- the binding agent or antigen binding domain(s) of the present disclosure may have ADCP activity towards cells expressing human TROP2 and Cluster of Differentiation 47 (CD47) (Uniprot Accession No. Q08722-1).
- CD47 Cluster of Differentiation 47
- An exemplary and non-limiting embodiment of a CD47 antigen is provided in SEQ ID NO: 176.
- the binding agent or antigen binding domain(s) of the present disclosure may have ADCC activity towards cells expressing human TROP2.
- the binding agent or antigen binding domain(s) of the present disclosure may be internalized in cells expressing human TROP2.
- the binding agent or antigen binding domain(s) of the present disclosure may be capable of inhibiting the growth of tumor cells expressing human TROP2.
- the binding agent or antigen binding domain(s) of the present disclosure may be capable of inhibiting the growth of tumor cells expressing human TROP2 and CD47. Accordingly, the binding agent may comprise one or more antigen binding domains that is capable of binding to CD47.
- the antigen binding domain that is capable of binding to CD47 may comprise: a. a CDRH1 having the amino acid sequence set forth in SEQ ID NO 156, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 157 and/or a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 158, or b. a CDRH1 having the amino acid sequence set forth in SEQ ID NO 159, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 160 and/or a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 161.
- the antigen binding domains that is capable of binding to CD47 may comprise an amino acid sequence at least 80% identical to the amino acid sequence set forth in SEQ ID NO:155.
- the antigen binding domains that is capable of binding to CD47 may comprise an amino acid sequence at least 80% identical to the amino acid sequence set forth in SEQ ID NO : 150 or 151.
- the present disclosure also relates to a binding agent that is capable of competing with one or more binding agents disclosed herein.
- the binding agent comprises at least one antigen binding domain that is capable of competing with one or more binding agent disclosed herein.
- the binding agent comprises at least one antigen binding fragment of a single domain antibody that is capable of competing with one or more binding agent disclosed herein.
- the binding agent is capable of competing or comprises one or more antigen binding domains that is capable of competing with a binding agent comprising: a. a heavy chain complementarity determining region 1 (CDRH1) having the amino acid sequence set forth in SEQ ID NO:1, a heavy chain complementarity determining region 2 (CDRH2) having the amino acid sequence set forth in SEQ ID NO:2 and a heavy chain complementarity determining region 3 (CDRH3) having the amino acid sequence set forth in SEQ ID NO:3; b.
- CDRH1 heavy chain complementarity determining region 1
- CDRH2 heavy chain complementarity determining region 2
- CDRH3 heavy chain complementarity determining region 3
- a CDRH1 having the amino acid sequence set forth in SEQ ID NO:4 a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 5 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 6; c. a CDRH1 having the amino acid sequence set forth in SEQ ID NO:7, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 8 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 9; d.
- a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 10 a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 11 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 12; e. a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 13, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 14 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 15; f.
- a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 16 a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 17 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 18; g. a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 19, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:20 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:21; h.
- variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95% identical to the amino acid sequence set forth in SEQ ID NO:27; ff a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95% identical to the amino acid sequence set forth in SEQ ID NO:28 and/or; gg. a variable region having an amino acid sequence at least 75%, 80% 85%, 90%, 95% identical to the amino acid sequence set forth in any one of SEQ ID NOs:73 to 114.
- the binding agent comprises two antigen binding fragments.
- the binding agent comprises two identical antigen binding fragments.
- the binding agent comprises two antigen binding domains.
- the binding agent comprises two identical antigen binding domains.
- the binding agent comprises more than two antigen binding fragments.
- the binding agent comprises more than two antigen binding domains.
- the binding agent comprises antigen binding fragments of at least two different single domain antibodies.
- the at least two different single domain antibodies have the same specificity. In other embodiments the at least two different single domain antibodies have different specificities.
- the binding agent comprises two antigen binding fragments of same or different single domain antibodies.
- the binding agent comprises more than two antigen binding fragments of same and/or different single domain antibodies.
- the binding agent may comprise a Fc or a portion thereof that is capable of binding to an Fc receptor of monocytes and/or macrophages.
- the binding agent may comprise a Fc or a portion thereof that is capable of binding to an Fc receptor on CD68+ macrophages.
- the binding agent comprises a dimerization domain.
- the dimerization domain allows the formation of homodimers.
- the dimerization domain allows the formation of heterodimers.
- the dimerization domain comprises an amino acid sequence that is contiguous to the amino acid sequence of the antigen binding domain.
- the dimerization domain comprises an immunoglobulin dimerization domain.
- Other dimerization domains known to a person skilled in the art are contemplated herein including leucine zippers, etc.
- the dimerization domain comprises an IgG, IgM, IgA, IgD or IgE dimerization domain (from human or animal IgGss, IgM, IgAs, IgDs or IgEs).
- the dimerization domain comprises a constant region of an antibody or a portion thereof.
- the constant region or portion thereof is from an IgG1, an IgG2, an IgG3 or an IgG4 heavy chain or combination thereof.
- the constant region or portion thereof comprises amino acid sequence of an IgG1, an IgG2, an IgG3 or an IgG4 heavy chain or combination thereof.
- the constant region or portion thereof is from a human IgG1 heavy chain.
- the constant region or portion thereof is from a human IgG2 heavy chain.
- the constant region or portion thereof is from a human IgG3 heavy chain.
- the constant region or portion thereof is from a human IgG4 heavy chain.
- the dimerization domain comprises a Fc region of an antibody or a portion thereof.
- the dimerization domain comprises a Fc region or a portion thereof that comprises Fc modification(s) or not.
- the dimerization domain comprises an altered or mutated Fc region or portion thereof.
- the Fc region or portion thereof may be altered or mutated so as to modify one or more characteristics of the binding agent.
- the Fc region or portion thereof is unglycosylated.
- the Fc region or portion thereof comprises one or more of the Fc modification(s) of Table A.
- the Fc region or portion thereof is altered or mutated so as to increase ADCC activity.
- afucosylation e.g., N297 in accordance with the EU numbering system
- the Fc region or portion thereof may have a reduced number of fucose residues.
- the binding agent comprises an afucosylated Fc region or portion thereof.
- the Fc region or portion thereof of the binding agent lacks fucose residues.
- the Fc region or portion thereof of the binding agent lacks core fucose residues.
- the Fc region or portion thereof of the binding agent fully lacks core fucose residues.
- the dimerization domain comprises a CH3 domain.
- the CH3 domain is a natural CH3 domain or a mutated CH3 domain.
- the dimerization domain also comprises a CH2 domain.
- the dimerization domain comprises a CH3 domain of an antibody.
- the dimerization domain may also comprise a CH2 domain of an antibody.
- the CH2 domain is a natural CH2 domain or a mutated CH2 domain.
- the dimerization domain comprises a natural CH2 domain and a natural CH3 domain.
- the dimerization domain comprises a natural CH2 domain and a mutated CH3 domain.
- exemplary embodiments of mutated CH3 domain are provided in PCT/CA2020/051753 filed on December 18, 2020, and published on June 24, 2021, under No. WO2021/119832A1, the entire content of which is incorporated herein by reference.
- the dimerization domain comprises a mutated CH2 domain and a natural CH3 domain.
- the dimerization domain comprises a mutated CH2 domain and a mutated CH3 domain.
- the binding agent is an antibody or an antigen binding fragment thereof or a variant thereof.
- the antibody or an antigen binding fragment thereof is a single domain antibody or an antigen binding fragment thereof or a variant thereof.
- the binding agent is a competing binding agent.
- the binding agent is a competing antibody or antigen binding fragment thereof.
- the binding agent is a competing single domain antibody or antigen binding fragment thereof.
- the binding agent is an antibody-like molecule.
- the binding agent comprises a protein scaffold.
- the binding agent comprises an immune cell modulating agent.
- the antigen binding fragments of single domain antibodies are in tandem.
- the binding agent is naked.
- the binding agent is conjugated to a therapeutic moiety.
- the binding agent is conjugated to a detectable moiety.
- the binding agent is conjugated to a protein allowing an extended half-life.
- the binding agent is attached to a nanoparticle.
- the binding agent of the present disclosure possesses anti-tumor activity.
- the binding agent of the present disclosure may be functional when naked (unconjugated).
- the binding agent of the present disclosure possesses antibody-dependent cellular cytotoxicity (ADCC) activity.
- the binding agent of the present disclosure possesses antibody-dependent cellular phagocytosis activity.
- the binding agent of the present disclosure possess activity as an antibody drug conjugate.
- the anti-TROP2 sdAbs of the present disclosure may have naked anti-tumor activity to a variety of solid tumors.
- the anti-TROP2 sdAbs of the present disclosure may cause tumor regression in in vivo xenograft models of multiple tumor types.
- the anti-TROP2 sdAbs of the present disclosure may cause tumor growth inhibition in in vivo xenograft models of multiple tumor types.
- the anti-TROP2 sdAbs of the present disclosure may cause in vivo tumor regression of late-stage tumors (large tumors).
- the anti-TROP2 sdAbs of the present disclosure may cause in vivo tumor regression of tumors.
- the anti-TROP2 sdAbs of the present disclosure may cause tumor regression at very low dose levels.
- the binding agent may have anti-tumor effect at a dose of approximately between 0.01 to 150 mg/kg, 0.01 to 100 mg/kg, 0.01 to 50mg/kg, 0.05 to 150 mg/kg 0.05 to 100 mg/kg, 0.05 to 50 mg/kg, 0.05 to 30 mg/kg, 0.05 to 10 mg/kg, 0.1 to 50mg/kg, 0.1 to 30mg/kg, 0.1 to 10m/kg, or 1.0 to 10 mg/kg.
- the anti-TROP2 sdAbs of the present disclosure may cause tumor regression at a dose of O.lmg/kg once per week.
- the anti-TROP2 sdAbs of the present disclosure may cause tumor regression with low frequency dosing.
- the anti-TROP2 sdAbs of the present disclosure may cause tumor regression with dosing once every three weeks.
- the anti-TROP2 sdAbs of the present disclosure may directly impact viability of tumor cells in vitro.
- the anti-TROP2 sdAbs of the present disclosure may elicit effector function in vitro.
- the anti-TROP2 sdAbs of the present disclosure may mediate their in vivo anti-tumor efficacy by an effector function-driven mechanism of action.
- the anti-TROP2 sdAbs of the present disclosure may mediate their in vivo anti-tumor efficacy by direct anti-tumor activity.
- the antigen binding fragment is partially or fully humanized.
- the antigen binding fragment comprises one or more human frameworks.
- the antigen binding domain is partially or fully humanized.
- the antigen binding domain comprises one or more human frameworks.
- the antigen binding domain comprises one or more humanized frameworks. In further embodiments, the antigen binding domain comprises one or more partially humanized frameworks.
- the level of humanization of a single domain antibody may be calculated based on the sequence identity to the closest human VH germline gene. Accordingly, the percentage of humanization score is based on framework regions 1-3 (FR1, FR2, FR3) and CDR1 and CDR2. In accordance with an embodiment, the sequence of CDR3 and FR4 are not accounted for assessing the level of humanization of a single domain disclosed herein.
- the level of humanization of the antigen binding domain is at least 80%.
- the level of humanization of the variable region of the single domain antibody of the present disclosure is at least 80%.
- compositions comprising the binding agent disclosed herein.
- the composition of the present disclosure is composed of binding agent that have the same sequence.
- compositions comprising the binding agent disclosed herein and a pharmaceutically acceptable carrier.
- the pharmaceutical composition of the present disclosure is composed of binding agent that have the same sequence.
- compositions comprising a conjugated binding agent as disclosed herein and a pharmaceutically acceptable carrier.
- nucleic acid or set of nucleic acids encoding the binding agent disclosed herein.
- the cells are engineered to express a binding agent such as for example, an antibody or an antigen binding fragment thereof or an antibody-like molecule. Accordingly, the present disclosure encompasses isolated cells that express an antibody or an antigen binding fragment thereof or an antibody-like molecule.
- the cells are engineered to express a binding agent such as for example, a chimeric antigen receptor (CAR) construct.
- a binding agent such as for example, a chimeric antigen receptor (CAR) construct.
- the present disclosure encompasses T-cells or NK cells that express a chimeric antigen receptor (CAR) construct.
- Additional aspects and embodiments of the present disclosure relate to a cell comprising the nucleic acid or the vector disclosed herein.
- kits comprising the binding agent disclosed herein.
- the kit may comprise a binding agent that binds to TROP2 and a binding agent that binds to a macrophage marker.
- the kit may comprise an antibody or an antigen binding fragment thereof that specifically binds to TROP2.
- the kit may comprise a binding agent as described herein.
- the kit may also comprise an antibody that binds to a macrophage marker, such as for example and without limitations an antibody or antigen binding fragment thereof that binds to CD68 (human CD68).
- kits comprising the nucleic acid disclosed herein.
- kits comprising the vector disclosed herein.
- kits comprising the cells disclosed herein.
- the present disclosure relates to a method of treating a disorder or disease comprising administering the binding agent disclosed herein.
- the present disclosure relates to a method of treating a disorder or disease comprising administering the composition disclosed herein.
- the present disclosure relates to a method of treating a disorder or disease comprising administering the pharmaceutical composition disclosed herein.
- the TROP2 binding agent, composition or pharmaceutical composition disclosed herein is administered to a subject having cancer selected from epithetial cancer, lung cancer (such as small cell lung cancer, non small cell lung cancer), myeloma, prostate cancer, breast cancer (such as triple negative breast cancer), rectal cancer, pancreatic cancer, glioblastoma, cervical cancer, colorectal cancer, gastric cancer, ovarian cancer, thyroid cancer, stomach cancer, cancer of the urinary bladder, cancer of the uterus, esophageal cancer, head and neck cancer, blood cancer.
- lung cancer such as small cell lung cancer, non small cell lung cancer
- myeloma myeloma
- prostate cancer such as triple negative breast cancer
- rectal cancer pancreatic cancer, glioblastoma, cervical cancer, colorectal cancer, gastric cancer, ovarian cancer, thyroid cancer, stomach cancer, cancer of the urinary bladder,
- the TROP2 binding agent, composition or pharmaceutical compositions disclosed herein is administered to a subject having a metastatic cancer.
- the binding agent, composition or pharmaceutical composition may be administered to a subject having a tumor expressing TROP2.
- aspects of the disclosure relate to a method of treating cancer, which comprises administering a drug that targets human TROP2 to a subject having a tumor expressing TROP2 and expressing one or more macrophage markers.
- the drug may be a binding agent as described herein.
- the binding agent may be Sacituzumab Govitecan, hTINA-1, h7E6, and AR47A6.4.2.
- the binding agent may be a small molecule.
- the macrophage marker is a pan macrophage marker such as, for example and without limitations, CD68.
