WO2023044039A1 - Compositions and methods for treating cancer - Google Patents
Compositions and methods for treating cancer Download PDFInfo
- Publication number
- WO2023044039A1 WO2023044039A1 PCT/US2022/043850 US2022043850W WO2023044039A1 WO 2023044039 A1 WO2023044039 A1 WO 2023044039A1 US 2022043850 W US2022043850 W US 2022043850W WO 2023044039 A1 WO2023044039 A1 WO 2023044039A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- dose
- cells
- tcr
- tfp
- msln
- Prior art date
Links
- 238000000034 method Methods 0.000 title claims abstract description 279
- 206010028980 Neoplasm Diseases 0.000 title claims abstract description 163
- 201000011510 cancer Diseases 0.000 title claims abstract description 101
- 239000000203 mixture Substances 0.000 title description 24
- 210000001744 T-lymphocyte Anatomy 0.000 claims abstract description 330
- 108091008874 T cell receptors Proteins 0.000 claims abstract description 329
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 claims abstract description 325
- 108090000015 Mesothelin Proteins 0.000 claims abstract description 154
- 102000003735 Mesothelin Human genes 0.000 claims abstract description 152
- 238000011282 treatment Methods 0.000 claims abstract description 58
- 108020001507 fusion proteins Proteins 0.000 claims abstract description 26
- 102000037865 fusion proteins Human genes 0.000 claims abstract description 26
- 238000002560 therapeutic procedure Methods 0.000 claims abstract description 21
- 210000004027 cell Anatomy 0.000 claims description 395
- 230000027455 binding Effects 0.000 claims description 137
- 239000000427 antigen Substances 0.000 claims description 116
- 108091007433 antigens Proteins 0.000 claims description 115
- 102000036639 antigens Human genes 0.000 claims description 115
- 108090000623 proteins and genes Proteins 0.000 claims description 101
- 150000007523 nucleic acids Chemical class 0.000 claims description 95
- 102000039446 nucleic acids Human genes 0.000 claims description 81
- 108020004707 nucleic acids Proteins 0.000 claims description 81
- 230000003834 intracellular effect Effects 0.000 claims description 64
- 102000004169 proteins and genes Human genes 0.000 claims description 53
- 150000001413 amino acids Chemical group 0.000 claims description 45
- 230000004068 intracellular signaling Effects 0.000 claims description 42
- 206010060933 Adverse event Diseases 0.000 claims description 40
- 231100000628 reference dose Toxicity 0.000 claims description 32
- 230000004048 modification Effects 0.000 claims description 29
- 238000012986 modification Methods 0.000 claims description 29
- 206010033128 Ovarian cancer Diseases 0.000 claims description 27
- 208000006178 malignant mesothelioma Diseases 0.000 claims description 27
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 26
- 201000005282 malignant pleural mesothelioma Diseases 0.000 claims description 24
- 239000012634 fragment Substances 0.000 claims description 23
- 206010052015 cytokine release syndrome Diseases 0.000 claims description 22
- 208000002154 non-small cell lung carcinoma Diseases 0.000 claims description 21
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 claims description 21
- 206010027406 Mesothelioma Diseases 0.000 claims description 17
- 208000006990 cholangiocarcinoma Diseases 0.000 claims description 17
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 claims description 12
- 206010044221 Toxic encephalopathy Diseases 0.000 claims description 12
- 238000011469 lymphodepleting chemotherapy Methods 0.000 claims description 12
- 230000004936 stimulating effect Effects 0.000 claims description 12
- 206010017758 gastric cancer Diseases 0.000 claims description 11
- 238000001356 surgical procedure Methods 0.000 claims description 11
- 241001529936 Murinae Species 0.000 claims description 10
- 206010029350 Neurotoxicity Diseases 0.000 claims description 10
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 10
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 10
- 238000002512 chemotherapy Methods 0.000 claims description 10
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 10
- 231100000228 neurotoxicity Toxicity 0.000 claims description 10
- 230000007135 neurotoxicity Effects 0.000 claims description 10
- 201000002528 pancreatic cancer Diseases 0.000 claims description 10
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 10
- 201000011549 stomach cancer Diseases 0.000 claims description 10
- 206010009944 Colon cancer Diseases 0.000 claims description 9
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 claims description 9
- 229960000390 fludarabine Drugs 0.000 claims description 9
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 claims description 9
- 238000001802 infusion Methods 0.000 claims description 9
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 claims description 8
- 206010014733 Endometrial cancer Diseases 0.000 claims description 8
- 206010014759 Endometrial neoplasm Diseases 0.000 claims description 8
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 8
- 230000000735 allogeneic effect Effects 0.000 claims description 8
- 229960004397 cyclophosphamide Drugs 0.000 claims description 8
- 201000005202 lung cancer Diseases 0.000 claims description 8
- 208000020816 lung neoplasm Diseases 0.000 claims description 8
- 238000001959 radiotherapy Methods 0.000 claims description 8
- 208000036832 Adenocarcinoma of ovary Diseases 0.000 claims description 7
- 206010061328 Ovarian epithelial cancer Diseases 0.000 claims description 7
- 208000013371 ovarian adenocarcinoma Diseases 0.000 claims description 7
- 201000006588 ovary adenocarcinoma Diseases 0.000 claims description 7
- 206010006187 Breast cancer Diseases 0.000 claims description 6
- 239000004471 Glycine Substances 0.000 claims description 6
- 206010045170 Tumour lysis syndrome Diseases 0.000 claims description 6
- 230000001580 bacterial effect Effects 0.000 claims description 6
- 238000006243 chemical reaction Methods 0.000 claims description 6
- 239000012642 immune effector Substances 0.000 claims description 6
- 229940121354 immunomodulator Drugs 0.000 claims description 6
- 208000014018 liver neoplasm Diseases 0.000 claims description 6
- 208000010380 tumor lysis syndrome Diseases 0.000 claims description 6
- 208000026310 Breast neoplasm Diseases 0.000 claims description 5
- 206010008342 Cervix carcinoma Diseases 0.000 claims description 5
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims description 5
- 206010060862 Prostate cancer Diseases 0.000 claims description 5
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 5
- 206010039491 Sarcoma Diseases 0.000 claims description 5
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 claims description 5
- 201000010881 cervical cancer Diseases 0.000 claims description 5
- 201000010175 gallbladder cancer Diseases 0.000 claims description 5
- 210000004475 gamma-delta t lymphocyte Anatomy 0.000 claims description 5
- 201000007270 liver cancer Diseases 0.000 claims description 5
- 206010061289 metastatic neoplasm Diseases 0.000 claims description 5
- 206010041823 squamous cell carcinoma Diseases 0.000 claims description 5
- 208000008190 Agammaglobulinemia Diseases 0.000 claims description 4
- 206010005003 Bladder cancer Diseases 0.000 claims description 4
- 206010048610 Cardiotoxicity Diseases 0.000 claims description 4
- 208000009329 Graft vs Host Disease Diseases 0.000 claims description 4
- 206010020983 Hypogammaglobulinaemia Diseases 0.000 claims description 4
- 206010033661 Pancytopenia Diseases 0.000 claims description 4
- 208000006265 Renal cell carcinoma Diseases 0.000 claims description 4
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 4
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 claims description 4
- 210000002203 alpha-beta t lymphocyte Anatomy 0.000 claims description 4
- 231100000259 cardiotoxicity Toxicity 0.000 claims description 4
- 230000007681 cardiovascular toxicity Effects 0.000 claims description 4
- 208000029742 colonic neoplasm Diseases 0.000 claims description 4
- 208000024389 cytopenia Diseases 0.000 claims description 4
- 208000024908 graft versus host disease Diseases 0.000 claims description 4
- 238000001990 intravenous administration Methods 0.000 claims description 4
- 201000001441 melanoma Diseases 0.000 claims description 4
- 230000001394 metastastic effect Effects 0.000 claims description 4
- 201000005112 urinary bladder cancer Diseases 0.000 claims description 4
- 208000035143 Bacterial infection Diseases 0.000 claims description 3
- 208000000461 Esophageal Neoplasms Diseases 0.000 claims description 3
- 208000022072 Gallbladder Neoplasms Diseases 0.000 claims description 3
- 208000032612 Glial tumor Diseases 0.000 claims description 3
- 206010018338 Glioma Diseases 0.000 claims description 3
- 206010023825 Laryngeal cancer Diseases 0.000 claims description 3
- 206010025323 Lymphomas Diseases 0.000 claims description 3
- 206010030155 Oesophageal carcinoma Diseases 0.000 claims description 3
- 208000004337 Salivary Gland Neoplasms Diseases 0.000 claims description 3
- 206010061934 Salivary gland cancer Diseases 0.000 claims description 3
- 208000024770 Thyroid neoplasm Diseases 0.000 claims description 3
- 208000009956 adenocarcinoma Diseases 0.000 claims description 3
- 238000009175 antibody therapy Methods 0.000 claims description 3
- 208000022362 bacterial infectious disease Diseases 0.000 claims description 3
- 201000004101 esophageal cancer Diseases 0.000 claims description 3
- 201000010536 head and neck cancer Diseases 0.000 claims description 3
- 208000014829 head and neck neoplasm Diseases 0.000 claims description 3
- 206010023841 laryngeal neoplasm Diseases 0.000 claims description 3
- 208000032839 leukemia Diseases 0.000 claims description 3
- 238000009092 lines of therapy Methods 0.000 claims description 3
- 201000002510 thyroid cancer Diseases 0.000 claims description 3
- 230000002463 transducing effect Effects 0.000 claims description 3
- 208000014644 Brain disease Diseases 0.000 claims description 2
- 208000032274 Encephalopathy Diseases 0.000 claims description 2
- 201000001342 Fallopian tube cancer Diseases 0.000 claims description 2
- 208000013452 Fallopian tube neoplasm Diseases 0.000 claims description 2
- 206010017533 Fungal infection Diseases 0.000 claims description 2
- 208000031888 Mycoses Diseases 0.000 claims description 2
- 208000005890 Neuroma Diseases 0.000 claims description 2
- 208000007125 Neurotoxicity Syndromes Diseases 0.000 claims description 2
- 208000026149 Primary peritoneal carcinoma Diseases 0.000 claims description 2
- 238000001815 biotherapy Methods 0.000 claims description 2
- 231100000153 central nervous system (CNS) toxicity Toxicity 0.000 claims description 2
- 208000005017 glioblastoma Diseases 0.000 claims description 2
- 230000002489 hematologic effect Effects 0.000 claims description 2
- 238000001794 hormone therapy Methods 0.000 claims description 2
- 208000011580 syndromic disease Diseases 0.000 claims description 2
- 238000009121 systemic therapy Methods 0.000 claims description 2
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 100
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 100
- 239000013598 vector Substances 0.000 description 79
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 74
- 108090000765 processed proteins & peptides Proteins 0.000 description 69
- 230000014509 gene expression Effects 0.000 description 65
- 201000010099 disease Diseases 0.000 description 61
- 108020004414 DNA Proteins 0.000 description 56
- 102000053602 DNA Human genes 0.000 description 56
- 102000004196 processed proteins & peptides Human genes 0.000 description 54
- 229920002477 rna polymer Polymers 0.000 description 52
- 235000018102 proteins Nutrition 0.000 description 51
- 125000003275 alpha amino acid group Chemical group 0.000 description 47
- 229920001184 polypeptide Polymers 0.000 description 47
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 46
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 45
- 235000001014 amino acid Nutrition 0.000 description 39
- 239000003795 chemical substances by application Substances 0.000 description 38
- 229940024606 amino acid Drugs 0.000 description 35
- 238000000338 in vitro Methods 0.000 description 34
- 125000003729 nucleotide group Chemical group 0.000 description 34
- 239000002773 nucleotide Substances 0.000 description 33
- 230000011664 signaling Effects 0.000 description 31
- 108091028043 Nucleic acid sequence Proteins 0.000 description 29
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 26
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 26
- 150000002632 lipids Chemical class 0.000 description 26
- 238000013518 transcription Methods 0.000 description 26
- 230000035897 transcription Effects 0.000 description 26
- 230000000139 costimulatory effect Effects 0.000 description 25
- 230000002401 inhibitory effect Effects 0.000 description 24
- 230000004913 activation Effects 0.000 description 23
- 125000000539 amino acid group Chemical group 0.000 description 23
- 238000003752 polymerase chain reaction Methods 0.000 description 21
- 101100519207 Mus musculus Pdcd1 gene Proteins 0.000 description 20
- 230000004044 response Effects 0.000 description 20
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 19
- 230000000295 complement effect Effects 0.000 description 19
- 102000040430 polynucleotide Human genes 0.000 description 18
- 108091033319 polynucleotide Proteins 0.000 description 18
- 239000002157 polynucleotide Substances 0.000 description 18
- 239000000047 product Substances 0.000 description 18
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 17
- 108060003951 Immunoglobulin Proteins 0.000 description 17
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 17
- 239000003814 drug Substances 0.000 description 17
- 230000006870 function Effects 0.000 description 17
- 102000018358 immunoglobulin Human genes 0.000 description 17
- 239000003446 ligand Substances 0.000 description 17
- 238000006467 substitution reaction Methods 0.000 description 17
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 description 16
- 108091028075 Circular RNA Proteins 0.000 description 16
- 210000001519 tissue Anatomy 0.000 description 16
- 101710163270 Nuclease Proteins 0.000 description 15
- 230000000694 effects Effects 0.000 description 15
- 239000002502 liposome Substances 0.000 description 15
- 239000013612 plasmid Substances 0.000 description 15
- 108020003589 5' Untranslated Regions Proteins 0.000 description 14
- 241000713666 Lentivirus Species 0.000 description 14
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 14
- 238000013519 translation Methods 0.000 description 14
- 108020005345 3' Untranslated Regions Proteins 0.000 description 13
- 102000004127 Cytokines Human genes 0.000 description 13
- 108090000695 Cytokines Proteins 0.000 description 13
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 13
- -1 agricultural or wild Species 0.000 description 13
- 239000011324 bead Substances 0.000 description 13
- 208000035475 disorder Diseases 0.000 description 13
- 102220080600 rs797046116 Human genes 0.000 description 13
- 230000004083 survival effect Effects 0.000 description 13
- 230000001225 therapeutic effect Effects 0.000 description 13
- 210000004881 tumor cell Anatomy 0.000 description 13
- 108010074708 B7-H1 Antigen Proteins 0.000 description 12
- 108010042407 Endonucleases Proteins 0.000 description 12
- 101000576802 Homo sapiens Mesothelin Proteins 0.000 description 12
- 241000124008 Mammalia Species 0.000 description 12
- 108010017070 Zinc Finger Nucleases Proteins 0.000 description 12
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 11
- 230000008901 benefit Effects 0.000 description 11
- 230000001086 cytosolic effect Effects 0.000 description 11
- 230000007423 decrease Effects 0.000 description 11
- 238000010362 genome editing Methods 0.000 description 11
- 230000035772 mutation Effects 0.000 description 11
- 229960002621 pembrolizumab Drugs 0.000 description 11
- 230000008569 process Effects 0.000 description 11
- 102000005962 receptors Human genes 0.000 description 11
- 108020003175 receptors Proteins 0.000 description 11
- 230000003612 virological effect Effects 0.000 description 11
- 108091036407 Polyadenylation Proteins 0.000 description 10
- 210000004369 blood Anatomy 0.000 description 10
- 239000008280 blood Substances 0.000 description 10
- 229940079593 drug Drugs 0.000 description 10
- 239000013604 expression vector Substances 0.000 description 10
- 230000028993 immune response Effects 0.000 description 10
- 230000001965 increasing effect Effects 0.000 description 10
- 239000000523 sample Substances 0.000 description 10
- 206010052747 Adenocarcinoma pancreas Diseases 0.000 description 9
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 9
- 108020004684 Internal Ribosome Entry Sites Proteins 0.000 description 9
- 239000012636 effector Substances 0.000 description 9
- 238000005516 engineering process Methods 0.000 description 9
- 238000001727 in vivo Methods 0.000 description 9
- 230000036210 malignancy Effects 0.000 description 9
- 201000002094 pancreatic adenocarcinoma Diseases 0.000 description 9
- 230000000638 stimulation Effects 0.000 description 9
- 241001430294 unidentified retrovirus Species 0.000 description 9
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 8
- 108010002350 Interleukin-2 Proteins 0.000 description 8
- 108091092195 Intron Proteins 0.000 description 8
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 8
- 108700008625 Reporter Genes Proteins 0.000 description 8
- 238000007792 addition Methods 0.000 description 8
- 238000002617 apheresis Methods 0.000 description 8
- 238000003556 assay Methods 0.000 description 8
- 238000004422 calculation algorithm Methods 0.000 description 8
- 238000002659 cell therapy Methods 0.000 description 8
- 150000001875 compounds Chemical class 0.000 description 8
- 230000001976 improved effect Effects 0.000 description 8
- 239000000463 material Substances 0.000 description 8
- 239000002245 particle Substances 0.000 description 8
- 230000001105 regulatory effect Effects 0.000 description 8
- 238000012546 transfer Methods 0.000 description 8
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 7
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 7
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 7
- 102100031780 Endonuclease Human genes 0.000 description 7
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 7
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 7
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 7
- 241000700605 Viruses Species 0.000 description 7
- 210000003719 b-lymphocyte Anatomy 0.000 description 7
- 230000000977 initiatory effect Effects 0.000 description 7
- 230000003993 interaction Effects 0.000 description 7
- 230000001404 mediated effect Effects 0.000 description 7
- 229910052697 platinum Inorganic materials 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 239000000126 substance Substances 0.000 description 7
- 238000001890 transfection Methods 0.000 description 7
- 239000013603 viral vector Substances 0.000 description 7
- 229940045513 CTLA4 antagonist Drugs 0.000 description 6
- 108091007741 Chimeric antigen receptor T cells Proteins 0.000 description 6
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 6
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 6
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 6
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 description 6
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 6
- 102100020943 Leukocyte-associated immunoglobulin-like receptor 1 Human genes 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 6
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 6
- 102100023123 Mucin-16 Human genes 0.000 description 6
- 241000283984 Rodentia Species 0.000 description 6
- 108010073062 Transcription Activator-Like Effectors Proteins 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 230000009286 beneficial effect Effects 0.000 description 6
- 238000003776 cleavage reaction Methods 0.000 description 6
- 239000002299 complementary DNA Substances 0.000 description 6
- 210000004602 germ cell Anatomy 0.000 description 6
- 238000003384 imaging method Methods 0.000 description 6
- 229960003301 nivolumab Drugs 0.000 description 6
- 230000036961 partial effect Effects 0.000 description 6
- 230000002688 persistence Effects 0.000 description 6
- 230000002062 proliferating effect Effects 0.000 description 6
- 230000007017 scission Effects 0.000 description 6
- 241000894007 species Species 0.000 description 6
- 210000003171 tumor-infiltrating lymphocyte Anatomy 0.000 description 6
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 6
- 241000701161 unidentified adenovirus Species 0.000 description 6
- 238000011144 upstream manufacturing Methods 0.000 description 6
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 5
- 102100027207 CD27 antigen Human genes 0.000 description 5
- 230000004568 DNA-binding Effects 0.000 description 5
- 102000004533 Endonucleases Human genes 0.000 description 5
- 108091027874 Group I catalytic intron Proteins 0.000 description 5
- 241000282412 Homo Species 0.000 description 5
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 5
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 5
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 description 5
- 101001138062 Homo sapiens Leukocyte-associated immunoglobulin-like receptor 1 Proteins 0.000 description 5
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 description 5
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 description 5
- 102000017578 LAG3 Human genes 0.000 description 5
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 5
- 108700026244 Open Reading Frames Proteins 0.000 description 5
- 108091034057 RNA (poly(A)) Proteins 0.000 description 5
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 description 5
- 238000011467 adoptive cell therapy Methods 0.000 description 5
- 230000002411 adverse Effects 0.000 description 5
- 230000000259 anti-tumor effect Effects 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 230000010261 cell growth Effects 0.000 description 5
- 210000003162 effector t lymphocyte Anatomy 0.000 description 5
- 238000001476 gene delivery Methods 0.000 description 5
- 210000000987 immune system Anatomy 0.000 description 5
- 238000002649 immunization Methods 0.000 description 5
- 230000003053 immunization Effects 0.000 description 5
- 238000011534 incubation Methods 0.000 description 5
- 108020004999 messenger RNA Proteins 0.000 description 5
- 238000010369 molecular cloning Methods 0.000 description 5
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 5
- 230000008488 polyadenylation Effects 0.000 description 5
- 239000002243 precursor Substances 0.000 description 5
- 230000035755 proliferation Effects 0.000 description 5
- 210000003289 regulatory T cell Anatomy 0.000 description 5
- 230000001177 retroviral effect Effects 0.000 description 5
- 230000019491 signal transduction Effects 0.000 description 5
- 230000003007 single stranded DNA break Effects 0.000 description 5
- 229940124597 therapeutic agent Drugs 0.000 description 5
- 238000010361 transduction Methods 0.000 description 5
- 230000026683 transduction Effects 0.000 description 5
- 238000005406 washing Methods 0.000 description 5
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 208000023275 Autoimmune disease Diseases 0.000 description 4
- 208000003174 Brain Neoplasms Diseases 0.000 description 4
- 238000011357 CAR T-cell therapy Methods 0.000 description 4
- 102100024263 CD160 antigen Human genes 0.000 description 4
- 108091033409 CRISPR Proteins 0.000 description 4
- 108091026890 Coding region Proteins 0.000 description 4
- 108091033380 Coding strand Proteins 0.000 description 4
- 241000702421 Dependoparvovirus Species 0.000 description 4
- 108700024394 Exon Proteins 0.000 description 4
- 108020005004 Guide RNA Proteins 0.000 description 4
- 101000761938 Homo sapiens CD160 antigen Proteins 0.000 description 4
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 4
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 4
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 4
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 4
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 4
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 4
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 4
- 108010038807 Oligopeptides Proteins 0.000 description 4
- 102000015636 Oligopeptides Human genes 0.000 description 4
- 208000006994 Precancerous Conditions Diseases 0.000 description 4
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 4
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 4
- 230000006044 T cell activation Effects 0.000 description 4
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 4
- 239000004473 Threonine Substances 0.000 description 4
- 108700019146 Transgenes Proteins 0.000 description 4
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 4
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- 230000015556 catabolic process Effects 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 238000006731 degradation reaction Methods 0.000 description 4
- 238000002716 delivery method Methods 0.000 description 4
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 4
- 238000004520 electroporation Methods 0.000 description 4
- 238000007710 freezing Methods 0.000 description 4
- 230000008014 freezing Effects 0.000 description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 4
- 230000003463 hyperproliferative effect Effects 0.000 description 4
- 230000001939 inductive effect Effects 0.000 description 4
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 4
- 229960000310 isoleucine Drugs 0.000 description 4
- 229920002521 macromolecule Polymers 0.000 description 4
- 210000004379 membrane Anatomy 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 239000000693 micelle Substances 0.000 description 4
- 210000003516 pericardium Anatomy 0.000 description 4
- 210000004303 peritoneum Anatomy 0.000 description 4
- 239000012071 phase Substances 0.000 description 4
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 4
- 239000002953 phosphate buffered saline Substances 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 230000002265 prevention Effects 0.000 description 4
- 230000002441 reversible effect Effects 0.000 description 4
- 208000024891 symptom Diseases 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- 230000008685 targeting Effects 0.000 description 4
- 230000002103 transcriptional effect Effects 0.000 description 4
- 239000004474 valine Substances 0.000 description 4
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 3
- 208000010507 Adenocarcinoma of Lung Diseases 0.000 description 3
- 206010001488 Aggression Diseases 0.000 description 3
- 102000006306 Antigen Receptors Human genes 0.000 description 3
- 108010083359 Antigen Receptors Proteins 0.000 description 3
- 206010004593 Bile duct cancer Diseases 0.000 description 3
- 238000010453 CRISPR/Cas method Methods 0.000 description 3
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 3
- 102100025466 Carcinoembryonic antigen-related cell adhesion molecule 3 Human genes 0.000 description 3
- 241000282693 Cercopithecidae Species 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 3
- 102000001301 EGF receptor Human genes 0.000 description 3
- 108060006698 EGF receptor Proteins 0.000 description 3
- 108060002716 Exonuclease Proteins 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical compound NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 3
- 101000914337 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 3 Proteins 0.000 description 3
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 3
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 3
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 3
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 3
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 description 3
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 3
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 3
- 101000666896 Homo sapiens V-type immunoglobulin domain-containing suppressor of T-cell activation Proteins 0.000 description 3
- 108091006905 Human Serum Albumin Proteins 0.000 description 3
- 102000008100 Human Serum Albumin Human genes 0.000 description 3
- 241000725303 Human immunodeficiency virus Species 0.000 description 3
- 206010020751 Hypersensitivity Diseases 0.000 description 3
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 3
- 102100027268 Interferon-stimulated gene 20 kDa protein Human genes 0.000 description 3
- 108090000172 Interleukin-15 Proteins 0.000 description 3
- 208000008839 Kidney Neoplasms Diseases 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- 208000031671 Large B-Cell Diffuse Lymphoma Diseases 0.000 description 3
- 239000000232 Lipid Bilayer Substances 0.000 description 3
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 3
- 206010027476 Metastases Diseases 0.000 description 3
- 102000007474 Multiprotein Complexes Human genes 0.000 description 3
- 108010085220 Multiprotein Complexes Proteins 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 102100038082 Natural killer cell receptor 2B4 Human genes 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- 206010038389 Renal cancer Diseases 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 description 3
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 description 3
- 108020004566 Transfer RNA Proteins 0.000 description 3
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 3
- 108091023045 Untranslated Region Proteins 0.000 description 3
- 102100038282 V-type immunoglobulin domain-containing suppressor of T-cell activation Human genes 0.000 description 3
- 230000009471 action Effects 0.000 description 3
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 3
- 235000004279 alanine Nutrition 0.000 description 3
- 230000007815 allergy Effects 0.000 description 3
- 210000000612 antigen-presenting cell Anatomy 0.000 description 3
- 230000000890 antigenic effect Effects 0.000 description 3
- 208000006673 asthma Diseases 0.000 description 3
- 229960003852 atezolizumab Drugs 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 239000001506 calcium phosphate Substances 0.000 description 3
- 229910000389 calcium phosphate Inorganic materials 0.000 description 3
- 235000011010 calcium phosphates Nutrition 0.000 description 3
- 238000002619 cancer immunotherapy Methods 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 230000001461 cytolytic effect Effects 0.000 description 3
- 230000034994 death Effects 0.000 description 3
- 231100000517 death Toxicity 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 210000004443 dendritic cell Anatomy 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 239000008121 dextrose Substances 0.000 description 3
- 230000004069 differentiation Effects 0.000 description 3
- 206010012818 diffuse large B-cell lymphoma Diseases 0.000 description 3
- 230000002255 enzymatic effect Effects 0.000 description 3
- 102000013165 exonuclease Human genes 0.000 description 3
- IJJVMEJXYNJXOJ-UHFFFAOYSA-N fluquinconazole Chemical compound C=1C=C(Cl)C=C(Cl)C=1N1C(=O)C2=CC(F)=CC=C2N=C1N1C=NC=N1 IJJVMEJXYNJXOJ-UHFFFAOYSA-N 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 3
- 230000006801 homologous recombination Effects 0.000 description 3
- 238000002744 homologous recombination Methods 0.000 description 3
- 210000002865 immune cell Anatomy 0.000 description 3
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 3
- 229940072221 immunoglobulins Drugs 0.000 description 3
- 238000003364 immunohistochemistry Methods 0.000 description 3
- 230000003308 immunostimulating effect Effects 0.000 description 3
- 230000008676 import Effects 0.000 description 3
- 208000027866 inflammatory disease Diseases 0.000 description 3
- 201000010982 kidney cancer Diseases 0.000 description 3
- 230000007774 longterm Effects 0.000 description 3
- 201000005249 lung adenocarcinoma Diseases 0.000 description 3
- 206010025135 lupus erythematosus Diseases 0.000 description 3
- FVVLHONNBARESJ-NTOWJWGLSA-H magnesium;potassium;trisodium;(2r,3s,4r,5r)-2,3,4,5,6-pentahydroxyhexanoate;acetate;tetrachloride;nonahydrate Chemical compound O.O.O.O.O.O.O.O.O.[Na+].[Na+].[Na+].[Mg+2].[Cl-].[Cl-].[Cl-].[Cl-].[K+].CC([O-])=O.OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O FVVLHONNBARESJ-NTOWJWGLSA-H 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 210000005033 mesothelial cell Anatomy 0.000 description 3
- 238000012544 monitoring process Methods 0.000 description 3
- 210000001616 monocyte Anatomy 0.000 description 3
- 229960005079 pemetrexed Drugs 0.000 description 3
- QOFFJEBXNKRSPX-ZDUSSCGKSA-N pemetrexed Chemical compound C1=N[C]2NC(N)=NC(=O)C2=C1CCC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 QOFFJEBXNKRSPX-ZDUSSCGKSA-N 0.000 description 3
- 239000011886 peripheral blood Substances 0.000 description 3
- 210000005259 peripheral blood Anatomy 0.000 description 3
- 239000008194 pharmaceutical composition Substances 0.000 description 3
- 210000004224 pleura Anatomy 0.000 description 3
- 230000000306 recurrent effect Effects 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 208000008732 thymoma Diseases 0.000 description 3
- 108010078373 tisagenlecleucel Proteins 0.000 description 3
- 102000035160 transmembrane proteins Human genes 0.000 description 3
- 108091005703 transmembrane proteins Proteins 0.000 description 3
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- MDSIZRKJVDMQOQ-GORDUTHDSA-N (2E)-4-hydroxy-3-methylbut-2-en-1-yl diphosphate Chemical compound OCC(/C)=C/COP(O)(=O)OP(O)(O)=O MDSIZRKJVDMQOQ-GORDUTHDSA-N 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- 102100033793 ALK tyrosine kinase receptor Human genes 0.000 description 2
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 2
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 2
- 102100034540 Adenomatous polyposis coli protein Human genes 0.000 description 2
- OGSPWJRAVKPPFI-UHFFFAOYSA-N Alendronic Acid Chemical compound NCCCC(O)(P(O)(O)=O)P(O)(O)=O OGSPWJRAVKPPFI-UHFFFAOYSA-N 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 102100038078 CD276 antigen Human genes 0.000 description 2
- 101710185679 CD276 antigen Proteins 0.000 description 2
- 101150013553 CD40 gene Proteins 0.000 description 2
- 102100035793 CD83 antigen Human genes 0.000 description 2
- 102100037904 CD9 antigen Human genes 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 description 2
- 241000282472 Canis lupus familiaris Species 0.000 description 2
- 102100024533 Carcinoembryonic antigen-related cell adhesion molecule 1 Human genes 0.000 description 2
- 201000009030 Carcinoma Diseases 0.000 description 2
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 2
- 229930105110 Cyclosporin A Natural products 0.000 description 2
- 108010036949 Cyclosporine Proteins 0.000 description 2
- 241000701022 Cytomegalovirus Species 0.000 description 2
- RWSOTUBLDIXVET-UHFFFAOYSA-N Dihydrogen sulfide Chemical compound S RWSOTUBLDIXVET-UHFFFAOYSA-N 0.000 description 2
- 102100037964 E3 ubiquitin-protein ligase RING2 Human genes 0.000 description 2
- 241000710188 Encephalomyocarditis virus Species 0.000 description 2
- 101000889900 Enterobacteria phage T4 Intron-associated endonuclease 1 Proteins 0.000 description 2
- 101000760853 Enterobacteria phage T4 Thymidylate synthase Proteins 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 241000701533 Escherichia virus T4 Species 0.000 description 2
- 241000282326 Felis catus Species 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 2
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 description 2
- 102100029360 Hematopoietic cell signal transducer Human genes 0.000 description 2
- 108010007707 Hepatitis A Virus Cellular Receptor 2 Proteins 0.000 description 2
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 2
- 101000779641 Homo sapiens ALK tyrosine kinase receptor Proteins 0.000 description 2
- 101000924577 Homo sapiens Adenomatous polyposis coli protein Proteins 0.000 description 2
- 101000946856 Homo sapiens CD83 antigen Proteins 0.000 description 2
- 101000738354 Homo sapiens CD9 antigen Proteins 0.000 description 2
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 description 2
- 101001095815 Homo sapiens E3 ubiquitin-protein ligase RING2 Proteins 0.000 description 2
- 101000990188 Homo sapiens Hematopoietic cell signal transducer Proteins 0.000 description 2
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 2
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 description 2
- 101001057193 Homo sapiens Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 Proteins 0.000 description 2
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 2
- 101001109503 Homo sapiens NKG2-C type II integral membrane protein Proteins 0.000 description 2
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 2
- 101000934341 Homo sapiens T-cell surface glycoprotein CD5 Proteins 0.000 description 2
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 2
- 101000809875 Homo sapiens TYRO protein tyrosine kinase-binding protein Proteins 0.000 description 2
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 2
- 101000740048 Homo sapiens Ubiquitin carboxyl-terminal hydrolase BAP1 Proteins 0.000 description 2
- 206010061598 Immunodeficiency Diseases 0.000 description 2
- 102000018682 Interleukin Receptor Common gamma Subunit Human genes 0.000 description 2
- 108010066719 Interleukin Receptor Common gamma Subunit Proteins 0.000 description 2
- 108010002586 Interleukin-7 Proteins 0.000 description 2
- 108010043610 KIR Receptors Proteins 0.000 description 2
- 102000002698 KIR Receptors Human genes 0.000 description 2
- 208000007666 Klatskin Tumor Diseases 0.000 description 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 2
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- 101000740049 Latilactobacillus curvatus Bioactive peptide 1 Proteins 0.000 description 2
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 2
- JLVVSXFLKOJNIY-UHFFFAOYSA-N Magnesium ion Chemical compound [Mg+2] JLVVSXFLKOJNIY-UHFFFAOYSA-N 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 102100025096 Mesothelin Human genes 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 2
- 102100022683 NKG2-C type II integral membrane protein Human genes 0.000 description 2
- 101710141230 Natural killer cell receptor 2B4 Proteins 0.000 description 2
- 208000034176 Neoplasms, Germ Cell and Embryonal Diseases 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 101710124239 Poly(A) polymerase Proteins 0.000 description 2
- 102000012338 Poly(ADP-ribose) Polymerases Human genes 0.000 description 2
- 108010061844 Poly(ADP-ribose) Polymerases Proteins 0.000 description 2
- 229920000776 Poly(Adenosine diphosphate-ribose) polymerase Polymers 0.000 description 2
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 2
- RJKFOVLPORLFTN-LEKSSAKUSA-N Progesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)C)[C@@]1(C)CC2 RJKFOVLPORLFTN-LEKSSAKUSA-N 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 108020005067 RNA Splice Sites Proteins 0.000 description 2
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 2
- 208000000453 Skin Neoplasms Diseases 0.000 description 2
- 230000005867 T cell response Effects 0.000 description 2
- 102100025244 T-cell surface glycoprotein CD5 Human genes 0.000 description 2
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 2
- 102100038717 TYRO protein tyrosine kinase-binding protein Human genes 0.000 description 2
- 229940123237 Taxane Drugs 0.000 description 2
- 108091036066 Three prime untranslated region Proteins 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- 208000003721 Triple Negative Breast Neoplasms Diseases 0.000 description 2
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 2
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 2
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 2
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 2
- 208000002495 Uterine Neoplasms Diseases 0.000 description 2
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 2
- 230000001594 aberrant effect Effects 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 150000003838 adenosines Chemical class 0.000 description 2
- 208000026935 allergic disease Diseases 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 239000004037 angiogenesis inhibitor Substances 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 230000005809 anti-tumor immunity Effects 0.000 description 2
- 239000012736 aqueous medium Substances 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 235000003704 aspartic acid Nutrition 0.000 description 2
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 2
- 230000008512 biological response Effects 0.000 description 2
- 239000012472 biological sample Substances 0.000 description 2
- 238000001574 biopsy Methods 0.000 description 2
- 210000001772 blood platelet Anatomy 0.000 description 2
- 210000001185 bone marrow Anatomy 0.000 description 2
- YKAYCWPQDPILSA-UHFFFAOYSA-N bromohydrin pyrophosphate Chemical compound BrCC(O)(C)CCOP(O)(=O)OP(O)(O)=O YKAYCWPQDPILSA-UHFFFAOYSA-N 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 208000018805 childhood acute lymphoblastic leukemia Diseases 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 210000000349 chromosome Anatomy 0.000 description 2
- 229960001265 ciclosporin Drugs 0.000 description 2
- 238000002648 combination therapy Methods 0.000 description 2
- 230000004940 costimulation Effects 0.000 description 2
- 238000005520 cutting process Methods 0.000 description 2
- 229930182912 cyclosporin Natural products 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 210000000805 cytoplasm Anatomy 0.000 description 2
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 2
- 231100000433 cytotoxic Toxicity 0.000 description 2
- 229940127089 cytotoxic agent Drugs 0.000 description 2
- 230000001472 cytotoxic effect Effects 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 102000048124 delta Opioid Receptors Human genes 0.000 description 2
- 229940119744 dextran 40 Drugs 0.000 description 2
- RNPXCFINMKSQPQ-UHFFFAOYSA-N dicetyl hydrogen phosphate Chemical compound CCCCCCCCCCCCCCCCOP(O)(=O)OCCCCCCCCCCCCCCCC RNPXCFINMKSQPQ-UHFFFAOYSA-N 0.000 description 2
- 230000006806 disease prevention Effects 0.000 description 2
- 210000003743 erythrocyte Anatomy 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 239000013613 expression plasmid Substances 0.000 description 2
- 230000002349 favourable effect Effects 0.000 description 2
- 210000004700 fetal blood Anatomy 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 201000007487 gallbladder carcinoma Diseases 0.000 description 2
- 238000012239 gene modification Methods 0.000 description 2
- 238000001415 gene therapy Methods 0.000 description 2
- 230000005017 genetic modification Effects 0.000 description 2