- the binding agent, composition or pharmaceutical composition may be administered to a subject having a tumor expressing TROP2 and a macrophage marker such as CD68.
- the eligibility of a subject to a treatment targeting TROP2 may be determined.
- the tumor of the subject may be tested for expression of TROP2 and/or for expression of a macrophage marker prior to the administration of the binding agent, composition or pharmaceutical composition described herein.
- the efficacy of the treatment may be assessed.
- the tumor of the subject may be tested for expression of TROP2 and for expression of a macrophage marker during and/or after treatment with the binding agent, composition or pharmaceutical composition described herein.
- the present disclosure relates to a method of making the binding agent disclosed herein by transforming cells with one or more vectors comprising the nucleic acid disclosed herein.
- the method may further comprise isolating and/or purifying the binding agent from impurities.
- the method further comprises conjugating the binding agent with a therapeutic moiety, detectable moiety, or a protein allowing an extended half-life or to nanoparticles.
- the present disclosure also relates to the use of the binding agent disclosed herein for detecting TROP2 in tumor cells or tumor tissue.
- the binding agent may have the CDR amino acid sequence of SEQ ID NO: 152.
- the binding agent may have the CDR amino acid sequence of SEQ ID NO: 153.
- the binding agent may have the CDR amino acid sequence of SEQ ID NO: 154.
- the binding agent may have an amino acid sequence having at least 80% sequence identity with the variable region of any one of SEQ ID NO: 152, SEQ ID NO: 153 or SEQ ID NO: 154.
- the binding agent may have one or more CDRs of any one of SEQ ID NO: 152, SEQ ID NO: 153 or SEQ ID NO: 154.
- the binding agent may have the CDR1, CDR2 and CDR3 amino acid sequence of any one of SEQ ID NO: 152, SEQ ID NO: 153 or SEQ ID NO: 154.
- the binding agent may have an amino acid sequence identical to the variable region of any one of SEQ ID NO: 152, SEQ ID NO: 153 or SEQ ID NO: 154. In yet other exemplary embodiments, the binding agent may have an amino acid sequence identical to any one of SEQ ID NO: 152, SEQ ID NO: 153 or SEQ ID NO: 154.
- the present disclosure also relates to method for identifying a binding agent capable of binding to human TROP2 and having anti-tumor activity as described herein.
- Figures 1A-D graphs illustrating the tumor volume over time of SCID mice bearing MDA-MB-453 (Figure 1A), MDA-MB-231 ( Figure 1B), BxPC-3 ( Figure 1C) or T.Tn ( Figure 1D) treated with the KD001, KD002, KD003, KD004 or KD005 anti-TROP2 sdAbs or with PBS.
- Figure 1E histogram showing binding of KD001, KD002, KD003, KD004 or KD005 anti-TROP2 sdAbs to MDA-MB-453, MDA-MB-231, BxPC3, and A375 cells compared with AR47A6.4.2 anti-TROP2 monoclonal antibody as analyzed by flow cytometry. Negative control is sdAb that binds HEWL (NC).
- Figure 2A graph of in vivo dose/response study of weekly treatment of KD001, KD002, KD003, KD004 or KD005 anti-TROP2 sdAbs at doses of 0.5mg/kg, 2mg/kg, 8 mg/kg and 30mg/kg i.p. in MDA-MB-453 implanted NCG mice tumor model. Negative control is PBS.
- Figure 2B graph of in vivo weekly treatment of large tumor with KD004 at 8mg/kg, once weekly (QW) i.p. in MDA-MB-453 implanted NCG mice tumor model. Negative control is PBS. Treatment was discontinued at around day 70, and replaced with PBS, and the negative control treated mice were treated with KD004 at 8mg/kg QW.
- Figure 2C graph showing the anti -tumor effect of various treatment regimen with KD004 at a dose of 8mg/kg with the indicated frequencies i.p. in MDA-MB-453 implanted NCG mice tumor model. Negative control is PBS.
- Figure 2D graph showing the anti-tumor effect of various treatment regimen with KD002 or KD005 at a dose of 0.1mg/kg i.p. in MDA-MB-453 implanted NCG mice tumor model. Negative control is PBS.
- Figure 2E Anti-TROP2 in vivo pharmacokinetic parameters.
- Figure 3 graph showing tumor volume over time of MDA-MB-453 implanted NCG mice treated with KD004 at 8 mg/kg i.p. at the indicated intervals in the presence or absence of human PBMCs. Negative control is PBS.
- Figure 4A histogram showing cell viability of MDA-MB-453 cells following 12 days treatment with 1 ⁇ M KD001, KD002, KD003, KD004 or KD005 anti-TROP2 sdAbs in comparison with AR47A6.4.2 anti-TROP2 monoclonal antibody.
- Negative controls include sdAb that binds HEWL (NC) or untreated cells.
- FIG. 4B image of MDA-MB-453 cells at 4x resolution after 12 days of treatment with KD001, KD002, KD003, KD004 or KD005 anti-TROP2 sdAb.
- Negative controls include sdAb that binds HEWL (NC) or untreated cells.
- Figure 5A histogram showing cell viability of MDA-MB-453 cells reflecting the ADCC activity of KD001, KD002, KD003, KD004 or KD005 anti-TROP2 sdAbs.
- Negative controls include untreated cells (No Ab), no effector cells, no target cells or sdAb that binds HEWL (NC).
- Comparisons includes cells treated with human IgG1 anti-TROP2 antibodies generated with the sequences from clones hTINA-1 and h7E6.
- FIG. 5B sdAbs tumor growth inhibition (TGI) was tested in vivo in NCG and SCID mice having different effector function background and implanted with either MDA-MB-231 or MDA-MB-453 cells s.c. Administration of KD002 or KD004 was initiated when average tumor volume reached 100mm 3 .
- TGI tumor growth inhibition
- Figures 6A-B histograms illustrating internalization of KD001, KD002, KD003, KD004 or KD005 anti-TROP2 sdAbs (Figure 6A) or AR47A6.4.2 ( Figure 6B) in MDA-MB-453 cells after 4 or 24 hours. Negative controls include sdAb that binds HEWL (NC) or medium only.
- Figures 6C graph illustrating internalization of KD001, KD002, KD003, KD004 or KD005 anti-TROP2 sdAbs in MDA-MB-453. Internalization was assessed by conjugation of HCAbs with a pH-sensitive probe and monitored by flow cytometry (Em. 560nm).
- Figure 6D Confocal microscopy images of MDA-MB-453 cells showing KD002 and KD005 antibody binding and internalization were taken at 0, 6 and 24 hours. For each time point, one representative cell is shown. The cells were stained with anti-human IgG Fc-FITC and the nuclei were counterstained with DAPI. Images were obtained using confocal fluorescence microscopy. Scale bar, 10 ⁇ M.
- Figures 7A-D binding of KD001, KD002, KD003, KD004, KD005, KD006 or KD007 anti-TROP2 sdAbs to CHO ( Figure 7A) or HEK parental cells ( Figure 7C) or CHO ( Figure 7B) or HEK cells expressing human TROP2 ( Figure 7D) compared with negative control (sdAb that binds HEWL (NC)) or comparator monoclonal antibodies AR47A6.4.2, hTINA-1, h7E6 and hRS7 as assessed by flow cytometry.
- Figure 7E Bar graph illustrating binding of KD001, KD002, KD003, KD004, KD005, KD006 or KD007 anti-TROP2 sdAbs to recombinant human EpCAM (rhEpCAM) and to recombinant human IGFBP-1 (rhIGFB-1) proteins.
- Figure 8 graph illustrating competition assays performed with either His tag conjugated KD001 (Figure 8A), KD002 (Figure 8B), KD003 ( Figure 8C), KD004 (Figure 8D) or KD005 ( Figure 8E) and each of KD001, KD002, KD003, KD004 or KD005 anti-TROP2 sdAbs for binding to human recombinant TROP2.
- Figure 9A graph illustrating competition assays between His tag conjugated KD004 and hRS7 or AR47A6.4.2 antibodies for the binding of human recombinant TROP2.
- Figure 9B graph illustrating competition assays between His tagged KD006 and KD007 anti-TROP2 sdAbs for the binding of human recombinant TROP2.
- Figure 10A schematic showing the various constructs used to map the binding domain of KD001, KD002, KD003, KD004 or KD005 anti-TROP2 sdAbs.
- Figure 10B picture of immunoblots performed with KD001, KD002, KD003, KD004 or KD005 anti-TROP2 sdAbs or with AR47A6.4.2 and hRS7 on human TROP2 extracellular domain (ECD) and human TROP2 cysteine poor domain (CPD). Negative control includes sdAb that binds HEWL (NC).
- Figures 11A-E pictures of immunoblots performed with KD001, KD002, KD003, KD004 or KD005 anti-TROP2 sdAbs on different forms of recombinant human TROP2 (non-denaturated, linear, reduced, deglycosylated using PNGase F).
- Figures 12A-12D graph showing binding of KD001, KD002, KD003, KD004 or KD005 anti-TROP2 sdAbs on recombinant cynomolgus/Rhesus TROP2 protein (Figure 12A), on recombinant human TROP2 protein ( Figure 12B), on mouse TROP2 protein ( Figure 12C) or on rat TROP2 protein ( Figure 12D).
- Negative control includes sdAb that binds HEWL.
- Positive control includes anti-TROP2 polyclonal antibody.
- Figure 12E table illustrating affinity of KD001, KD002, KD003, KD004 or KD005 anti- TROP2 sdAbs to human TROP2 and to cynomolgus TROP2 by SPR.
- Figure 12F table illustrating affinity of KD001, KD002, KD003, KD004 or KD005 anti- TROP2 sdAbs to human TROP2 with ka, kd and KD indicated.
- Figure 13A-13B histogram showing the binding of the indicated TROP2 antibodies at 100 nM to HEK cells transfected with TROP2 constructs with various cysteine-rich domain truncations as indicated.
- Figure 13C graph showing the tumor growth of in the xenograft model of T.Tn in the SCID mice upon treatment with anti-TROP2 antibodies at 8 mg/kg i.p., once per week. Treatment with KD006 led to a tumor growth inhibition of 48.6% in the xenograft model of T.Tn.
- Figure 14A graph of the antibody -mediated cellular phagocytosis activity of IgG1- or IgG4 versions of KD002 and KD004 against MDA-MB-453 tumors.
- Figure 14B graph showing CD47 and TROP2 expression level on MDA-MB-453, MDA- MB-231, and NCI-H292 cells measured by staining with anti-CD47 (Biolegend, cat# 323124) and anti-TROP2 (Biolegend, cat# 363804) antibodies at 1/100 dilutions. Data are shown as fold change of CD47 and TROP2 level relative to the isotype control staining.
- Figure 14C-E graphs showing the dose-response ADCP activity of KD002 and KD004 TROP2 antibodies against the MDA-MB-453 ( Figure 14C), MDA-MB-231 ( Figure 14D), and NCI-H292 ( Figure 14E) cells.
- the ADCP assays were performed with the Promega ADCP assay kits (Promega, cat# CS314906). Testing antibodies were serial diluted from 1.88 nM with 1/2.2 dilution.
- TROP2 antibodies KD002 and KD004 showed a high level of ADCP activity against MDA-MB-453 cells, whereas relatively low ADCP activity on MDA-MB-231 and NCI-H292 cells.
- Figure 14F graph illustrating the ADCP activity of KD002 and KD004 and the corresponding IgG4 version; KD017 and KD018 against MDA-MB-453, MDA-MB-231, and NCI-H292 cells. Assay was performed at the antibody concentration of 1 nM.
- Figure 15A graph illustrating the CD47 expression level on MDA-MB-231 and NCI- 11292 cells after CD47 knockdown with siRNA.
- the CD47 siRNA and control siRNA were used in the knockdown assay (Thermofisher CD47 silencer select pre-designed siRNA (Cat# 4392421) and silencer negative control siRNA (Cat# AM4635).
- Figure 15B-C graphs showing the dose-response ADCP activity of KD002 and KD005 TROP2 antibodies against the MDA-MB-231 ( Figure 15B), and NCI-H292 cells ( Figure 15C) upon CD47 knockdown. Testing antibodies were serial diluted from 2.1 nM with 1/2.5 dilution.
- Figure 15D graphs illustrating the ADCP activity of KD002 and KD005 and the corresponding IgG4 version, KD017 and KD019 against the MDA-MB-453, MDA-MB-231, and NCI-H292 cells upon inhibition of CD47 expression with siRNA (siCD47) or not (siNC). Assay was performed at the antibody concentration of 1 nM.
- Figure 15E graphs showing in vivo efficacy of TROP2-CD47 bispecific antibodies in the xenograft model of MDA-MB-231 in SCID mice. Mice were treated with KD004 at 8 mg/kg, once per week and KD065 and KD066 were administered at the same molarity (11 mg/kg) i.p.
- FIG 16A plots showing the THP-1 differentiated M1 and M2 macrophages upon treatment with PMA and cytokines.
- THP-1 cells showed upregulation of CD68 after PMA treatment.
- the M1 cells showed upregulation of CD38 and CD86 after treatment with IFN- ⁇ and LPS.
- M2 macrophages showed upregulation of CD206 and downregulation of CD38 after treatment with IL-4 and IL-13.
- Figure 16B bar graph showing the percentage of phagocytosed M1 or M2 macrophages upon treatment with KD002, KD004 or KD005 at 10 nM as illustrated by gating on the pHrodo positive and Celltrace Violet positive cells.
- Figure 17A bar graph illustrating the binding of TROP2 antibodies at 25 nM to TROP2 recombinant proteins by ELISA using an anti-IgG4 Fc secondary antibody.
- Figure 17B graph showing the anti-tumor effect of KD002 and KD017 at a dose of 8 mg/kg i.v. in MDA-MB-453 implanted NCG mice tumor model. Negative control is PBS.
- Figure 18A graph showing the dose-response ADCP activity of KD002 and KD005 TROP2 antibodies against the MDA-MB-453 (upper panel), MDA-MB-468 (middle panel), and T.Tn cells (lower panel).
- the ADCP assays were performed using the Promega ADCP assay kits (Promega, cat# CS314906).
- Figure 18B graph showing the anti -tumor effect of KD002 and KD005 in the MDA-MB- 453 (upper panel), MDA-MB-468 (middle panel), and T.T.n (lower panel) xenograft tumor models. Testing antibodies were administered with 8 mg/kg i.p., once per week.
- FIG. 19A Photomicrographs of IHC staining of mouse macrophages with F4/80 antibody on the xenograft tumors collected from COLO205, CAPAN1, MDA-MB-231, T.T.n and MDA-MB-453 xenograft models treated with the TROP2 antibodies KD002 and KD005 at the dose level of 8 mg/kg. Tumors were collected at the end of the study.
- Figure 19B Human colon adenocarcinoma tumor tissue microarray with KD067, KD068 or isotype control KD069 antibody.