- 235000013617 genetically modified food Nutrition 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 210000003714 granulocyte Anatomy 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 210000002443 helper t lymphocyte Anatomy 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 230000006058 immune tolerance Effects 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 108091008042 inhibitory receptors Proteins 0.000 description 2
- 230000010354 integration Effects 0.000 description 2
- 229960005386 ipilimumab Drugs 0.000 description 2
- FZWBNHMXJMCXLU-BLAUPYHCSA-N isomaltotriose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O)O1 FZWBNHMXJMCXLU-BLAUPYHCSA-N 0.000 description 2
- IPFXNYPSBSIFOB-UHFFFAOYSA-N isopentyl pyrophosphate Chemical compound CC(C)CCO[P@](O)(=O)OP(O)(O)=O IPFXNYPSBSIFOB-UHFFFAOYSA-N 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- 238000001638 lipofection Methods 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 229910001425 magnesium ion Inorganic materials 0.000 description 2
- 230000003211 malignant effect Effects 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 210000003071 memory t lymphocyte Anatomy 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 2
- 238000000520 microinjection Methods 0.000 description 2
- 230000000116 mitigating effect Effects 0.000 description 2
- 238000009126 molecular therapy Methods 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 2
- 201000005962 mycosis fungoides Diseases 0.000 description 2
- 210000000822 natural killer cell Anatomy 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 230000006780 non-homologous end joining Effects 0.000 description 2
- 210000004940 nucleus Anatomy 0.000 description 2
- 230000002611 ovarian Effects 0.000 description 2
- 230000002018 overexpression Effects 0.000 description 2
- 150000003904 phospholipids Chemical class 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 238000004393 prognosis Methods 0.000 description 2
- 208000037821 progressive disease Diseases 0.000 description 2
- 230000005855 radiation Effects 0.000 description 2
- 230000008439 repair process Effects 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 210000003705 ribosome Anatomy 0.000 description 2
- 235000002020 sage Nutrition 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 238000009094 second-line therapy Methods 0.000 description 2
- 238000004088 simulation Methods 0.000 description 2
- 201000000849 skin cancer Diseases 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 210000000130 stem cell Anatomy 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 238000002626 targeted therapy Methods 0.000 description 2
- 238000005809 transesterification reaction Methods 0.000 description 2
- 238000003146 transient transfection Methods 0.000 description 2
- 238000002054 transplantation Methods 0.000 description 2
- 208000022679 triple-negative breast carcinoma Diseases 0.000 description 2
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 2
- 229940121358 tyrosine kinase inhibitor Drugs 0.000 description 2
- 239000005483 tyrosine kinase inhibitor Substances 0.000 description 2
- 206010046766 uterine cancer Diseases 0.000 description 2
- 238000011179 visual inspection Methods 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 239000011701 zinc Substances 0.000 description 2
- 229910052725 zinc Inorganic materials 0.000 description 2
- XRASPMIURGNCCH-UHFFFAOYSA-N zoledronic acid Chemical compound OP(=O)(O)C(P(O)(O)=O)(O)CN1C=CN=C1 XRASPMIURGNCCH-UHFFFAOYSA-N 0.000 description 2
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- VGONTNSXDCQUGY-RRKCRQDMSA-N 2'-deoxyinosine Chemical group C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC2=O)=C2N=C1 VGONTNSXDCQUGY-RRKCRQDMSA-N 0.000 description 1
- RNAMYOYQYRYFQY-UHFFFAOYSA-N 2-(4,4-difluoropiperidin-1-yl)-6-methoxy-n-(1-propan-2-ylpiperidin-4-yl)-7-(3-pyrrolidin-1-ylpropoxy)quinazolin-4-amine Chemical compound N1=C(N2CCC(F)(F)CC2)N=C2C=C(OCCCN3CCCC3)C(OC)=CC2=C1NC1CCN(C(C)C)CC1 RNAMYOYQYRYFQY-UHFFFAOYSA-N 0.000 description 1
- 101710134681 40 kDa protein Proteins 0.000 description 1
- 108020005029 5' Flanking Region Proteins 0.000 description 1
- OGHAROSJZRTIOK-KQYNXXCUSA-O 7-methylguanosine Chemical compound C1=2N=C(N)NC(=O)C=2[N+](C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OGHAROSJZRTIOK-KQYNXXCUSA-O 0.000 description 1
- 102100034571 AT-rich interactive domain-containing protein 1B Human genes 0.000 description 1
- 108020005176 AU Rich Elements Proteins 0.000 description 1
- 241000604451 Acidaminococcus Species 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 229930024421 Adenine Natural products 0.000 description 1
- 241000972680 Adeno-associated virus - 6 Species 0.000 description 1
- 208000036764 Adenocarcinoma of the esophagus Diseases 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108700028369 Alleles Proteins 0.000 description 1
- 241000192542 Anabaena Species 0.000 description 1
- 206010061424 Anal cancer Diseases 0.000 description 1
- 244000303258 Annona diversifolia Species 0.000 description 1
- 235000002198 Annona diversifolia Nutrition 0.000 description 1
- 208000007860 Anus Neoplasms Diseases 0.000 description 1
- 206010073360 Appendix cancer Diseases 0.000 description 1
- 108091023037 Aptamer Proteins 0.000 description 1
- 241000203069 Archaea Species 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- 206010003571 Astrocytoma Diseases 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 241000714230 Avian leukemia virus Species 0.000 description 1
- 101710144268 B- and T-lymphocyte attenuator Proteins 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 229940122361 Bisphosphonate Drugs 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 101001042041 Bos taurus Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial Proteins 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 102100025221 CD70 antigen Human genes 0.000 description 1
- 210000005236 CD8+ effector T cell Anatomy 0.000 description 1
- 101150041972 CDKN2A gene Proteins 0.000 description 1
- 238000010354 CRISPR gene editing Methods 0.000 description 1
- 238000010356 CRISPR-Cas9 genome editing Methods 0.000 description 1
- 241000282832 Camelidae Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 101710190843 Carcinoembryonic antigen-related cell adhesion molecule 1 Proteins 0.000 description 1
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 description 1
- 206010007279 Carcinoid tumour of the gastrointestinal tract Diseases 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 102000011727 Caspases Human genes 0.000 description 1
- 108010076667 Caspases Proteins 0.000 description 1
- ZEOWTGPWHLSLOG-UHFFFAOYSA-N Cc1ccc(cc1-c1ccc2c(n[nH]c2c1)-c1cnn(c1)C1CC1)C(=O)Nc1cccc(c1)C(F)(F)F Chemical compound Cc1ccc(cc1-c1ccc2c(n[nH]c2c1)-c1cnn(c1)C1CC1)C(=O)Nc1cccc(c1)C(F)(F)F ZEOWTGPWHLSLOG-UHFFFAOYSA-N 0.000 description 1
- 101150069156 Cdkn2b gene Proteins 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 206010007953 Central nervous system lymphoma Diseases 0.000 description 1
- 108010035563 Chloramphenicol O-acetyltransferase Proteins 0.000 description 1
- 201000009047 Chordoma Diseases 0.000 description 1
- 108020004638 Circular DNA Proteins 0.000 description 1
- 108091062157 Cis-regulatory element Proteins 0.000 description 1
- 206010052360 Colorectal adenocarcinoma Diseases 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 208000009798 Craniopharyngioma Diseases 0.000 description 1
- 102000004420 Creatine Kinase Human genes 0.000 description 1
- 108010042126 Creatine kinase Proteins 0.000 description 1
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 1
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 230000007018 DNA scission Effects 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 1
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 1
- GZDFHIJNHHMENY-UHFFFAOYSA-N Dimethyl dicarbonate Chemical compound COC(=O)OC(=O)OC GZDFHIJNHHMENY-UHFFFAOYSA-N 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 208000006402 Ductal Carcinoma Diseases 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 101150076616 EPHA2 gene Proteins 0.000 description 1
- 102100035079 ETS-related transcription factor Elf-3 Human genes 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 108010037179 Endodeoxyribonucleases Proteins 0.000 description 1
- 102000011750 Endodeoxyribonucleases Human genes 0.000 description 1
- 241000701867 Enterobacteria phage T7 Species 0.000 description 1
- 206010014967 Ependymoma Diseases 0.000 description 1
- 102100030340 Ephrin type-A receptor 2 Human genes 0.000 description 1
- 206010073064 Epithelioid mesothelioma Diseases 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 208000006168 Ewing Sarcoma Diseases 0.000 description 1
- 102100023593 Fibroblast growth factor receptor 1 Human genes 0.000 description 1
- 101710182386 Fibroblast growth factor receptor 1 Proteins 0.000 description 1
- 102100023600 Fibroblast growth factor receptor 2 Human genes 0.000 description 1
- 101710182389 Fibroblast growth factor receptor 2 Proteins 0.000 description 1
- 102100027842 Fibroblast growth factor receptor 3 Human genes 0.000 description 1
- 101710182396 Fibroblast growth factor receptor 3 Proteins 0.000 description 1
- 102100037362 Fibronectin Human genes 0.000 description 1
- 102000002090 Fibronectin type III Human genes 0.000 description 1
- 108050009401 Fibronectin type III Proteins 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 206010053717 Fibrous histiocytoma Diseases 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 229940126656 GS-4224 Drugs 0.000 description 1
- 206010051066 Gastrointestinal stromal tumour Diseases 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- 208000021309 Germ cell tumor Diseases 0.000 description 1
- 102000001398 Granzyme Human genes 0.000 description 1
- 108060005986 Granzyme Proteins 0.000 description 1
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 1
- XKMLYUALXHKNFT-UUOKFMHZSA-N Guanosine-5'-triphosphate Chemical compound C1=2NC(N)=NC(=O)C=2N=CN1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O XKMLYUALXHKNFT-UUOKFMHZSA-N 0.000 description 1
- 108010074032 HLA-A2 Antigen Proteins 0.000 description 1
- 102000025850 HLA-A2 Antigen Human genes 0.000 description 1
- 102000006354 HLA-DR Antigens Human genes 0.000 description 1
- 108010058597 HLA-DR Antigens Proteins 0.000 description 1
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 1
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 1
- 102000001554 Hemoglobins Human genes 0.000 description 1
- 108010054147 Hemoglobins Proteins 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 101000924255 Homo sapiens AT-rich interactive domain-containing protein 1B Proteins 0.000 description 1
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 1
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 1
- 101000981093 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 1 Proteins 0.000 description 1
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 description 1
- 101000877379 Homo sapiens ETS-related transcription factor Elf-3 Proteins 0.000 description 1
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 1
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 description 1
- 101000960234 Homo sapiens Isocitrate dehydrogenase [NADP] cytoplasmic Proteins 0.000 description 1
- 101000599886 Homo sapiens Isocitrate dehydrogenase [NADP], mitochondrial Proteins 0.000 description 1
- 101000971538 Homo sapiens Killer cell lectin-like receptor subfamily F member 1 Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 101001122114 Homo sapiens NUT family member 1 Proteins 0.000 description 1
- 101000601770 Homo sapiens Protein polybromo-1 Proteins 0.000 description 1
- 101000633784 Homo sapiens SLAM family member 7 Proteins 0.000 description 1
- 101000934346 Homo sapiens T-cell surface antigen CD2 Proteins 0.000 description 1
- 101000795169 Homo sapiens Tumor necrosis factor receptor superfamily member 13C Proteins 0.000 description 1
- 101000994496 Homo sapiens cAMP-dependent protein kinase catalytic subunit alpha Proteins 0.000 description 1
- 101000944219 Homo sapiens cAMP-dependent protein kinase catalytic subunit beta Proteins 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 229920001612 Hydroxyethyl starch Polymers 0.000 description 1
- 206010021042 Hypopharyngeal cancer Diseases 0.000 description 1
- 206010056305 Hypopharyngeal neoplasm Diseases 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 102000012745 Immunoglobulin Subunits Human genes 0.000 description 1
- 108010079585 Immunoglobulin Subunits Proteins 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 description 1
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 description 1
- 102100025390 Integrin beta-2 Human genes 0.000 description 1
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 1
- 102000015271 Intercellular Adhesion Molecule-1 Human genes 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 108090000176 Interleukin-13 Proteins 0.000 description 1
- 108050003558 Interleukin-17 Proteins 0.000 description 1
- 102000013691 Interleukin-17 Human genes 0.000 description 1
- 108010002386 Interleukin-3 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 102000004889 Interleukin-6 Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 206010061252 Intraocular melanoma Diseases 0.000 description 1
- 208000009164 Islet Cell Adenoma Diseases 0.000 description 1
- 102100039905 Isocitrate dehydrogenase [NADP] cytoplasmic Human genes 0.000 description 1
- 102100037845 Isocitrate dehydrogenase [NADP], mitochondrial Human genes 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- 102100021458 Killer cell lectin-like receptor subfamily F member 1 Human genes 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 1
- 241000904817 Lachnospiraceae bacterium Species 0.000 description 1
- 101150030213 Lag3 gene Proteins 0.000 description 1
- 201000005099 Langerhans cell histiocytosis Diseases 0.000 description 1
- 206010061523 Lip and/or oral cavity cancer Diseases 0.000 description 1
- 206010073099 Lobular breast carcinoma in situ Diseases 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 102100020862 Lymphocyte activation gene 3 protein Human genes 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 208000006644 Malignant Fibrous Histiocytoma Diseases 0.000 description 1
- 206010073059 Malignant neoplasm of unknown primary site Diseases 0.000 description 1
- 206010064912 Malignant transformation Diseases 0.000 description 1
- 208000032271 Malignant tumor of penis Diseases 0.000 description 1
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 208000002030 Merkel cell carcinoma Diseases 0.000 description 1
- 206010027480 Metastatic malignant melanoma Diseases 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 241000713333 Mouse mammary tumor virus Species 0.000 description 1
- 208000003445 Mouth Neoplasms Diseases 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 241000714177 Murine leukemia virus Species 0.000 description 1
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 1
- 108060008487 Myosin Proteins 0.000 description 1
- 102000003505 Myosin Human genes 0.000 description 1
- 108091008877 NK cell receptors Proteins 0.000 description 1
- 206010028767 Nasal sinus cancer Diseases 0.000 description 1
- 208000001894 Nasopharyngeal Neoplasms Diseases 0.000 description 1
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 1
- 102000010648 Natural Killer Cell Receptors Human genes 0.000 description 1
- 102100028749 Neuritin Human genes 0.000 description 1
- 101710189685 Neuritin Proteins 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 206010029266 Neuroendocrine carcinoma of the skin Diseases 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 206010030137 Oesophageal adenocarcinoma Diseases 0.000 description 1
- 208000000160 Olfactory Esthesioneuroblastoma Diseases 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 206010031096 Oropharyngeal cancer Diseases 0.000 description 1
- 206010057444 Oropharyngeal neoplasm Diseases 0.000 description 1
- 208000007571 Ovarian Epithelial Carcinoma Diseases 0.000 description 1
- 240000007019 Oxalis corniculata Species 0.000 description 1
- 239000012661 PARP inhibitor Substances 0.000 description 1
- 239000012270 PD-1 inhibitor Substances 0.000 description 1
- 239000012668 PD-1-inhibitor Substances 0.000 description 1
- 239000012271 PD-L1 inhibitor Substances 0.000 description 1
- 206010061332 Paraganglion neoplasm Diseases 0.000 description 1
- 208000030852 Parasitic disease Diseases 0.000 description 1
- 208000000821 Parathyroid Neoplasms Diseases 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 208000002471 Penile Neoplasms Diseases 0.000 description 1
- 206010034299 Penile cancer Diseases 0.000 description 1
- 108010077524 Peptide Elongation Factor 1 Proteins 0.000 description 1
- 108010056995 Perforin Proteins 0.000 description 1
- KHGNFPUMBJSZSM-UHFFFAOYSA-N Perforine Natural products COC1=C2CCC(O)C(CCC(C)(C)O)(OC)C2=NC2=C1C=CO2 KHGNFPUMBJSZSM-UHFFFAOYSA-N 0.000 description 1
- 208000009565 Pharyngeal Neoplasms Diseases 0.000 description 1
- 206010034811 Pharyngeal cancer Diseases 0.000 description 1
- 241000709664 Picornaviridae Species 0.000 description 1
- 208000007913 Pituitary Neoplasms Diseases 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 208000002151 Pleural effusion Diseases 0.000 description 1
- 201000008199 Pleuropulmonary blastoma Diseases 0.000 description 1
- 229940121906 Poly ADP ribose polymerase inhibitor Drugs 0.000 description 1
- 108010039918 Polylysine Proteins 0.000 description 1
- 102000015623 Polynucleotide Adenylyltransferase Human genes 0.000 description 1
- 108010024055 Polynucleotide adenylyltransferase Proteins 0.000 description 1
- 102000003923 Protein Kinase C Human genes 0.000 description 1
- 108090000315 Protein Kinase C Proteins 0.000 description 1
- 102100037516 Protein polybromo-1 Human genes 0.000 description 1
- 108020005161 RNA Caps Proteins 0.000 description 1
- 108010065868 RNA polymerase SP6 Proteins 0.000 description 1
- 238000011529 RT qPCR Methods 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 208000015634 Rectal Neoplasms Diseases 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 241000712907 Retroviridae Species 0.000 description 1
- 208000008938 Rhabdoid tumor Diseases 0.000 description 1
- 206010073334 Rhabdoid tumour Diseases 0.000 description 1
- 108090000638 Ribonuclease R Proteins 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- 102100029198 SLAM family member 7 Human genes 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 108091061939 Selfish DNA Proteins 0.000 description 1
- 208000002669 Sex Cord-Gonadal Stromal Tumors Diseases 0.000 description 1
- 208000009359 Sezary Syndrome Diseases 0.000 description 1
- 208000021388 Sezary disease Diseases 0.000 description 1
- 102000010841 Signaling Lymphocytic Activation Molecule Family Human genes 0.000 description 1
- 108010062314 Signaling Lymphocytic Activation Molecule Family Proteins 0.000 description 1
- 108010074687 Signaling Lymphocytic Activation Molecule Family Member 1 Proteins 0.000 description 1
- 102000008115 Signaling Lymphocytic Activation Molecule Family Member 1 Human genes 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 102000015215 Stem Cell Factor Human genes 0.000 description 1
- 108010039445 Stem Cell Factor Proteins 0.000 description 1
- 230000006052 T cell proliferation Effects 0.000 description 1
- 229940046176 T-cell checkpoint inhibitor Drugs 0.000 description 1
- 239000012644 T-cell checkpoint inhibitor Substances 0.000 description 1
- 206010042971 T-cell lymphoma Diseases 0.000 description 1
- 208000027585 T-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 101710137500 T7 RNA polymerase Proteins 0.000 description 1
- QJJXYPPXXYFBGM-LFZNUXCKSA-N Tacrolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1\C=C(/C)[C@@H]1[C@H](C)[C@@H](O)CC(=O)[C@H](CC=C)/C=C(C)/C[C@H](C)C[C@H](OC)[C@H]([C@H](C[C@H]2C)OC)O[C@@]2(O)C(=O)C(=O)N2CCCC[C@H]2C(=O)O1 QJJXYPPXXYFBGM-LFZNUXCKSA-N 0.000 description 1
- 206010043276 Teratoma Diseases 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- 241000270666 Testudines Species 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 210000004241 Th2 cell Anatomy 0.000 description 1
- 108010022394 Threonine synthase Proteins 0.000 description 1
- 206010043515 Throat cancer Diseases 0.000 description 1
- 201000009365 Thymic carcinoma Diseases 0.000 description 1
- 102000006601 Thymidine Kinase Human genes 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 102000005497 Thymidylate Synthase Human genes 0.000 description 1
- 108091028113 Trans-activating crRNA Proteins 0.000 description 1
- 102100037116 Transcription elongation factor 1 homolog Human genes 0.000 description 1
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 1
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000044209 Tumor Suppressor Genes Human genes 0.000 description 1
- 108700025716 Tumor Suppressor Genes Proteins 0.000 description 1
- 102100040247 Tumor necrosis factor Human genes 0.000 description 1
- 102100029690 Tumor necrosis factor receptor superfamily member 13C Human genes 0.000 description 1
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 description 1
- 101150049278 US20 gene Proteins 0.000 description 1
- 208000015778 Undifferentiated pleomorphic sarcoma Diseases 0.000 description 1
- 208000023915 Ureteral Neoplasms Diseases 0.000 description 1
- 206010046392 Ureteric cancer Diseases 0.000 description 1
- 206010046431 Urethral cancer Diseases 0.000 description 1
- 206010046458 Urethral neoplasms Diseases 0.000 description 1
- 201000005969 Uveal melanoma Diseases 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 208000004354 Vulvar Neoplasms Diseases 0.000 description 1
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 1
- 208000008383 Wilms tumor Diseases 0.000 description 1
- ATBOMIWRCZXYSZ-XZBBILGWSA-N [1-[2,3-dihydroxypropoxy(hydroxy)phosphoryl]oxy-3-hexadecanoyloxypropan-2-yl] (9e,12e)-octadeca-9,12-dienoate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(COP(O)(=O)OCC(O)CO)OC(=O)CCCCCCC\C=C\C\C=C\CCCCC ATBOMIWRCZXYSZ-XZBBILGWSA-N 0.000 description 1
- 239000000370 acceptor Substances 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 229960000643 adenine Drugs 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 208000020990 adrenal cortex carcinoma Diseases 0.000 description 1
- 208000007128 adrenocortical carcinoma Diseases 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 230000016571 aggressive behavior Effects 0.000 description 1
- 208000012761 aggressive behavior Diseases 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 150000001299 aldehydes Chemical class 0.000 description 1
- 229960000548 alemtuzumab Drugs 0.000 description 1
- 229960004343 alendronic acid Drugs 0.000 description 1
- 150000001338 aliphatic hydrocarbons Chemical class 0.000 description 1
- 125000000266 alpha-aminoacyl group Chemical group 0.000 description 1
- 108010087408 alpha-beta T-Cell Antigen Receptors Proteins 0.000 description 1
- 102000006707 alpha-beta T-Cell Antigen Receptors Human genes 0.000 description 1
- AWUCVROLDVIAJX-UHFFFAOYSA-N alpha-glycerophosphate Natural products OCC(O)COP(O)(O)=O AWUCVROLDVIAJX-UHFFFAOYSA-N 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 150000001414 amino alcohols Chemical class 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000003432 anti-folate effect Effects 0.000 description 1
- 229940127074 antifolate Drugs 0.000 description 1
- 239000013059 antihormonal agent Substances 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 201000011165 anus cancer Diseases 0.000 description 1
- 208000021780 appendiceal neoplasm Diseases 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000000823 artificial membrane Substances 0.000 description 1
- 239000010425 asbestos Substances 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 229950002916 avelumab Drugs 0.000 description 1
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 1
- 229960002170 azathioprine Drugs 0.000 description 1
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 1
- 108010028263 bacteriophage T3 RNA polymerase Proteins 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 208000001119 benign fibrous histiocytoma Diseases 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 239000003012 bilayer membrane Substances 0.000 description 1
- 210000000013 bile duct Anatomy 0.000 description 1
- 208000026900 bile duct neoplasm Diseases 0.000 description 1
- 210000003445 biliary tract Anatomy 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 238000005842 biochemical reaction Methods 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 238000010170 biological method Methods 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 230000002051 biphasic effect Effects 0.000 description 1
- 150000004663 bisphosphonates Chemical class 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 201000008274 breast adenocarcinoma Diseases 0.000 description 1
- 201000005389 breast carcinoma in situ Diseases 0.000 description 1
- 229960005520 bryostatin Drugs 0.000 description 1
- MJQUEDHRCUIRLF-TVIXENOKSA-N bryostatin 1 Chemical compound C([C@@H]1CC(/[C@@H]([C@@](C(C)(C)/C=C/2)(O)O1)OC(=O)/C=C/C=C/CCC)=C\C(=O)OC)[C@H]([C@@H](C)O)OC(=O)C[C@H](O)C[C@@H](O1)C[C@H](OC(C)=O)C(C)(C)[C@]1(O)C[C@@H]1C\C(=C\C(=O)OC)C[C@H]\2O1 MJQUEDHRCUIRLF-TVIXENOKSA-N 0.000 description 1
- MUIWQCKLQMOUAT-AKUNNTHJSA-N bryostatin 20 Natural products COC(=O)C=C1C[C@@]2(C)C[C@]3(O)O[C@](C)(C[C@@H](O)CC(=O)O[C@](C)(C[C@@]4(C)O[C@](O)(CC5=CC(=O)O[C@]45C)C(C)(C)C=C[C@@](C)(C1)O2)[C@@H](C)O)C[C@H](OC(=O)C(C)(C)C)C3(C)C MUIWQCKLQMOUAT-AKUNNTHJSA-N 0.000 description 1
- 230000000981 bystander Effects 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 102100032791 cAMP-dependent protein kinase catalytic subunit alpha Human genes 0.000 description 1
- 102100033065 cAMP-dependent protein kinase catalytic subunit beta Human genes 0.000 description 1
- 239000003710 calcium ionophore Substances 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 230000009702 cancer cell proliferation Effects 0.000 description 1
- 230000009400 cancer invasion Effects 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 230000021164 cell adhesion Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 239000002458 cell surface marker Substances 0.000 description 1
- 229940030156 cell vaccine Drugs 0.000 description 1
- 230000007969 cellular immunity Effects 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 201000011633 childhood acute lymphocytic leukemia Diseases 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 238000012761 co-transfection Methods 0.000 description 1
- 206010009887 colitis Diseases 0.000 description 1
- 238000001246 colloidal dispersion Methods 0.000 description 1
- 239000000084 colloidal system Substances 0.000 description 1
- 201000010989 colorectal carcinoma Diseases 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 230000003750 conditioning effect Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 238000005138 cryopreservation Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 1
- 208000017763 cutaneous neuroendocrine carcinoma Diseases 0.000 description 1
- ATDGTVJJHBUTRL-UHFFFAOYSA-N cyanogen bromide Chemical compound BrC#N ATDGTVJJHBUTRL-UHFFFAOYSA-N 0.000 description 1
- 210000001096 cystic duct Anatomy 0.000 description 1
- 102000003675 cytokine receptors Human genes 0.000 description 1
- 108010057085 cytokine receptors Proteins 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 229940104302 cytosine Drugs 0.000 description 1
- 230000003436 cytoskeletal effect Effects 0.000 description 1
- 239000000824 cytostatic agent Substances 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 239000002254 cytotoxic agent Substances 0.000 description 1
- 231100000599 cytotoxic agent Toxicity 0.000 description 1
- 238000011393 cytotoxic chemotherapy Methods 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 230000000779 depleting effect Effects 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 229940093541 dicetylphosphate Drugs 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- BPHQZTVXXXJVHI-UHFFFAOYSA-N dimyristoyl phosphatidylglycerol Chemical compound CCCCCCCCCCCCCC(=O)OCC(COP(O)(=O)OCC(O)CO)OC(=O)CCCCCCCCCCCCC BPHQZTVXXXJVHI-UHFFFAOYSA-N 0.000 description 1
- 235000011180 diphosphates Nutrition 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 210000003515 double negative t cell Anatomy 0.000 description 1
- 238000009509 drug development Methods 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 238000013399 early diagnosis Methods 0.000 description 1
- 229960000284 efalizumab Drugs 0.000 description 1
- 229940121647 egfr inhibitor Drugs 0.000 description 1
- 208000014616 embryonal neoplasm Diseases 0.000 description 1
- 210000001671 embryonic stem cell Anatomy 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 238000005538 encapsulation Methods 0.000 description 1
- 201000003914 endometrial carcinoma Diseases 0.000 description 1
- 208000018463 endometrial serous adenocarcinoma Diseases 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 230000008029 eradication Effects 0.000 description 1
- 229960001433 erlotinib Drugs 0.000 description 1
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 1
- 208000028653 esophageal adenocarcinoma Diseases 0.000 description 1
- 208000032099 esthesioneuroblastoma Diseases 0.000 description 1
- CJAONIOAQZUHPN-KKLWWLSJSA-N ethyl 12-[[2-[(2r,3r)-3-[2-[(12-ethoxy-12-oxododecyl)-methylamino]-2-oxoethoxy]butan-2-yl]oxyacetyl]-methylamino]dodecanoate Chemical compound CCOC(=O)CCCCCCCCCCCN(C)C(=O)CO[C@H](C)[C@@H](C)OCC(=O)N(C)CCCCCCCCCCCC(=O)OCC CJAONIOAQZUHPN-KKLWWLSJSA-N 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 238000011124 ex vivo culture Methods 0.000 description 1
- 201000008819 extrahepatic bile duct carcinoma Diseases 0.000 description 1
- 208000024519 eye neoplasm Diseases 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 238000009093 first-line therapy Methods 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 239000004052 folic acid antagonist Substances 0.000 description 1
- 229940001490 fosamax Drugs 0.000 description 1
- 239000012595 freezing medium Substances 0.000 description 1
- 238000002825 functional assay Methods 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 108010062214 gamma-delta T-Cell Antigen Receptors Proteins 0.000 description 1
- 102000011778 gamma-delta T-Cell Antigen Receptors Human genes 0.000 description 1
- 201000006585 gastric adenocarcinoma Diseases 0.000 description 1
- 208000010749 gastric carcinoma Diseases 0.000 description 1
- 201000011243 gastrointestinal stromal tumor Diseases 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- 238000012246 gene addition Methods 0.000 description 1
- 238000012215 gene cloning Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 208000003884 gestational trophoblastic disease Diseases 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 229930004094 glycosylphosphatidylinositol Natural products 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 108010033706 glycylserine Proteins 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical class O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 1
- 229940029575 guanosine Drugs 0.000 description 1
- 230000003394 haemopoietic effect Effects 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 201000010235 heart cancer Diseases 0.000 description 1
- 208000024348 heart neoplasm Diseases 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 210000003494 hepatocyte Anatomy 0.000 description 1
- 229940064366 hespan Drugs 0.000 description 1
- 201000008298 histiocytosis Diseases 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 201000006866 hypopharynx cancer Diseases 0.000 description 1
- 230000008004 immune attack Effects 0.000 description 1
- 230000008629 immune suppression Effects 0.000 description 1
- 230000037189 immune system physiology Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 238000011532 immunohistochemical staining Methods 0.000 description 1
- 230000004957 immunoregulator effect Effects 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 229940125721 immunosuppressive agent Drugs 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000010874 in vitro model Methods 0.000 description 1
- 210000004263 induced pluripotent stem cell Anatomy 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 230000017730 intein-mediated protein splicing Effects 0.000 description 1
- 108010074108 interleukin-21 Proteins 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 230000002601 intratumoral effect Effects 0.000 description 1
- 201000002529 islet cell tumor Diseases 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 210000000244 kidney pelvis Anatomy 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 238000011813 knockout mouse model Methods 0.000 description 1
- 229940045426 kymriah Drugs 0.000 description 1
- 231100000225 lethality Toxicity 0.000 description 1
- 108010025001 leukocyte-associated immunoglobulin-like receptor 1 Proteins 0.000 description 1
- 208000012987 lip and oral cavity carcinoma Diseases 0.000 description 1
- 201000011059 lobular neoplasia Diseases 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 201000008443 lung non-squamous non-small cell carcinoma Diseases 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 210000004324 lymphatic system Anatomy 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 201000000564 macroglobulinemia Diseases 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 230000036212 malign transformation Effects 0.000 description 1
- 208000014699 malignant epithelioid mesothelioma Diseases 0.000 description 1
- 208000024407 malignant pericardial mesothelioma Diseases 0.000 description 1
- 208000020984 malignant renal pelvis neoplasm Diseases 0.000 description 1
- 208000026045 malignant tumor of parathyroid gland Diseases 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 210000001806 memory b lymphocyte Anatomy 0.000 description 1
- 208000021039 metastatic melanoma Diseases 0.000 description 1
- 208000037970 metastatic squamous neck cancer Diseases 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 239000011325 microbead Substances 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 206010051747 multiple endocrine neoplasia Diseases 0.000 description 1
- 229940014456 mycophenolate Drugs 0.000 description 1
- 229960000951 mycophenolic acid Drugs 0.000 description 1
- 201000006462 myelodysplastic/myeloproliferative neoplasm Diseases 0.000 description 1
- 210000000066 myeloid cell Anatomy 0.000 description 1
- 210000004296 naive t lymphocyte Anatomy 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 210000003928 nasal cavity Anatomy 0.000 description 1
- 229960005027 natalizumab Drugs 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 201000008026 nephroblastoma Diseases 0.000 description 1
- 230000000926 neurological effect Effects 0.000 description 1
- 239000002547 new drug Substances 0.000 description 1
- 108091027963 non-coding RNA Proteins 0.000 description 1
- 102000042567 non-coding RNA Human genes 0.000 description 1
- 201000008106 ocular cancer Diseases 0.000 description 1
- 201000002575 ocular melanoma Diseases 0.000 description 1
- 229960000572 olaparib Drugs 0.000 description 1
- FAQDUNYVKQKNLD-UHFFFAOYSA-N olaparib Chemical compound FC1=CC=C(CC2=C3[CH]C=CC=C3C(=O)N=N2)C=C1C(=O)N(CC1)CCN1C(=O)C1CC1 FAQDUNYVKQKNLD-UHFFFAOYSA-N 0.000 description 1
- 230000000174 oncolytic effect Effects 0.000 description 1
- 201000006958 oropharynx cancer Diseases 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 208000016632 ovarian clear cell cancer Diseases 0.000 description 1
- 201000003707 ovarian clear cell carcinoma Diseases 0.000 description 1
- 208000022102 pancreatic neuroendocrine neoplasm Diseases 0.000 description 1
- 208000003154 papilloma Diseases 0.000 description 1
- 208000029211 papillomatosis Diseases 0.000 description 1
- 208000007312 paraganglioma Diseases 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 229940121655 pd-1 inhibitor Drugs 0.000 description 1
- 229940121656 pd-l1 inhibitor Drugs 0.000 description 1
- 229930192851 perforin Natural products 0.000 description 1
- 201000004266 pericardial mesothelioma Diseases 0.000 description 1
- 210000005105 peripheral blood lymphocyte Anatomy 0.000 description 1
- 201000002513 peritoneal mesothelioma Diseases 0.000 description 1
- 230000035699 permeability Effects 0.000 description 1
- 208000028591 pheochromocytoma Diseases 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 238000000053 physical method Methods 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 208000010916 pituitary tumor Diseases 0.000 description 1
- 229940081858 plasmalyte a Drugs 0.000 description 1
- 210000004180 plasmocyte Anatomy 0.000 description 1
- 150000003057 platinum Chemical class 0.000 description 1
- 208000024356 pleural disease Diseases 0.000 description 1
- 210000001778 pluripotent stem cell Anatomy 0.000 description 1
- 229920000656 polylysine Polymers 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 208000016800 primary central nervous system lymphoma Diseases 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 239000000186 progesterone Substances 0.000 description 1
- 229960003387 progesterone Drugs 0.000 description 1
- 230000002250 progressing effect Effects 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 102000005912 ran GTP Binding Protein Human genes 0.000 description 1
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 1
- 229940051173 recombinant immunotoxin Drugs 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 206010038038 rectal cancer Diseases 0.000 description 1
- 201000001275 rectum cancer Diseases 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 208000015347 renal cell adenocarcinoma Diseases 0.000 description 1
- 201000007444 renal pelvis carcinoma Diseases 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 230000008521 reorganization Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 238000002271 resection Methods 0.000 description 1
- 238000011268 retreatment Methods 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 229910052895 riebeckite Inorganic materials 0.000 description 1
- OHRURASPPZQGQM-GCCNXGTGSA-N romidepsin Chemical compound O1C(=O)[C@H](C(C)C)NC(=O)C(=C/C)/NC(=O)[C@H]2CSSCC\C=C\[C@@H]1CC(=O)N[C@H](C(C)C)C(=O)N2 OHRURASPPZQGQM-GCCNXGTGSA-N 0.000 description 1
- 229960003452 romidepsin Drugs 0.000 description 1
- OHRURASPPZQGQM-UHFFFAOYSA-N romidepsin Natural products O1C(=O)C(C(C)C)NC(=O)C(=CC)NC(=O)C2CSSCCC=CC1CC(=O)NC(C(C)C)C(=O)N2 OHRURASPPZQGQM-UHFFFAOYSA-N 0.000 description 1
- 108010091666 romidepsin Proteins 0.000 description 1
- 102220058139 rs372082751 Human genes 0.000 description 1
- 102220003351 rs387906411 Human genes 0.000 description 1
- 238000011519 second-line treatment Methods 0.000 description 1
- 238000010187 selection method Methods 0.000 description 1
- 230000001235 sensitizing effect Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000011450 sequencing therapy Methods 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 238000004904 shortening Methods 0.000 description 1
- 230000008054 signal transmission Effects 0.000 description 1
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 1
- 229960002930 sirolimus Drugs 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 201000002314 small intestine cancer Diseases 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 230000000392 somatic effect Effects 0.000 description 1
- 230000037439 somatic mutation Effects 0.000 description 1
- 206010062261 spinal cord neoplasm Diseases 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000011255 standard chemotherapy Methods 0.000 description 1
- 238000011301 standard therapy Methods 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 239000011550 stock solution Substances 0.000 description 1
- 201000000498 stomach carcinoma Diseases 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 206010042863 synovial sarcoma Diseases 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 238000011521 systemic chemotherapy Methods 0.000 description 1
- 229960001967 tacrolimus Drugs 0.000 description 1
- QJJXYPPXXYFBGM-SHYZHZOCSA-N tacrolimus Natural products CO[C@H]1C[C@H](CC[C@@H]1O)C=C(C)[C@H]2OC(=O)[C@H]3CCCCN3C(=O)C(=O)[C@@]4(O)O[C@@H]([C@H](C[C@H]4C)OC)[C@@H](C[C@H](C)CC(=C[C@@H](CC=C)C(=O)C[C@H](O)[C@H]2C)C)OC QJJXYPPXXYFBGM-SHYZHZOCSA-N 0.000 description 1
- DKPFODGZWDEEBT-QFIAKTPHSA-N taxane Chemical class C([C@]1(C)CCC[C@@H](C)[C@H]1C1)C[C@H]2[C@H](C)CC[C@@H]1C2(C)C DKPFODGZWDEEBT-QFIAKTPHSA-N 0.000 description 1
- 229940066453 tecentriq Drugs 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 229950007137 tisagenlecleucel Drugs 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 230000010474 transient expression Effects 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 238000011277 treatment modality Methods 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 230000005740 tumor formation Effects 0.000 description 1
- 230000007306 turnover Effects 0.000 description 1
- 230000004222 uncontrolled growth Effects 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 1
- 201000011294 ureter cancer Diseases 0.000 description 1
- 229940045145 uridine Drugs 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 206010046885 vaginal cancer Diseases 0.000 description 1
- 208000013139 vaginal neoplasm Diseases 0.000 description 1
- 239000012808 vapor phase Substances 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 229940045208 yescarta Drugs 0.000 description 1
- 108010065816 zeta chain antigen T cell receptor Proteins 0.000 description 1
- 229960004276 zoledronic acid Drugs 0.000 description 1
- 229940002005 zometa Drugs 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4632—T-cell receptors [TCR]; antibody T-cell receptor constructs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464466—Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
- A61K39/464468—Mesothelin [MSLN]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
- A61K2239/55—Lung
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
- A61K2239/59—Reproductive system, e.g. uterus, ovaries, cervix or testes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/22—Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Cell Biology (AREA)
- Organic Chemistry (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Microbiology (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Zoology (AREA)
- Oncology (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Disclosed herein are methods for treatment of a mesothelin (MSLN)-expressing cancer in a human subject comprising administration of, e.g., a plurality of anti-MSLN T cell receptor fusion protein (TFP)– expressing T cells. The human subject described herein may have been previously administered with one or more lines of prior therapy before the administration of the plurality of anti-MSLN TFP-expressing T cells.