- the human multiple tumor tissue microarray was purchased from Novus Biologies (cat# NBP2-42056) and stained with the antibodies at 2 ⁇ g/ml.
- Figure 19C Human breast invasive ductal carcinoma tumor tissue microarray with KD067, KD068 or isotype control KD069 antibody.
- the human multiple tumor tissue microarray was purchased from Novus Biologies (cat# NBP2-42052) and stained with the antibodies at 2 ⁇ g/ml.
- Figure 19D Human head and neck tumor tissue microarray with KD067, KD068 or isotype control KD069 antibody (H&N squamous cell carcinoma).
- the human multiple tumor tissue microarray was purchased from Novus Biologies (cat# NBP2-42056) and stained with the antibodies at 2 ⁇ g/ml.
- Figure 19E Human kidney transitional cell carcinoma microarray with KD067, KD068 or isotype control KD069 antibody.
- the human multiple tumor tissue microarray was purchased from Novus Biologies (cat# NBP2-42052) and stained with the antibodies at 2 ⁇ g/ml.
- Figure 20A X-ray crystal structure of the extracellular domain of TROP2 protein with translucent surface rendering. The relative position of the Cystein-Rich Domain (CRD), Thyroglobulin Domain (TY-1), and Cy stein-Poor Domain (CPD) are indicated.
- CCD Cystein-Rich Domain
- TY-1 Thyroglobulin Domain
- CPD Cy stein-Poor Domain
- Figure 20B X-ray cocrystal of KD012 with human TROP2 (surface rendering shown).
- the contact region on TROP2 is shown on the surface of TROP2 in dark grey.
- the contacts between KD012 and TROP2 occur mainly in the CRD of TROP2 and CDR3 and framework 2 of KD012. CDRs and framework 2 are indicated with arrows.
- FIG. 20C X-ray cocrystal structure of KD012 with human TROP2.
- KD102 is depicted as a ribbon diagram. Selected residues on KD012 are shown, with the interacting residues on TROP2 shown in dark grey.
- Figure 20D shows amino acid residues involved in the interaction between KD012 and human TROP2 (within 4.5 ⁇ ; CDRs annotated in accordance with IMGT numbering).
- Figure 21A-21B represents dose-response ELISA binding of KD002 and humanized variants on human TROP2 recombinant protein.
- TROP2 antibodies were serially diluted from 200 nM to 0.00256 nM with 1/5 dilutions.
- Figure 22A-22B represents dose-response ELISA binding of KD005 and humanized variants on human TROP2 recombinant protein.
- TROP2 antibodies were serially diluted from 200 nM to 0.00256 nM with 1/5 dilutions.
- Figures 23A-23B bar graphs illustrating the relative light units of KD002 humanized variants compared to KD002 at 0.5nM ( Figure 23A) or 0.1nM ( Figure 23B) as measured with the Promega ADCP reporter assays.
- Figures 24A-24B bar graphs showing the relative light units of KD005 and KD005 humanized variants at 0.5nM ( Figure 24A) and 0.1nM ( Figure 24B) as measured with the Promega ADCP reporter assays.
- Figures 24C-24I dose-response ADCP assays carried out in MDA-MB-453 cells with KD045 (Figure 24C), KD047 (Figure 24D), KD048 (Figure 24E), KD049 (Figure 24F), KD053 ( Figure 24G), KD059 ( Figure 24H) and KD063 ( Figure 241).
- Figures 25-25B bar graphs showing the relative light units of KD002 humanized variants compared to KD002 at 0.5nM ( Figure 25A) or 0.1nM ( Figure 25B) as measured with the Promega ADCC reporter assays.
- Figures 26A-26B bar graphs showing the relative light units of KD005 and KD005 humanized variants at 0.5nM ( Figure 26A) and 0.1nM ( Figure 26B) as measured with the Promega ADCC reporter assays.
- Figure 27 Alignment between KD001, KD002, KD003, KD004 and KD005 variable regions.
- Figure 28 Alignment and consensus sequences of KD002 variants.
- Figure 29 Alignment of KD002 variants selected for their ADCC and ADCP activity.
- Figure 30 Alignment and consensus sequences of KD005 variants.
- Figure 31 Alignment of KD005 variants selected for their binding activity.
- Figure 32 Alignment of KD005 variants selected for their ADCP activity.
- Figure 33 Alignment of KD005 variants selected for their ADCC activity.
- Figure 34 Alignment of KD005 variants selected based on all characteristics.
- TR0P2 refers to a TROP2 protein or to a polypeptide comprising the TROP2 amino acid sequence.
- TROP2 encompasses the human TROP2 protein and any protein having at least 80% identity with the human TROP2 protein.
- anti- TROP2 antibody refers to an antibody of any format that binds to the TROP2 protein such as a TROP2 antigen or to a portion thereof and includes without limitations “anti- TROP2 single domain antibody”.
- binding agent refers to a molecule that comprises a polypeptidic portion (such as polypeptide chain(s)) and that is capable of specifically binding an antigen or that comprises a domain such as an antigen binding domain that is capable of specifically binding an antigen.
- antibody is used in the broadest sense and encompasses various antibody formats and structures, including any immunoglobulin, monoclonal antibody, polyclonal antibody, bivalent antibody, monovalent antibody, bispecific antibody, multiple specific (multi-specific) antibody, conventional antibody, single domain antibody, single chain antibody, heavy chain only antibody, nanobody, full-length antibody, humanized antibody, chimeric antibody that binds to a specific antigen, and any antigen binding fragment that exhibits the desired antigen binding activity.
- An antibody can be naturally occurring (native) or the results or recombination technologies.
- single domain antibody and “heavy chain only antibody” are used interchangeably.
- single domain antibody includes naturally occurring single domain antibody or heavy chain only antibody as well as single domain antibody in which the naturally occurring constant region is replaced by another dimerization domain such as for example a constant region of a human immunoglobulin (e.g., IgG) as well as variants such as humanized or chimeric single domain antibodies.
- a human immunoglobulin e.g., IgG
- a “naturally occurring single domain antibody” includes antibodies produced by camelids (camelid antibodies) or by shark. “Naturally occurring single domain antibody(ies)” also encompass antibody(ies) that are produced by transgenic animals modified to express heavy chain only antibodies. Exemplary embodiments of transgenic animals are provided in international application No. PCT/CA2021/050951 filed on July 21, 2021, and published on January 20, 2022, under No. W02022/011457, the entire content of which is incorporated herein by reference.
- KD001 any of the terms “KD001”, “KD002”, “KD003”, “KD004”, “KD005”, “KD006”, KD007”, “KD008”, “KD009”, “KD010”, “KD011”, “KD012”, “KD013”, “KD014”, “KD015”, “KD016”, “KD017”, “KD018”, “KD019”, “KD020”, “KD021”, “KD022”, “KD023”, “KD024”, “KD025”, “KD026”, “KD027”, “KD028”, “KD029”, “KD030”, “KD031”, “KD032”, “KD033”, “KD034”, “KD035”, “KD036”, “KD037”, “KD038”, “KD039”, “KD040”, “KD041
- KD061, KD062, KD063, KD064, KD067, KD068 or KD069 may have the corresponding variable region amino acid sequence set forth in Table 15, 16, 18 or 19 and a constant region that differs from that of the heavy chain amino acid sequence set forth in Table 15, 16, 18 or 19.
- KD062, KD063, KD064, KD067, KD068 or KD069 may have the corresponding variable region amino acid sequence set forth in Table 15, 16, 18 or 19 and a constant region allowing formation of homodimers as described herein.
- KD062, KD063, KD064, KD067, KD068 or KD069 may have the corresponding variable region amino acid sequence set forth in Table 15, 16, 18 or 19 and a constant region that binds to a macrophage Fc receptor.
- KD065 or “KD066” refer to a binding agent that comprises two chains, each having the corresponding amino acid sequence of the polypeptide chain set forth SEQ ID NO: 150 or SEQ ID NO: 151 respectively or each having the corresponding variable region amino acid sequence of the polypeptide chain.
- any one of KD065 or KD066 may have the corresponding variable region amino acid sequence of KD065 or KD66 and a different hinge and/or dimerization domain (e.g., CH2 and/or CH3) than KD065 or KD66.
- a different hinge and/or dimerization domain e.g., CH2 and/or CH3
- subject in need refers to a subject having, suspected of having a disorder or disease associated with TROP2, TROP2 expression (e.g., expression in tissue, cells or serum) or TROP2 overexpression.
- TROP2 expression e.g., expression in tissue, cells or serum
- TROP2 overexpression e.g., expression in tissue, cells or serum
- subject in need also refers to a subject having, suspected of having a disorder or disease that may benefit from treatment with a binding agent targeting TROP2.
- a “subject in need” include a subject having cancer or suspected of having cancer.
- treatment refers to both therapeutic treatment and prophylactic or tumor prevention measures.
- Subject in need of treatment include those already with the disorder as well as those prone to have the disorder or those in whom the disorder is to be prevented.
- Subject in need of treatment thus include subjects that already have cancer as well as those prone to have cancer or those in whom cancer is to be managed.
- the term “natural” as used in the context of a sequence refers to a sequence that occurs in nature.
- the term “about” or “approximately” with respect to a given value means that variation in the value is contemplated. In some embodiments, the term “about” or “approximately” shall generally mean a range within +/- 10 percent, within +/- 5 percent, within +/- 4 percent, within +/- 3 percent, within +/- 2 percent or within +/- 1 percent of a given value or range.
- the term “at least” with respect to a given value intends to include the value and superior values.
- the term “at least 80%” includes “at least 80%”, “at least 81%”, “at least 82%”, “at least 83%”, “at least 84%”, “at least 85%”, “at least 86%”, “at least 87%”, “at least 88%”,“at least 89%”, “at least 90%”, “at least 91%”, “at least 92%”, “at least 93%”, “at least 94%”, “at least 95%”, “at least 96%”, “at least 97%”, “at least 98%”, “at least 99%”, “at least 99.1%”, “at least 99.2%”, at least 99.3%”, at least 99.4%”, at least 99.5%”, at least 99.6%”, at least 99.7%”, at least 99.8%”, at least 99.9%”, and 100%.
- humanized means that the binding agent such as an antibody or antigen binding fragment comprises CDRs or CDR amino acid residues derived from non-human animal antibodies, FR regions derived from human antibodies, and when applicable, the constant regions derived from human antibodies.
- the expression “fully humanized framework region” means that the amino acid sequence of all framework regions of a given binding agent such as an antibody or antigen binding fragment is identical to that of a human antibody variable region e.g., a human germline antibody variable region sequence).
- partially humanized means that the amino acid sequence of one or more or all framework regions of the binding agent such as an antibody or antigen binding fragment is not totally identical to that of a human antibody variable region such as a germline human antibody variable region (e.g., a human germline antibody variable region sequence).
- a humanized, fully humanized or partially humanized binding agent such as an antibody or antigen binding fragment may comprises CDRs or CDR amino acid residues of a human antibody variable region (e.g., a human germline antibody variable region sequence).
- a “partially humanized framework region” thus encompasses, for example and without limitations, a human framework region that contains back-mutations reintroducing an original amino acid at its original location.
- a “partially humanized framework region” also encompasses, for example and without limitations, a human framework region in which one or more amino acid residue has been replaced, added or deleted.
- affinity refers to the strength of non-covalent interaction between a binding agent or antigen binding domain(s) thereof and an antigen. “Affinity” is represented, for example, by K D value, i.e., the ratio of dissociation rate to association rate (k off /k on ) when the binding between the antigen and the binding agent (e.g., antibody such as single domain antibody) reaches equilibrium.
- the affinity may be determined by using any conventional method known in the art, including but are not limited to, surface plasmon resonance method, microscale thermophoresis method, HPLC-MS method and flow cytometry (such as FACS) method.
- An antibody generally has a K D value of ⁇ 10 - 6 M (e.g., ⁇ 5x10 - 7 M, ⁇ 2x10 - 7 M, ⁇ 10 - 7 M, ⁇ 5x10 - 8 M, ⁇ 2x10 - 8 M, ⁇ 10 - 8 M, ⁇ 5x10 - 9 M, ⁇ 4x10 - 9 M, ⁇ 3 x10 - 9 M, ⁇ 2x10- 9 M, or ⁇ 10 - 9 M and any value ⁇ 10 - 6 ).
- ⁇ 10 - 6 M e.g., ⁇ 5x10 - 7 M, ⁇ 2x10 - 7 M, ⁇ 10 - 7 M, ⁇ 5x10 - 8 M, ⁇ 2x10 - 8 M, ⁇ 10 - 8 M, ⁇ 5x10 - 9 M, ⁇ 4x10 - 9 M, ⁇ 3 x10 - 9 M, ⁇ 2x10- 9 M, or ⁇ 10
- an antibody has a K D value in the nanomolar range or lower (e.g., ⁇ 9x10 - 9 M, ⁇ 8x10 - 9 M, ⁇ 7x10 - 9 M, ⁇ 6x10 - 9 M, ⁇ 5x10 - 9 M, ⁇ 4x10- 9 M, ⁇ 3x10 - 9 M, ⁇ 2x10 - 9 M, ⁇ 1x10 - 9 M or lower e.g., ⁇ 1x10 - 10 M, ⁇ 1x10 - 11 M, ⁇ 1x10- 12 M).
- K D value in the nanomolar range or lower e.g., ⁇ 9x10 - 9 M, ⁇ 8x10 - 9 M, ⁇ 7x10 - 9 M, ⁇ 6x10 - 9 M, ⁇ 5x10 - 9 M, ⁇ 4x10- 9 M, ⁇ 3x10 - 9 M, ⁇ 2x10 - 9 M, ⁇ 1x10 - 9 M
- an antibody has a K D value in the picomolar range or lower (e.g., ⁇ 9x10 - 12 M, ⁇ 8x10 - 12 M, ⁇ 7x10 - 12 M, ⁇ 6x10 - 12 M, ⁇ 5x10 - 12 M, ⁇ 4x10 - 12 M, ⁇ 3x10 - 12 M, ⁇ 2x10 - 12 M, ⁇ 1x10 - 12 M or lower).
- binding refers to a non-random binding reaction between two molecules, such as for example between an antibody and an antigen.
- Specific binding can be characterized in binding affinity, A K D value of ⁇ 10 - 6 M (e.g., ⁇ 5x10- 7 M, ⁇ 2x10 - 7 M, ⁇ 10 - 7 M, ⁇ 5x10 - 8 M, ⁇ 2x10 - 8 M, ⁇ 10 - 8 M, ⁇ 5x10 - 9 M, ⁇ 4x10 - 9 M, ⁇ 3x10- 9 M, ⁇ 2x10 - 9 M, or ⁇ 10 - 9 M and any value ⁇ 10 - 6 ) can indicate specific binding between a binding agent (e.g., antibody such as single domain antibody) and TROP2 (e.g., human TROP2).
- a binding agent e.g., antibody such as single domain antibody
- TROP2 e.g., human TROP2
- the term “competing for binding”, “compete for binding”, “compete(s) with” or “competing with” refers to the ability of a first antibody or antigen-binding fragment thereof (e.g., single domain antibody or antigen binding fragment thereof) to inhibit the binding interaction between TROP2 and a second anti-TROP2 antibody (e.g., a single domain antibody or antigen binding fragment thereof) to any detectable degree.
- a first antibody or antigen-binding fragment thereof e.g., single domain antibody or antigen binding fragment thereof
- a second anti-TROP2 antibody e.g., a single domain antibody or antigen binding fragment thereof
- epitope refers to the specific group of atoms or amino acid residues on an antigen to which an antibody (e.g., single domain antibody) binds.
- Two antibodies may bind the same or a closely related epitope within an antigen if they exhibit competitive binding for the antigen.
- An epitope can be linear or conformational (i.e., including amino acid residues spaced apart).
- an antibody or antigen binding fragment blocks binding of a reference antibody (e.g., single domain antibody) to the antigen by at least 85%, or at least 90%, or at least 95%
- the antibody or antigen-binding fragment may be considered to bind the same/closely related epitope as the reference antibody.
- a monoclonal, chimeric, human or humanized antibody or an antigen binding fragment thereof may compete with a single domain antibody of the present disclosure for binding to human TROP2.
- sequence identity indicates the degree of identity between two nucleic acid or two amino acid sequences when best compared and compared when a mutation such as substitution, insertion or deletion is appropriate.
- the sequence identity can be at least 85 %, 90 % or 95 %, preferably at least 95 %.
- Non-limiting examples include 85 %, 86 %, 87 %, 88 %, 89 %, 90 %, 91 %, 92 %, 93 %, 94 %, 95 %, 95 %, 96 %, 97 %, 98 %, 99 %, and 100 %.
- antibody or antigen binding fragment thereof refers to a fragment of the antibody or single antibody that encompasses the antigen binding domain and that may incorporate or not, other portion(s) of the antibody or single domain antibody such as for example amino acid residues of the hinge region, amino acid residues of a constant region, portion of a Fc region. Regardless of structure, an antigen binding fragment binds to the same antigen that is recognized by the complete antibody (e.g., single domain antibody).
- An antigen binding fragment of a single domain antibody includes for example the CDRs and sequences that encompass the CDRs such as the entire variable region or portion thereof or the entire heavy chain or portion thereof and may include or not, other portion(s) of the antibody.
- antigen binding domain relates to the portion of an antibody that is involved in antigen binding and comprises for example, one or more CDRs, one or more framework regions (FR) or the entire variable region.
- antigen binding domain in the context of a single domain antibody thereof relates to the portion of single domain antibody that is involved in antigen binding and comprises for example, one or more of CDR1 (CDRH1), CDR2 (CDRH2) or CDR3 (CDRH3), one or more framework regions FR1, FR2, FR3, FR4 or the entire variable region (VH or VHH).
- antigen binding domain in the context of a native antibody thereof relates to the portion of a native antibody that is involved in antigen binding and comprises for example, one or more of CDRH1, CDRH2, CDRH3, CDRL1, CDRL2 or CDRL3, one or more light chain or heavy chain framework regions FR1, FR2, FR3, FR4 or one or both entire variable regions (heavy chain variable region (VH) and/or light chain variable region (VL)).
- Antibodies or antigen binding fragments of the present disclosure may be obtained, for example, by immunizing an animal with a TROP2 antigen.
- the antibodies or antigen binding fragments of the present disclosure may be obtained from a library of antibodies.
- Binding agents that bind to TROP2 may be identified by in silico, in vitro and/or in vivo methods. Several in vitro methods rely on the binding of candidate antibodies or antigen binding fragments thereof to an antigen. As such anti-TROP2 antibodies or antigen binding fragments thereof may be identified by methods involving binding to the TROP2 antigen disclosed herein and/or using assays disclosed herein.
- the TROP2 antigen is a human TROP2, a TROP2 homologue, a TROP2 variant having a sequence at least 80% identical to human TROP2 thereof or a fragment thereof.
- the TROP2 homologue is cynomolgus TROP2.
- the TROP2 homologue is Rhesus TROP2.
- the TROP2 antigen comprises the extracellular domain of TROP2 (e.g., of human TROP2, TROP2 homologue or variant thereof).
- the TROP2 antigen comprises amino acid residues 27-274 of human TROP2, or of a TROP2 homologue or a fragment thereof. Accordingly, the TROP2 antigen may comprise a polypeptide comprising a human TROP2 amino acid sequence consisting of amino acid residues 27-274 or a fragment thereof.
- the TROP2 antigen comprises amino acid residues 27-146 of human TROP2, or of a TROP2 homologue or a fragment thereof. Accordingly, the TROP2 antigen may comprise a polypeptide comprising a human TROP2 amino acid sequence consisting of amino acid residues 27-146 or a fragment thereof.
- the TROP2 antigen comprises amino acid residues 27-73 of human TROP2, or of a TROP2 homologue or a fragment thereof. Accordingly, the TROP2 antigen may comprise a polypeptide comprising a human TROP2 amino acid sequence consisting of amino acid residues 27-73 or a fragment thereof.
- the TROP2 antigen may comprise at least 10 amino acid residues of human TROP2.
- the TROP2 antigen is a fragment of at least 10 amino acid residues of a human TROP2 amino acid sequence consisting of amino acid residues 27-146.
- the TROP2 antigen comprises between 10 to 110 amino acid residues, including for example between 10 to 100 amino acid residues, between 10 to 90 amino acid residues, between 10 to 80 amino acid residues, between 10 to 70 amino acid residues, between 10 to 60 amino acid residues, between 10 to 50 amino acid residues, between 10 to 40 amino acid residues, between 10 to 30 amino acid residues, 10 to 29 amino acid residues, between 10 to 28 amino acid residues, between 10 to 27 amino acid residues, between 10 to 26 amino acid residues, between 10 to 25 amino acid residues, between 10 to 24 amino acid residues, between 10 to 23 amino acid residues, between 10 to 22 amino acid residues, between 10 to 21 amino acid residues, between 10 to 20 amino acid residues, between 10 to 19 amino acid residues, between 10 to 18 amino acid residues, between 10 to 17 amino acid residues, between 10 to 16 amino acid residues, between 10 to 15 amino acid residues, between 10 to 14 amino acid residues, between 10 to 13 amino acid residues, between 10 to 12 amino acid residues, between 10
- the TROP2 antigen comprises at least 10 amino acid residues of a human TROP2 amino acid sequence consisting of amino acid residues 27-73.
- the TROP2 antigen comprises between 10 to 45 amino acid residues, including for example between 10 to 40 amino acid residues, between 10 to 35 amino acid residues, between 10 to 30 amino acid residues, 10 to 29 amino acid residues, between 10 to 28 amino acid residues, between 10 to 27 amino acid residues, between 10 to 26 amino acid residues, between 10 to 25 amino acid residues, between 10 to 24 amino acid residues, between 10 to 23 amino acid residues, between 10 to 22 amino acid residues, between 10 to 21 amino acid residues, between 10 to 20 amino acid residues, between 10 to 19 amino acid residues, between 10 to 18 amino acid residues, between 10 to 17 amino acid residues, between 10 to 16 amino acid residues, between 10 to 15 amino acid residues, between 10 to 14 amino acid residues, between 10 to 13 amino acid residues, between 10 to 12 amino acid residues between 10 to 11 amino acid residues of a human TROP2 amino acid sequence consisting of amino acid residues 27- 73.
- the TROP2 antigen comprises a human TROP2 amino acid sequence consisting of amino acid residues 27-56 of human TROP2 or a fragment thereof.
- the TROP2 antigen comprises a human TROP2 amino acid sequence consisting of amino acid residues 27-66 of human TROP2 or a fragment thereof.
- the TROP2 antigen comprises a human TROP2 amino acid sequence consisting of amino acid residues 47-56 of human TROP2 or a fragment thereof.
- the TROP2 antigen comprises a human TROP2 amino acid sequence consisting of amino acid residues 60-66 of human TROP2 or a fragment thereof.
- the TROP2 antigen comprises a human TROP2 amino acid sequence consisting of amino acid residues 47-66 of human TROP2 or a fragment thereof.
- the TROP2 antigen comprises a human TROP2 amino acid sequence consisting of amino acid residues 27-56, 27-66, 28-66, 29-66, 30-66, 31-66, 32-66, 33-66, 34-66, 35-66, 36-66, 37-66, 38-66, 39-66, 40-66, 41-66, 42-66, 43-66, 44-66, 45-66, 46-66 or 47-66.
- the TROP2 antigen may exclude the cysteine poor (CPD) domain of TROP2.
- TROP2 antigen An exemplary and non-limiting embodiment of a TROP2 antigen is provided in SEQ ID NO: 164.
- Exemplary embodiments of binding agents of the present disclosure includes a polypeptide chain disclosed herein.
- Exemplary embodiments of binding agents of the present disclosure includes antibodies or antigen binding fragments thereof.
- binding agents therefore include without limitations, native antibodies or antigen binding fragments thereof or single domain antibodies or antigen binding fragments thereof or variants thereof such as for example, humanized, chimeric or human antibodies or antigen binding fragments thereof or humanized or chimeric single domain antibodies or antigen binding fragments thereof.
- Single domain antibodies or antigen binding fragments thereof disclosed herein are particularly contemplated as well as binding agents that comprise one or more antigen binding domain(s) of one or more single domain antibodies disclosed herein.
- Single domain antibodies that compete with one or more single domain antibodies (having an amino acid sequence as disclosed herein) for the binding of a TROP2 antigen are also encompassed by the present disclosure.
- binding agents of the present disclosure include binding agents comprising antigen binding domain(s) such as antibody-like molecules (including single chain antibody), protein scaffold molecules and immune cell modulating agents. Accordingly, exemplary embodiments of binding agents of the present disclosure include antibody-like molecules that comprise one or more antigen binding domain(s) of one or more single antibodies disclosed herein.
- binding agents of the present disclosure include protein scaffold molecules that comprise one or more antigen binding domain(s) of one or more single antibodies disclosed herein.
- binding agents of the present disclosure comprises immune cell modulating agents that comprise one or more antigen binding domain(s) of one or more single antibodies disclosed herein.
- Binding agents including for example and without limitations, antibodies or antigen binding fragments thereof as well as single domain antibodies or antigen binding fragments thereof that competes with of a single domain antibody having an amino acid sequence disclosed herein are also encompassed by the present disclosure.
- the present disclosure thus relates to a binding agent comprising one or more antigen binding domains, wherein at least one of the one or more antigen binding domains comprises an antigen binding fragment thereof that is capable of binding to trophoblast cell surface antigen-2 (TROP2).
- a binding agent comprising one or more antigen binding domains, wherein at least one of the one or more antigen binding domains comprises an antigen binding fragment thereof that is capable of binding to trophoblast cell surface antigen-2 (TROP2).
- TROP2 trophoblast cell surface antigen-2
- the binding agent of the present disclosure is capable of binding to the extracellular domain (ECD) of TROP2.
- the binding agent of the present disclosure is capable of binding to the cysteine-rich domain and/or to the thyroglobulin type-1 domain of TROP2.
- the binding agent of the present disclosure is capable of binding to an epitope comprising amino acids of the extracellular domain of TROP2.
- the binding agent of the present disclosure is capable of binding to an epitope comprising amino acids of the cysteine-rich domain and/or of the thyroglobulin type- 1 domain of TROP2. In some embodiments, the binding agent of the present disclosure is capable of binding to an epitope including amino acid residues comprised within amino acid sequence 27-274 of TROP2 or a fragment thereof.
- the binding agent of the present disclosure is not capable of binding to the cysteine-poor domain (CPD) of TROP2.
- the binding agent of the present disclosure is not capable of binding to the amino acid 146 to 274 of TROP2.
- the binding agent is an anti-TROP2 antibody or an antigen binding fragment thereof. It is to be understood herein that the following represent exemplary and non- limiting embodiments of antibodies or antigen binding fragments thereof.
- Antibodies or antigen binding fragments thereof may be obtained from immunization of an animal (including a transgenic animal) with a TROP2 antigen as disclosed herein.
- single domain antibodies or antigen binding fragments thereof may be obtained by immunizing an animal such as a dromedary, a camel, a llama, an alpaca, a rabbit with a TROP2 antigen (e.g., ECD or fragments thereof).
- the sequence of a single domain antibody or antigen binding domain thereof may be obtained by immunizing a transgenic animal that is able to express single domain antibodies (see international application No. PCT/CA2021/050951 filed on July 12, 2021, and published on January 20, 2022, under No. W02022/011457 A1 the entire content of which is incorporated herein by reference).
- an antibody or antigen binding fragment thereof is obtained from serum or tissue of immunized animals such as bone marrow, spleen and/or lymph nodes.
- An hybridoma that results from fusion of cells of an immunized animal with a malignant and immortal plasma cell such as myeloma cells lacking hypoxanthine-guanine- phosphoribosyltransferase (HGPRT) an enzyme allowing cells to grow in HAT medium (hypoxanthine-aminopterin-thymidine) may be generated.
- Spleen cells are particularly useful to generate hybridomas.
- the antibody or antigen binding fragment thereof may be isolated from an hybridoma.
- the nucleic acid sequence of an antibody or antigen binding fragment thereof may be obtained by PCR amplification and sequencing from cells or tissue able to express the antibody or antigen binding fragment thereof.
- the amino acid sequence information is obtained from the nucleic acid sequence. Due to inherent degeneracy of the genetic code, a nucleic acid molecule encoding the same amino acid sequence but having a different nucleic acid sequence compared to the original nucleic acid sequence may be generated.
- nucleic acid sequence encoding the amino acid sequence of an antibody is obtained, recombinant expression of an antibody is rendered possible by transfection of one or more expression vector(s) into immortalized mammalian cell lines.
- sequence of an antibody of antigen binding fragment thereof may also be obtained by screening an established antibody library for sequences that have desired features such as for example, homology or identity with a reference antibody.
- Antibodies of the present disclosure includes native or intact antibodies that specifically bind to TROP2.
- a native or intact antibody includes an antibody that is recombinantly expressed, isolated from immunized animals or from an hybridoma.
- Exemplary embodiments of binding agents of the present disclosure include antibodies or antigen binding fragments thereof that specifically bind to at least one epitope comprising amino acids of the extracellular domain (ECD) of TROP2.
- Other exemplary embodiments of binding agents of the present disclosure include antibodies or antigen binding fragments thereof that specifically bind to at least one epitope comprising amino acids of the cysteine rich domain of TROP2.