Description
COMPOSITIONS AND METHODS FOR TREATING CANCER
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of U. S. Provisional Patent Application No. 63/244,969, filed September 16, 2021, which is incorporated herein by reference in its entirety.
BACKGROUND
[0002] Most patients with late-stage solid tumors are incurable with standard therapy. In addition, traditional treatment options often have serious side effects. Numerous attempts have been made to engage a patient’s immune system for rejecting cancerous cells, an approach collectively referred to as cancer immunotherapy. However, several obstacles make it rather difficult to achieve clinical effectiveness. Although hundreds of so-called tumor antigens have been identified, these are often derived from self and thus can direct the cancer immunotherapy against healthy tissue, or are poorly immunogenic. Furthermore, cancer cells use multiple mechanisms to render themselves invisible or hostile to the initiation and propagation of an immune attack by cancer immunotherapies.
[0003] Recent developments using chimeric antigen receptor (CAR) modified autologous T cell therapy, which relies on redirecting genetically engineered T cells to a suitable cell-surface molecule on cancer cells, show promising results in harnessing the power of the immune system to treat B cell malignancies (see, e.g., Sadelain et al., Cancer Discovery 3:388-398 (2013)). The clinical results with CD-19-specific CAR T cells (called CTL019) have shown complete remissions in patients suffering from chronic lymphocytic leukemia (CLL) as well as in childhood acute lymphoblastic leukemia (ALL) (see, e.g., Kalos et al., Sci Transl Med 3 :95ra73 (2011), Porter et al., NEJM 365:725-733 (2011), Grupp et al., NEJM 368: 1509-1518 (2013)). An alternative approach is the use of T cell receptor (TCR) alpha and beta chains selected for a tumor-associated peptide antigen for genetically engineering autologous T cells. These TCR chains will form complete TCR complexes and provide the T cells with a TCR for a second defined specificity. Encouraging results were obtained with engineered autologous T cells expressing NY-ESO-1 -specific TCR alpha and beta chains in patients with synovial carcinoma. [0004] Besides the ability of genetically modified T cells expressing a CAR or a second TCR to recognize and destroy respective target cells in vitro/ex vivo, successful patient therapy with engineered T cells requires the T cells to be capable of strong activation, expansion, persistence over time, and, in case of relapsing disease, to enable a ‘memory’ response. High and manageable clinical efficacy of CAR T cells is currently limited to BCMA- and CD- 19-positive B cell malignancies and to NY-ESO-1 -peptide expressing synovial sarcoma patients expressing HLA-A2. There is a clear need to improve genetically engineered T cells to more broadly act against various human malignancies.
Described herein are novel fusion proteins of TCR subunits, including CD3 epsilon, CD3gamma and CD3 delta, and of TCR alpha and TCR beta chains with binding domains specific for cell surface antigens that have the potential to overcome limitations of existing approaches.
[0005] Cytokine-associated toxicity such as CRS and neurotoxicity have been observed with CAR T- cell therapies (Bonifant et ah, Mol Ther Oncolytics. 2016;3: 16011; Turtle et ah, J Clin Invest. 2016; 126(6):2123-38). For example, existing CAR T-cell therapies are associated with severe CAR T-cell- related toxicides, including cytokine release syndrome (CRS) and neurological events (NEs), that may limit administration to specialized treatment center (Yescarta Risk Evaluation and Mitigation Strategy (REMS) Gilead Pharma September 10, 2019; Kymriah Risk Evaluation and Mitigation Strategy (REMS) Novartis September 10, 2019) and impact use in difficult-to-treat patients. There is a need for CAR T-cell therapies with a favorable benefit/risk profile, that are better tolerated by patients, and that allow for monitoring of adverse events.
SUMMARY
[0006] Provided herein are adoptive cell therapies for treating a cancer that are useful to overcome problems associated with existing CAR T-cell therapies. The adoptive cell therapies and methods of their use provided herein can be better tolerated by patients and can allow for monitoring of adverse events. For example, the adoptive cell therapies and use of such therapies in a low dose or splitdosing schedule provided herein can mitigate the risk of adverse events, such as cytokine-associated toxicity (e.g., CRS and neurotoxicity), and can allow for monitoring of adverse events before a full dosage is administered to a subject.
[0007] Provided herein is a method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising (a) administering to the human subject a first portion of a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti-MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising: (I) a TCR subunit comprising (i) at least a portion of a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain; and (II) an antibody domain comprising an anti-MSLN antigen binding domain and (b) administering a second portion of a dose of transduced anti-MSLN TFP T cells, wherein the second portion of a dose is administered less than 50 days following administration of the first portion of a dose of anti- MSLN TFP T cells, and wherein the first portion of a dose and the second portion of a dose comprise from about 1 x 105 to about 5 x io10 transduced cells/m2.
[0008] Provided herein is a method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising (a) administering to the human subject a first
portion of a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti-MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising: (I) a TCR subunit comprising (i) at least a portion of a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain; and (II) an antibody domain comprising an anti-MSLN antigen binding domain and (b) administering a second portion of a dose of transduced anti-MSLN TFP T cells, wherein the second portion of a dose is administered following administration of the first portion of a dose of anti-MSLN TFP T cells, and wherein the first portion of a dose and the second portion of a dose comprise about one-third to two- thirds of a reference dose, and wherein the reference dose is 1 x 105 to about 5 x io10 transduced cells/m2.
[0009] Provided herein is a method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising (a) administering to the human subject a first portion of a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti-MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising: (I) a TCR subunit comprising (i) at least a portion of a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain; and (II) an antibody domain comprising an anti-MSLN antigen binding domain and (b) administering a second portion of a dose of transduced anti-MSLN TFP T cells, wherein: the human subject elicits an adverse event and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells, or the human subject does not elicit an adverse event that is grade 2 or higher and the second portion of a dose is administered at a second timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells; wherein the first timepoint is longer than the second timepoint.
[0010] Provided herein is a method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising (a) administering to the human subject a first portion of a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti-MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising: (I) a TCR subunit comprising (i) at least a portion of a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain; and (II) an antibody domain comprising an anti-MSLN antigen binding domain and (b) administering a second portion of a dose of transduced anti-MSLN TFP T cells, wherein the second portion of a dose is administered following administration of the first portion of a dose of anti-MSLN TFP T cells, and wherein the first portion of a dose comprises a first number of transduced cells/m2 and wherein the second portion of a dose comprises a second number of transduced cells/m2, wherein the ratio of the
first number of transduced cells/m2 to the second number of transduced cells/m2 is from 1 : 10 to 10: 1, and wherein the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 is not 1 : 1.
[0011] Provided herein is a method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising (a) administering to the human subject a first portion of a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti-MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising: (I) a TCR subunit comprising (i) at least a portion of a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain; and (II) an antibody domain comprising an anti-MSLN antigen binding domain and (b) administering a second portion of a dose of transduced anti-MSLN TFP T cells, wherein the second portion of a dose is administered following administration of the first portion of a dose of anti-MSLN TFP T cells, and wherein the first portion of a dose comprises a first number of transduced cells/m2 and wherein the second portion of a dose comprises a second number of transduced cells/m2, and wherein the method reduces or prevents a risk of adverse event associated with administering a reference dose with a number of transduced cells/m2 equivalent to the sum of the first number of transduced cells/m2 and the second number of transduced cells/m2; wherein each of the first portion of a dose and the second portion of a dose comprise less transduced cells/m2 than the reference dose.
[0012] Provided herein is a method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising administering to the human subject a first dose or first portion of a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti-MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising: (I) a TCR subunit comprising (i) at least a portion of a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain; and (II) an antibody domain comprising an anti-MSLN antigen binding domain, wherein the first dose or the first portion of a dose comprises about 3 * 108 transduced cells/m2.
[0013] In some embodiments, the first number of transduced cells/m2 is different than the second number of transduced cells/m2.
[0014] In some embodiments, the method further comprises administering a second dose or second portion of a dose of transduced anti-MSLN TFP T cells.
[0015] In some embodiments, the first portion of a dose comprise a first number of transduced cells/m2 and wherein the second portion of a dose comprise a second number of transduced cells/m2,
wherein the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 is from 1 : 10 to 10: 1.
[0016] In some embodiments, the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 is not 1 : 1.
[0017] In some embodiments, the first portion of a dose and the second portion of a dose comprise from about one-third to two-thirds of a reference dose, and wherein the reference dose is 1 x 105 to about 5 * 1010 transduced cells/m2.
[0018] In some embodiments, the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 is from 1 :5 to 5: 1 or 1 :3 to 3: 1.
[0019] In some embodiments, the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 is from 1 :2 to 2: 1.
[0020] In some embodiments, the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 is about 1 :2 or about 2: 1.
[0021] In some embodiments, the first portion of a dose and the second portion of a dose comprise from about 1 x 106 to about 5 x io9 transduced cells/m2.
[0022] In some embodiments, the reference dose is from 1 x 106 to about 5 x io9 transduced cells/m2.
[0023] In some embodiments, the second portion of a dose is administered less than 50 days following administration of the first portion of a dose of anti-MSLN TFP T cells.
[0024] In some embodiments, the sum of the first portion of a dose and the second portion of a dose equals a reference dose.
[0025] In some embodiments, the reference dose is from 1 x 106 to about 5 x io9 transduced cells/m2.
[0026] In some embodiments, the reference dose is about I x io' transduced cells/m .
[0027] In some embodiments, the reference dose is about 5 x 107 transduced cells/m2.
[0028] In some embodiments, the reference dose is about 1 x 108 transduced cells/m2.
[0029] In some embodiments, the reference dose is about 3 x 108 transduced cells/m2.
[0030] In some embodiments, the reference dose is about 4 x io8 transduced cells/m2.
[0031] In some embodiments, the reference dose is about 5 x 108 transduced cells/m2.
[0032] In some embodiments, the reference dose is about 1 x io9 transduced cells/m2.
[0033] In some embodiments, the first portion of a dose is about 3.33 x io6 transduced cells/m2.
[0034] In some embodiments, the second portion of a dose is about 6.66 x io6 transduced cells/m2.
[0035] In some embodiments, the first portion of a dose is about 1.66 x io7 transduced cells/m2.
[0036] In some embodiments, the second portion of a dose is about 3.33 x io7 transduced cells/m2.
[0037] In some embodiments, the first portion of a dose is about 3.33 x 107 transduced cells/m2. [0038] In some embodiments, the second portion of a dose is about 6.66 x io7 transduced cells/m2. [0039] In some embodiments, the first portion of a dose is about 1 x 108 transduced cells/m2.
[0040] In some embodiments, the second portion of a dose is about 2 x 108 transduced cells/m2. [0041] In some embodiments, the first portion of a dose is about 1.33 x 108 transduced cells/m2. [0042] In some embodiments, the second portion of a dose is about 2.66 x 108 transduced cells/m2. [0043] In some embodiments, the first portion of a dose is about 1.66 x io8 transduced cells/m2. [0044] In some embodiments, the second portion of a dose is about 3.33 x io7 transduced cells/m2. [0045] In some embodiments, the first portion of a dose is about 3.33 x io8 transduced cells/m2. [0046] In some embodiments, the second portion of a dose is about 6.66 x io8 transduced cells/m2. [0047] In some embodiments, the second portion of a dose is administered less than 10 days following administration of the first portion of a dose of anti-MSLN TFP T cells.
[0048] In some embodiments, the second portion of a dose is administered 7 or fewer days following administration of the first portion of a dose of anti-MSLN TFP T cells.
[0049] In some embodiments, the second portion of a dose is administered at least three days after administering the first portion of a dose.
[0050] In some embodiments, the second portion of a dose is administered three to seven days after administering the first portion of a dose.
[0051] In some embodiments, the second portion of a dose is administered 3 days after administering the first portion of a dose.
[0052] In some embodiments, the second portion of a dose is administered 4 days after administering the first portion of a dose.
[0053] In some embodiments, the second portion of a dose is administered 5 days after administering the first portion of a dose.
[0054] In some embodiments, the second portion of a dose is administered 6 days after administering the first portion of a dose.
[0055] In some embodiments, the second portion of a dose is administered 7 days after administering the first portion of a dose.
[0056] In some embodiments, the human subject does not exhibit any adverse event after administering the first portion of a dose.
[0057] In some embodiments, the human subject exhibits an adverse event after administering the first portion of a dose, and wherein the second portion of a dose is administered at least seven days after administering the first portion of a dose.
[0058] Provided herein is a method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising administering to the human subject a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells comprising a recombinant nucleic acid comprising a sequence encoding a TFP comprising: (I) a TCR subunit comprising (i) at least a portion of a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain; and (II) an antibody domain comprising an anti-MSLN antigen binding domain; wherein the dose of anti-MSLN TFP T cells is about 1 x 108 transduced cells/m2, and wherein the human subject has received at least 5 prior lines of therapy prior to administering the dose.
[0059] In some embodiments, the adverse event is selected from the group consisting of cytokine release syndrome (CRS), neurotoxicity, severe CRS (sCRS), CAR T cell-related encephalopathy syndrome (CRES) or immune effector cell-associated neurotoxicity syndrome (ICANS), Central Nervous System (CNS) toxicity, tumor lysis syndrome (TLS), an infusion reaction, cytopenia, cardiac toxicity, hypogammaglobulinemia, graft-versus-host-disease and any combination thereof. [0060] In some embodiments, the adverse event is selected from the group consisting of cytokine release syndrome and neurotoxicity.
[0061] In some embodiments, the adverse event is > grade 3 cytokine release syndrome and/or > grade 2 neurotoxicity.
[0062] In some embodiments, the human subject exhibits an adverse event and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti- MSLN TFP T cells, wherein the first timepoint is longer than the second timepoint.
[0063] In some embodiments, the human subject exhibits an adverse event that is grade 1 or lower and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells.
[0064] In some embodiments, the human subject exhibits an adverse event that is grade 1 or higher and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells.
[0065] In some embodiments, the human subject exhibits an adverse event that is grade 2 or higher and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells.
[0066] In some embodiments, the human subject exhibits an adverse event that is grade 3 or higher and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells.
[0067] In some embodiments, the first timepoint is more than 7 days after the first portion of a dose is administered.
[0068] In some embodiments, the human subject does not exhibit an adverse event that is grade 2 or higher and the second portion of a dose is administered at a second timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells, wherein the first timepoint is longer than the second timepoint.
[0069] In some embodiments, the human subject does not exhibit an adverse event that is grade 3 or higher and the second portion of a dose is administered at a second timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells.
[0070] In some embodiments, the human subject exhibits an adverse event that is grade 1 or lower and the second portion of a dose is administered at a second timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells.
[0071] In some embodiments, the second timepoint is 7 days or less after the first portion of a dose is administered.
[0072] In some embodiments, the second timepoint is after the adverse event is no longer exhibited by the subject.
[0073] In some embodiments, the second timepoint is after the adverse event exhibited by the subject is grade 1 or less.
[0074] In some embodiments, the method reduces or prevents a risk of adverse event associated with administering a dose with an amount equivalent to the sum of the amount of the first portion of a dose plus the second portion of a dose.
[0075] In some embodiments, the adverse event comprises bacterial or fungal infection, tumor lysis syndrome, cytokine release syndrome, neurotoxicity, infusion reactions, cytopenias, cardiac toxicity, hypogammaglobulinemia or graft-versus-host disease.
[0076] In some embodiments, the human subject has or has not received one or more lines of prior therapy prior to administering the first portion of a dose.
[0077] In some embodiments, the one or more lines of prior therapy comprises surgery, chemotherapy, hormonal therapy, biological therapy, antibody therapy, radiation therapy, systemic therapy, or any combinations thereof.
[0078] In some embodiments, the human subject has or has not received a lymphodepleting chemotherapy regimen prior to administering the first portion of a dose.
[0079] In some embodiments, the method further comprises administering a lymphodepleting chemotherapy regimen to the human subject prior to administering the first portion of a dose.
[0080] In some embodiments, the lymphodepleting chemotherapy regimen comprises administration of about four doses of fludarabine and about three doses of cyclophosphamide.
[0081] In some embodiments, the lymphodepleting chemotherapy regimen comprises administration of four doses of fludarabine and three doses of cyclophosphamide.
[0082] In some embodiments, the lymphodepleting chemotherapy regimen comprises administration of fludarabine at a level of about 30 mg/m2/day on days -7 through -4 relative to administration of the first portion of a dose of anti-MSLN TFP T cells, and further comprises administration of cyclophosphamide at a level of about 600 mg/m2/day on days -6 through -4 relative to administration of the first portion of a dose of anti-MSLN TFP T cells.
[0083] In some embodiments, the lymphodepleting chemotherapy regimen comprises administration of fludarabine at a level of 30 mg/m2/day on days -7 through -4 relative to administration of the first portion of a dose of anti-MSLN TFP T cells, and further comprises administration of cyclophosphamide at a level of 600 mg/m2/day on days -6 through -4 relative to administration of the first portion of a dose of anti-MSLN TFP T cells.
[0084] In some embodiments, the TCR subunit and the anti-MSLN antigen binding domain are operatively linked.
[0085] In some embodiments, the TFP functionally interacts with an endogenous TCR complex in the T cell.
[0086] In some embodiments, the antibody domain is a murine, human or humanized antibody domain.
[0087] In some embodiments, the anti-MSLN binding domain is a scFv or a VHH domain.
[0088] In some embodiments, the anti-MSLN binding domain comprises a heavy chain variable domain having at least 80%, at least 85%, at least 90%, at least 95% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 46 or SEQ ID NO: 47.
[0089] In some embodiments, the anti-MSLN binding domain is a VHH domain.
[0090] In some embodiments, the TFP includes an extracellular domain of a TCR subunit that comprises an extracellular domain or portion thereof of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, TCR gamma chain, a TCR delta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications.
[0091] In some embodiments, the TFP includes a transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, TCR gamma chain, a TCR delta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR
subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications.
[0092] In some embodiments, the TCR intracellular domain comprises an intracellular domain of TCR alpha, TCR beta, TCR delta, or TCR gamma, or an amino acid sequence having at least one modification thereto.
[0093] In some embodiments, the TCR intracellular domain comprises a stimulatory domain from an intracellular signaling domain of CD3 gamma, CD3 delta, or CD3 epsilon, or an amino acid sequence having at least one modification thereto.
[0094] In some embodiments, the antibody domain is connected to the TCR extracellular domain by a linker sequence.
[0095] In some embodiments, the linker sequence is 120 amino acids in length or less.
[0096] In some embodiments, the linker sequence comprises (G4S)n, wherein G is glycine, S is serine, and n is an integer from 1 to 10, e.g., 1 to 4.
[0097] In some embodiments, at least two or three of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular do-main are from a same TCR subunit.
[0098] In some embodiments, at least two of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain are from the same TCR subunit.
[0099] In some embodiments, at least two of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain are from CD3 epsilon.
[00100] In some embodiments, at least two of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain are from CD3 delta.
[00101] In some embodiments, at least of two of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain are from CD3 gamma.
[00102] In some embodiments, all three of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain are from the same TCR subunit.
[00103] In some embodiments, the TCR subunit comprises the amino acid sequence of SEQ ID NO:
49.
[00104] In some embodiments, the TCR subunit comprises the amino acid sequence of SEQ ID NO:
50.
[00105] In some embodiments, the TCR subunit comprises the amino acid sequence of SEQ ID NO:
51.
[00106] In some embodiments, the TFP comprises the amino acid sequence of SEQ ID NO: 52.
[00107] In some embodiments, the anti-MSLN TFP T cells are human T cells.
[00108] In some embodiments, the anti-MSLN TFP T cells are CD8+ T cells or CD4+ T cells.
[00109] In some embodiments, the anti-MSLN TFP T cells are alpha beta T cells or gamma delta T cells.
[00110] In some embodiments, the anti-MSLN TFP T cells are autologous or allogeneic T cells.
[00111] In some embodiments, the method further comprises obtaining a population of cells from the human subject prior to administering the first portion of a dose of the anti-MSLN TFP T cells, and transducing T cells from the population of cells with a recombinant nucleic acid comprising a sequence encoding the TFP, thereby generating the anti-MSLN TFP T cells.
[00112] In some embodiments, the method further comprises identifying the human subject as having a MSLN-expressing cancer.
[00113] In some embodiments, the method does not induce cytokine release syndrome (CRS) above grade 1, above grade 2, or above grade 3.
[00114] In some embodiments, the MSLN-expressing cancer is mesothelioma.
[00115] In some embodiments, the MSLN-expressing cancer is malignant pleural mesothelioma (MPM).
[00116] In some embodiments, the MSLN-expressing cancer is ovarian adenocarcinoma.
[00117] In some embodiments, the MSLN-expressing cancer is cholangiocarcinoma.
[00118] In some embodiments, the MSLN-expressing cancer is non-small cell lung cancer (NSCLC).
[00119] In some embodiments, the MSLN-expressing cancer is selected from the group consisting of squamous carcinoma, adenocarcinoma, sarcomata, endometrial cancer, breast cancer, ovarian cancer, cervical cancer, fallopian tube cancer, primary peritoneal cancer, colon cancer, colorectal cancer, melanoma, renal cell carcinoma, lung cancer, non-small cell lung cancer, stomach cancer, bladder cancer, gall bladder cancer, liver cancer, thyroid cancer, laryngeal cancer, salivary gland cancer, esophageal cancer, head and neck cancer, glioblastoma, glioma, prostate cancer, pancreatic cancer, mesothelioma, sarcoma, hematological cancer, leukemia, lymphoma, neuroma, and any combinations thereof.
[00120] In some embodiments, the method comprises administering one or more additional doses of anti-MSLN TFP T cells after the second portion of a dose.
[00121] In some embodiments, the anti-MSLN TFP T cells are administered via intravenous infusion.
[00122] In some embodiments, the human subject is at risk of recurrence.
[00123] In some embodiments, the human subject has a prior history of recurrence after a prior therapy.
[00124] In some embodiments, the MSLN-expressing cancer is locally advanced.
[00125] In some embodiments, the MSLN-expressing cancer is metastatic.
[00126] Provided herein is a method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising: administering to the human subject a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells comprising a recombinant nucleic acid comprising a sequence encoding a TFP comprising: (I) a TCR subunit comprising (i) at least a portion of a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain; and (II) an antibody domain comprising an anti-MSLN antigen binding domain; wherein the dose of anti-MSLN TFP T cells is about 1 x 108 transduced cells/m2, and wherein the human subject has received at least 5 prior lines of therapy prior to administering the dose.
INCORPORATION BY REFERENCE
[00127] All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference.
BRIEF DESCRIPTION OF THE DRAWINGS
[00128] The novel features of the invention are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:
[00129] Figure 1 is a graph showing tumor regression in 16 of the study participants described in Example 3.
[00130] Figure 2 shows the response of Subject 2 to treatment with TC-210. Imaging data is on the left and soluble mesothelin and MPF levels following treatment are on the right.
[00131] Figure 3 shows imaging data of tumors in Subject 3 following treatment with TC-210. [00132] Figure 4 shows imaging data of tumors in Subject 4 following treatment with TC-210. [00133] Figure 5 shows imaging data of tumors in Subject 5 following treatment with TC-210. [00134] Figure 6 shows imaging data of tumors in Subject 14 following treatment with TC-210. [00135] Figure 7 shows imaging data of tumors in Subject 15 following treatment with TC-210. [00136] Figure 8 is a graph showing the subject response and follow up for the subjects described in Example 3.
[00137] Figure 9 is a series of graphs showing T cell expansion in subjects treated with TC-210.
[00138] Figure 10 is a series of graphs showing overall survival and progression free survival of subjects treated with TC-210.
[00139] Figure 11 is a graph showing tumor regression in 30 study participants described in Example 4.
[00140] Figure 12 is a graph showing tumor regression in the 22 mesothelioma patients.
[00141] Figure 13 is a graph showing tumor regression in the 7 ovarian cancer patients.
[00142] Figure 14 shows the overall survival and progression free survival in mesothelioma patients. [00143] Figure 15 shows TC-210 T Cell expansion in peripheral blood by qPCR. * indicates the patients for which no LD was performed.
[00144] Figure 16 shows the peak IL-6 (left panel) and IFNy (right panel) induction post TC-210 infusion.
[00145] Figure 17 is a set of bar graphs showing the change in soluble mesothelin-related peptide (SMRP, left panel) or megakaryocyte potentiating factor (MPF, right panel) in the circulating blood of patients compared to baseline levels prior to TC-210 administration. PR = partial response; SD = stable disease; PD = progressive disease.
DETAILED DESCRIPTION
[00146] Described herein are methods of adoptive cell therapy for treating a cancer, e.g., a mesothelin- expressing cancer, using TFP molecules direct to mesothelin-expressing tumor cells.
[00147] Unless otherwise defined, all terms of art, notations and other scientific terminology used herein are intended to have the meanings commonly understood by those of skill in the art to which this invention pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a difference over what is generally understood in the art. The techniques and procedures described or referenced herein are generally well understood and commonly employed using conventional methodologies by those skilled in the art, such as, for example, the widely utilized molecular cloning methodologies described in Sambrook et al., Molecular Cloning: A Laboratory Manual 4th ed. (2012) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY. As appropriate, procedures involving the use of commercially available kits and reagents are generally carried out in accordance with manufacturer-defined protocols and conditions unless otherwise noted.
Adoptive T cell Therapy
[00148] Adoptive T cell therapy (ACT) is a therapeutic modality that involves the manipulation of a cancer patient’s own T cells to endow them with anti -tumor activity. This is accomplished through the
collection, ex vivo activation, modification and expansion, and re-infusion into the patient. The objective of the process is the generation of potent and cancer antigen-specific T cell immunity. Tumor-associated antigens can be classified into 3 major groups:
1. Antigens present in healthy tissue but over-expressed in tumors, usually because they confer a growth advantage to the cancer cell.
2. Neo-antigens arising from somatic mutations in cancer cells.
3. Cancer germline antigens, which are proteins expressed on germline cells, which reside in immunoprivileged sites, and therefore are not vulnerable to autoimmune T cell targeting.
[00149] The first successful application of ACT was the use of tumor infiltrating lymphocytes (TILs), which rendered clinical responses in approximately 50% of patient with malignant melanoma (Topalian et. al., 1988). The wide applicability of this therapeutic modality was hindered by the requisite surgery to procure tissue from which to isolate TILs, the difficulties in successfully isolating and expanding TILs, and the difficulty in reproducing similar results in other malignancies. Genetransfer-based strategies were developed to overcome the immune tolerance on the tumor-specific T cell repertoire. These approaches redirect T cells to effectively target tumor antigens through the transfer of affinity-optimized T cell receptors (TCRs) or synthetic chimeric antigen receptors (CARs) via retrovirus- or lentivirus-based stable transduction. The CAR T cells represent the most extensively characterized ACT platform. CAR T cells are autologous T cells that have been re-programmed to target surface-expressed cancer associated antigens, typically through the inclusion of a single chain antibody variable fragment (scFv). These binding domains are fused to co-stimulatory domains as well as the CD3(^ chain and subsequently transfected into autologous T cells using viral or non-viral transduction processes. Upon binding to its cognate antigen, CAR T phosphorylates the immunoreceptor tyrosine-based activation motifs (IT AMs) within the CD3 zeta chain. This serves as the initiating T cell activation signal and is critical for CAR T mediated lysis of tumor antigens. Concurrently, scFv binding also stimulates the fused co-simulation domains (usually CD28 or 4-1BB) which provide important expansion and survival signals. Two CD19-directed CAR T cell approaches were approved in 2017 by FDA for the treatment of patients with either pediatric acute lymphoblastic leukemia (ALL) or diffuse large B-cell lymphoma (DLBCL), respectively: tisagenlecleucel (Kymriah™) and axicabtagene cileucel (Yescarta™) (CBER, 2017a; CBER 2017b). The former was also approved by FDA in 2018 for the treatment of patients with relapsed/refractory DLBCL. Notwithstanding this activity in hematological malignancies, CAR T cells have failed to induce significant clinical efficacy against solid cancers, largely due to T cell exhaustion and very limited persistence. By utilizing only 1 (CD3(^ chain) of the 6 distinct T cell receptor subunits in combination with a costimulatory domain, CARs operate outside of the natural TCR signaling complex. The failure
to initiate and harness a complete TCR response is arguably a primary underlying factor preventing CAR T cell success in solid tumor indications.
TFP Technology
[00150] In some embodiments, the isolated TFP molecules comprise a TCR extracellular domain that comprises an extracellular domain or portion thereof of a protein selected from the group consisting of the alpha or beta chain of the T cell receptor, CD3 delta, CD3 epsilon, or CD3 gamma, or an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications thereto. In some embodiments, the anti-mesothelin binding domain is connected to the TCR extracellular domain by a linker sequence. In some instances, the linker region comprises (G4S)n, wherein n=l to 4. In some instances, the linker sequence comprises a long linker (LL) sequence. In some instances, the long linker sequence comprises (G4S)n, wherein n=2 to 4. In some instances, the linker sequence comprises a short linker (SL) sequence. In some instances, the short linker sequence comprises (G4S)n, wherein n=l to 3.
[00151] In some embodiments, the isolated TFP molecules further comprise a sequence encoding a costimulatory domain. In other embodiments, the isolated TFP molecules further comprise a sequence encoding an intracellular signaling domain. In yet other embodiments, the isolated TFP molecules further comprise a leader sequence.
[00152] Also provided herein are vectors that comprise a nucleic acid molecule encoding any of the previously described TFP molecules. In some embodiments, the vector is selected from the group consisting of a DNA, a RNA, a plasmid, a lentivirus vector, adenoviral vector, or a retrovirus vector. In some embodiments, the vector further comprises a promoter. In some embodiments, the vector is an in vitro transcribed vector. In some embodiments, a nucleic acid sequence in the vector further comprises a poly(A) tail. In some embodiments, a nucleic acid sequence in the vector further comprises a 3’UTR.
[00153] Also provided herein are cells that comprise any of the described vectors. In some embodiments, the cell is a human T cell. In some embodiments, the cell is a CD8+ or CD4+ T cell. In other embodiments, the cell is a CD8+ CD4+ T cell. In other embodiments, the cell is a naive T-cell, memory stem T cell, central memory T cell, double negative T cell, effector memory T cell, effector T cell, ThO cell, TcO cell, Thl cell, Tel cell, Th2 cell, Tc2 cell, Thl7 cell, Th22 cell, gamma/delta T cell, alpha/beta T cell, natural killer (NK) cell, natural killer T (NKT) cell, hematopoietic stem cell and pluripotent stem cell. In other embodiments, the cells further comprise a nucleic acid encoding an inhibitory molecule that comprises a first polypeptide that comprises at least a portion of an inhibitory molecule, associated with a second polypeptide that comprises a positive signal from an intracellular
signaling domain. In some instances, the inhibitory molecule comprises a first polypeptide that comprises at least a portion of PD1 and a second polypeptide comprising a costimulatory domain and primary signaling domain.
[00154] In another aspect, provided herein are isolated TFP molecules that comprise a human or humanized anti-mesothelin binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular signaling domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide.
[00155] In another aspect, provided herein are isolated TFP molecules that comprise a human or humanized anti-mesothelin binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular signaling domain, wherein the TFP molecule is capable of functionally integrating into an endogenous TCR complex.
[00156] In another aspect, provided herein are human CD8+ or CD4+ T cells that comprise at least two TFP molecules, the TFP molecules comprising a human or humanized anti-mesothelin binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8+ or CD4+ T cell.
[00157] In another aspect, provided herein are protein complexes that comprise i) a TFP molecule comprising a human or humanized anti-mesothelin binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain; and ii) at least one endogenous TCR complex.
[00158] In some embodiments, the TCR comprises an extracellular domain or portion thereof of a protein selected from the group consisting of the alpha or beta chain of the T cell receptor, CD3 delta, CD3 epsilon, or CD3 gamma. In some embodiments, the anti-mesothelin binding domain is connected to the TCR extracellular domain by a linker sequence. In some instances, the linker region comprises (G4S)n, wherein n=l to 4. In some instances, the linker sequence comprises a long linker (LL) sequence. In some instances, the long linker sequence comprises (G4S)n, wherein n=2 to 4. In some instances, the linker sequence comprises a short linker (SL) sequence. In some instances, the short linker sequence comprises (G4S)n, wherein n=l to 3.
[00159] Also provided herein are human CD8+ or CD4+ T cells that comprise at least two different TFP proteins per any of the described protein complexes.
[00160] In another aspect, provided herein is a population of human CD8+ or CD4+ T cells, wherein the T cells of the population individually or collectively comprise at least two TFP molecules, the TFP molecules comprising a human or humanized anti-mesothelin binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the TFP molecule is capable
of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8+ or CD4+ T cell.
[00161] In another aspect, provided herein is a population of human CD8+ or CD4+ T cells, wherein the T cells of the population individually or collectively comprise at least two TFP molecules encoded by an isolated nucleic acid molecule provided herein.
[00162] In another aspect, provided herein are methods of making a cell comprising transducing a T cell with any of the described vectors.
[00163] In another aspect, provided herein are methods of generating a population of RNA-engineered cells that comprise introducing an in vitro transcribed RNA or synthetic RNA into a cell, where the RNA comprises a nucleic acid encoding any of the described TFP molecules.
[00164] In another aspect, provided herein are methods of providing an anti-tumor immunity in a mammal that comprise administering to the mammal an effective amount of a cell expressing any of the described TFP molecules. In some embodiments, the cell is an autologous T cell. In some embodiments, the cell is an allogeneic T cell. In some embodiments, the mammal is a human.
[00165] In another aspect, provided herein are methods of treating a mammal having a disease associated with expression of mesothelin that comprise administering to the mammal an effective amount of the cell of comprising any of the described TFP molecules. In some embodiments, the disease associated with mesothelin expression is selected from a proliferative disease such as a cancer or malignancy or a precancerous condition such as a pancreatic cancer, an ovarian cancer, a stomach cancer, a lung cancer, or an endometrial cancer, or is a non-cancer related indication associated with expression of mesothelin.
[00166] In some embodiments, the cells expressing any of the described TFP molecules are administered in combination with an agent that ameliorates one or more side effects associated with administration of a cell expressing a TFP molecule. In some embodiments, the cells expressing any of the described TFP molecules are administered in combination with an agent that treats the disease associated with mesothelin.
[00167] Also provided herein are any of the described isolated nucleic acid molecules, any of the described isolated polypeptide molecules, any of the described isolated TFPs, any of the described protein complexes, any of the described vectors or any of the described cells for use as a medicament.
Definitions
[00168] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains.
[00169] The term “a” and “an” refers to one or to more than one (e.g., to at least one) of the grammatical object of the article. By way of example, “an element” means one element or more than one element.
[00170] As used herein, “about” can mean plus or minus less than 1 or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, or greater than 30 percent, depending upon the situation and known or knowable by one skilled in the art.
[00171] As used herein the specification, “subject” or “subjects” or “individuals” may include, but are not limited to, mammals such as humans or non-human mammals, e.g., domesticated, agricultural or wild, animals, as well as birds, and aquatic animals. “Patients” are subjects suffering from or at risk of developing a disease, disorder or condition or otherwise in need of the compositions and methods provided herein.
[00172] As used herein, “treating” or “treatment” refers to any indicia of success in the treatment or amelioration of the disease or condition. Treating can include, for example, reducing, delaying or alleviating the severity of one or more symptoms of the disease or condition, or it can include reducing the frequency with which symptoms of a disease, defect, disorder, or adverse condition, and the like, are experienced by a patient. As used herein, “treat or prevent” is sometimes used herein to refer to a method that results in some level of treatment or amelioration of the disease or condition, and contemplates a range of results directed to that end, including but not restricted to prevention of the condition entirely.
[00173] As used herein, “preventing” refers to the prevention of the disease or condition, e.g., tumor formation, in the patient. For example, if an individual at risk of developing a tumor or other form of cancer is treated with the methods of the present disclosure and does not later develop the tumor or other form of cancer, then the disease has been prevented, at least over a period of time, in that individual.
[00174] The term “antigen-binding domain” means the portion of an antibody that is capable of specifically binding to an antigen or epitope. One example of an antigen-binding domain is an antigenbinding domain formed by a VH -VL dimer of an antibody. Another example of an antigen-binding domain is an antigen-binding domain formed by diversification of certain loops from the tenth fibronectin type III domain of an Adnectin™.
[00175] As used herein, a “therapeutically effective amount” is the amount of a composition or an active component thereof sufficient to provide a beneficial effect or to otherwise reduce a detrimental non-beneficial event to the individual to whom the composition is administered. By “therapeutically effective dose” herein is meant a dose that produces one or more desired or desirable (e.g., beneficial) effects for which it is administered, such administration occurring one or more times over a given
period of time. The exact dose will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques (see, e.g., Lieberman, Pharmaceutical Dosage Forms (vols. 1-3, 1992); Lloyd, The Art, Science and Technology of Pharmaceutical Compounding (1999); and Pickar, Dosage Calculations (1999)).
[00176] As used herein, a “T cell receptor (TCR) fusion protein” or “TFP” includes a recombinant polypeptide derived from the various polypeptides comprising the TCR that is generally capable of i) binding to a surface antigen on target cells and ii) interacting with other polypeptide components of the intact TCR complex, typically when co-located in or on the surface of a T cell. A “TFP T cell” is a T cell that has been transduced (e.g., according to the methods disclosed herein) and that expresses a TFP, e.g., incorporated into the natural TCR. In some embodiments, the T cell is a CD4+ T cell, a CD8+ T cell, or a CD4+ / CD8+ T cell. In some embodiments, the TFP T cell is an NK cell. In some embodiments, the TFP T cell is a gamma-delta T cell.
[00177] As used herein, the term “mesothelin” also known as MSLN or CAK1 antigen or Pre-pro- megakaryocyte-potentiating factor, refers to the protein that in humans is encoded by the MSLN (or Megakaryocyte-potentiating factor (MPF)) gene. Mesothelin is a 40 kDa protein present on normal mesothelial cells and overexpressed in several human tumors, including mesothelioma and ovarian and pancreatic adenocarcinoma. The mesothelin gene encodes a precursor protein that is processed to yield mesothelin which is attached to the cell membrane by a glycophosphatidylinositol linkage and a 31-kDa shed fragment named megakaryocyte-potentiating factor (MPF). Mesothelin may be involved in cell adhesion, but its biological function is not known. Mesothelin is a tumor differentiation antigen that is normally present on the mesothelial cells lining the pleura, peritoneum and pericardium. Mesothelin is an antigenic determinant detectable on mesothelioma cells, ovarian cancer cells, pancreatic adenocarcinoma cell and some squamous cell carcinomas (see, e.g., Kojima et al., J. Biol. Chem. 270:21984-21990(1995) and Onda et al., Clin. Cancer Res. 12:4225-4231(2006)). Mesothelin interacts with CA125/MUC16 (see, e.g., Rump et al., J. Biol. Chem. 279:9190-9198(2004) and Ma et al., J. Biol. Chem. 287:33123-33131(2012)).
[00178] The human and murine amino acid and nucleic acid sequences can be found in a public database, such as GenBank, UniProt and Swiss-Prot. For example, the amino acid sequence of human mesothelin can be found as UniProt/Swiss-Prot Accession No. Q13421. The human mesothelin polypeptide canonical sequence is UniProt Accession No. Q13421 (or Q13421-1): MALPTARPLLGSCGTPALGSLLFLLFSLGWVQPSRTLAGETGQEAAPLDGVLANPPNISSLSP RQLLGFPCAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLF LNPD AF SGPQ ACTRFF SRITKANVDLLPRGAPERQRLLP A ALAC WG VRGSLLSE AD VR ALG GLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPPSTWSVSTMDA
LRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPERTILRPRFRREVEKTACPSGKKAREI DESLIFYKKWELEACVDAALLATQMDRVNAIPFTYEQLDVLKHKLDELYPQGYPESVIQHL GYLFLKMSPEDIRKWNVTSLETLKALLEVNKGHEMSPQAPRRPLPQVATLIDRFVKGRGQL DKDTLDTLTAFYPGYLCSLSPEELSSVPPSSIWAVRPQDLDTCDPRQLDVLYPKARLAFQNM NGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGPHVE GLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLSMQEALSGTPCLLGPGPV LTVLALLLASTLA.
[00179] The nucleotide sequence encoding human mesothelin transcript variant 1 can be found at Accession No. NM005823. The nucleotide sequence encoding human mesothelin transcript variant 2 can be found at Accession No. NM013404. The nucleotide sequence encoding human mesothelin transcript variant 3 can be found at Accession No. NM001177355. Mesothelin is expressed on mesothelioma cells, ovarian cancer cells, pancreatic adenocarcinoma cell and squamous cell carcinomas (see, e.g., Kojima et al., J. Biol. Chem. 270:21984-21990(1995) and Onda et al., Clin. Cancer Res. 12:4225-4231(2006)). Other cells that express mesothelin are provided below in the definition of “disease associated with expression of mesothelin.” Mesothelin also interacts with CA125/MUC16 (see, e.g., Rump et al., J. Biol. Chem. 279:9190-9198(2004) and Ma et al., J. Biol. Chem. 287:33123-33131(2012)). In one example, the antigen-binding portion of TFPs recognizes and binds an epitope within the extracellular domain of the mesothelin protein as expressed on a normal or malignant mesothelioma cell, ovarian cancer cell, pancreatic adenocarcinoma cell, or squamous cell carcinoma cell.
[00180] The term “antibody,” as used herein, refers to a protein, or polypeptide sequences derived from an immunoglobulin molecule, which specifically binds to an antigen. Antibodies can be intact immunoglobulins of polyclonal or monoclonal origin, or fragments thereof and can be derived from natural or from recombinant sources.
[00181] The terms “antibody fragment” or “antibody binding domain” refer to at least one portion of an antibody, or recombinant variants thereof, that contains the antigen binding domain, e.g., an antigenic determining variable region of an intact antibody, that is sufficient to confer recognition and specific binding of the antibody fragment to a target, such as an antigen and its defined epitope. Examples of antibody fragments include, but are not limited to, Fab, Fab’, F(ab’)2, and Fv fragments, single-chain (sc)Fv (“scFv”) antibody fragments, linear antibodies, single domain antibodies (abbreviated “sdAb”) (either VL or VH), camelid VHH domains, and multi-specific antibodies formed from antibody fragments.
[00182] The term “scFv” refers to a fusion protein comprising at least one antibody fragment comprising a variable region of a light chain and at least one antibody fragment comprising a variable
region of a heavy chain, wherein the light and heavy chain variable regions are contiguously linked via a short flexible polypeptide linker, and capable of being expressed as a single polypeptide chain, and wherein the scFv retains the specificity of the intact antibody from which it is derived.
[00183] “Heavy chain variable region” or “VH” ” (or, in the case of single domain antibodies, e.g., nanobodies, “VHH”) with regard to an antibody refers to the fragment of the heavy chain that contains three CDRs interposed between flanking stretches known as framework regions, these framework regions are generally more highly conserved than the CDRs and form a scaffold to support the CDRs. [00184] Unless specified, as used herein a scFv may have the VL and VH variable regions in either order, e.g., with respect to the N-terminal and C-terminal ends of the polypeptide, the scFv may comprise VL-linker-VH or may comprise VH-linker-VL.
[00185] The portion of the TFP composition of the disclosure comprising an antibody or antibody fragment thereof may exist in a variety of forms where the antigen binding domain is expressed as part of a contiguous polypeptide chain including, for example, a single domain antibody fragment (sdAb) or heavy chain antibodies HCAb, a single chain antibody (scFv) derived from a murine, humanized or human antibody (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, N.Y.; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, N.Y.; Houston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; Bird et al., 1988, Science 242:423-426). In one aspect, the antigen binding domain of a TFP composition of the disclosure comprises an antibody fragment. In a further aspect, the TFP comprises an antibody fragment that comprises a scFv or a sdAb.
[00186] The term “antigen” or “Ag” refers to a molecule that is capable of being bound specifically by an antibody, or otherwise provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically-competent cells, or both.
[00187] The skilled artisan will understand that any macromolecule, including virtually all proteins or peptides, can serve as an antigen. Furthermore, antigens can be derived from recombinant or genomic DNA. A skilled artisan will understand that any DNA, which comprises a nucleotide sequences or a partial nucleotide sequence encoding a protein that elicits an immune response therefore encodes an “antigen” as that term is used herein. Furthermore, one skilled in the art will understand that an antigen need not be encoded solely by a full length nucleotide sequence of a gene. It is readily apparent that the present disclosure includes, but is not limited to, the use of partial nucleotide sequences of more than one gene and that these nucleotide sequences are arranged in various combinations to encode polypeptides that elicit the desired immune response. Moreover, a skilled artisan will understand that an antigen need not be encoded by a “gene” at all. It is readily apparent that an antigen can be generated synthesized or can be derived from a biological sample, or might be macromolecule besides a
polypeptide. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a fluid with other biological components.
[00188] The term “anti-tumor effect” refers to a biological effect which can be manifested by various means, including but not limited to, e.g., a decrease in tumor volume, a decrease in the number of tumor cells, a decrease in the number of metastases, an increase in life expectancy, decrease in tumor cell proliferation, decrease in tumor cell survival, or amelioration of various physiological symptoms associated with the cancerous condition. An “anti-tumor effect” can also be manifested by the ability of the peptides, polynucleotides, cells and antibodies of the disclosure in prevention of the occurrence of tumor in the first place.
[00189] The term “autologous” refers to any material derived from the same individual to whom it is later to be re-introduced into the individual.
[00190] The term “allogeneic” refers to any material derived from a different animal of the same species or different patient as the individual to whom the material is introduced. Two or more individuals are said to be allogeneic to one another when the genes at one or more loci are not identical. In some aspects, allogeneic material from individuals of the same species may be sufficiently unlike genetically to interact antigenically.
[00191] The term “xenogeneic” refers to a graft derived from an animal of a different species.
[00192] The term “cancer” refers to a disease characterized by the rapid and uncontrolled growth of aberrant cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Examples of various cancers are described herein and include but are not limited to, breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lung cancer, and the like.
[00193] The phrase “disease associated with expression of mesothelin” includes, but is not limited to, a disease associated with expression of mesothelin or condition associated with cells which express mesothelin including, e.g., proliferative diseases such as a cancer or malignancy or a precancerous condition. In one aspect, the cancer is a mesothelioma. In one aspect, the cancer is a pancreatic cancer. In one aspect, the cancer is an ovarian cancer. In one aspect, the cancer is a stomach cancer. In one aspect, the cancer is a lung cancer. In one aspect, the cancer is an endometrial cancer. Non-cancer related indications associated with expression of mesothelin include, but are not limited to, e.g., autoimmune disease, (e.g., lupus, rheumatoid arthritis, colitis), inflammatory disorders (allergy and asthma), and transplantation.
[00194] The term “conservative sequence modifications” refers to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody or antibody fragment containing the amino acid sequence. Such conservative modifications include amino acid substitutions,
additions and deletions. Modifications can be introduced into an antibody or antibody fragment of the disclosure by standard techniques known in the art, such as site-directed mutagenesis and PCR- mediated mutagenesis. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, one or more amino acid residues within a TFP of the disclosure can be replaced with other amino acid residues from the same side chain family and the altered TFP can be tested using the functional assays described herein.
[00195] The term “stimulation” refers to a primary response induced by binding of a stimulatory domain or stimulatory molecule (e.g., a TCR/CD3 complex) with its cognate ligand thereby mediating a signal transduction event, such as, but not limited to, signal transduction via the TCR/CD3 complex. Stimulation can mediate altered expression of certain molecules, and/or reorganization of cytoskeletal structures, and the like.
[00196] The term “stimulatory molecule” or “stimulatory domain” refers to a molecule or portion thereof expressed by a T cell that provides the primary cytoplasmic signaling sequence(s) that regulate primary activation of the TCR complex in a stimulatory way for at least some aspect of the T cell signaling pathway. In one aspect, the primary signal is initiated by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with peptide, and which leads to mediation of a T cell response, including, but not limited to, proliferation, activation, differentiation, and the like. A primary cytoplasmic signaling sequence (also referred to as a “primary signaling domain”) that acts in a stimulatory manner may contain a signaling motif which is known as immunoreceptor tyrosine-based activation motif or “IT AM”. Examples of an IT AM containing primary cytoplasmic signaling sequence that is of particular use in the disclosure includes, but is not limited to, those derived from TCR zeta, FcR gamma, FcRbeta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, CD278 (also known as “ICOS”) and CD66d.
[00197] The term “antigen presenting cell” or “APC” refers to an immune system cell such as an accessory cell (e.g., a B-cell, a dendritic cell, and the like) that displays a foreign antigen complexed with major histocompatibility complexes (MHC’s) on its surface. T cells may recognize these complexes using their T cell receptors (TCRs). APCs process antigens and present them to T cells.
[00198] An “intracellular signaling domain,” as the term is used herein, refers to an intracellular portion of a molecule. The intracellular signaling domain generates a signal that promotes an immune effector function of the TFP containing cell, e.g., a TFP-expressing T cell. Examples of immune effector function, e.g., in a TFP-expressing T cell, include cytolytic activity and T helper cell activity, including the secretion of cytokines. In an embodiment, the intracellular signaling domain can comprise a primary intracellular signaling domain. Exemplary primary intracellular signaling domains include those derived from the molecules responsible for primary stimulation, or antigen dependent simulation. In an embodiment, the intracellular signaling domain can comprise a costimulatory intracellular domain. Exemplary costimulatory intracellular signaling domains include those derived from molecules responsible for costimulatory signals, or antigen independent stimulation.
[00199] A primary intracellular signaling domain can comprise an IT AM (“immunoreceptor tyrosinebased activation motif’). Examples of ITAM containing primary cytoplasmic signaling sequences include, but are not limited to, those derived from CD3 zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, and CD66d DAP10 and DAP12.
[00200] The term “costimulatory molecule” refers to the cognate binding partner on a T cell that specifically binds with a costimulatory ligand, thereby mediating a costimulatory response by the T cell, such as, but not limited to, proliferation. Costimulatory molecules are cell surface molecules other than antigen receptors or their ligands that are required for an efficient immune response. Costimulatory molecules include, but are not limited to an MHC class 1 molecule, BTLA and a Toll ligand receptor, as well as DAP10, DAP12, CD30, LIGHT, 0X40, CD2, CD27, CD28, CDS, ICAM- 1, LFA-1 (CDl la/CD18) and 4-1BB (CD137). A costimulatory intracellular signaling domain can be the intracellular portion of a costimulatory molecule. A costimulatory molecule can be represented in the following protein families: TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), and activating NK cell receptors. Examples of such molecules include CD27, CD28, 4-1BB (CD137), 0X40, GITR, CD30, CD40, ICOS, BAFFR, HVEM, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, and a ligand that specifically binds with CD83, and the like. The intracellular signaling domain can comprise the entire intracellular portion, or the entire native intracellular signaling domain, of the molecule from which it is derived, or a functional fragment thereof. The term “4- IBB” refers to a member of the TNFR superfamily with an amino acid sequence provided as GenBank Acc. No. AAA62478.2, or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like; and a “4- IBB costimulatory domain” is defined as amino acid residues 214-255 of GenBank Acc. No. AAA62478.2, or equivalent residues from non- human species, e.g., mouse, rodent, monkey, ape and the like.
[00201] The term “encoding” refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (e.g., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom. Thus, a gene, cDNA, or RNA, encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system. Both the coding strand, the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
[00202] Unless otherwise specified, a “nucleotide sequence encoding an amino acid sequence” includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence. The phrase nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain one or more introns.
[00203] The term “effective amount” or “therapeutically effective amount” are used interchangeably herein, and refer to an amount of a compound, formulation, material, or composition, as described herein effective to achieve a particular biological or therapeutic result.
[00204] The term “endogenous” refers to any material from or produced inside an organism, cell, tissue or system.
[00205] The term “exogenous” refers to any material introduced from or produced outside an organism, cell, tissue or system.
[00206] The term “expression” refers to the transcription and/or translation of a particular nucleotide sequence driven by a promoter.
[00207] The term “transfer vector” refers to a composition of matter which comprises an isolated nucleic acid and which can be used to deliver the isolated nucleic acid to the interior of a cell. Numerous vectors are known in the art including, but not limited to, linear polynucleotides, polynucleotides associated with ionic or amphiphilic compounds, plasmids, and viruses. Thus, the term “transfer vector” includes an autonomously replicating plasmid or a virus. The term should also be construed to further include non-plasmid and non-viral compounds which facilitate transfer of nucleic acid into cells, such as, for example, a polylysine compound, liposome, and the like. Examples of viral transfer vectors include, but are not limited to, adenoviral vectors, adeno-associated virus vectors, retroviral vectors, lentiviral vectors, and the like.
[00208] The term “expression vector” refers to a vector comprising a recombinant polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed.
An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system. Expression vectors include all those known in the art, including cosmids, plasmids (e.g., naked or contained in liposomes) and viruses (e.g., lentiviruses, retroviruses, adenoviruses, and adeno-associated viruses) that incorporate the recombinant polynucleotide.
[00209] The term “lentivirus” refers to a genus of the Retroviridae family. Lentiviruses are unique among the retroviruses in being able to infect non-dividing cells; they can deliver a significant amount of genetic information into the DNA of the host cell, so they are one of the most efficient methods of a gene delivery vector. HIV, SIV, and FIV are all examples of lentiviruses.
[00210] The term “lentiviral vector” refers to a vector derived from at least a portion of a lentivirus genome, including especially a self-inactivating lentiviral vector as provided in Milone et al., Mol. Ther. 17(8): 1453-1464 (2009). Other examples of lentivirus vectors that may be used in the clinic, include but are not limited to, e.g., the LENTIVECTOR™ gene delivery technology from Oxford BioMedica, the LENTIMAX™ vector system from Lentigen, and the like. Nonclinical types of lentiviral vectors are also available and would be known to one skilled in the art.
[00211] The term “homologous” or “identity” refers to the subunit sequence identity between two polymeric molecules, e.g., between two nucleic acid molecules, such as, two DNA molecules or two RNA molecules, or between two polypeptide molecules. When a subunit position in both of the two molecules is occupied by the same monomeric subunit; e.g., if a position in each of two DNA molecules is occupied by adenine, then they are homologous or identical at that position. The homology between two sequences is a direct function of the number of matching or homologous positions; e.g., if half (e.g., five positions in a polymer ten subunits in length) of the positions in two sequences are homologous, the two sequences are 50% homologous; if 90% of the positions (e.g., 9 of 10), are matched or homologous, the two sequences are 90% homologous.
[00212] “Humanized” forms of non-human (e.g., murine) antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab’, F(ab’)2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin. For the most part, humanized antibodies and antibody fragments thereof are human immunoglobulins (recipient antibody or antibody fragment) in which residues from a complementary- determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity, and capacity. In some instances, Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, a humanized antib ody/antibody fragment can comprise residues which are found neither in the recipient antibody nor in the imported
CDR or framework sequences. These modifications can further refine and optimize antibody or antibody fragment performance. In general, the humanized antibody or antibody fragment thereof will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or a significant portion of the FR regions are those of a human immunoglobulin sequence. The humanized antibody or antibody fragment can also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details, see Jones et al., Nature, 321 : 522-525, 1986; Reichmann et al., Nature, 332: 323-329, 1988; Presta, Curr. Op. Struct. Biol., 2: 593-596, 1992.
[00213] “Human” or “fully human” refers to an immunoglobulin, such as an antibody or antibody fragment, where the whole molecule is of human origin or consists of an amino acid sequence identical to a human form of the antibody or immunoglobulin.
[00214] The term “isolated” means altered or removed from the natural state. For example, a nucleic acid or a peptide naturally present in a living animal is not “isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is “isolated.” An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
[00215] In the context of the present disclosure, the following abbreviations for the commonly occurring nucleic acid bases are used. “A” refers to adenosine, “C” refers to cytosine, “G” refers to guanosine, “T” refers to thymidine, and “U” refers to uridine.
[00216] The term “operably linked” or “transcriptional control” refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter. For example, a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence. For instance, a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence. Operably linked DNA sequences can be contiguous with each other and, e.g., where necessary to join two protein coding regions, are in the same reading frame.
[00217] The term “parenteral” administration of an immunogenic composition includes, e.g., subcutaneous (s.c.), intravenous (i.v.), intramuscular (i.m.), or intrastemal injection, intratumoral, or infusion techniques.
[00218] The term “nucleic acid” or “polynucleotide” refers to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural
nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed- base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)).
[00219] The terms “peptide,” “polypeptide,” and “protein” are used interchangeably, and refer to a compound comprised of amino acid residues covalently linked by peptide bonds. A protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein’s or peptide’s sequence. Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds. As used herein, the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types. “Polypeptides” include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others. A polypeptide includes a natural peptide, a recombinant peptide, or a combination thereof.
[00220] The term “promoter” refers to a DNA sequence recognized by the transcription machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a polynucleotide sequence.
[00221] The term “promoter/regulatory sequence” refers to a nucleic acid sequence which is required for expression of a gene product operably linked to the promoter/regulatory sequence. In some instances, this sequence may be the core promoter sequence and in other instances, this sequence may also include an enhancer sequence and other regulatory elements which are required for expression of the gene product. The promoter/regulatory sequence may, for example, be one which expresses the gene product in a tissue specific manner.
[00222] The term “constitutive” promoter refers to a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell under most or all physiological conditions of the cell.
[00223] The term “inducible” promoter refers to a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be
produced in a cell substantially only when an inducer which corresponds to the promoter is present in the cell.
[00224] The term “tissue-specific” promoter refers to a nucleotide sequence which, when operably linked with a polynucleotide encodes or specified by a gene, causes the gene product to be produced in a cell substantially only if the cell is a cell of the tissue type corresponding to the promoter.
[00225] The terms “linker” and “flexible polypeptide linker” as used in the context of a scFv refers to a peptide linker that consists of amino acids such as glycine and/or serine residues used alone or in combination, to link variable heavy and variable light chain regions together. In one embodiment, the flexible polypeptide linker is a Gly/Ser linker and comprises the amino acid sequence (Gly-Gly-Gly- Ser)n, where n is a positive integer equal to or greater than 1. For example, n=l, n=2, n=3, n=4, n=5, n=6, n=7, n=8, n=9 and n=10. In one embodiment, the flexible polypeptide linkers include, but are not limited to, (Gly4Ser)4 or (Gly4Ser)3. In another embodiment, the linkers include multiple repeats of (Gly2Ser), (GlySer) or (GlysSer). Also included within the scope of the disclosure are linkers described in WO2012/138475 (incorporated herein by reference). In some instances, the linker sequence comprises (G4S)n, wherein n=2 to 4. In some instances, the linker sequence comprises (G4S)n, wherein n=l to 3.
[00226] As used herein, a 5’ cap (also termed an RNA cap, an RNA 7-methylguanosine cap or an RNA m7G cap) is a modified guanine nucleotide that has been added to the “front” or 5’ end of a eukaryotic messenger RNA shortly after the start of transcription. The 5’ cap consists of a terminal group which is linked to the first transcribed nucleotide. Its presence is critical for recognition by the ribosome and protection from RNases. Cap addition is coupled to transcription, and occurs co- transcriptionally, such that each influences the other. Shortly after the start of transcription, the 5’ end of the mRNA being synthesized is bound by a cap-synthesizing complex associated with RNA polymerase. This enzymatic complex catalyzes the chemical reactions that are required for mRNA capping. Synthesis proceeds as a multi-step biochemical reaction. The capping moiety can be modified to modulate functionality of mRNA such as its stability or efficiency of translation.
[00227] As used herein, “/// vitro transcribed RNA” refers to RNA, preferably mRNA, which has been synthesized in vitro. Generally, the in vitro transcribed RNA is generated from an in vitro transcription vector. The in vitro transcription vector comprises a template that is used to generate the in vitro transcribed RNA.
[00228] As used herein, a “poly(A)” is a series of adenosines attached by polyadenylation to the mRNA. In the preferred embodiment of a construct for transient expression, the polyA is between 50 and 5000, preferably greater than 64, more preferably greater than 100, most preferably greater than
300 or 400. Poly(A) sequences can be modified chemically or enzymatically to modulate mRNA functionality such as localization, stability or efficiency of translation.
[00229] As used herein, “polyadenylation” refers to the covalent linkage of a polyadenylyl moiety, or its modified variant, to a messenger RNA molecule. In eukaryotic organisms, most messenger RNA (mRNA) molecules are polyadenylated at the 3’ end. The 3’ poly(A) tail is a long sequence of adenine nucleotides (often several hundred) added to the pre-mRNA through the action of an enzyme, polyadenylate polymerase. In higher eukaryotes, the poly(A) tail is added onto transcripts that contain a specific sequence, the polyadenylation signal. The poly(A) tail and the protein bound to it aid in protecting mRNA from degradation by exonucleases. Polyadenylation is also important for transcription termination, export of the mRNA from the nucleus, and translation. Polyadenylation occurs in the nucleus immediately after transcription of DNA into RNA, but additionally can also occur later in the cytoplasm. After transcription has been terminated, the mRNA chain is cleaved through the action of an endonuclease complex associated with RNA polymerase. The cleavage site is usually characterized by the presence of the base sequence AAUAAA near the cleavage site. After the mRNA has been cleaved, adenosine residues are added to the free 3’ end at the cleavage site.
[00230] As used herein, “transient” refers to expression of a non-integrated transgene for a period of hours, days or weeks, wherein the period of time of expression is less than the period of time for expression of the gene if integrated into the genome or contained within a stable plasmid replicon in the host cell.
[00231] The term “signal transduction pathway” refers to the biochemical relationship between a variety of signal transduction molecules that play a role in the transmission of a signal from one portion of a cell to another portion of a cell. The phrase “cell surface receptor” includes molecules and complexes of molecules capable of receiving a signal and transmitting signal across the membrane of a cell.
[00232] The term “subject” is intended to include living organisms in which an immune response can be elicited (e.g., mammals, human). Exemplary subjects include humans, monkeys, dogs, cats, mice, rats, cows, horses, camels, goats, rabbits, and sheep. In certain embodiments, the subject is a human. A “patient” is a subject suffering from or at risk of developing a disease, disorder or condition or otherwise in need of the compositions and methods provided herein.
[00233] The term, a “substantially purified” cell refers to a cell that is essentially free of other cell types. A substantially purified cell also refers to a cell which has been separated from other cell types with which it is normally associated in its naturally occurring state. In some instances, a population of substantially purified cells refers to a homogenous population of cells. In other instances, this term refers simply to cell that have been separated from the cells with which they are naturally associated
in their natural state. In some aspects, the cells are cultured in vitro. In other aspects, the cells are not cultured in vitro.
[00234] The term “therapeutic” as used herein means a treatment. A therapeutic effect is obtained by reduction, suppression, remission, or eradication of a disease state.
[00235] The term “prophylaxis” as used herein means the prevention of or protective treatment for a disease or disease state.
[00236] In the context of the present disclosure, “tumor antigen” or “hyperproliferative disorder antigen” or “antigen associated with a hyperproliferative disorder” refers to antigens that are common to specific hyperproliferative disorders. In certain aspects, the hyperproliferative disorder antigens of the present disclosure are derived from, cancers including but not limited to primary or metastatic melanoma, thymoma, lymphoma, sarcoma, mesothelioma, renal cell carcinoma, stomach cancer, breast cancer, lung cancer, gastric cancer, ovarian cancer, NHL, leukemia, uterine cancer, prostate cancer, colon cancer, cervical cancer, bladder cancer, kidney cancer, brain cancer, liver cancer, pancreatic cancer, brain cancer, endometrial cancer, and stomach cancer.
[00237] The term “pharmaceutical composition” refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective in treating a subject, and which contains no additional components which are unacceptably toxic to the subject in the amounts provided in the pharmaceutical composition.
[00238] The terms “modulate” and “modulation” refer to reducing or inhibiting or, alternatively, activating or increasing, a recited variable.
[00239] The terms “increase” and “activate” refer to an increase of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100- fold, or greater in a recited variable.
[00240] The terms “reduce” and “inhibit” refer to a decrease of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100-fold, or greater in a recited variable.
[00241] The term “agonize” refers to the activation of receptor signaling to induce a biological response associated with activation of the receptor. An “agonist” is an entity that binds to and agonizes a receptor.