- the antibodies or antigen binding fragments thereof bind to a TROP2 antigen disclosed herein.
- the antibodies of the present disclosure specifically bind to human TROP2. In another embodiment, the antibodies of the present disclosure specifically bind to cynomolgus TROP2. In another embodiment, the antibodies of the present disclosure specifically bind to Rhesus TROP2.
- a native or intact antibody comprises two heavy (H) chains and two light (L) chains.
- Mammalian heavy chains are classified as alpha, delta, epsilon, gamma, and mu, each heavy chain consists of a variable region (VH) and a first, second, third, and optionally fourth constant region (CH1, CH2, CH3, CH4 respectively);
- mammalian light chains are classified as ⁇ or ⁇ , while each light chain consists of a variable region (VL) and a constant region.
- the antibody has a “Y” shape, with the stem of the Y consisting of the second and third constant regions of two heavy chains bound together via disulfide bonding.
- Each arm of the Y includes the variable region and first constant region of a single heavy chain bound to the variable and constant regions of a single light chain.
- the variable regions of the light and heavy chains are responsible for antigen binding.
- the variable regions in both chains generally contain three highly variable loops called the complementarity determining regions (CDRs) (light chain CDRs including CDRL1, CDRL2, and CDRL3, heavy chain CDRs including CDRH1, CDRH2, CDRH3).
- CDR boundaries for the antibodies and antigen-binding fragments disclosed herein may be defined or identified by the conventions of Kabat, IMGT, Chothia, or A1-Lazikani.
- the three CDRs are interposed between flanking stretches known as framework regions (FRs) (light chain FRs including LFR1, LFR2, LFR3, and LFR4, heavy chain FRs including HFR1, HFR2, HFR3, and HFR4), which are more highly conserved than the CDRs and form a scaffold to support the highly variable loops.
- FRs framework regions
- the constant regions of the heavy and light chains are not involved in antigen-binding, but exhibit various effector functions.
- Antibodies are assigned to classes based on the amino acid sequences of the constant regions of their heavy chains.
- the five major classes or isotypes of antibodies are IgA, IgD, IgE, IgG, and IgM, which are characterized by the presence of alpha, delta, epsilon, gamma, and mu heavy chains, respectively.
- IgG1 gamma 1 heavy chain
- IgG2 gamma2 heavy chain
- IgG3 gamma3 heavy chain
- IgG4 gamma4 heavy chain
- IgA1 alpha 1 heavy chain
- IgA2 alpha2 heavy chain
- Antibodies of the present disclosure includes chimeric antibodies that specifically bind to TROP2.
- a chimeric antibody is a recombinant protein that contains the variable region(s) including the complementarity determining regions (CDRs) of an antibody derived from one or more species, such as a rodent antibody, while the constant domains of the antibody molecule are derived from those of another species, such as a human antibody.
- Antibodies of the present disclosure includes humanized antibodies that specifically bind to TROP2.
- a humanized antibody is a recombinant protein in which the CDRs or CDR residues from an antibody from one species; e.g., a rodent antibody, are transferred from the heavy and light variable chains of the rodent antibody into human heavy and light variable regions (e.g., framework region sequences).
- the constant domains of the antibody molecule are derived from those of a human antibody.
- a limited number of framework region amino acid residues from the parent (rodent) antibody may be substituted into the human antibody framework region sequences.
- additional modification might be required in order to restore the original affinity of the murine antibody.
- the humanized antibody is a humanized single domain antibody.
- a humanized antibody that competes with a single domain antibody disclosed herein is encompassed by the present disclosure.
- Antibodies of the present disclosure includes human antibodies that specifically binds to TROP2.
- a fully human antibody can be obtained from a transgenic non-human animal. Methods for producing fully human antibodies using either combinatorial approaches or transgenic animals transformed with human immunoglobulin loci are known in the art. In one alternative, the phage display technique may be used to generate human antibodies.
- the fully human antibodies are expected to exhibit even fewer side effects than chimeric or humanized antibodies and to function in vivo as essentially endogenous human antibodies.
- a human antibody that competes with a single domain antibody disclosed herein is encompassed by the present disclosure.
- Antibodies of the present disclosure includes single domain antibodies (sdAbs) that specifically binds to TROP2.
- single domain antibody and “heavy chain only antibody” are used interchangeably.
- the term “single domain antibody” is used in its broad sense and includes naturally occurring single domain antibodies or variants thereof such as humanized single domain antibodies or chimeric single domain antibodies.
- a single domain antibody is said to be chimeric when it possesses a constant region of another species.
- the single domain antibody is a chimeric single domain antibody.
- the chimeric single domain antibody comprises a humanized variable region and a human constant region.
- the chimeric single domain antibody comprises the variable region of a native single domain antibody.
- a single domain antibody is usually composed of two heavy chains.
- a single domain antibody is about 12-15 kDa in size (about 110 amino acids in length).
- a sdAb can selectively bind to target antigens, like full-size antibodies, and have similar affinities for antigens. However, because of their much smaller size, they may be capable of better penetration into solid tumors. The smaller size also contributes to the stability of the sdAb, which is more resistant to pH and temperature extremes than full size antibodies (Van Der Linden et al., 1999, Biochim Biophys Act 1431 :37-46).
- Naturally occurring single domain antibodies consist of a single variable region (VH or VHH) and two constant domains (CH2 and CH3).
- the variable region of naturally occurring single domain antibodies may be cloned and fused to a constant region of a naturally occurring antibody heavy chain.
- the variable region of a naturally occurring single domain antibody is replaced with that of a human IgG heavy chain constant region which comprise CH1, CH2 and CH3 domains and optionally CH4 domain and may optionally comprise a hinge.
- the antigen binding property of a single domain antibody is conferred by the heavy chain variable region.
- a single heavy chain or even a single heavy variable region may be sufficient for specific binding to an antigen.
- a single domain antibody is usually composed of two heavy chains.
- the two heavy chains may be assembled via a dimerization domain such as for example a constant region of a class G human immunoglobulin.
- the two heavy chains may also be expressed as a single polypeptide chain.
- binding agents include antibodies and antigen-binding fragments thereof such as, for example and without limitations, single domain antibodies from camelids or sharks, human antibodies including IgGs (including human IgG1, human IgG2, human IgG3, human IgG4), human IgMs, human IgAs (including human IgA1 and human IgA2), human IgEs, human IgDs, animal antibodies including for example, IgGs (IgG1, IgG2a, IgG2b, IgG2c, IgG3, IgG4), IgMs, IgAs, IgEs and IgDs and variants (e.g., chimeric, humanized or human) having a similar format.
- human antibodies including IgGs (including human IgG1, human IgG2, human IgG3, human IgG4), human IgMs, human IgAs (including human IgA1 and human IgA2), human IgEs, human IgDs,
- binding agents of the present disclosure encompass antigen-binding fragments such as, for example and without limitations, Fab, Fab’, F(ab’) 2 , complementarity determining regions, variable regions including VHs, VHHs, VLs, and the like.
- An antigen binding fragment can be prepared by known techniques such as by proteolytic hydrolysis of a full-length antibody or by expression in E. coli or another host of the DNA coding for the fragment.
- An antigen binding fragment can be obtained by pepsin or papain digestion of full-length antibodies by conventional methods.
- antigen binding fragment can be produced by enzymatic cleavage of antibodies with pepsin to provide an approximate 100 kD fragment denoted F(ab’) 2 .
- a F(ab’) 2 fragment can be further cleaved using a thiol reducing agent, and optionally a blocking group for the sulfhydryl groups resulting from cleavage of disulfide linkages, to produce an approximate 50 Kd Fab’ monovalent fragment.
- a thiol reducing agent optionally a blocking group for the sulfhydryl groups resulting from cleavage of disulfide linkages
- antibodies that binds to TROP2 can be bispecific or multispecific.
- a “multispecific antibody” is an antibody that can bind simultaneously to at least two targets that are of different structure, e.g., two or more different antigens, two or more different epitopes on the same antigen, or a hapten and/or an antigen or epitope.
- a “multivalent antibody” is an antibody that can bind simultaneously to at least two targets that are of the same or different structure. Valency indicates how many antigen binding domains the antibody has; i.e., monovalent, bivalent, trivalent or multivalent. Multivalency provides an antibody with an advantage of multiple interactions in binding to an antigen, thus increasing the avidity of binding to the antigen.
- Specificity indicates how many antigens or epitopes an antibody is able to bind; i.e., monospecific, bispecific, trispecific, multispecific.
- a native antibody e.g., an IgG
- Multispecific, multivalent antibodies include antibodies that have more than one antigen binding domain of different specificity.
- a “bispecific antibody” is an antibody that can bind simultaneously to two targets which are of different structure. Bispecific antibodies (bsAb) and bispecific antibody fragments (bsFab) may have at least antigen binding domain that specifically binds to TROP2.
- bispecific antibodies can be produced by the quadroma method, which involves the fusion of two different hybridomas, each producing a monoclonal antibody recognizing a different antigenic site.
- Another method for producing bispecific antibodies uses heterobifunctional cross-linkers to chemically tether two different monoclonal antibodies.
- binding agent of the present disclosure is a single domain antibody. It is to be understood herein that the following represent exemplary and non-limiting embodiments of single domain antibodies or antigen binding fragments thereof.
- the single domain antibody possesses unique binding features.
- the complementarity determining region 3 (CDR3) of the sdAb disclosed herein forms a loop fitting into a groove within the cysteine rich domain (CRD) of the extracellular domain (ECD) of TROP2.
- Amino acid residues of the CDR3 and of the framework region 2 (FR2) interact with amino acid residues of TROP2 cysteine rich domain and together form a clip around the CRD.
- the single domain antibodies of the present disclosure also possess anti-cancer activity such as antibody-dependent cellular cytotoxicity (ADCC) and/or antibody-dependent cellular phagocytosis (ADCP) activity.
- the single domain antibodies of the present disclosure may also be conjugated for therapeutic, or detection uses.
- Exemplary embodiments of binding agents of the present disclosure include single domain antibodies or antigen binding fragments thereof that specifically bind to at least one epitope comprising amino acids of the extracellular domain (ECD) of TROP2.
- Other exemplary embodiments of binding agents of the present disclosure include single domain antibodies or antigen binding fragments thereof that specifically bind to at least one epitope comprising amino acids of the cysteine rich domain of TROP2.
- the single domain antibodies or antigen binding fragments thereof bind to a TROP2 antigen disclosed herein.
- the single domain antibodies of the present disclosure specifically bind to human TROP2. In another embodiment, the single domain antibodies of the present disclosure specifically bind to cynomolgus TROP2. In another embodiment, the single domain antibodies of the present disclosure specifically bind to Rhesus TROP2.
- single domain antibodies of the present disclosure specifically bind to the ECD or the CRD of human TROP2.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:54 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:52 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:53.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:55 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:47.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:58 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:56 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:57.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:61 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:59 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:60.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:62 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:50.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:55 and/or the amino acid sequence of the CDR2 set forth in 47.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 117 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:55 and/or the amino acid sequence of the CDR2 set forth in 47.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 118 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:55 and/or the amino acid sequence of the CDR2 set forth in 47.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 119 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:55 and/or the amino acid sequence of the CDR2 set forth in 47.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 117 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:55 and/or the amino acid sequence of the CDR2 set forth in 124.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 117 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:55 and/or the amino acid sequence of the CDR2 set forth in 123.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:62 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:50.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 117 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:62 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:50.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 118 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:62 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:50.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 120 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:62 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO:50.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID N0:5.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 130.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 131.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 133.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 131.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 132.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 133.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 172 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 133.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 134.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO:4 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 135.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 174 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 127 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 129.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 14.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 137.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 138.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 136.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 137.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 138.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 139.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 173 and optionally the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 137.
- single domain antibody or antigen binding fragment thereof of the present disclosure comprises the three CDRs of the single domain antibody disclosed herein.
- the single domain antibody or antigen binding fragment thereof comprises a CDR1 having the amino acid sequence set forth in SEQ ID NO: 1, a heavy chain complementarity determining region 2 (CDRH2) having the amino acid sequence set forth in SEQ ID NO:2 and a heavy chain complementarity determining region 3 (CDRH3) having the amino acid sequence set forth in SEQ ID NO:3.
- CDR1 having the amino acid sequence set forth in SEQ ID NO: 1
- CDRH2 heavy chain complementarity determining region 2
- CDRH3 heavy chain complementarity determining region 3
- the single domain antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:4, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 5 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:6.
- the single domain antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:7, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 8 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:9.
- the single domain antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 10, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 11 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 12.
- the single domain antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 13, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 14 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 15.
- the single domain antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 16, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 17 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 18.
- the single domain antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 19, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:20 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:21.
- the single domain antibody comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:46, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:47 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:48.
- the single domain antibody comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:55, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:47 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:48.
- the single domain antibody comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:49, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:50 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:51.
- the single domain antibody comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 62, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:50 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:51.
- the single domain antibody comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 52, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:53 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:54.
- the single domain antibody comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:56, a CDRH2 having the amino acid sequence set forth in SEQ ID NO:57 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:58.
- the single domain antibody comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO:59, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 60 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:61.
- the single domain antibody comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 63, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 64 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:65.
- the single domain antibody comprises a CDRH1 having the amino acid sequence set forth in SEQ ID NO: 66, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 67 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO:68.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:55, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 123 and the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:55, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 124 and the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 130 and the amino acid sequence of the CDR3 set forth in SEQ ID NO:6.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 131 and the amino acid sequence of the CDR3 set forth in SEQ ID NO:6.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 132 and the amino acid sequence of the CDR3 set forth in SEQ ID NO:6.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 133 and the amino acid sequence of the CDR3 set forth in SEQ ID NO:6.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 134 and the amino acid sequence of the CDR3 set forth in SEQ ID NO:6.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 135 and the amino acid sequence of the CDR3 set forth in SEQ ID NO:6.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO: 127, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 129 and the amino acid sequence of the CDR3 set forth in SEQ ID NO:6.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 14 and the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 136 and the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 137 and the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 138 and the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 139 and the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15.