[00242] The term “antagonize” refers to the inhibition of receptor signaling to inhibit a biological response associated with activation of the receptor. An “antagonist” is an entity that binds to and antagonizes a receptor.
[00243] The term “effector T cell” includes T helper (e.g., CD4+) cells and cytotoxic (e.g., CD8+) T cells. CD4+ effector T cells contribute to the development of several immunologic processes, including
maturation of B cells into plasma cells and memory B cells, and activation of cytotoxic T cells and macrophages. CD8+ effector T cells destroy virus-infected cells and tumor cells. See Seder and Ahmed, Nature Immunol., 2003, 4:835-842, incorporated by reference in its entirety, for additional information on effector T cells.
[00244] The term “regulatory T cell” includes cells that regulate immunological tolerance, for example, by suppressing effector T cells. In some aspects, the regulatory T cell has a CD4+CD25+Foxp3+ phenotype. In some aspects, the regulatory T cell has a CD8+CD25+ phenotype. See Nocentini et al., Br. J. Pharmacol., 2012, 165:2089-2099, incorporated by reference in its entirety. [00245] In some instances, the disease is a cancer selected from the group consisting of mesothelioma, papillary serous ovarian adenocarcinoma, clear cell ovarian carcinoma, mixed Mullerian ovarian carcinoma, endometroid mucinous ovarian carcinoma, malignant pleural disease, pancreatic adenocarcinoma, ductal pancreatic adenocarcinoma, uterine serous carcinoma, lung adenocarcinoma, extrahepatic bile duct carcinoma, gastric adenocarcinoma, esophageal adenocarcinoma, colorectal adenocarcinoma, breast adenocarcinoma, a disease associated with mesothelin expression, and combinations thereof, a disease associated with mesothelin expression, and combinations thereof.
[00246] The term “transfected” or “transformed” or “transduced” refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell. A “transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid. The cell includes the primary subject cell and its progeny.
[00247] The term “specifically binds,” refers to an antibody, an antibody fragment or a specific ligand, which recognizes and binds a cognate binding partner (e.g. , mesothelin) present in a sample, but which does not necessarily and substantially recognize or bind other molecules in the sample.
[00248] The term “line of therapy,” as used herein, refers to a treatment that consists of one or more complete treatment cycles with a single agent, surgery, or ration therapy, a regimen consisting of a combination of several drugs, surgery, or radiation therapy, or a planned sequential therapy of various regimens. A treatment is considered a new line of therapy if any one of the following two conditions are met:
(i) Start of a new line of treatment after discontinuation of a previous line of treatment: If a treatment regimen is discontinued for any reason and a different regimen is started, it should be considered a new line of therapy. A regimen is considered to have been discontinued if all the drugs, radiation therapy or surgery in that given regimen have been stopped. A regimen is not considered to have been discontinued if some of the drugs, radiation therapy, or surgery of the regimen, but not all, have been discontinued.
(ii) The unplanned addition or substitution of one or more drugs, radiation therapy, or surgery in an existing regimen: Unplanned addition of a new drug, a new radiation therapy, or a new surgery or unplanned switching to a different drug (or combination of drugs), a different radiation therapy, or a different surgery for any reason is considered a new line of therapy.
[00249] Ranges: throughout this disclosure, various aspects of the present disclosure can be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the present disclosure. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6. As another example, a range such as 95-99% identity, includes something with 95%, 96%, 97%, 98% or 99% identity, and includes subranges such as 96-99%, 96-98%, 96-97%, 97-99%, 97-98% and 98-99% identity. This applies regardless of the breadth of the range.
Mesothelin
[00250] Mesothelin is a 40 kDa glycosyl-phosphatidyl inositol-linked membrane protein differentiation antigen, whose expression is mostly restricted to mesothelial cells lining the pleura, pericardium and peritoneum in healthy individuals (Chang and Pastan, 1996; Chang et al, 1992; Hassan and Ho, 2008). Mesothelin is overexpressed in multiple cancers, including more than 90% of malignant pleural mesotheliomas (MPMs) and pancreatic adenocarcinomas, approximately 70% of ovarian cancers, and approximately half of non-small cell lung cancers (NSCLCs), among others (Argani et al, 2001; Hassan and Ho, 2008; Hassan et al, 2005; Ordonez, 2003). The precise physiological function of mesothelin is not completely understood, but it has been postulated to promote metastasis through its binding to MUC16 (Chen et al, 2013). MSLN (the gene encoding for mesothelin) knockout mice grow and reproduce normally and have no detectable phenotype. Therapeutic modalities include antibodies, recombinant immunotoxins, and CAR T cells. However, aberrant mesothelin expression plays an active role in both malignant transformation and tumor aggressiveness by promoting cancer cell proliferation, invasion, and metastasis.
[00251] Mesothelin expression is normally restricted to serosal cells of the pleura, peritoneum, and pericardium. Mesothelin is highly expressed in a wide range of solid tumors, including epithelioid mesothelioma (95%), extrahepatic biliary cancer (95%), pancreatic adenocarcinoma (85%), serous
ovarian adenocarcinoma (75%), lung adenocarcinoma (57%), triple negative breast cancer (66%), endometrial carcinoma (59%), gastric carcinoma (47%), colorectal carcinoma (30%), and others.
[00252] Mesothelin overexpression is associated with poorer prognosis in mesothelioma, ovarian cancer, cholangiocarcinoma, lung adenocarcinoma, triple-negative breast cancer, and pancreatic adenocarcinoma.
[00253] Given its high expression in tumors and low expression in normal tissue, mesothelin is an attractive target for immunotherapy. Currently, several chimeric antigen receptor (CAR) T cell programs directed against mesothelin are being investigated.
[00254] The compositions and methods comprising anti-MSLN TFP T cells disclosed herein are a novel cell therapy that consists of genetically engineered T cells that express an antibody domain (e.g., a single-domain antibody or a single chain Fv) that recognizes human mesothelin fused to a TCR subunit (e.g., TCR alpha chain, TCR beta chain, TCR gamma chain, TCR delta chain, CD3 6, CD3 a, or CD3 C, subunit) which, upon expression, can be incorporated into the endogenous T cell receptor complex. The antibody domain can comprise an anti-MSLN antigen binding domain. The antibody domain can be a murine, human or humanized antibody domain. The anti-MSLN binding domain can be a scFv or a VHH domain. The anti-MSLN binding domain can comprise a domain having at least 80%, at least 85%, at least 90%, at least 95% or 100% sequence identity to the amino acid sequence of an anti-MSLN binding domain disclosed herein, e.g., in Table AL The anti-MSLN binding domain can comprise a heavy chain variable domain having at least 80%, at least 85%, at least 90%, at least 95% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 11, SEQ ID NO: 15, SEQ ID NO: 19, SEQ ID NO: 23, SEQ ID NO: 27, SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 46, SEQ ID NO: 47, or SEQ ID NO: 48. The anti-MSLN binding domain can comprise a light chain variable domain having at least 80%, at least 85%, at least 90%, at least 95% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 5, SEQ ID NO: 9, SEQ ID NO: 13, SEQ ID NO: 17, SEQ ID NO: 21, SEQ ID NO: 25, SEQ ID NO: 29, or SEQ ID NO: 31. In some embodiments, the anti-MSLN binding domain comprises a single-domain antibody comprising a heavy chain variable domain having at least 80%, at least 85%, at least 90%, at least 95% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 46. In some embodiments, the anti-MSLN binding domain comprises a CDR1 having an amino acid sequence of SEQ ID NO: 37, a CDR2 having an amino acid sequence of SEQ ID NO: 38, and a CDR3 having an amino acid sequence of SEQ ID NO: 39.
Mesothelin Expression in Cancer
[00255] The expression of mesothelin in cancer has been broadly studied. Serial analyses of gene expression (SAGE: www.ncbi.nlm.nih.gov/projects/SAGE/), conducted at the National Institutes of
Health (NIH), have shown high messenger ribonucleic acid (mRNA) expression of mesothelin in NSCLC, pancreatic cancer, MPM, ovarian cancer, cholangiocarcinoma, and other adenocarcinomas (Hassan and Ho, 2008). Expression profiles have been further supported by immunohistochemistry (IHC) studies performed on biopsy tissues taken from patients with multiple tumor types (Inaguma et al, 2017). While the IHC staining can vary dependent on antibody clone that is used, most IHC analyses indicate that 90% of ovarian cancer and > 75% of MPM or pancreatic cancer biopsies are immunoreactive to anti-mesothelin antibodies. Mesothelin expression and prevalence in various tumor types has been reviewed by Morello et al (2016) (Table A).
Malignant Pleural Mesothelioma (MPM)
[00256] MPM represents about 80% of mesothelioma cases. MPM is a regional and highly aggressive tumor that arises from the mesothelium of the pleural surface. Rarely, other serosal membranes of the human body are also coated with mesothelium, such as peritoneum (peritoneal mesothelioma) and pericardium (pericardial mesothelioma), are affected. The incidence of MPM has increased significantly and it is estimated that 40,000 people die each year worldwide due to asbestos-related MPM. Different types of MPM have been identified including epithelioid (50%-70% of cases), biphasic (30%), and sarcomatoid (10%-20%) with increasingly aggressive behavior and worse prognosis. In addition to a high incidence (25%-60%) of somatic BAP1 mutations, MPM is also associated with frequent alterations in other major tumor suppressor genes, such as pl6/Cdkn2a, pl9/Arf, pl9/Cdkn2b, and NF2. Effective treatment options for patients with MPM are very limited. The standard of care recommended for MPM is palliative chemotherapy with a doublet of platinum
salt and an anti-folate. Unfortunately, objective response rates are 17% to 40% and the median overall survival (OS) of patients with MPM is 12 to 19 months when systemic chemotherapy is used with or without anti-angiogenic agents or targeted therapy. Anti-CTLA-4 failed to show a survival advantage as second-line therapy in MPM. Anti -programmed death receptor- 1 (PD-1) and anti-PD-Ll antibodies (e.g., pembrolizumab, nivolumab, avelumab) are currently being tested in several trials in MPM. Early phase trials with anti-PD-1 or anti-PD-Ll antibodies have shown partial response rates up to 28% and disease control rates up to 76% with median duration of response of 12 months, but confirmatory data are required to validate these agents as the second line treatment of choice in MPM.
Non-small Cell Lung Cancer
[00257] NSCLC remains the leading cause of cancer-related mortality worldwide, accounting for approximately 18% of all cancer deaths. Despite treatment with platinum- and taxane-based chemotherapy, patients with metastatic NSCLC have a median survival of approximately 10 months, and a 5 -year survival rate of approximately 15%. Despite the increased number of treatment options available for patients with non-squamous histology NSCLC, there has been little OS improvement from several new agents, including pemetrexed, erlotinib, and bevacizumab beyond very small subpopulations. Therapeutic options for mutation wild-type non-squamous NSCLC are particularly limited after failure of front-line chemotherapy. Overall, this group of patients only has an OS of about 8 months after progression from platinum agents. Once resistance to tyrosine kinase inhibitors (TKIs) occurs, the patients who have epidermal growth factor receptor (EGFR) mutations or ALK translocations will have a rapid disease progression. Therefore, NSCLC remains a disease with high unmet medical need. Recently, T cell checkpoint regulators such as CTLA-4 and programmed death- 1 (PD-1, CD279) down- regulate T cell activation and proliferation upon engagement by their cognate ligands. T cell checkpoint inhibitors induce antitumor activity by breaking immune tolerance to tumor cell antigens. PD-1 and PD-L1 inhibitors are effective against metastatic NSCLC lacking sensitizing EGFR or ALK mutations.
[00258] Pembrolizumab (Keytruda®, Merck), nivolumab (Opdivo®, Bristol-Myers Squibb), and atezolizumab (Tecentriq®, Genentech) are approved as second-line therapy. Among patients in whom the percentage of tumor cells with membranous PD-L1 staining (tumor proportion score) is 50% or greater, pembrolizumab has also replaced cytotoxic chemotherapy as the first-line treatment of choice. However, patients with a tumor proportion score of 50% or greater represent a minority of those with NSCLC. A randomized, phase 2 trial of carboplatin plus pemetrexed with or without pembrolizumab showed significantly better rates of response and longer progression-free survival (PFS) with the addition of pembrolizumab than with chemotherapy alone. In the global, double-blind, placebo- controlled, phase 3 KEYNOTE- 189 trial, the addition of pembrolizumab to standard chemotherapy of
pemetrexed and a platinum-based drug resulted in significantly longer OS and PFS than chemotherapy alone and such combination is likely to become standard frontline therapy (Ghandi et al, 2018). Notably, no standard of care is available for patients failing to respond or relapsing after checkpoint inhibitor therapy.
Ovarian Cancer
[00259] Ovarian cancers can be classified in several subtypes according to their histopathology, which also determines their therapy. Epithelial ovarian cancer comprises 90% of all ovarian malignancies, with other pathologic subtypes such as germ cell and sex-cord stromal tumors being much rarer. It is estimated that 22,240 new diagnoses and 14,070 deaths from ovarian cancer will occur in 2018 in the United States (SEER, 2018). Ovarian cancer is characterized by late-stage presentation (more than 70% of cases), bulky metastatic tumor burden, and frequent recurrence of eventual chemoresistant disease, which result in cure rates below 15% among subjects with stage 3/4 disease. The 2 canonical types of drugs used to treat ovarian cancer — taxane and platinum-based agents — have not been replaced in the past 20 years, although the optimum timing of treatment (neoadjuvant versus adjuvant) and the best route of administration (intravenous versus intraperitoneal) remain unknown.
[00260] Recurrent ovarian cancer is not curable. The objectives of therapy are symptom palliation and extension of life. Subjects with platinum-sensitive ovarian cancer should be treated with a platinumbased agent. Those progressing after platinum retreatment and those with platinum-resistant disease, non-platinum combination and targeted therapies are available. The initial clinical efficacy of novel therapeutics, such as poly(ADP-ribose) polymerase (PARP) inhibitors and immune-checkpoint inhibitors, has ushered in a new wave of drug development in ovarian cancer. The synthetic lethality of BRCA mutated (e.g., deficient) ovarian cancer cells exposed to the PARP inhibitor olaparib resulted in a median PFS of 7 months and median OS of 16.6 months. Efficacy with checkpoint inhibitors in subjects with advanced recurrent ovarian cancer has been modest thus far. Best overall response rate (ORR) has been 15% with nivolumab, 12% with pembrolizumab, and 10% with ipilimumab (Hamanishi et al, 2015; Varga et al, 2015).
Cholangiocarcinoma
[00261] Cholangiocarcinomas are biliary epithelial tumors of the intrahepatic, perihilar, and distal biliary tree. Intrahepatic cholangiocarcinomas (iCCAs) (20% of cases) arise above the second-order bile ducts, whereas the cystic duct is the anatomical point of distinction between perihilar cholangiocarcinomas (pCCAs) (50%-60%), and distal cholangiocarcinomas (dCCAs; 20-30%). Most subjects have advanced- stage disease at presentation due to its aggressiveness and difficulty in early diagnosis. While surgery is the preferred therapy, only 35% of cases have early disease amenable to surgical resection with curative intent. For unresectable cholangiocarcinoma, the available standard-
of-care chemotherapy (gemcitabine and cisplatin) renders a median OS < 1 year, partly due to the desmoplastic stroma that fosters cancer cell survival and poses a barrier to the delivery of chemotherapy. Recurrent mutations in IDH1, IDH2, FGFR1, FGFR2, FGFR3, EPHA2, and BAP1 are found predominantly in iCCAs, whereas ARID1B, ELF3, PBRM1, PRKACA, and PRKACB mutations occur preferentially in pCCA/dCCA. Some of the latter represent actionable mutations whose therapeutic potential is currently being investigated in clinical trials. At present, clinical data on immunotherapy in cholangiocarcinoma are limited. PD-L1 expression has been reported in 9% to 72% of specimens, and on 46% to 63% of immune cells within the tumor microenvironment. Interim data from the KEYNOTE-028 basket trial (NCT02054806) with pembrolizumab have been reported. Of the 24 enrolled subjects with PD-L1 expression >1% (20 cholangiocarcinoma, 4 gallbladder carcinoma), 4 (17%, 3 with cholangiocarcinoma and 1 with gallbladder carcinoma) had a partial response (PR), and 4 (17%) had stable disease (SD). The median PFS was not reached at the time of reporting. These data prompted the launching of a biliary cancer cohort of 100 subjects in the ongoing KEYNOTE-158 basket trial (NCT02628067).
T cell receptor (TCR) fusion proteins (TFPs)
[00262] The present disclosure encompasses DNA and RNA constructs encoding TFPs (e.g., anti- MSLN TFPs), and variants thereof, wherein the TFP comprises a binding domain, e.g., an antibody or an antibody fragment, a ligand, or a ligand binding protein, that binds specifically to a tumor-associated antigen e.g., mesothelin, e.g., human mesothelin, wherein the sequence of the antibody fragment is contiguous with and in the same reading frame as a nucleic acid sequence encoding a TCR subunit or portion thereof. The TFPs are able to associate with one or more endogenous (or alternatively, one or more exogenous, or a combination of endogenous and exogenous) TCR subunits in order to form a functional TCR complex.
[00263] The TFPs can comprise a target-specific binding element otherwise referred to as an antigen binding domain. The choice of moiety depends upon the type and number of target antigen that define the surface of a target cell. For example, the antigen binding domain may be chosen to recognize a target antigen that acts as a cell surface marker on target cells associated with a particular disease state. Thus, examples of cell surface markers that may act as target antigens for the antigen binding domain in a TFP of the disclosure include those associated with viral, bacterial and parasitic infections; autoimmune diseases; and cancerous diseases (e.g., malignant diseases).
[00264] The TFP-mediated T cell response can be directed to an antigen of interest by way of engineering an antigen-binding domain into the TFP that specifically binds a desired antigen. A portion of the TFP may comprise the antigen binding domain that targets mesothelin.
[00265] The antigen binding domain can be any domain that binds to the antigen including but not limited to a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a human antibody, a humanized antibody, and a functional fragment thereof, including but not limited to a single-domain antibody such as a heavy chain variable domain (VH), a light chain variable domain (VL) and a variable domain (VHH) of a camelid derived nanobody, and to an alternative scaffold known in the art to function as antigen binding domain, such as a recombinant fibronectin domain, anticalin, DARPIN and the like. Likewise, a natural or synthetic ligand specifically recognizing and binding the target antigen can be used as antigen binding domain for the TFP. In some instances, it is beneficial for the antigen binding domain to be derived from the same species in which the TFP will ultimately be used in. For example, for use in humans, it may be beneficial for the antigen binding domain of the TFP to comprise human or humanized residues for the antigen binding domain of an antibody or antibody fragment.
[00266] Thus, the antigen-binding domain can comprise a humanized or human antibody or an antibody fragment, or a murine antibody or antibody fragment. The humanized or human anti- mesothelin binding domain may comprise one or more (e.g., all three) light chain complementary determining region 1 (LC CDR1), light chain complementary determining region 2 (LC CDR2), and light chain complementary determining region 3 (LC CDR3) of a humanized or human anti-mesothelin binding domain described herein, and/or one or more (e.g., all three) heavy chain complementary determining region 1 (HC CDR1), heavy chain complementary determining region 2 (HC CDR2), and heavy chain complementary determining region 3 (HC CDR3) of a humanized or human anti- mesothelin binding domain described herein, e.g., a humanized or human anti-mesothelin binding domain comprising one or more, e.g., all three, LC CDRs and one or more, e.g., all three, HC CDRs. The humanized or human anti-mesothelin binding domain may comprise one or more (e.g., all three) heavy chain complementary determining region 1 (HC CDR1), heavy chain complementary determining region 2 (HC CDR2), and heavy chain complementary determining region 3 (HC CDR3) of a humanized or human anti-mesothelin binding domain described herein, e.g., the humanized or human anti-mesothelin binding domain has two variable heavy chain regions, each comprising a HC CDR1, a HC CDR2 and a HC CDR3 described herein. The humanized or human anti-mesothelin binding domain may comprise a humanized or human light chain variable region described herein and/or a humanized or human heavy chain variable region described herein. The humanized or human anti-mesothelin binding domain may comprise a humanized heavy chain variable region described herein, e.g., at least two humanized or human heavy chain variable regions described herein. The anti- mesothelin binding domain can be a scFv comprising a light chain and a heavy chain of an amino acid sequence provided herein. The anti-mesothelin binding domain can be a VHH comprising a heavy
chain of an amino acid sequence provided herein. The anti-mesothelin binding domain (e.g., a scFv or VHH) may comprise: a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 30, 20 or 10 modifications e.g., substitutions) of an amino acid sequence of a light chain variable region provided herein, or a sequence with 95-99% identity with an amino acid sequence provided herein; and/or a heavy chain variable region comprising an amino acid sequence having at least one, two or three modifications e.g., substitutions) but not more than 30, 20 or 10 modifications e.g., substitutions) of an amino acid sequence of a heavy chain variable region provided herein, or a sequence with 95-99% identity to an amino acid sequence provided herein. The humanized or human anti-mesothelin binding domain can be a scFv, and a light chain variable region comprising an amino acid sequence described herein, is attached to a heavy chain variable region comprising an amino acid sequence described herein, via a linker, e.g., a linker described herein. The humanized anti-mesothelin binding domain may include a (Gly4-Ser)n linker, wherein n is 1, 2, 3, 4, 5, or 6, preferably 3 or 4. The light chain variable region and heavy chain variable region of a scFv can be, e.g., in any of the following orientations: light chain variable region-linker-heavy chain variable region or heavy chain variable region-linker-light chain variable region. In some instances, the linker sequence comprises a long linker (LL) sequence. In some instances, the long linker sequence comprises (G4S)n, wherein n=2 to 4. In some instances, the linker sequence comprises a short linker (SL) sequence. In some instances, the short linker sequence comprises (G4S)n, wherein n=l to 3.
[00267] A non-human antibody may be humanized, where specific sequences or regions of the antibody are modified to increase similarity to an antibody naturally produced in a human or fragment thereof.
[00268] A humanized antibody can be produced using a variety of techniques known in the art, including but not limited to, CDR-grafting (see, e.g., European Patent No. EP 239,400; International Publication No. WO 91/09967; and U.S. Pat. Nos. 5,225,539, 5,530,101, and 5,585,089, each of which is incorporated herein in its entirety by reference), veneering or resurfacing (see, e.g., European Patent Nos. EP 592,106 and EP 519,596; Padlan, 1991, Molecular Immunology, 28(4/5):489-498; Studnicka et al., 1994, Protein Engineering, 7(6):805-814; and Roguska et al., 1994, PNAS, 91 :969-973, each of which is incorporated herein by its entirety by reference), chain shuffling (see, e.g., U.S. Pat. No. 5,565,332, which is incorporated herein in its entirety by reference), and techniques disclosed in, e.g., U.S. Patent Application Publication No. US2005/0042664, U.S. Patent Application Publication No. US2005/0048617, U.S. Pat. No. 6,407,213, U.S. Pat. No. 5,766,886, International Publication No. WO 9317105, Tan et al., J. Immunol., 169: 1119-25 (2002), Caldas et al., Protein Eng., 13(5):353-60 (2000), Morea et al., Methods, 20(3):267-79 (2000), Baca et al., J. Biol. Chem., 272(16): 10678-84 (1997),
Roguska et al., Protein Eng., 9(10):895-904 (1996), Couto et al., Cancer Res., 55 (23 Supp):5973s- 5977s (1995), Couto et al., Cancer Res., 55(8): 1717-22 (1995), Sandhu J S, Gene, 150(2):409-10 (1994), and Pedersen et al., J. Mol. Biol., 235(3):959-73 (1994), each of which is incorporated herein in its entirety by reference. Often, framework residues in the framework regions will be substituted with the corresponding residue from the CDR donor antibody to alter, for example improve, antigen binding. These framework substitutions are identified by methods well-known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions (see, e.g., Queen et al., U.S. Pat. No. 5,585,089; and Riechmann et al., 1988, Nature, 332:323, which are incorporated herein by reference in their entireties).
[00269] A humanized antibody or antibody fragment has one or more amino acid residues remaining in it from a source which is nonhuman. These nonhuman amino acid residues are often referred to as “import” residues, which are typically taken from an “import” variable domain. Humanized antibodies or antibody fragments may comprise one or more CDRs from nonhuman immunoglobulin molecules and framework regions wherein the amino acid residues comprising the framework are derived completely or mostly from human germline. Multiple techniques for humanization of antibodies or antibody fragments are well-known in the art and can essentially be performed following the method of Winter and co-workers (Jones et al., Nature, 321 :522-525 (1986); Riechmann et al., Nature, 332:323-327 (1988); Verhoeyen et al., Science, 239: 1534-1536 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody, e.g., CDR-grafting (EP 239,400; PCT Publication No. WO 91/09967; and U.S. Pat. Nos. 4,816,567; 6,331,415; 5,225,539; 5,530,101; 5,585,089; 6,548,640, the contents of which are incorporated herein by reference in their entirety). In such humanized antibodies and antibody fragments, substantially less than an intact human variable domain has been substituted by the corresponding sequence from a nonhuman species. Humanized antibodies are often human antibodies in which some CDR residues and possibly some framework (FR) residues are substituted by residues from analogous sites in rodent antibodies. Humanization of antibodies and antibody fragments can also be achieved by veneering or resurfacing (EP 592,106; EP 519,596; Padlan, 1991, Molecular Immunology, 28(4/5):489-498; Studnicka et al., Protein Engineering, 7(6):805-814 (1994); and Roguska et al., PNAS, 91 :969-973 (1994)) or chain shuffling (U.S. Pat. No. 5,565,332), the contents of which are incorporated herein by reference in their entirety.
[00270] The choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is to reduce antigenicity. According to the so-called “best-fit” method, the sequence of the variable domain of a rodent antibody is screened against the entire library of known
human variable-domain sequences. The human sequence which is closest to that of the rodent is then accepted as the human framework (FR) for the humanized antibody (Sims et al., J. Immunol., 151 :2296 (1993); Chothia et al., J. Mol. Biol., 196:901 (1987), the contents of which are incorporated herein by reference herein in their entirety). Another method uses a particular framework derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains. The same framework may be used for several different humanized antibodies (see, e.g., Nicholson et al. Mol. Immun. 34 (16-17): 1157-1165 (1997); Carter et al., Proc. Natl. Acad. Sci. USA, 89:4285 (1992); Presta et al., J. Immunol., 151 :2623 (1993), the contents of which are incorporated herein by reference herein in their entirety). The framework region, e.g., all four framework regions, of the heavy chain variable region may be derived from a VH4-4-59 germline sequence. The framework region can comprise, one, two, three, four or five modifications, e.g., substitutions, e.g., from the amino acid at the corresponding murine sequence. The framework region, e.g., all four framework regions of the light chain variable region may be derived from a VK3-1.25 germline sequence. The framework region can comprise, one, two, three, four or five modifications, e.g., substitutions, e.g., from the amino acid at the corresponding murine sequence.
[00271] The portion of a TFP composition that comprises an antibody fragment can be humanized with retention of high affinity for the target antigen and other favorable biological properties. Humanized antibodies and antibody fragments may be prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences. Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, e.g., the analysis of residues that influence the ability of the candidate immunoglobulin to bind the target antigen. In this way, FR residues can be selected and combined from the recipient and import sequences so that the desired antibody or antibody fragment characteristic, such as increased affinity for the target antigen, is achieved. In general, the CDR residues are directly and most substantially involved in influencing antigen binding.
[00272] A humanized antibody or antibody fragment may retain a similar antigenic specificity as the original antibody, e.g., in the present disclosure, the ability to bind human mesothelin. A humanized antibody or antibody fragment may have improved affinity and/or specificity of binding to human mesothelin.
[00273] The anti-mesothelin binding domain can be characterized by particular functional features or properties of an antibody or antibody fragment. For example, the portion of a TFP composition of the
disclosure that comprises an antigen binding domain can specifically bind human mesothelin. The antigen binding domain has the same or a similar binding specificity to human mesothelin as the FMC63 scFv described in Nicholson et al. Mol. Immun. 34 (16-17): 1157-1165 (1997). The disclosure can relate to an antigen binding domain comprising an antibody or antibody fragment, wherein the antibody binding domain specifically binds to a mesothelin protein or fragment thereof, wherein the antibody or antibody fragment comprises a variable light chain and/or a variable heavy chain that includes an amino acid sequence provided herein. The scFv may be contiguous with and in the same reading frame as a leader sequence.
Anti-MSLN TFP T cells
Stability and Mutations
[00274] The stability of an anti-mesothelin binding domain, e.g., sdAb or scFv molecules (e.g., soluble sdAb or scFv) can be evaluated in reference to the biophysical properties (e.g., thermal stability) of a conventional control scFv molecule or a full length antibody. The humanized or human sdAb or scFv may have a thermal stability that is greater than about 0.1, about 0.25, about 0.5, about 0.75, about 1, about 1.25, about 1.5, about 1.75, about 2, about 2.5, about 3, about 3.5, about 4, about 4.5, about 5, about 5.5, about 6, about 6.5, about 7, about 7.5, about 8, about 8.5, about 9, about 9.5, about 10 degrees, about 11 degrees, about 12 degrees, about 13 degrees, about 14 degrees, or about 15 degrees Celsius than a parent sdAb or scFv in the described assays.
[00275] The improved thermal stability of the anti-mesothelin binding domain, e.g., sdAb or scFv is subsequently conferred to the entire mesothelin-TFP construct, leading to improved therapeutic properties of the anti-mesothelin TFP construct. The thermal stability of the anti-mesothelin binding domain, e.g., sdAb or scFv can be improved by at least about 2 °C or 3 °C as compared to a conventional antibody. The anti-mesothelin binding domain, e.g., sdAb or scFv may have a 1 °C, 2 °C, 3 °C, 4 °C, 5 °C, 6 °C, 7 °C, 8 °C, 9 °C, 10 °C, 11 °C, 12 °C, 13 °C, 14 °C, or 15 °C improved thermal stability as compared to a conventional antibody. Comparisons can be made, for example, between the sdAb or scFv molecules disclosed herein and sdAb or scFv molecules or Fab fragments of an antibody from which the sdAb VHH was derived or the scFv VH and VL were derived. Thermal stability can be measured using methods known in the art. For example, Tj ican be measured. Methods for measuring TM and other methods of determining protein stability are described below.
[00276] Mutations in sdAb or scFv (arising through humanization or mutagenesis of the soluble sdAb or scFv) alter the stability of the sdAb or scFv and improve the overall stability of the sdAb or scFv and the anti-mesothelin TFP construct. Stability of the humanized scFv is compared against the llama sdAb or murine scFv using measurements such as TM, temperature denaturation and temperature
aggregation. The anti-mesothelin binding domain, e.g., a sdAb or scFv, may comprise at least one mutation arising from the humanization process such that the mutated sdAb or scFv confers improved stability to the anti-mesothelin TFP construct. The anti-mesothelin binding domain, e.g., sdAb or scFv may comprise at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 mutations arising from the humanization process such that the mutated sdAb or scFv confers improved stability to the mesothelin-TFP construct.
[00277] The antigen binding domain of the TFP may comprise an amino acid sequence that is homologous to an antigen binding domain amino acid sequence described herein, and the antigen binding domain retains the desired functional properties of the anti-mesothelin antibody fragments described herein. The TFP composition of the disclosure may comprise an antibody fragment, e.g., a sdAb or scFv.
[00278] The antigen binding domain of the TFP can be engineered by modifying one or more amino acids within one or both variable regions (e.g., VHH, VH and/or VL), for example within one or more CDR regions and/or within one or more framework regions. The TFP composition of the disclosure may comprise an antibody fragment, e.g., a sdAb or scFv.
[00279] It will be understood by one of ordinary skill in the art that the antibody or antibody fragment of the TFP may further be modified such that they vary in amino acid sequence (e.g., from wild-type), but not in desired activity. For example, additional nucleotide substitutions leading to amino acid substitutions at “non-essential” amino acid residues may be made to the protein. For example, a nonessential amino acid residue in a molecule may be replaced with another amino acid residue from the same side chain family. A string of amino acids can be replaced with a structurally similar string that differs in order and/or composition of side chain family members, e.g., a conservative substitution, in which an amino acid residue is replaced with an amino acid residue having a similar side chain, may be made.
[00280] Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
[00281] Percent identity in the context of two or more nucleic acids or polypeptide sequences refers to two or more sequences that are the same. Two sequences are “substantially identical” if two sequences have a specified percentage of amino acid residues or nucleotides that are the same (e.g., 60% identity, optionally 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%
identity over a specified region, or, when not specified, over the entire sequence), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. Optionally, the identity exists over a region that is at least about 50 nucleotides (or 10 amino acids) in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides (or 20, 50, 200 or more amino acids) in length.
[00282] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman, (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch, (1970) J. Mol. Biol. 48:443, by the search for similarity method of Pearson and Lipman, (1988) Proc. Nat’ 1. Acad. Sci. USA 85:2444, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection (see, e.g., Brent et al., (2003) Current Protocols in Molecular Biology). Two examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., (1977) Nuc. Acids Res. 25:3389-3402; and Altschul et al., (1990) J. Mol. Biol. 215:403-410, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information.
[00283] The present disclosure contemplates modifications of the starting antibody or fragment (e.g., sdAb or scFv) amino acid sequence that generate functionally equivalent molecules. For example, the VHH and VH or VL of an anti-mesothelin binding domain, e.g., sdAb or scFv, comprised in the TFP can be modified to retain at least about 70%, 71%. 72%. 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% identity of the starting VHH and VH or VL framework region of the anti-mesothelin binding domain, e.g., sdAb or scFv. The present disclosure contemplates modifications of the entire TFP construct, e.g., modifications in one or more amino acid sequences of the various domains of the TFP construct in order to generate functionally equivalent molecules. The TFP construct can be modified
to retain at least about 70%, 71%. 72%. 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity of the starting TFP construct.
Extracellular domain
[00284] The extracellular domain may be derived either from a natural or from a recombinant source. Where the source is natural, the domain may be derived from any protein, but in particular a membrane-bound or transmembrane protein. In one aspect the extracellular domain is capable of associating with the transmembrane domain. An extracellular domain of particular use in this present disclosure may include at least the extracellular region(s) of e.g., the alpha, beta, gamma, or delta chain of the T cell receptor, or CD3 epsilon, CD3 gamma, or CD3 delta, or in alternative embodiments, CD28, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154. In some instances, the TCR extracellular domain comprises an extracellular domain or portion thereof of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, a TCR gamma chain, a TCR delta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications.
[00285] In some embodiments, the TCR extracellular domain comprises an extracellular domain or portion thereof of a TCR alpha chain, a TCR beta chain, a TCR delta chain, or a TCR gamma chain. In some embodiments, the TCR extracellular domain comprises an IgC domain of a TCR alpha chain, a TCR beta chain, a TCR delta chain, or a TCR gamma chain.
[00286] In some embodiments, the extracellular domain comprises, or comprises at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36,
37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63,
64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90,
91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more consecutive amino acid residues of the extracellular domain of a TCR alpha chain, a TCR beta chain, a TCR delta chain, or a TCR gamma chain. In some embodiments, the extracellular domain comprises a sequence having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or more sequence identity to a sequence encoding the extracellular domain of a TCR alpha chain, a TCR beta chain, a TCR delta chain, or a TCR gamma chain. In some embodiments, the extracellular domain comprises a sequence encoding the extracellular domain of a TCR alpha chain, a TCR beta chain, a TCR delta chain, or a TCR gamma chain having a truncation of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more amino acids at the N- or C-terminus or at both the N- and C- terminus.
[00287] In some embodiments, the extracellular domain comprises, or comprises at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36,
37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63,
64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90,
91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more consecutive amino acid residues of an IgC domain of
TCR alpha, a TCR beta, a TCR delta, or a TCR gamma. In some embodiments, the extracellular domain comprises a sequence having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or more sequence identity to a sequence encoding an IgC domain of TCR alpha, a TCR beta, a TCR delta, or a TCR gamma. In some embodiments, the extracellular domain comprises a sequence encoding an IgC domain of TCR alpha, TCR beta, TCR delta, or TCR gamma having a truncation of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more amino acids at the N- or C-terminus or at both the N- and C-terminus.
[00288] In some embodiments, the extracellular domain comprises, or comprises at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36,
37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63,
64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90,
91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more consecutive amino acid residues of the extracellular domain of a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, or a CD3 delta TCR subunit. In some embodiments, the extracellular domain comprises a sequence having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or more sequence identity to a sequence encoding the extracellular domain of a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, or a CD3 delta TCR subunit. In some embodiments, the extracellular domain comprises a sequence encoding the extracellular domain of a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, or a CD3 delta TCR subunit having a truncation of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more amino acids at the N- or C-terminus or at both the bland C-terminus.
Transmembrane Domain
[00289] In general, a TFP sequence contains an extracellular domain and a transmembrane domain encoded by a single genomic sequence. In alternative embodiments, a TFP can be designed to comprise a transmembrane domain that is heterologous to the extracellular domain of the TFP. A transmembrane domain can include one or more additional amino acids adjacent to the transmembrane region, e.g., one or more amino acid associated with the extracellular region of the protein from which the transmembrane was derived (e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or more amino acids of the
extracellular region) and/or one or more additional amino acids associated with the intracellular region of the protein from which the transmembrane protein is derived (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or more amino acids of the intracellular region). In some cases, the transmembrane domain can include at least 30, 35, 40, 45, 50, 55, 60 or more amino acids of the extracellular region. In some cases, the transmembrane domain can include at least 30, 35, 40, 45, 50, 55, 60 or more amino acids of the intracellular region. In one aspect, the transmembrane domain is one that is associated with one of the other domains of the TFP is used. In some instances, the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins, e.g., to minimize interactions with other members of the receptor complex. In one aspect, the transmembrane domain is capable of homodimerization with another TFP on the TFP-T cell surface. In a different aspect the amino acid sequence of the transmembrane domain may be modified or substituted so as to minimize interactions with the binding domains of the native binding partner present in the same TFP.
[00290] The transmembrane domain may be derived either from a natural or from a recombinant source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. In one aspect the transmembrane domain is capable of signaling to the intracellular domain(s) whenever the TFP has bound to a target. In some instances, the TCR- integrating subunit comprises a transmembrane domain comprising a transmembrane domain of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, a TCR gamma chain, a TCR delta chain, a TCR zeta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD28, CD37, CD64, CD80, CD86, CD134, CD137, CD154, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications.
[00291] In some embodiments, the transmembrane domain comprises, or comprises at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 or more consecutive amino acid residues of the transmembrane domain of a TCR alpha chain, a TCR beta chain, a TCR gamma chain, a TCR delta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, or a CD3 delta TCR subunit. In some embodiments, the transmembrane domain comprises a sequence having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or more sequence identity to a sequence encoding the transmembrane domain of a TCR alpha chain, a TCR beta chain, a TCR gamma chain, a TCR delta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, or a CD3 delta TCR subunit. In some embodiments, the transmembrane domain comprises a sequence encoding the transmembrane domain of a TCR alpha chain, a TCR
beta chain, a TCR gamma chain, a TCR delta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, or a CD3 delta TCR subunit having a truncation of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acids at the N- or C-terminus or at both the N- and C-terminus.
[00292] In some instances, the transmembrane domain can be attached to the extracellular region of the TFP, e.g., the antigen binding domain of the TFP, via a hinge, e.g., a hinge from a human protein. For example, in one embodiment, the hinge can be a human immunoglobulin (Ig) hinge, e.g., an IgG4 hinge, or a CD8a hinge.
Linkers
[00293] Optionally, a short oligo- or polypeptide linker, between 2 and 10 amino acids in length may form the linkage between the binding element and the TCR extracellular domain of the TFP. A glycine-serine doublet provides a particularly suitable linker. In some cases, the linker may be at least about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more in length. For example, in one aspect, the linker comprises the amino acid sequence of GGGGSGGGGS or a sequence (GGGGS)x wherein X is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more. In some embodiments, X is 2. In some embodiments, X is 4. In some embodiments, the linker is encoded by a nucleotide sequence of GGTGGCGGAGGTTCTGGAGGTGGAGGTTCC .
Cytoplasmic Domain
[00294] The cytoplasmic domain of the TFP can include an intracellular domain. In some embodiments, the intracellular domain is from CD3 gamma, CD3 delta, CD3 epsilon, TCR alpha, TCR beta, TCR gamma, or TCR delta. In some embodiments, the intracellular domain comprises a signaling domain, if the TFP contains CD3 gamma, delta or epsilon polypeptides; TCR alpha, TCR beta, TCR gamma, and TCR delta subunits generally have short (e.g., 1-19 amino acids in length) intracellular domains and are generally lacking in a signaling domain. An intracellular signaling domain is generally responsible for activation of at least one of the normal effector functions of the immune cell in which the TFP has been introduced. While the intracellular domains of TCR alpha, TCR beta, TCR gamma, and TCR delta do not have signaling domains, they are able to recruit proteins having a primary intracellular signaling domain described herein, e.g., CD3 zeta, which functions as an intracellular signaling domain. The term “effector function” refers to a specialized function of a cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines. Thus the term “intracellular signaling domain” refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain. To the extent that a truncated portion of the intracellular signaling domain is used, such truncated portion may be used in place of the intact chain
as long as it transduces the effector function signal. The term intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
[00295] Examples of intracellular domains for use in the TFP of the present disclosure include the cytoplasmic sequences of the T cell receptor (TCR) and co-receptors that are able to act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any recombinant sequence that has the same functional capability. [00296] In some embodiments, the intracellular domain comprises the intracellular domain of a TCR alpha chain, a TCR beta chain, a TCR gamma chain, a TCR delta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, or a CD3 delta TCR subunit.
[00297] In some embodiments, the intracellular domain comprises, or comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or 19 or more consecutive amino acid residues of the intracellular domain of a TCR alpha chain, a TCR beta chain, a TCR gamma chain, or a TCR delta chain. In some embodiments, the intracellular domain comprises a sequence having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or more sequence identity to a sequence encoding the intracellular domain of a TCR alpha chain, a TCR beta chain, a TCR gamma chain, or a TCR delta chain. In some embodiments, the transmembrane domain comprises a sequence encoding the intracellular domain of a TCR alpha chain, a TCR beta chain, a TCR gamma chain, or a TCR delta chain having a truncation of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acids at the N- or C-terminus or at both the N- and C-terminus.
[00298] In some embodiments, the intracellular domain comprises, or comprises at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, or 62 or more consecutive amino acid residues of the intracellular domain of a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, or a CD3 delta TCR subunit. In some embodiments, the intracellular domain comprises a sequence having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or more sequence identity to a sequence encoding the intracellular domain of a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, or a CD3 delta TCR subunit. In some embodiments, the intracellular domain comprises a sequence encoding the intracellular domain of a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, or a CD3 delta TCR subunit having a truncation of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more amino acids at the N- or C-terminus or at both the N- and C-terminus.
[00299] It is known that signals generated through the TCR alone are insufficient for full activation of naive T cells and that a secondary and/or costimulatory signal is required. Thus, naive T cell
activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequences: those that initiate antigen-dependent primary activation through the TCR (primary intracellular signaling domains) and those that act in an antigen-independent manner to provide a secondary or costimulatory signal (secondary cytoplasmic domain, e.g., a costimulatory domain).
[00300] A primary signaling domain regulates primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way. Primary intracellular signaling domains that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosinebased activation motifs (ITAMs).
[00301] Examples of ITAMs containing primary intracellular signaling domains that are of particular use in the present disclosure include those of CD3 zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, and CD66d. In one embodiment, a TFP of the present disclosure comprises an intracellular signaling domain, e.g., a primary signaling domain of CD3 epsilon, CD3 delta, or CD3 gamma. In one embodiment, a primary signaling domain comprises a modified ITAM domain, e.g., a mutated IT AM domain which has altered (e.g., increased or decreased) activity as compared to the native ITAM domain. In one embodiment, a primary signaling domain comprises a modified ITAM-containing primary intracellular signaling domain, e.g., an optimized and/or truncated ITAM-containing primary intracellular signaling domain. In an embodiment, a primary signaling domain comprises one, two, three, four or more ITAM motifs.
[00302] The intracellular signaling domain of the TFP can comprise a CD3 signaling domain, e.g., CD3 epsilon, CD3 delta, CD3 gamma, or CD3 zeta, by itself or it can be combined with any other desired intracellular signaling domain(s) useful in the context of a TFP of the present disclosure. For example, the intracellular signaling domain of the TFP can comprise a CD3 epsilon chain portion and a costimulatory signaling domain. The costimulatory signaling domain refers to a portion of the TFP comprising the intracellular domain of a costimulatory molecule. A costimulatory molecule is a cell surface molecule other than an antigen receptor or its ligands that is required for an efficient response of lymphocytes to an antigen. Examples of such molecules include CD27, CD28, 4-1BB (CD137), 0X40, CD30, CD40, PD1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83, and the like. For example, CD27 costimulation has been demonstrated to enhance expansion, effector function, and survival of human TFP-T cells in vitro and augments human T cell persistence and antitumor activity in vivo (Song et al., Blood. 2012; 119(3):696-706).
[00303] The intracellular signaling sequences within the cytoplasmic portion of the TFP of the present disclosure may be linked to each other in a random or specified order. Optionally, a short
oligo- or polypeptide linker, for example, between 2 and 10 amino acids (e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids) in length may form the linkage between intracellular signaling sequences.
[00304] In one embodiment, a glycine-serine doublet can be used as a suitable linker. In one embodiment, a single amino acid, e.g., an alanine, a glycine, can be used as a suitable linker.
[00305] In one aspect, the TFP-expressing cell described herein can further comprise a second TFP, e.g., a second TFP that includes a different antigen binding domain, e.g., to the same target (e.g., MSLN) or a different target (e.g., CD70, CD 19, or MUC16). In one embodiment, when the TFP- expressing cell comprises two or more different TFPs, the antigen binding domains of the different TFPs can be such that the antigen binding domains do not interact with one another. For example, a cell expressing a first and second TFP can have an antigen binding domain of the first TFP, e.g., as a fragment, e.g., a scFv, that does not form an association with the antigen binding domain of the second TFP, e.g., the antigen binding domain of the second TFP is a VHH.
[00306] In another aspect, the TFP-expressing cell described herein can further express another agent, e.g., an agent which enhances the activity of a modified T cell. For example, in one embodiment, the agent can be an agent which inhibits an inhibitory molecule. Inhibitory molecules, e.g., PD1, can, in some embodiments, decrease the ability of a modified T cell to mount an immune effector response. Examples of inhibitory molecules include PD1, PD-L1, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD 160, 2B4 and TGFR beta. In one embodiment, the agent which inhibits an inhibitory molecule comprises a first polypeptide, e.g., an inhibitory molecule, associated with a second polypeptide that provides a positive signal to the cell, e.g., an intracellular signaling domain described herein. In one embodiment, the agent comprises a first polypeptide, e.g., of an inhibitory molecule such as PD1, LAG3, CTLA4, CD160, BTLA, LAIR1, TIM3, 2B4 and TIGIT, or a fragment of any of these (e.g., at least a portion of an extracellular domain of any of these), and a second polypeptide which is an intracellular signaling domain described herein (e.g., comprising a costimulatory domain (e.g., 4-1BB, CD27 or CD28, e.g., as described herein) and/or a primary signaling domain (e.g., a CD3 zeta signaling domain described herein). In one embodiment, the agent comprises a first polypeptide of PD1 or a fragment thereof (e.g., at least a portion of an extracellular domain of PD1), and a second polypeptide of an intracellular signaling domain described herein (e.g., a CD28 signaling domain described herein and/or a CD3 zeta signaling domain described herein). PD1 is an inhibitory member of the CD28 family of receptors that also includes CD28, CTLA-4, ICOS, and BTLA. PD-1 is expressed on activated B cells, T cells and myeloid cells (Agata et al., 1996, Int. Immunol 8:765-75). Two ligands for PD1, PD-L1 and PD-L2, have been shown to downregulate T cell activation upon binding to PD1 (Freeman et al., 2000 J. Exp. Med. 192: 1027-34; Latchman et al., 2001 Nat. Immunol. 2:261-8; Carter et al., 2002 Eur. J.
Immunol. 32:634-43). PD-L1 is abundant in human cancers (Dong et al., 2003 J. Mol. Med. 81 :281- 7; Blank et al., 2005 Cancer Immunol. Immunother. 54:307-314; Konishi et al., 2004 Clin. Cancer Res. 10:5094). Immune suppression can be reversed by inhibiting the local interaction of PD1 with PD-L1.
[00307] In one embodiment, the agent comprises the extracellular domain (ECD) of an inhibitory molecule, e.g., Programmed Death 1 (PD1) can be fused to a transmembrane domain and optionally an intracellular signaling domain such as 4 IBB and CD3 zeta (also referred to herein as a PD1 TFP). In one embodiment, the PD1 TFP, when used in combinations with an anti-MSLN TFP described herein, improves the persistence of the T cell. In one embodiment, the TFP is a PD1 TFP comprising the extracellular domain of PD-1. Alternatively, provided are TFPs containing an antibody or antibody fragment such as a scFv that specifically binds to the Programmed Death-Ligand 1 (PD-L1) or Programmed Death-Ligand 2 (PD-L2).
[00308] In another aspect, the present disclosure provides a population of TFP-expressing T cells, e.g., TFP-T cells. In some embodiments, the population of TFP-expressing T cells comprises a mixture of cells expressing different TFPs. For example, in one embodiment, the population of TFP- T cells can include a first cell expressing a TFP having an anti-MSLN binding domain described herein, and a second cell expressing a TFP having a binding domain specifically targeting a different antigen, e.g., a binding domain described herein that differs from the anti-MSLN binding domain in the TFP expressed by the first cell. As another example, the population of TFP-expressing cells can include a first cell expressing a TFP that includes a first binding domain binding domain, e.g., as described herein, and a second cell expressing a TFP that includes an antigen binding domain to a target other than the binding domain of the first cell (e.g., another tumor-associated antigen).
[00309] In another aspect, the present disclosure provides a population of cells wherein at least one cell in the population expresses a TFP having a domain described herein, and a second cell expressing another agent, e.g., an agent which enhances the activity of a modified T cell. For example, in one embodiment, the agent can be an agent which inhibits an inhibitory molecule. Inhibitory molecules, e.g., can, in some embodiments, decrease the ability of a modified T cell to mount an immune effector response. Examples of inhibitory molecules include PD1, PD-L1, PD-L2, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and TGFR beta. In one embodiment, the agent that inhibits an inhibitory molecule comprises a first polypeptide, e.g., an inhibitory molecule, associated with a second polypeptide that provides a positive signal to the cell, e.g., an intracellular signaling domain described herein. In some embodiments, the agent is a cytokine. In some embodiments, the cytokine is IL-15. In some embodiments, IL- 15 increases the persistence of the T cells described herein.
Recombinant Nucleic Acids Encoding a TFP
[00310] Disclosed herein, in some embodiments, are recombinant nucleic acids encoding the TFPs disclosed herein.
[00311] In some instances, the recombinant nucleic acid further comprises a leader sequence. In some instances, the recombinant nucleic acid further comprises a promoter sequence. In some instances, the recombinant nucleic acid further comprises a sequence encoding a poly(A) tail. In some instances, the recombinant nucleic acid further comprises a 3’UTR sequence. In some instances, the nucleic acid is an isolated nucleic acid or a non-naturally occurring nucleic acid. Non- naturally occurring nucleic acids are well known to those of skill in the art. In some instances, the nucleic acid is an in vitro transcribed nucleic acid.
[00312] Disclosed herein are methods for producing in vitro transcribed RNA encoding TFPs. The present disclosure also includes a TFP encoding RNA construct that can be directly transfected into a cell. A method for generating mRNA for use in transfection can involve in vitro transcription (IVT) of a template with specially designed primers, followed by polyA addition, to produce a construct containing 3’ and 5’ untranslated sequence (“UTR”), a 5’ cap and/or Internal Ribosome Entry Site (IRES), the nucleic acid to be expressed, and a polyA tail, typically 50-2000 bases in length. RNA so produced can efficiently transfect different kinds of cells. In one aspect, the template includes sequences for the TFP.
[00313] In one aspect the anti-MSLN TFP is encoded by a messenger RNA (mRNA). In one aspect the mRNA encoding the anti-MSLN TFP is introduced into a T cell for production of a TFP-T cell. In one embodiment, the in vitro transcribed RNA TFP can be introduced to a cell as a form of transient transfection. The RNA is produced by in vitro transcription using a polymerase chain reaction (PCR)-generated template. DNA of interest from any source can be directly converted by PCR into a template for in vitro mRNA synthesis using appropriate primers and RNA polymerase. The source of the DNA can be, for example, genomic DNA, plasmid DNA, phage DNA, cDNA, synthetic DNA sequence or any other appropriate source of DNA. The desired template for in vitro transcription is a TFP of the present disclosure. In one embodiment, the DNA to be used for PCR contains an open reading frame. The DNA can be from a naturally occurring DNA sequence from the genome of an organism. In one embodiment, the nucleic acid can include some or all of the 5’ and/or 3’ untranslated regions (UTRs). The nucleic acid can include exons and introns. In one embodiment, the DNA to be used for PCR is a human nucleic acid sequence. In another embodiment, the DNA to be used for PCR is a human nucleic acid sequence including the 5’ and 3’ UTRs. The DNA can alternatively be an artificial DNA sequence that is not normally expressed in a
naturally occurring organism. An exemplary artificial DNA sequence is one that contains portions of genes that are ligated together to form an open reading frame that encodes a fusion protein. The portions of DNA that are ligated together can be from a single organism or from more than one organism.
[00314] PCR is used to generate a template for in vitro transcription of mRNA which is used for transfection. Methods for performing PCR are well known in the art. Primers for use in PCR are designed to have regions that are substantially complementary to regions of the DNA to be used as a template for the PCR. “Substantially complementary,” as used herein, refers to sequences of nucleotides where a majority or all of the bases in the primer sequence are complementary, or one or more bases are non-complementary, or mismatched. Substantially complementary sequences are able to anneal or hybridize with the intended DNA target under annealing conditions used for PCR. The primers can be designed to be substantially complementary to any portion of the DNA template. For example, the primers can be designed to amplify the portion of a nucleic acid that is normally transcribed in cells (the open reading frame), including 5’ and 3’ UTRs. The primers can also be designed to amplify a portion of a nucleic acid that encodes a particular domain of interest. In one embodiment, the primers are designed to amplify the coding region of a human cDNA, including all or portions of the 5’ and 3’ UTRs. Primers useful for PCR can be generated by synthetic methods that are well known in the art. “Forward primers” are primers that contain a region of nucleotides that are substantially complementary to nucleotides on the DNA template that are upstream of the DNA sequence that is to be amplified. “Upstream” is used herein to refer to a location 5, to the DNA sequence to be amplified relative to the coding strand. “Reverse primers” are primers that contain a region of nucleotides that are substantially complementary to a double-stranded DNA template that are downstream of the DNA sequence that is to be amplified. “Downstream” is used herein to refer to a location 3’ to the DNA sequence to be amplified relative to the coding strand.
[00315] Any DNA polymerase useful for PCR can be used in the methods disclosed herein. The reagents and polymerase are commercially available from a number of sources.
[00316] Chemical structures with the ability to promote stability and/or translation efficiency may also be used. The RNA preferably has 5’ and 3’ UTRs. In one embodiment, the 5’ UTR is between one and 3,000 nucleotides in length. The length of 5’ and 3’ UTR sequences to be added to the coding region can be altered by different methods, including, but not limited to, designing primers for PCR that anneal to different regions of the UTRs. Using this approach, one of ordinary skill in the art can modify the 5’ and 3’ UTR lengths that can be used to achieve optimal translation efficiency following transfection of the transcribed RNA.
[00317] The 5’ and 3’ UTRs can be the naturally occurring, endogenous 5’ and 3’ UTRs for the nucleic acid of interest. Alternatively, UTR sequences that are not endogenous to the nucleic acid of interest can be added by incorporating the UTR sequences into the forward and reverse primers or by any other modifications of the template. The use of UTR sequences that are not endogenous to the nucleic acid of interest can be useful for modifying the stability and/or translation efficiency of the RNA. For example, it is known that AU-rich elements in 3 ’UTR sequences can decrease the stability of mRNA. Therefore, 3’ UTRs can be selected or designed to increase the stability of the transcribed RNA based on properties of UTRs that are well known in the art.
[00318] In one embodiment, the 5’ UTR can contain the Kozak sequence of the endogenous nucleic acid. Alternatively, when a 5’ UTR that is not endogenous to the nucleic acid of interest is being added by PCR as described above, a consensus Kozak sequence can be redesigned by adding the 5’ UTR sequence. Kozak sequences can increase the efficiency of translation of some RNA transcripts, but does not appear to be required for all RNAs to enable efficient translation. In other embodiments the 5’ UTR can be 5 ’UTR of an RNA virus whose RNA genome is stable in cells. In other embodiments various nucleotide analogues can be used in the 3’ or 5’ UTR to impede exonuclease degradation of the mRNA.
[00319] To enable synthesis of RNA from a DNA template without the need for gene cloning, a promoter of transcription should be attached to the DNA template upstream of the sequence to be transcribed. When a sequence that functions as a promoter for an RNA polymerase is added to the 5’ end of the forward primer, the RNA polymerase promoter becomes incorporated into the PCR product upstream of the open reading frame that is to be transcribed. In one preferred embodiment, the promoter is a T7 polymerase promoter, as described elsewhere herein. Other useful promoters include, but are not limited to, T3 and SP6 RNA polymerase promoters. Consensus nucleotide sequences for T7, T3 and SP6 promoters are known in the art.
[00320] In a preferred embodiment, the mRNA has both a cap on the 5’ end and a 3’ poly(A) tail which determine ribosome binding, initiation of translation and stability mRNA in the cell. On a circular DNA template, for instance, plasmid DNA, RNA polymerase produces a long concatameric product which is not suitable for expression in eukaryotic cells. The transcription of plasmid DNA linearized at the end of the 3’ UTR results in normal sized mRNA which is not effective in eukaryotic transfection even if it is polyadenylated after transcription.
[00321] On a linear DNA template, phage T7 RNA polymerase can extend the 3’ end of the transcript beyond the last base of the template (Schenborn and Mierendorf, Nuc Acids Res., 13:6223- 36 (1985); Nacheva and Berzal-Herranz, Eur. J. Biochem., 270: 1485-65 (2003)).
[00322] The conventional method of integration of polyA/T stretches into a DNA template is molecular cloning. However, polyA/T sequence integrated into plasmid DNA can cause plasmid instability, which is why plasmid DNA templates obtained from bacterial cells are often highly contaminated with deletions and other aberrations. This makes cloning procedures not only laborious and time consuming but often not reliable. That is why a method which allows construction of DNA templates with polyA/T 3’ stretch without cloning highly desirable.
[00323] The polyA/T segment of the transcriptional DNA template can be produced during PCR by using a reverse primer containing a polyT tail, such as 100 T tail (size can be 50-5000 Ts), or after PCR by any other method, including, but not limited to, DNA ligation or in vitro recombination. Poly(A) tails also provide stability to RNAs and reduce their degradation. Generally, the length of a poly(A) tail positively correlates with the stability of the transcribed RNA. In one embodiment, the poly(A) tail is between 100 and 5000 adenosines.
[00324] Poly(A) tails of RNAs can be further extended following in vitro transcription with the use of a poly(A) polymerase, such as E. coli polyA polymerase (E-PAP). In one embodiment, increasing the length of a poly(A) tail from 100 nucleotides to between 300 and 400 nucleotides results in about a two-fold increase in the translation efficiency of the RNA. Additionally, the attachment of different chemical groups to the 3’ end can increase mRNA stability. Such attachment can contain modified/artificial nucleotides, aptamers and other compounds. For example, ATP analogs can be incorporated into the poly(A) tail using poly(A) polymerase. ATP analogs can further increase the stability of the RNA.
[00325] 5’ caps on also provide stability to RNA molecules. In a preferred embodiment, RNAs produced by the methods disclosed herein include a 5’ cap. The 5’ cap is provided using techniques known in the art and described herein (Cougot, et al., Trends in Biochem. Sci., 29:436-444 (2001); Stepinski, et al., RNA, 7: 1468-95 (2001); Elango, et al., Biochim. Biophys. Res. Commun., 330:958- 966 (2005)).
[00326] The RNAs produced by the methods disclosed herein can also contain an internal ribosome entry site (IRES) sequence. The IRES sequence may be any viral, chromosomal or artificially designed sequence which initiates cap-independent ribosome binding to mRNA and facilitates the initiation of translation. Any solutes suitable for cell electroporation, which can contain factors facilitating cellular permeability and viability such as sugars, peptides, lipids, proteins, antioxidants, and surfactants can be included.
[00327] RNA can be introduced into target cells using any of a number of different methods, for instance, commercially available methods which include, but are not limited to, electroporation (Amaxa Nucleofector™-II (Amaxa Biosystems, Cologne, Germany)), (ECM 830 (BTX) (Harvard
Instruments, Boston, Mass.) or the Gene Pulser II (BioRad, Denver, Colo.), Multiporator (Eppendort, Hamburg Germany), cationic liposome mediated transfection using lipofection, polymer encapsulation, peptide mediated transfection, or biolistic particle delivery systems such as “gene guns” (see, for example, Nishikawa, et al. Hum Gene Then, 12(8):861-70 (2001)).
[00328] For additional information on making and using TFP T cells, see U.S. Patent Nos. 10,442,849, 10,358,473, 10,358,474, and 10,208,285, each of which is herein incorporated by reference.
Gene Editing of TCR Complex or Endogenous Protein-coding Genes
[00329] In some embodiments, the modified T cells disclosed herein are engineered using a gene editing technique such as clustered regularly interspaced short palindromic repeats (CRISPR®, see, e.g., U.S. Patent No. 8,697,359), transcription activator-like effector (TALE) nucleases (TALENs, see, e.g., U.S. Patent No. 9,393,257), meganucleases (endodeoxyribonucleases having large recognition sites comprising double-stranded DNA sequences of 12 to 40 base pairs), zinc finger nuclease (ZFN, see, e.g., Umov et al., Nat. Rev. Genetics (2010) vl 1, 636-646), or megaTAL nucleases (a fusion protein of a meganuclease to TAL repeats) methods. In this way, a chimeric construct may be engineered to combine desirable characteristics of each subunit, such as conformation or signaling capabilities. See also Sander & Joung, Nat. Biotech. (2014) v32, 347-55; and June et al., 2009 Nature Reviews Immunol. 9.10: 704-716, each incorporated herein by reference. In some embodiments, one or more of the extracellular domain, the transmembrane domain, or the cytoplasmic domain of a TFP subunit are engineered to have aspects of more than one natural TCR subunit domain (e.g., are chimeric).
[00330] Recent developments of technologies to permanently alter the human genome and to introduce site-specific genome modifications in disease relevant genes lay the foundation for therapeutic applications. These technologies are now commonly known as “genome editing.
[00331] In some embodiments, gene editing techniques are employed to disrupt an endogenous TCR gene. In some embodiments, mentioned endogenous TCR gene encodes a TCR alpha chain, a TCR beta chain, or a TCR alpha chain and a TCR beta chain. In some embodiments, mentioned endogenous TCR gene encodes a TCR gamma chain, a TCR delta chain, or a TCR gamma chain and a TCR delta chain. In some embodiments, gene editing techniques pave the way for multiplex genomic editing, which allows simultaneous disruption of multiple genomic loci in endogenous TCR gene. In some embodiments, multiplex genomic editing techniques are applied to generate gene- disrupted T cells that are deficient in the expression of endogenous TCR, and/or human leukocyte antigens (HLAs), and/or programmed cell death protein 1 (PD1), and/or other genes.
[00332] Current gene editing technologies comprise meganucleases, zinc-finger nucleases (ZFN), TAL effector nucleases (TALEN), and clustered regularly interspaced short palindromic repeats (CRISPR)/CRISPR-associated (Cas) system. These four major classes of gene-editing techniques share a common mode of action in binding a user-defined sequence of DNA and mediating a doublestranded DNA break (DSB). DSB may then be repaired by either non-homologous end joining (NHEJ) or -when donor DNA is present- homologous recombination (HR), an event that introduces the homologous sequence from a donor DNA fragment. Additionally, nickase nucleases generate single-stranded DNA breaks (SSB). DSBs may be repaired by single strand DNA incorporation (ssDI) or single strand template repair (ssTR), an event that introduces the homologous sequence from a donor DNA.
[00333] Genetic modification of genomic DNA can be performed using site-specific, rare-cutting endonucleases that are engineered to recognize DNA sequences in the locus of interest. Methods for producing engineered, site-specific endonucleases are known in the art. For example, zinc-finger nucleases (ZFNs) can be engineered to recognize and cut predetermined sites in a genome. ZFNs are chimeric proteins comprising a zinc finger DNA-binding domain fused to the nuclease domain of the Fokl restriction enzyme. The zinc finger domain can be redesigned through rational or experimental means to produce a protein that binds to a pre-determined DNA sequence -18 basepairs in length. By fusing this engineered protein domain to the Fokl nuclease, it is possible to target DNA breaks with genome-level specificity. ZFNs have been used extensively to target gene addition, removal, and substitution in a wide range of eukaryotic organisms (reviewed in Durai et al. (2005) Nucleic Acids Res 33, 5978). Likewise, TAL-effector nucleases (TALENs) can be generated to cleave specific sites in genomic DNA. Like a ZFN, a TALEN comprises an engineered, site-specific DNA-binding domain fused to the Fokl nuclease domain (reviewed in Mak et al. (2013), Curr Opin Struct Biol. 23:93-9). In this case, however, the DNA binding domain comprises a tandem array of TAL-effector domains, each of which specifically recognizes a single DNA basepair. Compact TALENs have an alternative endonuclease architecture that avoids the need for dimerization (Beurdeley et al. (2013), Nat Commun. 4: 1762). A Compact TALEN comprises an engineered, site-specific TAL-effector DNA-binding domain fused to the nuclease domain from the I-TevI homing endonuclease. Unlike Fokl, I-TevI does not need to dimerize to produce a double-strand DNA break so a Compact TALEN is functional as a monomer.
[00334] Engineered endonucleases based on the CRISPR/Cas9 system are also known in the art (Ran et al. (2013), Nat Protoc. 8:2281-2308; Mali et al. (2013), Nat Methods 10:957-63). The CRISPR gene-editing technology is composed of an endonuclease protein whose DNA-targeting specificity and cutting activity can be programmed by a short guide RNA or a duplex crRNA/TracrRNA. A
CRISPR endonuclease comprises two components: (1) a caspase effector nuclease, typically microbial Cas9; and (2) a short "guide RNA" or a RNA duplex comprising a 18 to 20 nucleotide targeting sequence that directs the nuclease to a location of interest in the genome. By expressing multiple guide RNAs in the same cell, each having a different targeting sequence, it is possible to target DNA breaks simultaneously to multiple sites in the genome (multiplex genomic editing). [00335] There are two classes of CRISPR systems known in the art (Adli (2018) Nat. Commun. 9: 1911), each containing multiple CRISPR types. Class 1 contains type I and type III CRISPR systems that are commonly found in Archaea. And, Class II contains type II, IV, V, and VI CRISPR systems. Although the most widely used CRISPR/Cas system is the type II CRISPR-Cas9 system, CRISPR/Cas systems have been repurposed by researchers for genome editing. More than 10 different CRISPR/Cas proteins have been remodeled within last few years (Adli (2018) Nat. Commun. 9: 1911). Among these, such as Casl2a (Cpfl) proteins from Acidaminococcus sp (AsCpfl) and Lachnospiraceae bacterium (LbCpfl), are particularly interesting.
[00336] Homing endonucleases are a group of naturally occurring nucleases that recognize 15-40 base-pair cleavage sites commonly found in the genomes of plants and fungi. They are frequently associated with parasitic DNA elements, such as group 1 self-splicing introns and inteins. They naturally promote homologous recombination or gene insertion at specific locations in the host genome by producing a double -stranded break in the chromosome, which recruits the cellular DNA- repair machinery (Stoddard (2006), Q. Rev. Biophys. 38: 49-95). Specific amino acid substations could reprogram DNA cleavage specificity of homing nucleases (Niyonzima (2017), Protein Eng Des Sei. 30(7): 503-522). Meganucleases (MN) are monomeric proteins with innate nuclease activity that are derived from bacterial homing endonucleases and engineered for a unique target site (Gersbach (2016), Molecular Therapy. 24: 430-446). In some embodiments, meganuclease is engineered I-Crel homing endonuclease. In other embodiments, meganuclease is engineered I-Scel homing endonuclease.
[00337] In addition to mentioned four major gene editing technologies, chimeric proteins comprising fusions of meganucleases, ZFNs, and TALENs have been engineered to generate novel monomeric enzymes that take advantage of the binding affinity of ZFNs and TALENs and the cleavage specificity of meganucleases (Gersbach (2016), Molecular Therapy. 24: 430-446). For example, A megaTAL is a single chimeric protein, which is the combination of the easy-to-tailor DNA binding domains from TALENs with the high cleavage efficiency of meganucleases.
[00338] In order to perform the gene editing technique, the nucleases, and in the case of the CRISPR/ Cas9 system, a gRNA, must be efficiently delivered to the cells of interest. Delivery methods such as physical, chemical, and viral methods are also know in the art (Mali (2013). Indian
J. Hum. Genet. 19: 3-8.). In some instances, physical delivery methods can be selected from the methods but not limited to electroporation, microinjection, or use of ballistic particles. On the other hand, chemical delivery methods require use of complex molecules such calcium phosphate, lipid, or protein. In some embodiments, viral delivery methods are applied for gene editing techniques using viruses such as but not limited to adenovirus, lentivirus, and retrovirus.
Vectors
[00339] In some embodiments, the instant disclosure provides vectors comprising the recombinant nucleic acid(s) encoding the TFP and/or additional molecules of interest (e.g., a protein or proteins to be secreted by the TFP T cell). In some instances, the vector is selected from the group consisting of a DNA, a RNA, a plasmid, a lentivirus vector, adenoviral vector, an adeno-associated viral vector (AAV), a Rous sarcoma viral (RSV) vector, or a retrovirus vector. In some instances, the vector is an AAV6 vector. In some instances, the vector further comprises a promoter. In some instances, the vector is an in vitro transcribed vector.
[00340] The nucleic acid sequences coding for the desired molecules can be obtained using recombinant methods known in the art, such as, for example by screening libraries from cells expressing the gene, by deriving the gene from a vector known to include the same, or by isolating directly from cells and tissues containing the same, using standard techniques. Alternatively, the gene of interest can be produced synthetically, rather than cloned.
[00341] The present disclosure also provides vectors in which a DNA of the present disclosure is inserted. Vectors derived from retroviruses such as the lentivirus are suitable tools to achieve longterm gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells. Lenti viral vectors have the added advantage over vectors derived from onco- retroviruses such as murine leukemia viruses in that they can transduce non-proliferating cells, such as hepatocytes. They also have the added advantage of low immunogenicity.