- single domain antibody or antigen binding fragment thereof of the present disclosure comprises the CDR1, CDR2, CDR3 and the FR2 amino acid sequence of the single domain antibody disclosed herein.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:52, the amino acid sequence of the CDR2 set forth in SEQ ID NO:53, the amino acid sequence of the CDR3 set forth in SEQ ID NO:54 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:55, the amino acid sequence of the CDR2 set forth in SEQ ID NO:47, the amino acid sequence of the CDR3 set forth in SEQ ID NO:48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:56, the amino acid sequence of the CDR2 set forth in SEQ ID NO:57, the amino acid sequence of the CDR3 set forth in SEQ ID NO:58 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:59, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 60, the amino acid sequence of the CDR3 set forth in SEQ ID NO:61 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:62, the amino acid sequence of the CDR2 set forth in SEQ ID NO:50, the amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:55, the amino acid sequence of the CDR2 set forth in SEQ ID NO:47, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO:116.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:55, the amino acid sequence of the CDR2 set forth in SEQ ID NO:47, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO:117.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:55, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 47, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO:118.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:55, the amino acid sequence of the CDR2 set forth in SEQ ID NO:47, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 119.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:55, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 124, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO:117.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:55, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 123, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 48 and the amino acid sequence of the FR2 set forth in SEQ ID NO:117.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:62, the amino acid sequence of the CDR2 set forth in SEQ ID NO:50, the amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 116.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:62, the amino acid sequence of the CDR2 set forth in SEQ ID NO:50, the amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 117.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:62, the amino acid sequence of the CDR2 set forth in SEQ ID NO:50, amino acid sequence of the CDR3 set forth in SEQ ID NO: 51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 118.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:62, the amino acid sequence of the CDR2 set forth in SEQ ID NO:50, amino acid sequence of the CDR3 set forth in SEQ ID NO:51 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 120.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO:5, the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 130, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 131, the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 133, the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 131, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 132, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 133, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 133, the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 172.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 134, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO:4, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 135, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO: 127, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 129, the amino acid sequence of the CDR3 set forth in SEQ ID NO:6 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 174.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 14, the amino acid sequence of the CDR3 set forth in SEQ ID NO:15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 137, the amino acid sequence of the CDR3 set forth in SEQ ID NO:15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 138, the amino acid sequence of the CDR3 set forth in SEQ ID NO:15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 170.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 136, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13 and/or the amino acid sequence of the CDR2 set forth in SEQ ID NO: 137, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 138, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 139, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 171.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence of the CDR1 set forth in SEQ ID NO: 13, the amino acid sequence of the CDR2 set forth in SEQ ID NO: 137, the amino acid sequence of the CDR3 set forth in SEQ ID NO: 15 and the amino acid sequence of the FR2 set forth in SEQ ID NO: 173.
- the single domain antibody or antigen binding fragment thereof comprises the variable region of the single domain antibody disclosed herein.
- the single domain antibody comprises a variable region having an amino acid sequence as set forth in SEQ ID NO:22.
- the single domain antibody comprises a variable region having an amino acid sequence as set forth in SEQ ID NO:23.
- the single domain antibody comprises a variable region having an amino acid sequence as set forth in SEQ ID NO:24.
- the single domain antibody comprises a variable region having an amino acid sequence as set forth in SEQ ID NO:25.
- the single domain antibody comprises a variable region having an amino acid sequence as set forth in SEQ ID NO:26.
- the single domain antibody comprises a variable region having an amino acid sequence as set forth in SEQ ID NO:27.
- the single domain antibody comprises a variable region having an amino acid sequence as set forth in SEQ ID NO:28.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:29.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:71. In additional exemplary embodiments, the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:72.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 73.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:74.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 75.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:76.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:77.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:78.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:79.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:80.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:81.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:82.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 83.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:84. In additional exemplary embodiments, the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:85.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:86.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:87.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:88.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:89.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:90.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:91.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:92.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 93.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:94.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 95.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:96.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:97. In additional exemplary embodiments, the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 98.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:99.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 100.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 101.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:012.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 103.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 104.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 105.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 106.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 107.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 108.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 109.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 110. In additional exemplary embodiments, the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 111.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 112.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 113.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 114.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 115.
- the single domain antibody or antigen binding fragment thereof comprises the heavy chain of the single domain antibody disclosed herein.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:30.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO: 31.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:32.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:33.
- the single domain antibody that an amino acid sequence as set forth in SEQ ID NO:34.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:35.
- the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:44. In other exemplary embodiments, the single domain antibody comprises an amino acid sequence as set forth in SEQ ID NO:45.
- Binding agents comprising antigen binding domain(s) of sdAbs
- Binding agents of the present disclosure comprise one or more antigen binding domain(s) of an antibody or antigen binding fragment thereof that binds to TROP2.
- the binding agents of the present disclosure comprise one or more antigen binding domain(s) of a single domain antibody disclosed herein. It is to be understood herein that the following represent exemplary and non-limiting embodiments of binding agents comprising antigen binding domain(s) of single domain antibodies.
- the binding agent of the present disclosure comprises one or more antigen binding domains that specifically bind to trophoblast cell surface antigen-2 (TROP2). In some embodiments, the binding agent of the present disclosure, comprises one or more antigen binding domains that binds to a different target than TROP2.
- TROP2 trophoblast cell surface antigen-2
- binding agents of the present disclosure include those that comprise one or more antigen binding domains that specifically bind to at least one epitope comprising amino acids of the extracellular domain (ECD) of TROP2.
- Other exemplary embodiments of binding agents of the present disclosure include those that comprise one or more antigen binding domains that specifically bind to at least one epitope comprising amino acids of the cysteine rich domain of TROP2.
- the binding agent comprise one or more antigen binding domains that specifically bind to a TROP2 antigen disclosed herein.
- the binding agent of the present disclosure comprises one or more antigen binding domains that specifically bind to human TROP2. In another embodiment, the binding agent of the present disclosure comprises one or more antigen binding domains that specifically bind to cynomolgus TROP2. In another embodiment, the binding agent of the present disclosure comprises one or more antigen binding domains that specifically bind to Rhesus TROP2.
- the binding agent of the present disclosure comprises one or more antigen binding domains that specifically bind to the ECD or the CRD of human TROP2.
- the binding agents of the present disclosure comprise one or more antigen binding domain(s) of a native antibody (CDRs, and/or VL and VH) that binds to TROP2.
- the CDRs or variable regions (VL and VH) of antibodies and antigen binding fragments thereof may be expressed as a single polypeptide chain to generate single chain Fv (scFV) molecules and variants. Numerous formats are contemplated as indicated below.
- the CDRs or variable region of multiple single domain antibodies may be expressed as a single polypeptide chain thereby providing multivalence and/or multispecificity to the binding agent.
- multiple polypeptide chains may be assembled to increase the diversity or avidity of interactions with TROP2. Numerous formats are contemplated as indicated below.
- antigen binding fragments or antigen binding domain(s) of the single domain antibodies disclosed herein may be used to generate binding agents that are monospecific, multispecific, monovalent or multivalent.
- variable region or CDRs of a single domain antibody can be fused with a Fc, CH3 or CH2-CH3 domain of an antibody to allow homodimerization thereby generating a multivalent binding agent.
- variable region or CDRs of a single domain antibody can be fused in tandem with required spacers or linkers to generate a multivalent and monospecific binding agent.
- variable regions or CDRs of two single domain antibodies can be fused with a Fc, CH3 or CH2-CH3 domain to allow heterodimerization thereby generating a multivalent and multispecific binding agent.
- variable regions or CDRs of two or more single domain antibodies may be fused in tandem with required spacers or linkers to generate a multivalent and multispecific binding agent.
- Binding agents of the present disclosure may have a format of an antibody or antigen binding fragment thereof, an antibody -like molecule (native antibody fused with a single domain antibody or with an antigen binding domain of a sdAb, Fc-, CH3- fusions and the like), a fusion with protein scaffolds, immune cell modulating agents and the like. Binding agents also include immune cell modulating agents such as for example, dual- affinity retargeting molecules (DARTs), chimeric antigen receptors (CAR) constructs, bispecific T cell engagers construct (BiTEs), bispecific killer cell engagers (BiKEs), trispecific killer cell engagers (TriKEs) containing scFvs or VHHs.
- DARTs dual- affinity retargeting molecules
- CAR chimeric antigen receptors
- BiTEs bispecific T cell engagers construct
- BiKEs bispecific killer cell engagers
- TriKEs trispecific killer cell engagers
- Binding agents also encompass fusion with protein scaffolds, including ankyrin repeat proteins, Z-domain of Staphylococcus protein-A, Type-III fibronetin, knottin and the like.
- Exemplary embodiments of binding agents include monospecific-, bispecifics (symmetric or asymmetric) trispecific-, or multispecific antibodies as well as monovalent, bivalent, trivalent or multivalent antibodies, single chain FVs (scFVs) and derivatives such diabody, triabody, tetrabody, tandem di-scFvs, tandem tri-scFvs, scFV-Fc, minibody (scFV-CH3), tandem diabody, di-diabody, bibody and the like, VH or VHHs and derivatives such as, tandem bispecific or multispecific VHH, bivalent VHH-Fc fusions, VHH-hinge-CH2-CH3 fusions, bivalent CH3 fusions, VHH pentabody, decabody and the like.
- a single chain Fv molecule comprises a VL domain and a VH domain.
- the VL and VH domains associate to form a target binding site. These two domains are further covalently linked by a peptide linker (L).
- L peptide linker
- a scFv molecule is denoted as either VL-L-VH if the VL domain is the N-terminal part of the scFv molecule, or as VH-L-VL if the VH domain is the N-terminal part of the scFv molecule.
- the binding agents of the present disclosure may have a format as disclosed in PCT/CA2020/051753 filed on December 18, 2020 and published on June 24, 2021 under No. WO2021/119832A1, the entire content of which is incorporated herein by reference) such as for example, as formula la, formula lb, formula Ic, formula II, formula III, formula IV, formula V, formula VI, formula VII or formula VIII and the like or formula I, formula II, formula III, formula Illa and formula Illb, formula IV, formula V, formula VI, formula VII or formula VIII disclosed herein.
- the binding agents of the present disclosure may be formed by the assembly of two polypeptide chains having the same configuration (with same or different amino acid sequence) or having different configurations where the same or different configurations include the configuration set forth in formula I, formula II, formula III, formula Illa and formula Illb, formula IV, formula V, formula VI, formula VII or formula VIII disclosed herein.
- the binding agents of the present disclosure is monospecific. In some embodiments, the binding agents of the present disclosure is multispecific.
- binding agents of the present disclosure may be monospecific, multispecific, monovalent or multivalent.
- a binding agent that comprises two or more antigen binding domains of a single domain antibody is considered multivalent.
- a multivalent single domain antibody can be monospecific (if all antigen binding domains bind to exactly the same epitope) or multispecific (if the antigen binding domains bind to different epitopes on same target or to different epitopes or targets).
- a binding agent that comprises only one antigen binding domain is considered monovalent.
- the antigen binding domain sequence (e.g., sequence of the variable light chain and variable heavy chain of an intact antibody or the sequence of the variable heavy chain of a single domain antibody) may be obtained by a variety of molecular cloning procedures, such as RT-PCR, 5 ’-RACE, and cDNA library screening.
- the sequence of interest may be cloned into an expression vector(s), the expression vector(s) transfected into cells and the binding agent isolated and/or purified.
- the light chain and the heavy chain can be cloned into a single expression vector or into two separate expression vectors. Co-transfection of the separate expression vectors is necessary for the intact antibody to assemble properly.
- a single expression vector (expressing the heavy chain) is sufficient.
- Monospecific binding agents encompass binding agents that are specific for a single epitope of a given antigen.
- An exemplary embodiment of a monospecific binding agent includes a binding agent that comprise one antigen binding fragment of a single domain antibody.
- Another exemplary embodiment of a monospecific binding agent includes a binding agent that comprise more than one antigen binding fragments of a single domain antibody, but the antigen binding fragments have identical CDRs and framework regions.
- Yet another exemplary embodiment of a binding agent includes a binding agent that comprise more than one antigen binding fragments of single domain antibodies, but the variable regions have identical CDRs and different framework regions.
- a further exemplary embodiment of a monospecific binding agent includes a binding agent that comprise antigen binding fragments of single domain antibodies that differ in the amino acid sequence of one or more of their CDRs (e.g., conservative substitution in one or more CDRs) without affecting their ability to bind to the same antigen or epitope.
- Multispecific binding agents encompass binding agents that are specific for more than one epitope (of the same antigen or different antigens) or to more than one antigen.
- a multispecific polypeptide chain or binding agent may thus have more than one variable region of a single domain antibody, at least two of which bind to different antigens or epitopes.
- each variable region may be specific for a given antigen.
- two or more antigen binding fragments of a given binding agent may be specific for the same or different antigens.
- three or more antigen binding fragments of a given binding agent may be specific for the same or different antigens.
- four or more antigen binding fragments of a given binding agent may be specific for the same or different antigens.
- five or more antigen binding fragments of a given binding agent may be specific for the same or different antigens.
- six or more antigen binding fragments of a given binding agent may be specific for the same or different antigens. The specificity may depend on the number of antigen binding fragments present in a given binding agent.
- multispecific binding agents include those having two antigen binding fragments of different specificities.
- multispecific binding agents include those having more than two antigen binding fragments that bind to two different antigens, proteins or to two different epitopes on the same antigens or proteins.
- the binding agent of the present disclosure is monovalent.
- the binding agent of the present disclosure is multivalent.
- Exemplary non-limiting embodiments of multivalent binding agents include binding agents composed of multivalent polypeptide chains.
- Other non-limiting exemplary embodiments of multivalent binding agents include binding agents composed of more than one monovalent polypeptide chain.
- a bispecific binding agent may be bivalent or multivalent depending on the number of variable regions that it contains.
- Exemplary non-limiting embodiments of bispecific binding agents include those comprising two identical bispecific polypeptide chains that form a dimer.
- bi specific binding agents are provided herein.
- the bispecific binding agent comprises an antigen binding domain that binds to TROP2 and comprises formula II (see PCT/CA2020/051753 filed on December 18, 2020, and published on June 24, 2021, under No. WO2021/119832A1 the entire content of which is herein incorporated by reference).
- the binding agent comprises a polypeptide chain that comprises in a N- to C-terminal fashion, a) an antigen binding domain of a single domain antibody, b) a linker, c) a dimerization domain, d) a linker and e) an antigen binding domain of a single domain antibody, at least one of the antigen binding domain of a) or e) is an antigen binding domain that binds to TROP2.
- the antigen binding domain of a) and the antigen binding domain of e) are different.
- the antigen binding domain of a) and the antigen binding domain of e) are the same.
- the linker of b) and the linker of d) are the same.
- the linker of b) and the linker of d) are different.
- the antigen binding domain of a) comprises an antigen binding domain of a single domain antibody that specifically binds to human TROP2. In another exemplary embodiment, the antigen binding domain of a) comprises an antigen binding domain of a single domain antibody that specifically binds to CD47 such as for example human CD47.
- the antigen binding domain of e) comprises an antigen binding domain of a single domain antibody that specifically binds to human TROP2.
- the antigen binding domain of e) comprises an antigen binding domain of a single domain antibody that specifically binds to CD47, such as for example human CD47.
- the bispecific binding agent comprises two polypeptide chains.
- the two polypeptide chains are non-covalently assembled by amino acid residues of the CH2 and/or CH3 domain contained therein so as to obtain a bispecific and tetravalent binding agent.