[00342] In another embodiment, the vector comprising the nucleic acid encoding the desired TFP of the present disclosure is an adenoviral vector (A5/35). In another embodiment, the expression of nucleic acids encoding TFPs can be accomplished using of transposons such as sleeping beauty, crisper, CAS9, and zinc finger nucleases. See, e.g., June et al., 2009 Nature Reviews Immunology 9.10: 704-716, which is incorporated herein by reference.
[00343] The TFP of the present invention may be used in multi ci stronic vectors or vectors expressing several proteins in the same transcriptional unit. Such vectors may use internal ribosomal entry sites (IRES). Since IRES are not functional in all hosts and do not allow for the stoichiometric expression of multiple protein, self-cleaving peptides may be used instead. For example, several viral
peptides are cleaved during translation and allow for the expression of multiple proteins form a single transcriptional unit. Such peptides include 2A-peptides, or 2A-like sequences, from members of the Picornaviridae virus family. See for example Szymczak et al., 2004, Nature Biotechnology; 22:589-594. In some embodiments, the recombinant nucleic acid described herein encodes the TFP in frame with the agent, with the two sequences separated by a self-cleaving peptide, such as a 2A sequence, or a T2A sequence.
[00344] The expression constructs of the present disclosure may also be used for nucleic acid immunization and gene therapy, using standard gene delivery protocols. Methods for gene delivery are known in the art (see, e.g., U.S. Pat. Nos. 5,399,346, 5,580,859, 5,589,466, each of which is incorporated by reference herein in their entireties). In another embodiment, the present disclosure provides a gene therapy vector.
[00345] The nucleic acid can be cloned into a number of types of vectors. For example, the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
[00346] Further, the expression vector may be provided to a cell in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al., 2012, Molecular Cloning: A Laboratory Manual, volumes 1-4, Cold Spring Harbor Press, NY), and in other virology and molecular biology manuals. Viruses, which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers, (e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193).
[00347] A number of virally based systems have been developed for gene transfer into mammalian cells. For example, retroviruses provide a convenient platform for gene delivery systems. A selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo. A number of retroviral systems are known in the art. In some embodiments, adenovirus vectors are used. A number of adenovirus vectors are known in the art. In one embodiment, lentivirus vectors are used.
[00348] Additional promoter elements, e.g., enhancers, regulate the frequency of transcriptional initiation. Typically, these are located in the region 30-110 bp upstream of the start site, although a number of promoters have been shown to contain functional elements downstream of the start site as well. The spacing between promoter elements frequently is flexible, so that promoter function is
preserved when elements are inverted or moved relative to one another. In the thymidine kinase (tk) promoter, the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline. Depending on the promoter, it appears that individual elements can function either cooperatively or independently to activate transcription.
[00349] An example of a promoter that is capable of expressing a TFP transgene in a mammalian T cell is the EFla promoter. The native EFla promoter drives expression of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. The EFla promoter has been extensively used in mammalian expression plasmids and has been shown to be effective in driving TFP expression from transgenes cloned into a lentiviral vector (see, e.g., Milone et al., Mol. Ther. 17(8): 1453-1464 (2009)). Another example of a promoter is the immediate early cytomegalovirus (CMV) promoter sequence. This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto. However, other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the elongation factor- la promoter, the hemoglobin promoter, and the creatine kinase promoter. Further, the present disclosure should not be limited to the use of constitutive promoters. Inducible promoters are also contemplated as part of the present disclosure. The use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively linked when such expression is desired or turning off the expression when expression is not desired. Examples of inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline-regulated promoter.
[00350] In order to assess the expression of a TFP polypeptide or portions thereof, the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors. In other aspects, the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells. Useful selectable markers include, for example, antibiotic-resistance genes, such as neo and the like.
[00351] Reporter genes are used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences. In general, a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells. Suitable reporter genes may include genes encoding luciferase, beta-galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tei et al., 2000 FEBS Letters 479: 79-82). Suitable expression systems are well known and may be prepared using known techniques or obtained commercially. In general, the construct with the minimal 5’ flanking region showing the highest level of expression of reporter gene is identified as the promoter. Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.
[00352] Methods of introducing and expressing genes into a cell are known in the art. In the context of an expression vector, the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art. For example, the expression vector can be transferred into a host cell by physical, chemical, or biological means.
[00353] Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al., 2012, Molecular Cloning: A Laboratory Manual, volumes 1-4, Cold Spring Harbor Press, NY). A preferred method for the introduction of a polynucleotide into a host cell is calcium phosphate transfection.
[00354] Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors. Viral vectors, and especially retroviral vectors, have become the most widely used method for inserting genes into mammalian, e.g., human cells. Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses and adeno-associated viruses, and the like (see, e.g., U.S. Pat. Nos. 5,350,674 and 5,585,362.
[00355] Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle). Other methods of state-of-the-art targeted delivery of nucleic acids are available, such as delivery of polynucleotides with targeted nanoparticles or other suitable submicron sized delivery system.
[00356] In the case where a non-viral delivery system is utilized, an exemplary delivery vehicle is a liposome. The use of lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo or in vivo). In another aspect, the nucleic acid may be associated with a lipid. The nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid. Lipid, lipid/DNA or lipid/expression vector associated compositions are not limited to any particular structure in solution. For example, they may be present in a bilayer structure, as micelles, or with a “collapsed” structure. They may also simply be interspersed in a solution, possibly forming aggregates that are not uniform in size or shape. Lipids are fatty substances which may be naturally occurring or synthetic lipids. For example, lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
[00357] Lipids suitable for use can be obtained from commercial sources. For example, dimyristyl phosphatidylcholine (“DMPC”) can be obtained from Sigma, St. Louis, Mo.; dicetyl phosphate (“DCP”) can be obtained from K & K Laboratories (Plainview, N.Y.); cholesterol (“Choi”) can be obtained from Calbiochem-Behring; dimyristyl phosphatidylglycerol (“DMPG”) and other lipids may be obtained from Avanti Polar Lipids, Inc. (Birmingham, Ala.). Stock solutions of lipids in chloroform or chloroform/methanol can be stored at about -20 °C. Chloroform is used as the only solvent since it is more readily evaporated than methanol. “Liposome” is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes can be characterized as having vesicular structures with a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution. The lipid components undergo self-rearrangement before the formation of closed structures and entrap water and dissolved solutes between the lipid bilayers (Ghosh et al., 1991 Glycobiology 5: 505-10). However, compositions that have different structures in solution than the normal vesicular structure are also encompassed. For example, the lipids may assume a micellar structure or merely exist as nonuniform aggregates of lipid molecules. Also contemplated are lipofectamine-nucleic acid complexes.
[00358] Regardless of the method used to introduce exogenous nucleic acids into a host cell or otherwise expose a cell to the inhibitor of the present disclosure, in order to confirm the presence of the recombinant DNA sequence in the host cell, a variety of assays may be performed. Such assays include, for example, “molecular biological” assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR; “biochemical” assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and western blots) or by assays described herein to identify agents falling within the scope of the present disclosure.
[00359] The present disclosure further provides a vector comprising a TFP encoding nucleic acid molecule. In one aspect, a TFP vector can be directly transduced into a cell, e.g., a T cell. In one aspect, the vector is a cloning or expression vector, e.g., a vector including, but not limited to, one or more plasmids (e.g., expression plasmids, cloning vectors, minicircles, minivectors, double minute chromosomes), retroviral and lentiviral vector constructs. In one aspect, the vector is capable of expressing the TFP construct in mammalian T cells. In one aspect, the mammalian T cell is a human T cell.
Circular RNA
[00360] In some embodiments, TFP T cells are transduced with an RNA molecule. In some embodiments, the RNA is circular RNA. In some embodiments, the circular RNA is exogenous. In other embodiments, circular RNA is endogenous. In other embodiments, circular RNAs with an internal ribosomal entry site (IRES) can be translated in vitro or in vivo or ex vivo.
[00361] Circular RNAs are a class of single-stranded RNAs with a contiguous structure that have enhanced stability and a lack of end motifs necessary for interaction with various cellular proteins. Circular RNAs are 3-5’ covalently closed RNA rings, and circular RNAs do not display Cap or poly(A) tails. Since circular RNAs lack the free ends necessary for exonuclease-mediated degradation, rendering them resistant to several mechanisms of RNA turnover and granting them extended lifespans as compared to their linear mRNA counterparts. For this reason, circularization may allow for the stabilization of mRNAs that generally suffer from short half-lives and may therefore improve the overall efficacy of mRNA in a variety of applications. Circular RNAs are produced by the process of splicing, and circularization occurs using conventional splice sites mostly at annotated exon boundaries (Starke et al., 2015; Szabo et al., 2015). For circularization, splice sites are used in reverse: downstream splice donors are “backspliced” to upstream splice acceptors (see Jeck and Sharpless, 2014; Barrett and Salzman, 2016; Szabo and Salzman, 2016; Holdt et al., 2018 for review).
[00362] To generate circular RNAs that we could subsequently transfer into cells, in vitro production of circular RNAs with autocatalytic-splicing introns can be programmed. A method for generating circular RNA can involve in vitro transcription (IVT) of a precursor linear RNA template with specially designed primers. Three general strategies have been reported so far for RNA circularization: chemical methods using cyanogen bromide or a similar condensing agent, enzymatic methods using RNA or DNA ligases, and ribozymatic methods using self-splicing introns. In preferred embodiments, precursor RNA was synthesized by run-off transcription and then heated in the presence of magnesium ions and GTP to promote circularization. RNA so produced can efficiently transfect different kinds of cells. In one aspect, the template includes sequences for the TFP, CAR, and TCR, or combination thereof.
[00363] The group I intron of phage T4 thymidylate synthase (td) gene is well characterized to circularize while the exons linearly splice together (Chandry and Bel- fort, 1987; Ford and Ares, 1994; Perriman and Ares, 1998). When the td intron order is permuted flanking any exon sequence, the exon is circularized via two autocatalytic transesterification reactions (Ford and Ares, 1994; Puttaraju and Been, 1995). In preferred embodiments, the group I intron of phage T4 thymidylate synthase (td) gene is used to generate exogenous circular RNA.
[00364] In some exemplary embodiments, a ribozymatic method utilizing a permuted group I catalytic intron has been used since it is more applicable to long RNA circularization and requires only the addition of GTP and Mg2+ as cofactors. This permuted intron-exon (PIE) splicing strategy consists of fused partial exons flanked by half-intron sequences. In vitro, these constructs undergo the double transesterification reactions characteristic of group I catalytic introns, but because the exons are fused, they are excised as covalently 5’ to 3’ linked circles.
[00365] In one aspect, disclosed herein is a sequence containing a full-length encephalomyocarditis virus (such as EMCV) IRES, a gene encoding a TFP, a CAR, a TCR or combination thereof, two short regions corresponding to exon fragments (El and E2), and of the PIE construct between the 3’ and 5’ introns of the permuted group I catalytic intron in the thymidylate synthase (Td) gene of the T4 phage or the permuted group I catalytic intron in the pre-tRNA gene of Anabaena. In more preferred embodiments, the mentioned sequence further comprises complementary “homology arms” placed at the 5’ and 3’ ends of the precursor RNA with the aim of bringing the 5’ and 3’ splice sites into proximity of one another. To ensure that the major splicing product was circular, the splicing reaction can be treated with RNase R.
[00366] In one aspect, the anti-MSLN TFP is encoded by a circular RNA. In one aspect the circular RNA encoding the anti-MSLN TFP is introduced into a T cell for production of a TFP-T cell. In one
embodiment, the in vitro transcribed RNA TFP can be introduced to a cell as a form of transient transfection.
[00367] In some aspects, linear precursor RNA is produced by in vitro transcription using a polymerase chain reaction (PCR)-generated template as is described herein.
[00368] For additional information on TFP T cells produced by the methods above, see International Application No. PCT/US20/29344, which is herein incorporated by reference.
Therapeutic Applications
[00369] The TFP T cells provided herein may be useful for the treatment of any disease or condition involving mesothelin over-expression. In some embodiments, the disease or condition is a disease or condition that can benefit from treatment with adoptive cell therapy. In some embodiments, the disease or condition is a tumor. In some embodiments, the disease or condition is a cell proliferative disorder. In some embodiments, the disease or condition is a cancer.
[00370] In some embodiments, provided herein is a method of treating a disease or condition in a subject in need thereof by administering an effective amount of a TFP T cell provided herein to the subject. In some aspects, the disease or condition is a cancer.
[00371] Any suitable cancer may be treated with the TFP T cells provided herein. Illustrative suitable cancers include, for example, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), adrenocortical carcinoma, anal cancer, appendix cancer, astrocytoma, basal cell carcinoma, brain tumor, bile duct cancer, bladder cancer, bone cancer, breast cancer, bronchial tumor, carcinoma of unknown primary origin, cardiac tumor, cervical cancer, chordoma, colon cancer, colorectal cancer, craniopharyngioma, ductal carcinoma, embryonal tumor, endometrial cancer, ependymoma, esophageal cancer, esthesioneuroblastoma, fibrous histiocytoma, Ewing sarcoma, eye cancer, germ cell tumor, gallbladder cancer, gastric cancer, gastrointestinal carcinoid tumor, gastrointestinal stromal tumor, gestational trophoblastic disease, glioma, head and neck cancer, hepatocellular cancer, histiocytosis, Hodgkin lymphoma, hypopharyngeal cancer, intraocular melanoma, islet cell tumor, Kaposi sarcoma, kidney cancer, Langerhans cell histiocytosis, laryngeal cancer, lip and oral cavity cancer, liver cancer, lobular carcinoma in situ, lung cancer, macroglobulinemia, malignant fibrous histiocytoma, melanoma, Merkel cell carcinoma, mesothelioma, metastatic squamous neck cancer with occult primary, midline tract carcinoma involving NUT gene, mouth cancer, multiple endocrine neoplasia syndrome, multiple myeloma, mycosis fungoides, myelodysplastic syndrome, myelodysplastic/myeloproliferative neoplasm, nasal cavity and par nasal sinus cancer, nasopharyngeal cancer, neuroblastoma, non-small cell lung cancer, oropharyngeal cancer, osteosarcoma, ovarian cancer, pancreatic cancer, papillomatosis, paraganglioma, parathyroid cancer, penile cancer,
pharyngeal cancer, pheochromocytomas, pituitary tumor, pleuropulmonary blastoma, primary central nervous system lymphoma, prostate cancer, rectal cancer, renal cell cancer, renal pelvis and ureter cancer, retinoblastoma, rhabdoid tumor, salivary gland cancer, Sezary syndrome, skin cancer, small cell lung cancer, small intestine cancer, soft tissue sarcoma, spinal cord tumor, stomach cancer, T cell lymphoma, teratoid tumor, testicular cancer, throat cancer, thymoma and thymic carcinoma, thyroid cancer, urethral cancer, uterine cancer, vaginal cancer, vulvar cancer, and Wilms tumor.
Modified T cells
[00372] Disclosed herein are modified T cells comprising the sequence encoding the TFP of the nucleic acid disclosed herein or a TFP encoded by the sequence of the nucleic acid disclosed herein. Further disclosed herein, in some embodiments, are modified allogenic T cells comprising the sequence encoding the TFP disclosed herein or a TFP encoded by the sequence of the nucleic acid disclosed herein.
[00373] In some embodiments, the modified T cells comprising the recombinant nucleic acid disclosed herein, or the vectors disclosed herein comprises a functional disruption of an endogenous TCR. Further disclosed herein, in some embodiments, are modified allogenic T cells comprising the sequence encoding the TFP disclosed herein or a TFP encoded by the sequence of the nucleic acid disclosed herein.
[00374] In some instances, the T cell further comprises a heterologous sequence encoding a TCR constant domain, wherein the TCR constant domain is a TCR alpha constant domain, a TCR beta constant domain or a TCR alpha constant domain and a TCR beta constant domain. In some instances, the endogenous TCR that is functionally disrupted is an endogenous TCR alpha chain, an endogenous TCR beta chain, or an endogenous TCR alpha chain and an endogenous TCR beta chain. In some instances, the T cell further comprises a heterologous sequence encoding a TCR constant domain, wherein the TCR constant domain is a TCR gamma constant domain, a TCR delta constant domain or a TCR gamma constant domain and a TCR delta constant domain. In some instances, the endogenous TCR that is functionally disrupted is an endogenous TCR gamma chain, an endogenous TCR delta chain, or an endogenous TCR gamma chain and an endogenous TCR delta chain. In some instances, the endogenous TCR that is functionally disrupted has reduced binding to MHC-peptide complex compared to that of an unmodified control T cell. In some instances, the functional disruption is a disruption of a gene encoding the endogenous TCR. In some instances, the disruption of a gene encoding the endogenous TCR is a removal of a sequence of the gene encoding the endogenous TCR from the genome of a T cell. In some instances, the T cell is a human T cell. In some instances, the T cell is a CD8+ or CD4+ T cell. In some instances, the T cell is an allogenic T
cell. In some instances, the T cell is a TCR alpha-beta T cell. In some instances, the T cell is a TCR gamma-delta T cell. In some instances, one or more of TCR alpha, TCR beta, TCR gamma, and TCR delta have been modified to produce an allogeneic T cell. See, e.g., copending PCT Publication No. WO2019173693, which is herein incorporated by reference.
[00375] In some embodiments, the modified T cells are y6 T cells and do not comprise a functional disruption of an endogenous TCR. In some embodiments, the y6 T cells are V<51+ V<52- y<5 T cells. In some embodiments, the y6 T cells are V<51- V<52+ y<5 T cells. In some embodiments, the y6 T cells are V<51- V<52- y<5 T cells.
[00376] In some instances, the modified T cells further comprise a nucleic acid encoding an inhibitory molecule that comprises a first polypeptide comprising at least a portion of an inhibitory molecule, associated with a second polypeptide comprising a positive signal from an intracellular signaling domain. In some instances, the inhibitory molecule comprises the first polypeptide comprising at least a portion of PD1 and the second polypeptide comprising a costimulatory domain and primary signaling domain.
Sources of T cells
[00377] Prior to expansion and genetic modification, a source of T cells is obtained from a subject. The term “subject” is intended to include living organisms in which an immune response can be elicited (e.g., mammals). Examples of subjects include humans, dogs, cats, mice, rats, and transgenic species thereof. T cells can be obtained from a number of sources, including peripheral blood mononuclear cells (PBMCs), bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In some embodiments, T cells can be obtained from a leukopak. In certain aspects of the present disclosure, any number of T cell lines available in the art, may be used. In certain aspects of the present disclosure, T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as Ficoll™ separation. In one preferred aspect, cells from the circulating blood of an individual are obtained by apheresis. The apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets. In one aspect, the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps. In one aspect of the present disclosure, the cells are washed with phosphate buffered saline (PBS). In an alternative aspect, the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations. Initial activation steps in the absence of calcium can lead to
magnified activation. As those of ordinary skill in the art would readily appreciate a washing step may be accomplished by methods known to those in the art, such as by using a semi-automated “flow-through” centrifuge (for example, the Cobe® 2991 cell processor, the Baxter Oncology CytoMate, or the Haemonetics® Cell Saver® 5) according to the manufacturer’s instructions. After washing, the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca-free, Mg-free PBS, PlasmaLyte A, or other saline solution with or without buffer. Alternatively, the undesirable components of the apheresis sample may be removed, and the cells directly resuspended in culture media.
[00378] In embodiments, the T cells are aP T cells. In some embodiments, the T cells are y6 T cells. y6 T cells are obtained from a bank of umbilical cord blood, peripheral blood, human embryonic stem cells, or induced pluripotent stem cells, for example.
[00379] In one aspect, T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLL® gradient or by counterflow centrifugal elutriation. A specific subpopulation of T cells, such as CD3+, CD28+, CD4+, CD8+, CD45RA+, CD45RO+, alpha-beta, or gamma-delta T cells, can be further isolated by positive or negative selection techniques. For example, in one aspect, CD4+ and CD8+ T cells are isolated with anti-CD4 and anti-CD8 microbeads. In another aspect, T cells are isolated by incubation with anti-CD3/anti-CD28 (e.g., 3x28)-conjugated beads, such as DYNABEADS® M-450 CD3/CD28 T or Trans-Act® beads, for a time period sufficient for positive selection of the desired T cells. In one aspect, the time period is about 30 minutes. In a further aspect, the time period ranges from 30 minutes to 36 hours or longer and all integer values there between. In a further aspect, the time period is at least 1, 2, 3, 4, 5, or 6 hours. In yet another preferred aspect, the time period is 10 to 24 hours. In one aspect, the incubation time period is 24 hours. Longer incubation times may be used to isolate T cells in any situation where there are few T cells as compared to other cell types, such in isolating tumor infiltrating lymphocytes (TIL) from tumor tissue or from immunocompromised individuals. Further, use of longer incubation times can increase the efficiency of capture of CD8+ T cells. Thus, by simply shortening or lengthening the time T cells are allowed to bind to the CD3/CD28 beads and/or by increasing or decreasing the ratio of beads to T cells (as described further herein), subpopulations of T cells can be preferentially selected for or against at culture initiation or at other time points during the process. Additionally, by increasing or decreasing the ratio of anti-CD3 and/or anti-CD28 antibodies on the beads or other surface, subpopulations of T cells can be preferentially selected for or against at culture initiation or at other desired time points. The skilled artisan would recognize that multiple rounds of selection can also be used in the context of this present disclosure. In certain aspects, it may be desirable to perform the selection procedure
and use the “unselected” cells in the activation and expansion process. “Unselected” cells can also be subjected to further rounds of selection.
[00380] Enrichment of a T cell population by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells. One method is cell sorting and/or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected. For example, to enrich for CD4+ cells by negative selection, a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CDl lb, CD16, HLA-DR, and CD8. In certain aspects, it may be desirable to enrich for or positively select for regulatory T cells which typically express CD4+, CD25+, CD62Lhi, GITR+, and FoxP3+. Alternatively, in certain aspects, T regulatory cells are depleted by anti-C25 conjugated beads or other similar method of selection.
[00381] In one embodiment, a T cell population can be selected that expresses one or more of IFN-y TNF-alpha, IL-17A, IL-2, IL-3, IL-4, GM-CSF, IL-10, IL-13, granzyme B, and perforin, or other appropriate molecules, e.g., other cytokines. Methods for screening for cell expression can be determined, e.g., by the methods described in PCT Publication No. WO2013126712, which is herein incorporated by reference.
[00382] For isolation of a desired population of cells by positive or negative selection, the concentration of cells and surface (e.g., particles such as beads) can be varied. In certain aspects, it may be desirable to significantly decrease the volume in which beads and cells are mixed together (e.g., increase the concentration of cells), to ensure maximum contact of cells and beads. For example, in one aspect, a concentration of 2 billion cells/mL is used. In one aspect, a concentration of 1 billion cells/mL is used. In a further aspect, greater than 100 million cells/mL is used. In a further aspect, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/mL is used. In yet one aspect, a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/mL is used. In further aspects, concentrations of 125 or 150 million cells/mL can be used. Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells, or from samples where there are many tumor cells present (e.g., leukemic blood, tumor tissue, etc.). Such populations of cells may have therapeutic value and would be desirable to obtain. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.
[00383] In a related aspect, it may be desirable to use lower concentrations of cells. By significantly diluting the mixture of T cells and surface (e.g., particles such as beads), interactions between the particles and cells is minimized. This selects for cells that express high amounts of desired antigens
to be bound to the particles. For example, CD4+ T cells express higher levels of CD28 and are more efficiently captured than CD8+ T cells in dilute concentrations. In one aspect, the concentration of cells used is 5xlO6/mL. In other aspects, the concentration used can be from about lxlO5/mL to lxlO6/mL, and any integer value in between. In other aspects, the cells may be incubated on a rotator for varying lengths of time at varying speeds at either 2-10 °C or at room temperature.
[00384] T cells for stimulation can also be frozen after a washing step. Wishing not to be bound by theory, the freeze and subsequent thaw step provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population. After the washing step that removes plasma and platelets, the cells may be suspended in a freezing solution. While many freezing solutions and parameters are known in the art and will be useful in this context, one method involves using PBS containing 20% DMSO and 8% human serum albumin, or culture media containing 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin and 7.5% DMSO, or 31.25% Plasmalyte-A, 31.25% Dextrose 5%, 0.45% NaCl, 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin, and 7.5% DMSO or other suitable cell freezing media containing for example, Hespan and PlasmaLyte A, the cells then are frozen to -80 °C at a rate of 1 per minute and stored in the vapor phase of a liquid nitrogen storage tank. Other methods of controlled freezing may be used as well as uncontrolled freezing immediately at -20 °C or in liquid nitrogen. In certain aspects, cryopreserved cells are thawed and washed as described herein and allowed to rest for one hour at room temperature prior to activation using the methods of the present disclosure.
[00385] Also contemplated in the context of the present disclosure is the collection of blood samples or apheresis product from a subject at a time period prior to when the expanded cells as described herein might be needed. As such, the source of the cells to be expanded can be collected at any time point necessary, and desired cells, such as T cells, isolated and frozen for later use in T cell therapy for any number of diseases or conditions that would benefit from T cell therapy, such as those described herein. In one aspect a blood sample or an apheresis is taken from a generally healthy subject. In certain aspects, a blood sample or an apheresis is taken from a generally healthy subject who is at risk of developing a disease, but who has not yet developed a disease, and the cells of interest are isolated and frozen for later use. In certain aspects, the T cells may be expanded, frozen, and used at a later time. In certain aspects, samples are collected from a patient shortly after diagnosis of a particular disease as described herein but prior to any treatments. In a further aspect, the cells are isolated from a blood sample or an apheresis from a subject prior to any number of relevant treatment modalities, including but not limited to treatment with agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents such as cyclosporin, azathioprine, methotrexate, and mycophenolate, antibodies, or other immunoablative
agents such as alemtuzumab, anti-CD3 antibodies, cytoxan, fludarabine, cyclosporin, tacrolimus, rapamycin, mycophenolic acid, steroids, romidepsin, and irradiation.
[00386] In a further aspect of the present disclosure, T cells are obtained from a patient directly following treatment that leaves the subject with functional T cells. In this regard, it has been observed that following certain cancer treatments, in particular treatments with drugs that damage the immune system, shortly after treatment during the period when patients would normally be recovering from the treatment, the quality of T cells obtained may be optimal or improved for their ability to expand ex vivo. Likewise, following ex vivo manipulation using the methods described herein, these cells may be in a preferred state for enhanced engraftment and in vivo expansion. Thus, it is contemplated within the context of the present disclosure to collect blood cells, including T cells, dendritic cells, or other cells of the hematopoietic lineage, during this recovery phase. Further, in certain aspects, mobilization (for example, mobilization with GM-CSF) and conditioning regimens can be used to create a condition in a subject wherein repopulation, recirculation, regeneration, and/or expansion of particular cell types is favored, especially during a defined window of time following therapy. Illustrative cell types include T cells, B cells, dendritic cells, and other cells of the immune system.
Activation and Expansion of T Cells
[00387] T cells may be activated and expanded generally using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041, and 7,572,631.
[00388] Generally, the T cells of the present disclosure may be expanded by contact with a surface having attached thereto an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a costimulatory molecule on the surface of the T cells. In particular, T cell populations may be stimulated as described herein, such as by contact with an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore. For costimulation of an accessory molecule on the surface of the T cells, a ligand that binds the accessory molecule is used. For example, a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells. To stimulate proliferation of either CD4+ T cells, CD8+ T cells, or CD4+CD8+ T cells, an anti-CD3 antibody and an anti-CD28 antibody. Examples of an anti-CD28 antibody include 9.3, B-T3, XR- CD28 (Diaclone, Besancon, France) can be used as can other methods commonly known in the art
(Berg et al., Transplant Proc. 30(8):3975-3977, 1998; Haanen et al., J. Exp. Med. 190(9): 13191328, 1999; Garland et al., J. Immunol. Meth. 227(l-2):53-63, 1999). In some embodiments, T cells are activated by incubation with anti-CD3/anti-CD28-conjugated beads, such as DYNABEADS® or Trans-Act® beads, for a time period sufficient for activation of the T cells. In one aspect, the time period is at least 1, 2, 3, 4, 5, or 6 hours. In yet another preferred aspect, the time period is 10 to 24 hours, e.g., 24 hours. In some embodiments, T cells are activated by stimulation with an anti-CD3 antibody and an anti-CD28 antibody in combination with cytokines that bind the common gammachain (e.g., IL-2, IL-7, IL-12, IL-15, IL-21, and others). In some embodiments, T cells are activated by stimulation with an anti-CD3 antibody and an anti-CD28 antibody in combination with 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 100 U/mL of IL-2, IL-7, and/or IL-15. In some embodiments, the cells are activated for 24 hours. In some embodiments, after transduction, the cells are expanded in the presence of anti-CD3 antibody, anti-CD28 antibody in combination with the same cytokines. In some embodiments, cells activated in the presence of an anti-CD3 antibody and an anti-CD28 antibody in combination with cytokines that bind the common gamma-chain are expanded in the presence of the same cytokines in the absence of the anti-CD3 antibody and anti-CD28 antibody after transduction. In some embodiments, after transduction, the cells are expanded in the presence of anti-CD3 antibody, anti-CD28 antibody in combination with the same cytokines up to a first washing step, when the cells are sub-cultured in media that includes the cytokines but does not include the anti-CD3 antibody and anti-CD28 antibody. In some embodiments, the cells are subcultured every 1, 2, 3, 4, 5, or 6 days. In some embodiments, cells are expanded for 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 days.
[00389] The expansion of T cells may be stimulated with zoledronic acid (Zometa), alendronic acid (Fosamax) or other related bisphosphonate drugs at concentrations of 0.1, 0.25, 0.5, 1.0, 2.0, 3.0, 4.0, 5.0, 7.5, 10, or 100 pM in the presence of feeder cells (irradiated cancer cells, PBMCs, artificial antigen presenting cells). The expansion of T cells may be stimulated with isopentyl pyrophosphate (IPP), (E)-4-Hydroxy-3-methyl-but-2-enyl pyrophosphate (HMBPP or HMB-PP) or other structurally related compounds at concentrations of 0.1, 0.25, 0.5, 1.0, 2.0, 3.0, 4.0, 5.0, 7.5, 10, or 100 pM in the presence of feeder cells (irradiated cancer cells, PBMCs, artificial antigen presenting cells). In some embodiments, the expansion of T cells may be stimulated with synthetic phosphoantigens (e.g., bromohydrin pyrophosphate; BrHPP), 2M3B1 PP, or 2-methyl-3-butenyl-l - pyrophosphate in the presence of IL-2 for one-to-two weeks. In some embodiments, the expansion of T cells may be stimulated with immobilized anti-TCRyd (e.g., pan TCRY6) in the presence of IL-2, e.g., for approximately 14 days. In some embodiments, the expansion of T cells may be stimulated
with culture of immobilized anti-CD3 antibodies (e.g., OKT3) in the presence of IL-2. In some embodiments, the aforementioned culture is maintained for about seven days prior to subculture in soluble anti-CD3, and IL-2.
[00390] T cells that have been exposed to varied stimulation times may exhibit different characteristics. For example, typical blood or apheresed peripheral blood mononuclear cell products have a helper T cell population (TH, CD4+) that is greater than the cytotoxic or suppressor T cell population (TC, CD8+). Ex vivo expansion of T cells by stimulating CD3 and CD28 receptors produces a population of T cells that prior to about days 8-9 consists predominately of TH cells, while after about days 8-9, the population of T cells comprises an increasingly greater population of TC cells. Accordingly, depending on the purpose of treatment, infusing a subject with a T cell population comprising predominately of TH cells may be advantageous. Similarly, if an antigenspecific subset of TC cells has been isolated it may be beneficial to expand this subset to a greater degree.
[00391] Further, in addition to CD4 and CD8 markers, other phenotypic markers vary significantly, but in large part, reproducibly during the course of the cell expansion process. Thus, such reproducibility enables the ability to tailor an activated T cell product for specific purposes.
[00392] Once a TFP is constructed, various assays can be used to evaluate the activity of the molecule, such as but not limited to, the ability of T cells to activate and expand stimulation, and anti-cancer activities in appropriate in vitro and animal models. Assays to evaluate the effects of a TFP are described in further detail below.
Mesothelin Associated Diseases and/or Disorders
[00393] In one aspect, the present disclosure provides methods for treating a disease associated with mesothelin expression. In one aspect, the present disclosure provides methods for treating a disease wherein part of the tumor is negative for mesothelin and part of the tumor is positive for mesothelin. For example, the TFP of the present disclosure is useful for treating subjects that have undergone treatment for a disease associated with elevated expression of mesothelin, wherein the subject that has undergone treatment for elevated levels of mesothelin exhibits a disease associated with elevated levels of mesothelin.
[00394] In one aspect, the present disclosure pertains to a method of inhibiting growth of a mesothelin- expressing tumor cell, comprising contacting the tumor cell with a mesothelin TFP T cell of the present invention such that the TFP-T is activated in response to the antigen and targets the cancer cell, wherein the growth of the tumor is inhibited.
[00395] In one aspect, the present disclosure pertains to a method of treating cancer in a subject. The method comprises administering to the subject a mesothelin TFP T cell of the present invention such that the cancer is treated in the subject. An example of a cancer that is treatable by the mesothelin TFP T cell of the present disclosure is a cancer associated with expression of mesothelin. In one aspect, the cancer is a mesothelioma. In one aspect, the cancer is selected from malignant pleural mesothelioma (MPM), non-small cell lung cancer (NSCLC), serous ovarian adenocarcinoma, or cholangiocarcinoma.
[00396] The present disclosure includes a type of cellular therapy where T cells are genetically modified to express a TFP and the TFP-expressing T cell is infused to a recipient in need thereof. The infused cell is able to kill tumor cells in the recipient. Unlike antibody therapies, TFP-expressing T cells are able to replicate in vivo, resulting in long-term persistence that can lead to sustained tumor control. In various aspects, the T cells administered to the patient, or their progeny, persist in the patient for at least one month, two month, three months, four months, five months, six months, seven months, eight months, nine months, ten months, eleven months, twelve months, thirteen months, fourteen month, fifteen months, sixteen months, seventeen months, eighteen months, nineteen months, twenty months, twenty-one months, twenty-two months, twenty-three months, two years, three years, four years, or five years after administration of the T cell to the patient.
[00397] The present disclosure also includes a type of cellular therapy where T cells are modified, e.g., by in vitro transcribed RNA, to transiently express a TFP and the TFP-expressing T cell is infused to a recipient in need thereof. The infused cell is able to kill tumor cells in the recipient. Thus, in various aspects, the T cells administered to the patient, is present for less than one month, e.g., three weeks, two weeks, or one week, after administration of the T cell to the patient.
[00398] Without wishing to be bound by any particular theory, the anti-tumor immunity response elicited by the TFP-expressing T cells may be an active or a passive immune response, or alternatively may be due to a direct vs indirect immune response. The TFP transduced T cells may exhibit specific proinflammatory cytokine secretion and potent cytolytic activity in response to human cancer cells expressing the mesothelin antigen, resist soluble mesothelin inhibition, mediate bystander killing and/or mediate regression of an established human tumor. For example, antigen-less tumor cells within a heterogeneous field of mesothelin-expressing tumor may be susceptible to indirect destruction by mesothelin-redirected T cells that has previously reacted against adjacent antigen-positive cancer cells. [00399] The human TFP-modified T cells of the present disclosure may be a type of vaccine for ex vivo immunization and/or in vivo therapy in a mammal, e.g., a human.