- the binding agent or antigen binding domain(s) of the present disclosure may be capable of inhibiting the growth of tumor cells expressing human TROP2 and CD47.
- the binding agent comprises one or more antigen binding domains that is capable of binding to CD47.
- the binding agent comprises one or more antigen binding domains that is capable of binding to TROP2 and one or more antigen binding domains that is capable of binding to CD47.
- the antigen binding domain that is capable of binding to CD47 comprises: a. a CDRH1 having the amino acid sequence set forth in SEQ ID NO 156, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 157 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 158, or b. a CDRH1 having the amino acid sequence set forth in SEQ ID NO 159, a CDRH2 having the amino acid sequence set forth in SEQ ID NO: 160 and a CDRH3 having the amino acid sequence set forth in SEQ ID NO: 161.
- the antigen binding domain that is capable of binding to CD47 comprises an amino acid sequence as set forth in SEQ ID NO:155.
- the binding agent is capable of binding to CD47 and TROP2 and comprises an amino acid sequence as set forth in SEQ ID NO: 155 and the amino acid sequence of at least one antigen binding domain of at least one single domain antibody disclosed herein.
- the binding agent is capable of binding to CD47 and TROP2 and comprises an amino acid sequence as set forth in SEQ ID NO: 155 and the amino acid sequence of an antigen binding domain of at least one single domain antibody set forth in any one of SEQ ID NOs:22-26 or SEQ ID Nos:73-114.
- the binding agent is capable of binding to CD47 and TROP2 and comprises an amino acid sequence as set forth in SEQ ID NO: 150 or in SEQ ID NO: 151.
- Binding agent of the present disclosure therefore encompass antibody variants (e.g., single domain antibody variants), variants of antibody-like molecule, variants of protein scaffold, variants of immune cell modulating agent.
- binding agents of the present disclosure may comprise an antigen binding fragment or an antigen binding domain of an antibody variant such as an antigen binding fragment or an antigen binding domain of a single domain antibody variant.
- the present disclosure more particularly encompasses variants of the single domain antibody disclosed herein as well as binding agents that comprise one or more antigen binding domain of a single domain antibody variant.
- Variants of the binding agents disclosed herein may have the same format as the binding agent disclosed herein.
- variants of the binding agents encompassed by the present disclosure may be multispecific and/or multivalent.
- Variants encompassed by the present disclosure include those which may comprise an insertion of one or more amino acid residues at one or more position, a deletion of one or more amino acid residues at one or more position or a substitution of one or more amino acid residues at one or more position (conservative or non-conservative substitutions).
- naturally occurring residues are divided into groups based on common side chain properties. Conservative substitutions may be made by exchanging an amino acid from one of the groups listed below (group 1 to 6) for another amino acid of the same group. Non- conservative substitutions will entail exchanging a member of one of these groups for another.
- Amino acids can be categorized based on net charge as indicated by an amino acid’s isoelectric point.
- the isoelectric point is the pH at which the average net charge of the amino acid molecule is zero. When pH>pI, an amino acid has a net negative charge, and when the pH ⁇ pI, an amino acid has a net positive charge.
- the measured pl value for an antibody is between about 3 and 9 (e.g.
- the measured pl value for an antibody is between about 4 and 7 (e.g. 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0), and any values in between.
- Exemplary isoelectric points of amino acids are shown in Table 2 below.
- amino acids with positive electrically charged side chains include, for example, Arginine (R), Histidine (H), and Lysine (K).
- Amino acids with negative electrically charged side chains include, for example, Aspartic Acid (D) and Glutamic Acid (E).
- Amino acids with polar properties include, for example, Serine (S), Threonine (T), Asparagine (N), Glutamine (Q), and Cysteine (C), Tyrosine (Y) and Tryptophan (W).
- Non-polar amino acids include, for example, Alanine (A), Valine (V), Isoleucine (I), Leucine (L), Methionine (M), Phenylalanine (F), Glycine (G) and Proline (P).
- the isoelectric point of an antibody is modified via amino acid substitution. See, e.g. US20110076275.
- modifying the isoelectric point of a polypeptide comprising an antibody results in a change in the antibody’s half-life.
- the degree of similarity and identity between variable chains is determined herein using the Blast2 sequence program (Tatiana A. Tatusova, Thomas L. Madden (1999), "Blast 2 sequences - a new tool for comparing protein and nucleotide sequences", FEMS Microbiol Lett. 174:247-250) using default settings, i.e., blastp program, BLOSUM62 matrix (open gap 11 and extension gap penalty 1; gapx dropoff 50, expect 10.0, word size 3) and activated filters.
- Blast2 sequence program Tropiana A. Tatusova, Thomas L. Madden (1999), "Blast 2 sequences - a new tool for comparing protein and nucleotide sequences", FEMS Microbiol Lett. 174:247-250
- blastp program BLOSUM62 matrix (open gap 11 and extension gap penalty 1; gapx dropoff 50, expect 10.0, word size 3) and activated filters.
- Percent identity will therefore be indicative of amino acids which are identical in comparison with the original peptide and which may occupy the same or similar position.
- Percent similarity will be indicative of amino acids which are identical and those which are replaced with conservative amino acid substitution in comparison with the original peptide at the same or similar position.
- Variants of the present disclosure may therefore comprise a sequence that is at least 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical with that of an original or reference sequence or a portion of an original sequence.
- mutations in one or more CDRs, variable region or constant region may be performed by amino acid substitution.
- substitutions include conservative amino acid substitutions or non-conservative amino acid substitutions.
- Exemplary substitutions are provided in Table 2.
- Other exemplary substitutions are provided in Table 13.
- Yet other exemplary substitutions are provided in Table 14.
- polypeptide chains having an amino acid sequence which is at least 75%, 80% 85%, 90%, 95%, 99% identical or less than 100% identical to a given amino acid sequence may have amino acid substitutions, additions or deletions that are generally located outside of the complementarity determining regions.
- a variant may have at least 80% sequence identity with a sequence disclosed herein. In other embodiments, a variant may have at least 85% sequence identity with a sequence disclosed herein. In yet embodiments, a variant may have at least 90% sequence identity with a sequence disclosed herein. In further embodiments, a variant may have at least 95% sequence identity with a sequence disclosed herein. In other embodiments, a variant may have at least 99% sequence identity with a sequence disclosed herein.
- variation may occur in one or more CDR.
- the mutations may occur for example, in CDR amino acid residues that are not involved in the interaction with TROP2.
- amino acid residues of CDR1 and/or CDR2 may be mutated.
- amino acid residues of CDR3 may be mutated. CDR mutations that improve affinity with TROP2 are particularly contemplated.
- variation may occur in the framework regions.
- the mutations may occur for example, in the framework amino acid residues that are not involved in the interaction with TROP2.
- amino acid residues of FR1 and FR3 and/or FR4 may be mutated.
- amino acid residues of FR2 may be mutated.
- FR2 mutations that improve affinity with TROP2 are particularly contemplated.
- the variations may occur in the constant region.
- the constant region may be mutated so as to modulate ADCC activity.
- the constant region may be mutated so as to modulate ADCP activity.
- the constant region may be mutated so as to improve ADCP activity.
- the constant region may be mutated so as to improve internalization.
- the constant region may be mutated so as to improve stability.
- Exemplary and non-limiting embodiments of mutations in the constant region (e.g., Fc region) that improves one or more effector function are encompassed by the present disclosure, exemplary embodiments of which, are provided in the Table A (List of Mutations Antibodies (Basel). 2020 Nov 17;9(4):64, the entire content of which is incorporated herein by reference).
- single domain antibody variants are provided herein. Binding agents comprising one or more antigen binding domain(s) of one or more single domain antibody variants are also encompassed by the present disclosure.
- single domain antibody variants include those having the amino acid sequence set forth in SEQ ID NO: 143-146.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence set forth in SEQ ID NO: 143.
- any of X 1a to X 1r is each independently any (e.g., naturally occurring) amino acid residue.
- any of X 1a to X 1r is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NO:23 or SEQ ID NOs:73-93, or conservative amino acid substitutions or non-conservative amino acid substitutions thereof.
- any of X 1a to X 1r is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 or SEQ ID NO:26 or conservative amino acid substitutions or non-conservative amino acid substitutions thereof.
- any X 1a to X 1r is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NO:23 or SEQ ID Nos: 73 -93.
- any X 1a to X 1r is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 to SEQ ID NO:26.
- any of X 1a to X 1r is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NOs: 73, 75, 76, 77, 78, 81, 82, 83, 85, 89 or 91, or conservative amino acid substitutions or non-conservative amino acid substitutions thereof.
- any X 1a to X 1r is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NOs: 73, 75, 76, 77, 78, 81, 82, 83, 85, 89 or 91.
- X 1a is Q or E; X 1b is Q, V or L; X 1c is M or L; X 1d is V or P; X 1e is G or Q; X 1f is P, L or R; X 1g is Y or V; X 1h is D, N, E; X 1i is P or A; X 1j is S or T; X 1k is A or S; X 1l is L or Q; X 1m is N or S; X 1n is K or R; X 1o is P or A; X 1p is L or V; X 1q is R or Y; and/or X 1r is Q or M.
- X 1a is Q or E; X 1b is Q, V or L; Xu is M or L; X 1 a is V or P; X 1e is G or Q; X 1f is P, L or R; X 1g is Y; X 1h is D, X 1i is P or A; X 1j is S or T; X 1k is A or S; X 1l is L or Q; X 1m is N or S; X 1n is K or R; X 1o is P or A; X 1p is L or V; X 1q is R or Y; and/or X 1r is Q or M.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence set forth in SEQ ID NO: 144.
- SEQ ID NO: 144 (KD005 consensus) X 2a VQLX 2b ESGGGLX 2c X 2d X 2e GGSLRLSCAASGFTFSGSDMSWVRQAPGKGX 2f E WVSX 2g ITSGGTTYYX 2h DX 2i VKGRFTISRDNX 2j KNTLYLQMNSLX 2k X 2l X 2m DTAX 2 n YX 2o CAKSRLTDSHYVEDAWGQGTX 2p VTVSS
- any of X 2a to X 2p is each independently any (e.g., naturally occurring) amino acid residue.
- any of X 2a to X 2p is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NO:26 or SEQ ID NO:94-114 or conservative amino acid substitutions or non-conservative amino acid substitutions thereof.
- any of X 2a to X 2p is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 or SEQ ID NO:26 or conservative amino acid substitutions or non- conservative amino acid substitutions thereof.
- any X 2a to X 2p is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NO:26 or SEQ ID NO:94-114.
- any X 2a to X 2p is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 to SEQ ID NO:26.
- any of X 2a to X 2p is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NOs: 94, 95, 96, 97, 98, 100, 101, 102, 103, 104, 105, 106, 107 or 108 or conservative amino acid substitutions or non- conservative amino acid substitutions thereof.
- any X 2a to X 2p is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NOs: 94, 95, 96, 97, 98, 100, 101, 102, 103, 104, 105, 106, 107 or 108.
- any of X 2a to X 2p is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NOs: 94, 95, 96, 97, 100, 102, 103, 104, 105, 106, 108, 112 or 114 or conservative amino acid substitutions or non-conservative amino acid substitutions thereof.
- any X 2a to X 2p is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NOs: 94, 95, 96, 97, 100, 102, 103, 104, 105, 106, 108, 112 or 114.
- any of X 2a to X 2p is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NOs: 94, 95, 96, 97, 98, 99, 100, 101, 102, 104, 105, 112, 113 or 114 or conservative amino acid substitutions or non- conservative amino acid substitutions thereof.
- any X 2a to X 2p is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NOs: 94, 95, 96, 97, 98, 99, 100, 101, 102, 104, 105, 112, 113 or 114.
- any of X 2a to X 2p is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NOs: 94, 95, 96, 97, 102 or 105 or conservative amino acid substitutions or non-conservative amino acid substitutions thereof.
- any X 2a to X 2p is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NOs: 94, 95, 96, 97, 102 or 105.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence set forth in SEQ ID NO: 145.
- SEQ ID NO: 145 (Consensus from KD001 to KD005 heavy chain)
- any of X 3a to X 3y is each independently any (e.g., naturally occurring) amino acid residue.
- any of X 3a to X 3y is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 or SEQ ID NO:26 or conservative amino acid substitutions or non- conservative amino acid substitutions thereof.
- any of X 3a to X 3y is each independently an amino acid residue most frequently found in the group consisting of SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 to SEQ ID NO:26.
- X 3a is M or L; X 3b is Q, H or E; X 3c is V, P or A; X 3d is G or R; X 3e is P or T; X 3f is S, N or G; X 3g is A, Y or S; X 3h is N or T; X 3i is A, S or G; X 3j is D, G or S; X 3k is G or absent; X 3l is S or G; X 3m is K, N or T; X 3n is Y or D; X 3o is I or T; X 3p is T or M; X 3q is L or Q; X 3r is N or S; X 3s is K or T; X 3t is E or D; X 3u is R or K; X 3v is A or S; X 3w is K or R; X 3x is T or S; and/or X 3y is Y or A.
- X 3a is M or L; X 3b is Q, H or E; X 3c is V, P or A; X 3 d is G or R; X 3e is P or T; X 3 f is S, N or G; X 3g is A, Y or S; X 3H is N or T; X 3i is A, S or G; X 3j is D, G or S; X 3k is G or absent; X 3l is S or G; X 3m is K, N or T; X 3n is Y; X 3o is I or T; X 3p is T or M; X 3q is L or Q; X 3r is N or S; X 3s is K or T; X 3t is E or D; X 3u is R or K; X 3v is A or S; X 3w is R; X 3x is S; and/or X 3y is A.
- the single domain antibody or antigen binding fragment thereof comprises the amino acid sequence set forth in SEQ ID NO: 146.
- SEQ ID NO: 146 (Consensus for KD001-KD005 and selected variants heavy chains) X 4a VQLX 4b ESGGGX 4c X 4 dX 4e X 4f GX 4g SLRLSCAASGFX 4h FSX 4i X 4j DMX 4k WX 4 l RQAP GKX 4m X 4n X 4o WVSX 4p IX 4q X 4r X 4s GX 4t X 4u TX 4v YX 4w DX 4x VKGRFTX 4y SRDNX 4z KNX 5a LYLX 5b MNX 5c LX 5d X 5e X 5f DTAX 5g YX 5h CAX 5i X 5j X 5k LTDX 5l HYVEDX 5m WGQGTX 5n V
- any of X 4a to X 5n is each independently any (e.g., naturally occurring) amino acid residue.
- any of X 4a to X 5n is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NOs:22-26, SEQ ID Nos:73-114 or conservative amino acid substitutions or non-conservative amino acid substitutions thereof.
- any of X 4a to X 5n is each independently an amino acid residue found at a corresponding position in any one of SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 or SEQ ID NO:26 or conservative amino acid substitutions or non-conservative amino acid substitutions thereof.
- any of X 4a to X 5n is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NOs:22-26, SEQ ID Nos:73-114.
- any of X 4a to X 5n is each independently an amino acid residue most frequently found at a corresponding position in any one of SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 to SEQ ID NO:26.
- X 4a is Q or E
- X 4b is Q, L or V
- X 4c is M or L
- X 4d is V or I
- X 4e is Q
- X 4f is P
- X 4g is G or R
- X 4h is P or T
- X 4i is G, S or N
- X 4j is A or S
- X 4k is S or H
- X 4l is V or Y
- X 4m is G or Q
- X 4n is P, L or R
- X 4o is E or V
- X 4p is Y
- X 4q is T or N
- X 4r is A, S or G
- X 4s is G, S, D, N or E
- X 4t is absent or S
- X 4u is K or T
- X 4v is Y
- X 4w is P or A
- the single domain antibody or antigen binding fragment thereof may have the amino acid sequence as defined in any one of SEQ ID NOs: 143 to 146, wherein the amino acid sequence of the CDR3 is as set forth in SEQ ID NO: 126.
- the single domain antibody or antigen binding fragment thereof may have the amino acid sequence as defined in any one of SEQ ID NOs: 143 to 146, wherein the amino acid sequence of the CDR3 is as set forth in SEQ ID NO: 126 and the amino acid sequence of the FR2 is as set forth in SEQ ID NO: 121.
- the amino acid sequence of the CDR3 and the amino acid sequence of the FR2 are on a same polypeptide chain.
- the amino acid sequence of the CDR3 and the amino acid sequence of the FR2 are on separate polypeptide chains.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Cell Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Veterinary Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Animal Behavior & Ethology (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP22874016.3A EP4408893A4 (en) | 2021-09-29 | 2022-09-28 | Binding agents targeting tumor cells expressing too much 2 |
| MX2024003779A MX2024003779A (es) | 2021-09-29 | 2022-09-28 | Agentes de union dirigidos a celulas tumorales que expresan trop2. |
| AU2022357634A AU2022357634A1 (en) | 2021-09-29 | 2022-09-28 | Binding agents targeting trop2-expressing tumor cells |
| KR1020247014071A KR20240082383A (ko) | 2021-09-29 | 2022-09-28 | Trop2를 발현하는 종양 세포를 표적으로 하는 결합제 |
| CA3231574A CA3231574A1 (en) | 2021-09-29 | 2022-09-28 | Binding agents targeting trop2-expressing tumor cells |
| IL311673A IL311673A (en) | 2021-09-29 | 2022-09-28 | Binding agents targeting TROP2-expressing tumor cells |
| CN202280072946.1A CN118159566A (zh) | 2021-09-29 | 2022-09-28 | 靶向表达trop2的肿瘤细胞的结合剂 |
| JP2024519706A JP2024535930A (ja) | 2021-09-29 | 2022-09-28 | Trop2発現腫瘍細胞を標的化する結合剤 |
| US18/620,397 US20240360242A1 (en) | 2021-09-29 | 2024-03-28 | Binding agents targeting trop2-expressing tumor cells |
| US18/664,070 US12338295B2 (en) | 2021-09-29 | 2024-05-14 | Binding agents targeting TROP2-expressing tumor cells |
| US18/664,091 US12275799B2 (en) | 2021-09-29 | 2024-05-14 | Binding agents targeting TROP2-expressing tumor cells |
| US18/664,078 US12371508B2 (en) | 2021-09-29 | 2024-05-14 | Binding agents targeting TROP2-expressing tumor cells |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163249728P | 2021-09-29 | 2021-09-29 | |
| US63/249,728 | 2021-09-29 | ||
| US202263326572P | 2022-04-01 | 2022-04-01 | |
| US63/326,572 | 2022-04-01 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US18/620,397 Continuation US20240360242A1 (en) | 2021-09-29 | 2024-03-28 | Binding agents targeting trop2-expressing tumor cells |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023049999A1 true WO2023049999A1 (en) | 2023-04-06 |
Family
ID=85780298
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/CA2022/051437 Ceased WO2023049999A1 (en) | 2021-09-29 | 2022-09-28 | Binding agents targeting trop2-expressing tumor cells |
Country Status (10)
| Country | Link |
|---|---|
| US (4) | US20240360242A1 (https=) |
| EP (1) | EP4408893A4 (https=) |
| JP (1) | JP2024535930A (https=) |
| KR (1) | KR20240082383A (https=) |
| AU (1) | AU2022357634A1 (https=) |
| CA (1) | CA3231574A1 (https=) |
| IL (1) | IL311673A (https=) |
| MX (1) | MX2024003779A (https=) |
| TW (1) | TW202330605A (https=) |
| WO (1) | WO2023049999A1 (https=) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024051383A1 (zh) * | 2023-07-28 | 2024-03-14 | 上海洛启生物医药技术有限公司 | 抗Trop2抗体、包含所述抗体的缀合物及其应用 |
| WO2024207112A1 (en) * | 2023-04-04 | 2024-10-10 | Kisoji Biotechnology Inc. | Binding agents targeting trop2-expressing tumor cells |
| US12275799B2 (en) | 2021-09-29 | 2025-04-15 | Kisoji Biotechnology Inc. | Binding agents targeting TROP2-expressing tumor cells |
| WO2026059880A1 (en) * | 2024-09-12 | 2026-03-19 | Modernatx, Inc. | Trop2 binding molecules, nucleic acids encoding same, and methods of use |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018183041A1 (en) * | 2017-03-27 | 2018-10-04 | Immunomedics, Inc. | Treatment of trop-2 expressing triple negative breast cancer with sacituzumab govitecan and a rad51 inhibitor |
| WO2020011868A1 (en) * | 2018-07-11 | 2020-01-16 | UCB Biopharma SRL | Antibodies comprising a polypeptide inserted in framework 3 region |
| CN111518212A (zh) * | 2020-04-16 | 2020-08-11 | 上海洛启生物医药技术有限公司 | 抗Trop2纳米抗体及其应用 |
Family Cites Families (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EA201500220A1 (ru) | 2010-05-17 | 2015-10-30 | Ливтех, Инк. | Антитело против trop-2 человека, обладающее противоопухолевой активностью in vivo |
| WO2011155579A1 (ja) | 2010-06-10 | 2011-12-15 | 北海道公立大学法人札幌医科大学 | 抗Trop-2抗体 |
| US9427464B2 (en) | 2011-11-22 | 2016-08-30 | Chiome Bioscience Inc. | Anti-human TROP-2 antibody having an antitumor activity in vivo |
| CN116199790A (zh) * | 2015-02-10 | 2023-06-02 | 米纳瓦生物技术公司 | 人源化抗MUCl*抗体 |
| CN112646038B (zh) * | 2019-10-11 | 2025-06-03 | 迈威(上海)生物科技股份有限公司 | 抗人Trop-2抗体及其应用 |
| EP4077374A4 (en) | 2019-12-20 | 2023-12-27 | Kisoji Biotechnology Inc. | POLYPEPTIDES, PROTEIN COMPLEXES AND METHODS FOR PRODUCING THE SAME |
| CN112321715B (zh) * | 2020-11-03 | 2022-05-10 | 博奥信生物技术(南京)有限公司 | 抗trop2纳米抗体及其制备方法和应用 |
| CN114685669A (zh) | 2020-12-30 | 2022-07-01 | 和铂医药(苏州)有限公司 | 结合trop2的抗体及其用途 |
| EP4408893A4 (en) | 2021-09-29 | 2026-02-18 | Kisoji Biotechnology Inc | Binding agents targeting tumor cells expressing too much 2 |
-
2022
- 2022-09-28 EP EP22874016.3A patent/EP4408893A4/en active Pending
- 2022-09-28 JP JP2024519706A patent/JP2024535930A/ja active Pending
- 2022-09-28 MX MX2024003779A patent/MX2024003779A/es unknown
- 2022-09-28 IL IL311673A patent/IL311673A/en unknown
- 2022-09-28 CA CA3231574A patent/CA3231574A1/en active Pending
- 2022-09-28 KR KR1020247014071A patent/KR20240082383A/ko active Pending
- 2022-09-28 WO PCT/CA2022/051437 patent/WO2023049999A1/en not_active Ceased
- 2022-09-28 AU AU2022357634A patent/AU2022357634A1/en active Pending
- 2022-09-29 TW TW111137049A patent/TW202330605A/zh unknown
-
2024
- 2024-03-28 US US18/620,397 patent/US20240360242A1/en active Pending
- 2024-05-14 US US18/664,070 patent/US12338295B2/en active Active
- 2024-05-14 US US18/664,091 patent/US12275799B2/en active Active
- 2024-05-14 US US18/664,078 patent/US12371508B2/en active Active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018183041A1 (en) * | 2017-03-27 | 2018-10-04 | Immunomedics, Inc. | Treatment of trop-2 expressing triple negative breast cancer with sacituzumab govitecan and a rad51 inhibitor |
| WO2020011868A1 (en) * | 2018-07-11 | 2020-01-16 | UCB Biopharma SRL | Antibodies comprising a polypeptide inserted in framework 3 region |
| CN111518212A (zh) * | 2020-04-16 | 2020-08-11 | 上海洛启生物医药技术有限公司 | 抗Trop2纳米抗体及其应用 |
Non-Patent Citations (4)
| Title |
|---|
| IKEDA ET AL.: "PrlEll, a novel anti-Trop-2 antibody isolated by adenovirus-based antibody screening, recognizes a unique epitope", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, vol. 458, no. 4, 19 February 2015 (2015-02-19), pages 877 - 882, XP029144583, DOI: 10.1016/j.bbrc. 2015.02.05 1 * |
| IKEDA MASAHIRO, KATO KAZUNORI, YAMAGUCHI MIKI, HAMADA HIROFUMI, NAKAMURA KAZUYASU, SUGIMOTO YOSHIYUKI: "Cell Surface Antibody Retention Influences In Vivo Antitumor Activity Mediated by Antibody-dependent Cellular Cytotoxicity", ANTICANCER RESEARCH, INTERNATIONAL INSTITUTE OF ANTICANCER RESEARCH, GR, vol. 36, no. 11, 1 November 2016 (2016-11-01), GR , pages 5937 - 5944, XP093056839, ISSN: 0250-7005, DOI: 10.21873/anticanres.11181 * |
| LIN ET AL.: "A novel human Fab antibody for Trop2 inhibits breast cancer growth in vitro and in vivo", INTERNATIONAL JOURNAL OF CANCER, vol. 134, no. 1, 19 September 2013 (2013-09-19), pages 1239 - 1249, XP071288232, DOI: 10.1002/ijc.28451 * |
| TANAKA TOMOHIRO, OHISHI TOMOKAZU, ASANO TEIZO, TAKEI JUNKO, NANAMIYA REN, HOSONO HIDEKI, SANO MASATO, HARADA HIROYUKI, KAWADA MANA: "An anti‑TROP2 monoclonal antibody TrMab‑6 exerts antitumor activity in breast cancer mouse xenograft models", ONCOLOGY REPORTS, SPANDIDOS PUBL., vol. 46, no. 1, 1 January 2021 (2021-01-01), XP093056840, ISSN: 1021-335X, DOI: 10.3892/or.2021.8083 * |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12275799B2 (en) | 2021-09-29 | 2025-04-15 | Kisoji Biotechnology Inc. | Binding agents targeting TROP2-expressing tumor cells |
| US12338295B2 (en) | 2021-09-29 | 2025-06-24 | Kisoji Biotechnology Inc. | Binding agents targeting TROP2-expressing tumor cells |
| US12371508B2 (en) | 2021-09-29 | 2025-07-29 | Kisoji Biotechnology Inc. | Binding agents targeting TROP2-expressing tumor cells |
| WO2024207112A1 (en) * | 2023-04-04 | 2024-10-10 | Kisoji Biotechnology Inc. | Binding agents targeting trop2-expressing tumor cells |
| WO2024051383A1 (zh) * | 2023-07-28 | 2024-03-14 | 上海洛启生物医药技术有限公司 | 抗Trop2抗体、包含所述抗体的缀合物及其应用 |
| WO2026059880A1 (en) * | 2024-09-12 | 2026-03-19 | Modernatx, Inc. | Trop2 binding molecules, nucleic acids encoding same, and methods of use |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2022357634A1 (en) | 2024-05-09 |
| US20240317886A1 (en) | 2024-09-26 |
| US20240327537A1 (en) | 2024-10-03 |
| TW202330605A (zh) | 2023-08-01 |
| MX2024003779A (es) | 2024-04-19 |
| EP4408893A1 (en) | 2024-08-07 |
| EP4408893A4 (en) | 2026-02-18 |
| IL311673A (en) | 2024-05-01 |
| US12371508B2 (en) | 2025-07-29 |
| US12338295B2 (en) | 2025-06-24 |
| US20240317887A1 (en) | 2024-09-26 |
| US20240360242A1 (en) | 2024-10-31 |
| US12275799B2 (en) | 2025-04-15 |
| KR20240082383A (ko) | 2024-06-10 |
| CA3231574A1 (en) | 2023-04-06 |
| JP2024535930A (ja) | 2024-10-02 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12338295B2 (en) | Binding agents targeting TROP2-expressing tumor cells | |
| AU2019356806B2 (en) | Antibody constructs binding 4-1BB and tumor-associated antigens and uses thereof | |
| US12415861B2 (en) | Anti C-MET antibodies | |
| US10836833B2 (en) | Cell engaging binding molecules | |
| EP4324853A1 (en) | Multi-specific antibody targeting bcma | |
| CN119698294A (zh) | 结合γ-δT细胞受体的变体抗体 | |
| US20230265202A1 (en) | Antibody constructs binding 4-1bb and folate receptor alpha and uses thereof | |
| CN111788229A (zh) | Csf1r结合剂 | |
| KR20260007641A (ko) | Trop2를 발현하는 종양 세포를 표적으로 하는 결합제 | |
| CN118159566A (zh) | 靶向表达trop2的肿瘤细胞的结合剂 | |
| WO2024131846A1 (en) | Antibody, antigen-binding fragment thereof, and pharmaceutical use thereof | |
| WO2024088386A1 (en) | Antibody, antigen-binding fragment thereof, and pharmaceutical use thereof | |
| WO2025242212A1 (en) | Anti-sstr2 antibodies | |
| HK40120932A (zh) | 抗体及其药物偶联物和用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22874016 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3231574 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 311673 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2024519706 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 810398 Country of ref document: NZ Ref document number: AU2022357634 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 20247014071 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280072946.1 Country of ref document: CN |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022874016 Country of ref document: EP Effective date: 20240429 |
|
| ENP | Entry into the national phase |
Ref document number: 2022357634 Country of ref document: AU Date of ref document: 20220928 Kind code of ref document: A |