[00400] With respect to ex vivo immunization, at least one of the following occurs in vitro prior to administering the cell into a mammal: i) expansion of the cells, ii) introducing a nucleic acid encoding a TFP to the cells or iii) cry opreservation of the cells.
[00401] Ex vivo procedures are well known in the art and are discussed more fully herein. Briefly, cells are isolated from a mammal (e.g., a human) and genetically modified (e.g., transduced or transfected in vitro with a vector expressing a TFP disclosed herein. The TFP -modified cell can be administered to a mammalian recipient to provide a therapeutic benefit. The mammalian recipient may be a human and the TFP-modified cell can be autologous with respect to the recipient. Alternatively, the cells can be allogeneic, syngeneic or xenogeneic with respect to the recipient.
[00402] The procedure for ex vivo expansion of hematopoietic stem and progenitor cells is described in U.S. Pat. No. 5,199,942, incorporated herein by reference, can be applied to the cells of the present disclosure. Other suitable methods are known in the art, therefore the present disclosure is not limited to any particular method of ex vivo expansion of the cells. Briefly, ex vivo culture and expansion of T cells comprises: (1) collecting CD34+ hematopoietic stem and progenitor cells from a mammal from peripheral blood harvest or bone marrow explants; and (2) expanding such cells ex vivo. In addition to the cellular growth factors described in U.S. Pat. No. 5,199,942, other factors such as flt3-L, IL-1, IL- 3 and c-kit ligand, can be used for culturing and expansion of the cells.
[00403] In addition to using a cell-based vaccine in terms of ex vivo immunization, the present disclosure also provides compositions and methods for in vivo immunization to elicit an immune response directed against an antigen in a patient.
[00404] Generally, the cells activated and expanded as described herein may be utilized in the treatment and prevention of diseases that arise in individuals who are immunocompromised. In particular, the TFP-modified T cells of the present disclosure are used in the treatment of diseases, disorders and conditions associated with expression of mesothelin. The cells of the present disclosure may be used in the treatment of patients at risk for developing diseases, disorders and conditions associated with expression of mesothelin. Thus, the present disclosure provides methods for the treatment or prevention of diseases, disorders and conditions associated with expression of mesothelin comprising administering to a subject in need thereof, a therapeutically effective amount of the TFP- modified T cells of the disclosure.
[00405] The TFP-T cells of the present disclosure may be used to treat a proliferative disease such as a cancer or malignancy or a precancerous condition. In one aspect, he cancer is a mesothelioma. In one aspect, the cancer is selected from malignant pleural mesothelioma (MPM), non-small cell lung cancer (NSCLC), serous ovarian adenocarcinoma, or cholangiocarcinoma. Further, a disease associated with mesothelin expression includes, but is not limited to, e.g., atypical and/or non-classical
cancers, malignancies, precancerous conditions or proliferative diseases expressing mesothelin. Noncancer related indications associated with expression of mesothelin include, but are not limited to, e.g., autoimmune disease, (e.g., lupus), inflammatory disorders (allergy and asthma) and transplantation.
[00406] The TFP-modified T cells of the present disclosure may be administered either alone, or as a pharmaceutical composition in combination with diluents and/or with other components such as IL-2 or other cytokines or cell populations.
[00407] The present disclosure also provides methods for inhibiting the proliferation or reducing a mesothelin-expressing cell population, the methods comprising contacting a population of cells comprising a mesothelin-expressing cell with an anti-mesothelin TFP-T cell of the present disclosure that binds to the mesothelin-expressing cell. The anti-mesothelin TFP-T cell of the present disclosure may reduce the quantity, number, amount or percentage of cells and/or cancer cells by at least 25%, at least 30%, at least 40%, at least 50%, at least 65%, at least 75%, at least 85%, at least 95%, or at least 99% in a subject with or animal model a cancer associated with mesothelin-expressing cells relative to a negative control. In one aspect, the subject is a human.
[00408] The present disclosure also provides methods for preventing, treating and/or managing a disease associated with mesothelin-expressing cells e.g., a cancer expressing mesothelin), the methods comprising administering to a subject in need an anti-mesothelin TFP-T cell of the present disclosure that binds to the mesothelin-expressing cell. In one aspect, the subject is a human. Non-limiting examples of disorders associated with mesothelin-expressing cells include autoimmune disorders (such as lupus), inflammatory disorders (such as allergies and asthma) and cancers (such as pancreatic cancer, ovarian cancer, stomach cancer, lung cancer, or endometrial cancer, or atypical cancers expressing mesothelin).
[00409] The present disclosure also provides methods for preventing, treating and/or managing a disease associated with mesothelin-expressing cells, the methods comprising administering to a subject in need an anti-mesothelin TFP-T cell of the present disclosure that binds to the mesothelin-expressing cell. In one aspect, the subject is a human.
[00410] The present disclosure provides methods for preventing relapse of cancer associated with mesothelin-expressing cells, the methods comprising administering to a subject in need thereof an anti- mesothelin TFP-T cell of the present disclosure that binds to the mesothelin-expressing cell. In one aspect, the methods comprise administering to the subject in need thereof an effective amount of an anti-mesothelin TFP-T cell described herein that binds to the mesothelin-expressing cell in combination with an effective amount of another therapy.
Combination Therapies
[00411] In some embodiments, the TFP T cells provided herein are administered with at least one additional therapeutic agent. Any suitable additional therapeutic agent may be administered with a TFP T cell provided herein. In some aspects, the additional therapeutic agent is selected from radiation, a cytotoxic agent, a chemotherapeutic agent, a cytostatic agent, an anti-hormonal agent, an EGFR inhibitor, an immunostimulatory agent, an anti-angiogenic agent, and combinations thereof.
[00412] In some embodiments, the additional therapeutic agent comprises an immunostimulatory agent.
[00413] In some embodiments, the immunostimulatory agent is an agent that blocks signaling of an inhibitory receptor of an immune cell, or a ligand thereof. In some aspects, the inhibitory receptor or ligand is selected from cytotoxic T-lymphocyte-associated protein 4 (CTLA-4, also known as CD 152), programmed cell death protein 1 (also PD-1 or CD279), programmed death ligand 1 (also PD-L1 or CD274), transforming growth factor beta (TGFP), lymphocyte-activation gene 3 (LAG-3, also CD223), Tim-3 (hepatitis A virus cellular receptor 2 or HAVCR2 or CD366), neuritin, B- and T- lymphocyte attenuator (also BTLA or CD272), killer cell immunoglobulin-like receptors (KIRs), and combinations thereof. In some aspects, the agent is selected from an anti-PD-1 antibody (e.g., pembrolizumab or nivolumab), and anti-PD-Ll antibody (e.g., atezolizumab), an anti-CTLA-4 antibody (e.g., ipilimumab), an anti-TIM3 antibody, carcinoembryonic antigen-related cell adhesion molecule 1 (CECAM-1, also CD66a) and 5 (CEACAM-5, also CD66e), vset immunoregulatory receptor (also VISR or VISTA), leukocyte-associated immunoglobulin-like receptor 1 (also LAIR1 or CD305), CD160, natural killer cell receptor 2B4 (also CD244 or SLAMF4), and combinations thereof. In some aspects, the agent is pembrolizumab. In some aspects, the agent is nivolumab. In some aspects, the agent is atezolizumab.
[00414] In some embodiments, the additional therapeutic agent is an agent that inhibits the interaction between PD-1 and PD-L1. In some aspects, the additional therapeutic agent that inhibits the interaction between PD-1 and PD-L1 is selected from an antibody, a peptidomimetic and a small molecule. In some aspects, the additional therapeutic agent that inhibits the interaction between PD-1 and PD-L1 is selected from pembrolizumab (KEYTRUDA®), nivolumab (OPDIVO®), atezolizumab, avelumab, pidilizumab, durvalumab, sulfamonomethoxine 1, and sulfamethizole 2. In some embodiments, the additional therapeutic agent that inhibits the interaction between PD-1 and PD-L1 is any therapeutic known in the art to have such activity, for example as described in Weinmann et al., Chem Med Chem, 2016, 14:1576 (DOI: 10.1002/cmdc.201500566), incorporated by reference in its entirety. In some embodiments, the agent that inhibits the interaction between PD-1 and PD-L1 is formulated in the same pharmaceutical composition an antibody provided herein. In some embodiments, the agent that inhibits the interaction between PD-1 and PD-L1 is formulated in a different pharmaceutical
composition from an antibody provided herein. In some embodiments, the agent that inhibits the interaction between PD-1 and PD-L1 is administered prior to administration of an antibody provided herein. In some embodiments, the agent that inhibits the interaction between PD-1 and PD-L1 is administered after administration of an antibody provided herein. In some embodiments, the agent that inhibits the interaction between PD-1 and PD-L1 is administered contemporaneously with an antibody provided herein, but the agent and antibody are administered in separate pharmaceutical compositions. [00415] In some embodiments, the immunostimulatory agent is an agonist of a co-stimulatory receptor of an immune cell. In some aspects, the co-stimulatory receptor is selected from GITR, 0X40, ICOS, LAG-2, CD27, CD28, 4-1BB, CD40, STING, a toll-like receptor, RIG-1, and a NOD-like receptor. In some embodiments, the agonist is an antibody.
[00416] In some embodiments, the immunostimulatory agent modulates the activity of arginase, indoleamine-2 3 -dioxygenase, or the adenosine A2A receptor.
[00417] In some embodiments, the immunostimulatory agent is a cytokine. In some aspects, the cytokine is selected from IL-2, IL-5, IL-7, IL-12, IL-15, IL-21, and combinations thereof.
[00418] In some embodiments, the immunostimulatory agent is an oncolytic virus. In some aspects, the oncolytic virus is selected from a herpes simplex virus, a vesicular stomatitis virus, an adenovirus, a Newcastle disease virus, a vaccinia virus, and a maraba virus.
[00419] Further examples of additional therapeutic agents include a taxane (e.g., paclitaxel or docetaxel); a platinum agent (e.g., carboplatin, oxaliplatin, and/or cisplatin); a topoisomerase inhibitor (e.g., irinotecan, topotecan, etoposide, and/or mitoxantrone); folinic acid (e.g., leucovorin); or a nucleoside metabolic inhibitor (e.g., fluorouracil, capecitabine, and/or gemcitabine). In some embodiments, the additional therapeutic agent is folinic acid, 5-fluorouracil, and/or oxaliplatin. In some embodiments, the additional therapeutic agent is 5-fluorouracil and irinotecan. In some embodiments, the additional therapeutic agent is a taxane and a platinum agent. In some embodiments, the additional therapeutic agent is paclitaxel and carboplatin. In some embodiments, the additional therapeutic agent is pemetrexate. In some embodiments, the additional therapeutic agent is a targeted therapeutic such as an EGFR, RAF or MEK-targeted agent.
[00420] The additional therapeutic agent may be administered by any suitable means. In some embodiments, a medicament provided herein, and the additional therapeutic agent are included in the same pharmaceutical composition. In some embodiments, an antibody provided herein, and the additional therapeutic agent are included in different pharmaceutical compositions.
[00421] In embodiments where an antibody provided herein and the additional therapeutic agent are included in different pharmaceutical compositions, administration of the antibody can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent. In some aspects,
administration of an antibody provided herein, and the additional therapeutic agent occur within about one month of each other. In some aspects, administration of an antibody provided herein, and the additional therapeutic agent occur within about one week of each other. In some aspects, administration of an antibody provided herein, and the additional therapeutic agent occur within about one day of each other. In some aspects, administration of an antibody provided herein, and the additional therapeutic agent occur within about twelve hours of each other. In some aspects, administration of an antibody provided herein, and the additional therapeutic agent occur within about one hour of each other.
Tumor Antigen Associated Diseases or Disorders
[00422] Many patients treated with cancer therapeutics that are directed to one target on a tumor cell, e.g., BCMA, CD19, CD20, CD22, CD123, MUC16, MSLN, etc., become resistant overtime as escape mechanisms such as alternate signaling pathways and feedback loops become activated. Dual specificity therapeutics attempt to address this by combining targets that often substitute for each other as escape routes. Therapeutic T cell populations having TCRs specific to more than one tumor- associated antigen are promising combination therapeutics. In some embodiments, the dual specificity TFP T cells are administered with an additional anti-cancer agent; in some embodiments, the anticancer agent is an antibody or fragment thereof, another TFP T cell, a CAR T cell, or a small molecule. Exemplary tumor-associated antigens include, but are not limited to, oncofetal antigens (e.g., those expressed in fetal tissues and in cancerous somatic cells), oncoviral antigens (e.g., those encoded by tumorigenic transforming viruses), overexpressed/ accumulated antigens (e.g., those expressed by both normal and neoplastic tissue, with the level of expression highly elevated in neoplasia), cancer-testis antigens (e.g., those expressed only by cancer cells and adult reproductive tissues such as testis and placenta), lineage-restricted antigens (e.g., those expressed largely by a single cancer histotype), mutated antigens (e.g., those expressed by cancer as a result of genetic mutation or alteration in transcription), posttranslationally altered antigens (e.g., those tumor-associated alterations in glycosylation, etc.), and idiotypic antigens (e.g., those from highly polymorphic genes where a tumor cell expresses a specific clonotype, e.g., as in B cell, T cell lymphoma/leukemia resulting from clonal aberrancies). Exemplary tumor-associated antigens include, but are not limited to, antigens of alpha- actinin-4, ARTCI, alphafetoprotein (AFP), BCR-ABL fusion protein (b3a2), B-RAF, CASP-5, CASP- 8, beta-catenin, Cdc27, CDK4, CDK12, CDKN2A, CLPP, COA-1, CSNK1A1, CD79, CD79B, dek- can fusion protein, EFTUD2, Elongation factor 2, ETV6-AML1 fusion protein, FLT3-ITD, FNDC3B, FN1, GAS7, GPNMB, HAUS3, HSDL1, LDLR-fucosyltransferase AS fusion protein, HLA-A2d, HLA-A1 Id, hsp70-2, MART2, MATN, MEI, MUM-lf, MUM-2, MUM-3, neo-PAP, Myosin class I,
NFYC, OGT, OS-9, p53, pml-RARalpha fusion protein, PPP1R3B, PRDX5, PTPRK, K-ras, N-ras, RBAF600, SIRT2, SNRPD1, SYT-SSX1 or -SSX2 fusion protein, TGF-betaRII, triosephosphate isomerase, BAGE-1, D393-CD20n, Cyclin-Al, GAGE-1, GAGE-2, GAGE-8, GAGE-3, GAGE-4, GAGE-5, GAGE-6, GAGE-7, GnTVf, HERV-K-MEL, KK-LC-1, KM-HN-1, LAGE-1, LY6K, MAGE-A1, MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A6, MAGE-A9, MAGE-A10, MAGE-A12 m, MAGE-CI, MAGE-C2, mucink, NA88-A, NY-ESO-1 / LAGE-2, SAGE, Spl7, SSX-2, SSX-4, TAG-1, TAG-2, TRAG-3, TRP2-INT2g, XAGE-lb/GAGED2a, Gene / protein, CEA, gplOO / Pmell7, mammaglobin-A, Melan-A / MART-1, NY-BR-1, OA1, PAP, PSA, RAB38 / NY-MEL-1, TRP-1 / gp75, TRP-2, tyrosinase, adipophilin, AIM-2, ALDH1A1, BCLX (L), BING-4, CALCA, CD45, CD274, CPSF, cyclin DI, DKK1, ENAH (hMena), EpCAM, EphA3, EZH2, FGF5, glypican- 3, G250 / MN / CAIX, HER-2 / neu, HLA-DOB, Hepsin, IDO1, IGF2B3, IL13Ralpha2, Intestinal carboxyl esterase, alpha-foetoprotein, Kallikrein 4, KIF20A, Lengsin, M-CSF, MCSP, mdm-2, Meloe, Midkine, MMP-2, MMP-7, MUC1, MUC5AC, p53, PAX5, PBF, PRAME, PSMA, RAGE-1, RGS5, RhoC, RNF43, RU2AS, secernin 1, SOXIO, STEAP1, survivin, Telomerase, TPBG, VEGF, and WTL [00423] A TFP-expressing cell described herein may be used in combination with other known agents and therapies. Administered “in combination”, as used herein, means that two (or more) different treatments are delivered to the subject during the course of the subject’s affliction with the disorder, e.g., the two or more treatments are delivered after the subject has been diagnosed with the disorder and before the disorder has been cured or eliminated or treatment has ceased for other reasons. The delivery of one treatment can still be occurring when the delivery of the second begins, so that there is overlap in terms of administration. This is sometimes referred to herein as “simultaneous” or “concurrent delivery”. Alternatively, the delivery of one treatment may end before the delivery of the other treatment begins. In either case, the treatment is more effective because of combined administration. For example, the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment or the analogous situation is seen with the first treatment. Delivery can be such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other. The effect of the two treatments can be partially additive, wholly additive, or greater than additive. The delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.
[00424] The “at least one additional therapeutic agent” may include a TFP-expressing cell. Also provided are T cells that express multiple TFPs, which bind to the same or different target antigens, or
same or different epitopes on the same target antigen. Also provided are populations of T cells in which a first subset of T cells express a first TFP and a second subset of T cells express a second TFP.
[00425] A TFP-expressing cell described herein and the at least one additional therapeutic agent can be administered simultaneously, in the same or in separate compositions, or sequentially. For sequential administration, the TFP-expressing cell described herein can be administered first, and the additional agent can be administered second, or the order of administration can be reversed.
[00426] A TFP-expressing cell described herein may be used in a treatment regimen in combination with surgery, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and tacrolimus, antibodies, or other immunoablative agents such as alemtuzumab, anti-CD3 antibodies or other antibody therapies, cytoxin, fludarabine, cyclosporin, tacrolimus, rapamycin, mycophenolic acid, steroids, romidepsin, cytokines, and irradiation. A TFP- expressing cell described herein may also be used in combination with a peptide vaccine, such as that described in Izumoto et al. 2008 J Neurosurg 108:963-971. A TFP-expressing cell described herein may also be used in combination with a promoter of myeloid cell differentiation (e.g., all-trans retinoic acid), an inhibitor of myeloid-derived suppressor cell (MDSC) expansion (e.g., inhibitors of c-kit receptor or a VEGF inhibitor), an inhibitor of MDSC function (e.g., COX2 inhibitors or phosphodiesterase-5 inhibitors), or therapeutic elimination of MDSCs (e.g., with a chemotherapeutic regimen such as treatment with doxorubicin and cyclophosphamide). Other therapeutic agents that may prevent the expansion of MDSCs include amino-biphosphonate, biphosphanate, sildenafil and tadalafil, nitroaspirin, vitamin D3, and gemcitabine. (See, e.g., Gabrilovich and Nagaraj, Nat. Rev. Immunol, (2009) v9(3) 162-174).
[00427] The subject can be administered an agent which reduces or ameliorates a side effect associated with the administration of a TFP-expressing cell. Side effects associated with the administration of a TFP-expressing cell include, but are not limited to cytokine release syndrome (CRS), and hemophagocytic lymphohistiocytosis (HLH), also termed Macrophage Activation Syndrome (MAS). Symptoms of CRS include high fevers, nausea, transient hypotension, hypoxia, and the like. Accordingly, the methods described herein can comprise administering a TFP-expressing cell described herein to a subject and further administering an agent to manage elevated levels of a soluble factor resulting from treatment with a TFP-expressing cell. The soluble factor elevated in the subject is one or more of IFN-y, TNFa, IL-2, IL-6 and IL8. Therefore, an agent administered to treat this side effect can be an agent that neutralizes one or more of these soluble factors. Such agents include, but are not limited to a steroid, an inhibitor of TNFa, and an inhibitor of IL-6. An example of a TNFa inhibitor is entanercept. An example of an IL-6 inhibitor is tocilizumab (toe).
[00428] The subject can be administered an agent which enhances the activity of a TFP-expressing cell. For example, the agent can be an agent which inhibits an inhibitory molecule. Inhibitory molecules, e.g., Programmed Death 1 (PD1), can, decrease the ability of a TFP-expressing cell to mount an immune effector response. Examples of inhibitory molecules include PD1, PD-L1, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and TGFRbeta. Inhibition of an inhibitory molecule, e.g., by inhibition at the DNA, RNA or protein level, can optimize a TFP-expressing cell performance. An inhibitory nucleic acid, e.g., an inhibitory nucleic acid, e.g., a dsRNA, e.g., an siRNA or shRNA, can be used to inhibit expression of an inhibitory molecule in the TFP-expressing cell. The inhibitor can be a shRNA. The inhibitory molecule is inhibited within a TFP-expressing cell. In these cases, a dsRNA molecule that inhibits expression of the inhibitory molecule is linked to the nucleic acid that encodes a component, e.g., all of the components, of the TFP. The inhibitor of an inhibitory signal can be, e.g., an antibody or antibody fragment that binds to an inhibitory molecule. For example, the agent can be an antibody or antibody fragment that binds to PD1, PD-L1, PD-L2 or CTLA4 (e.g., ipilimumab (also referred to as MDX-010 and MDX-101, and marketed as Yervoy™; Bristol-Myers Squibb; tremelimumab (IgG2 monoclonal antibody available from Pfizer, formerly known as ticilimumab, CP-675,206)). The agent is an antibody or antibody fragment that binds to TIM3. The agent is an antibody or antibody fragment that binds to LAG3.
[00429] The T cells may be altered (e.g., by gene transfer) in vivo via a lentivirus, e.g., a lentivirus specifically targeting a CD4+ or CD8+ T cell. (See, e.g., Zhou et al., J. Immunol. (2015) 195:2493- 2501).
[00430] The agent which enhances the activity of a TFP-expressing cell can be, e.g., a fusion protein comprising a first domain and a second domain, wherein the first domain is an inhibitory molecule, or fragment thereof, and the second domain is a polypeptide that is associated with a positive signal, e.g., a polypeptide comprising an intracellular signaling domain as described herein. The polypeptide that is associated with a positive signal can include a costimulatory domain of CD28, CD27, ICOS, e.g., an intracellular signaling domain of CD28, CD27 and/or ICOS, and/or a primary signaling domain, e.g., of CD3 zeta, e.g., described herein. The fusion protein can be expressed by the same cell that expressed the TFP. The fusion protein may be expressed by a cell, e.g., a T cell that does not express an anti-mesothelin TFP.
[00431] The human or humanized antibody domain comprising an antigen binding domain that is an anti-mesothelin binding domain encoded by the nucleic acid, or an antibody comprising the anti- mesothelin binding domain, or a cell expressing the anti-mesothelin binding domain encoded by the nucleic acid can have an affinity value of at most about 200 nM, 100 nM, 75 nM, a 50 nM, 25 nM, 20 nM, 15 nM, 14 nM, 13 nM, 12 nM, 11 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2
nM, 1 nM, 0.9 nM, 0.8 nM, 0.7 nM, 0.6 nM, 0.5 nM, 0.4 nM, 0.3 nM, 0.2 nM, 0.1 nM, 0.09 nM, 0.08 nM, 0.07 nM, 0.06 nM, 0.05 nM, 0.04 nM, 0.03 nM, 0.02 nM, or 0.01 nM; and/or at least about 100 nM, 75 nM, a 50 nM, 25 nM, 20 nM, 15 nM, 14 nM, 13 nM, 12 nM, 11 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, 1 nM, 0.9 nM, 0.8 nM, 0.7 nM, 0.6 nM, 0.5 nM, 0.4 nM, 0.3 nM, 0.2 nM, 0.1 nM, 0.09 nM, 0.08 nM, 0.07 nM, 0.06 nM, 0.05 nM, 0.04 nM, 0.03 nM, 0.02 nM, or 0.01 nM; and or about 200 nM, 100 nM, 75 nM, a 50 nM, 25 nM, 20 nM, 15 nM, 14 nM, 13 nM, 12 nM, 11 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, 1 nM, 0.9 nM, 0.8 nM, 0.7 nM, 0.6 nM, 0.5 nM, 0.4 nM, 0.3 nM, 0.2 nM, 0.1 nM, 0.09 nM, 0.08 nM, 0.07 nM, 0.06 nM, 0.05 nM, 0.04 nM, 0.03 nM, 0.02 nM, or 0.01 nM.
Pharmaceutical Compositions
[00432] Pharmaceutical compositions of the present disclosure may comprise a TFP-expressing cell, e.g., a plurality of TFP-expressing cells, as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients. Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. Compositions of the present disclosure can be formulated for intravenous administration.
[00433] Pharmaceutical compositions of the present disclosure may be administered in a manner appropriate to the disease to be treated (or prevented). The quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient’s disease, although appropriate dosages may be determined by clinical trials.
[00434] The pharmaceutical composition can be substantially free of, e.g., there are no detectable levels of a contaminant, e.g., selected from the group consisting of endotoxin, mycoplasma, replication competent lentivirus (RCL), p24, VSV-G nucleic acid, HIV gag, residual anti-CD3/anti-CD28 coated beads, mouse antibodies, pooled human serum, bovine serum albumin, bovine serum, culture media components, vector packaging cell or plasmid components, a bacterium and a fungus. The bacterium may be at least one selected from the group consisting of Alcaligenes faecalis, Candida albicans, Escherichia coli, Haemophilus influenza, Neisseria meningitides, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus pneumonia, and Streptococcus pyogenes group A.
[00435] When “an immunologically effective amount,” “an anti-tumor effective amount,” “a tumorinhibiting effective amount,” or “therapeutic amount” is indicated, the precise amount of the compositions of the present disclosure to be administered can be determined by a physician with
consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject). It can generally be stated that a pharmaceutical composition comprising the T cells described herein may be administered at a dosage of 104 to 109 cells/kg body weight, in some instances 105 to 106 cells/kg body weight, including all integer values within those ranges. T cell compositions may also be administered multiple times at these dosages. The cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med. 319: 1676, 1988).
[00436] It may be desired to administer activated T cells to a subject and then subsequently redraw blood (or have an apheresis performed), activate T cells therefrom according to the present disclosure, and reinfuse the patient with these activated and expanded T cells. This process can be carried out multiple times every few weeks. T cells can be activated from blood draws of from 10 cc to 400 cc. T cells can be activated from blood draws of 20 cc, 30 cc, 40 cc, 50 cc, 60 cc, 70 cc, 80 cc, 90 cc, or 100 cc.
[00437] The administration of the subject compositions may be carried out in any convenient manner, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation. The compositions described herein may be administered to a patient trans arterially, subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous (i.v.) injection, or intraperitoneally. The T cell compositions of the present disclosure can be administered to a patient by intradermal or subcutaneous injection. The T cell compositions of the present disclosure can be administered by i.v. injection. The compositions of T cells may be injected directly into a tumor, lymph node, or site of infection. In some embodiments, described herein are compositions for parenteral administration which comprises a solution of cells is dissolved or suspended in an acceptable carrier, for example, an aqueous carrier. A variety of aqueous carriers can be used, e.g., water, buffered water, 0.9% saline, 0.3% glycine, hyaluronic acid and the like. These compositions can be sterilized by conventional, well known sterilization techniques, or can be sterile filtered. The compositions can contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc.
[00438] In a particular exemplary aspect, subjects may undergo leukapheresis, wherein leukocytes are collected, enriched, or depleted ex vivo to select and/or isolate the cells of interest, e.g., T cells. These T cell isolates may be expanded by methods known in the art and treated such that one or more TFP constructs of the present disclosure may be introduced, thereby creating a TFP-expressing T cell of the disclosure. Subjects in need thereof may subsequently undergo standard treatment with high dose
chemotherapy followed by peripheral blood stem cell transplantation. Following or concurrent with the transplant, subjects may receive an infusion of the expanded TFP T cells of the present disclosure. Expanded cells may be administered before or following surgery.
[00439] The dosage of the above treatments to be administered to a patient will vary with the precise nature of the condition being treated and the recipient of the treatment. The scaling of dosages for human administration can be performed according to art-accepted practices. The dose for alemtuzumab, for example, will generally be in the range 1 to about 100 mg for an adult patient, usually administered daily for a period between 1 and 30 days. The preferred daily dose is 1 to 10 mg per day although in some instances larger doses of up to 40 mg per day may be used (described in U.S. Pat. No. 6,120,766).
[00440] The TFP can be introduced into T cells, e.g., using in vitro transcription, and the subject (e.g., human) receives an initial administration of TFP T cells of the disclosure, and one or more subsequent administrations of the TFP T cells of the disclosure, wherein the one or more subsequent administrations are administered less than 15 days, e.g., 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, or 2 days after the previous administration. More than one administration of the TFP T cells of the present disclosure may be administered to the subject (e.g., human) per week, e.g., 2, 3, or 4 administrations of the TFP T cells of the present disclosure are administered per week. The subject (e.g., human subject) may receive more than one administration of the TFP T cells per week (e.g., 2, 3 or 4 administrations per week) (also referred to herein as a cycle), followed by a week of no TFP T cells administrations, and then one or more additional administration of the TFP T cells (e.g., more than one administration of the TFP T cells per week) is administered to the subject. The subject (e.g., human subject) may receive more than one cycle of TFP T cells, and the time between each cycle is less than 10, 9, 8, 7, 6, 5, 4, or 3 days. The TFP T cells can be administered every other day for 3 administrations per week. The TFP T cells of the present disclosure can be administered for at least two, three, four, five, six, seven, eight or more weeks.
[00441] Mesothelin TFP T cells can be generated using lentiviral viral vectors, such as lentivirus. TFP- T cells generated that way will have stable TFP expression.
[00442] TFP T cells may transiently express TFP vectors for 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 days after transduction. Transient expression of TFPs can be effected by RNA TFP vector delivery. The TFP RNA can be transduced into the T cell by electroporation.
[00443] A potential issue that can arise in patients being treated using transiently expressing TFP T cells (particularly with murine scFv bearing TFP T cells) is anaphylaxis after multiple treatments.
[00444] Without being bound by this theory, it is believed that such an anaphylactic response might be caused by a patient developing humoral anti-TFP response, e.g., anti-TFP antibodies having an anti-
IgE isotype. It is thought that a patient’s antibody producing cells undergo a class switch from IgG isotype (that does not cause anaphylaxis) to IgE isotype when there is a ten to fourteen-day break in exposure to antigen.
[00445] If a patient is at high risk of generating an anti-TFP antibody response during the course of transient TFP therapy (such as those generated by RNA transductions), TFP T cell infusion breaks should not last more than ten to fourteen days.
Methods of Treatment
[00446] Provided herein are methods of treating a human subject in need thereof for treating a cancer (e.g., a MSLN-expressing cancer). The method can comprise administering to the human subject one or more doses of a population of T cells, wherein a T cell of the population of T cells comprises a recombinant nucleic acid comprising a sequence encoding a T cell receptor (TCR) fusion protein (TFP). The population of T cells can be called anti-MSLN TFP T cells. The TFP can comprise (a) a TCR subunit comprising (i) at least a portion of a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain; and (b) an antibody domain comprising an anti-MSLN antigen binding domain. The TCR subunit and the anti-MSLN antigen binding domain can be operatively linked. The TFP can functionally interact with an endogenous TCR complex in the T cell.
[00447] The present disclosure also provides methods of treating a mesothelin (MSLN)-expressing cancer in a human subject in need thereof comprising: (a) obtaining a population of cells from the human subject; (b) administering to the human subject one or more doses of a population of T cells transduced with a recombinant nucleic acid comprising a sequence encoding a T cell receptor (TCR) fusion protein (TFP) comprising: (i) a TCR subunit comprising (ii) a CD3 epsilon extracellular domain, (iii) a CD3 epsilon transmembrane domain, and (iv) a CD3 epsilon intracellular domain; and (v) an antibody domain comprising an anti-MSLN antigen binding domain.
[00448] Provided herein is a method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising (a) administering to the human subject a first portion of a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti-MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising: (I) a TCR subunit comprising (i) at least a portion of a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain; and (II) an antibody domain comprising an anti-MSLN antigen binding domain and (b) administering a second portion of a dose of transduced anti-MSLN TFP T cells, wherein the second portion of a dose is administered less than 50 days following administration of the first portion of a dose of anti-
MSLN TFP T cells, and wherein the first portion of a dose and the second portion of a dose comprise from about 1 x 105 to about 5 x io10 transduced cells/m2.
[00449] Provided herein is a method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising (a) administering to the human subject a first portion of a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti-MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising: (I) a TCR subunit comprising (i) at least a portion of a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain; and (II) an antibody domain comprising an anti-MSLN antigen binding domain and (b) administering a second portion of a dose of transduced anti-MSLN TFP T cells, wherein the second portion of a dose is administered following administration of the first portion of a dose of anti-MSLN TFP T cells, and wherein the first portion of a dose and the second portion of a dose comprise about one-third to two- thirds of a reference dose, and wherein the reference dose is 1 x io5 to about 5 x io10 transduced cells/m2.
[00450] Provided herein is a method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising (a) administering to the human subject a first portion of a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti-MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising: (I) a TCR subunit comprising (i) at least a portion of a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain; and (II) an antibody domain comprising an anti-MSLN antigen binding domain and (b) administering a second portion of a dose of transduced anti-MSLN TFP T cells, wherein: the human subject elicits an adverse event and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells, or the human subject does not elicit an adverse event that is grade 2 or higher and the second portion of a dose is administered at a second timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells; wherein the first timepoint is longer than the second timepoint.
[00451] Provided herein is a method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising (a) administering to the human subject a first portion of a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti-MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising: (I) a TCR subunit comprising (i) at least a portion of a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain; and (II) an antibody domain comprising an anti-MSLN antigen binding domain and (b) administering a
second portion of a dose of transduced anti-MSLN TFP T cells, wherein the second portion of a dose is administered following administration of the first portion of a dose of anti-MSLN TFP T cells, and wherein the first portion of a dose comprises a first number of transduced cells/m2 and wherein the second portion of a dose comprises a second number of transduced cells/m2, wherein the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 is from 1 : 10 to 10: 1, and wherein the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 is not 1 : 1.
[00452] Provided herein is a method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising (a) administering to the human subject a first portion of a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti-MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising: (I) a TCR subunit comprising (i) at least a portion of a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain; and (II) an antibody domain comprising an anti-MSLN antigen binding domain and (b) administering a second portion of a dose of transduced anti-MSLN TFP T cells, wherein the second portion of a dose is administered following administration of the first portion of a dose of anti-MSLN TFP T cells, and wherein the first portion of a dose comprises a first number of transduced cells/m2 and wherein the second portion of a dose comprises a second number of transduced cells/m2, and wherein the method reduces or prevents a risk of adverse event associated with administering a reference dose with a number of transduced cells/m2 equivalent to the sum of the first number of transduced cells/m2 and the second number of transduced cells/m2; wherein each of the first portion of a dose and the second portion of a dose comprise less transduced cells/m2 than the reference dose.
[00453] Provided herein is a method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising administering to the human subject a first dose or first portion of a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti-MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising: (I) a TCR subunit comprising (i) at least a portion of a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain; and (II) an antibody domain comprising an anti-MSLN antigen binding domain, wherein the first dose or the first portion of a dose comprises about 3 * 108 transduced cells/m2.
[00454] The method can comprise administering to the human subject an amount of transduced anti- MSLN T cell receptor fusion protein (TFP) T cells. The amount of anti-MSLN TFP T cell can comprise from about 5 x 107 to about 1 x 1Q9 transduced cells/m2. The cancer can be a variety of cancers
expressing MSLN. For example, the cancer can comprise malignant pleural mesothelioma (MPM), non-small cell lung cancer (NSCLC), serous ovarian adenocarcinoma, or cholangiocarcinoma. [00455] Provided herein is a method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising administering to the human subject a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells comprising a recombinant nucleic acid comprising a sequence encoding a TFP comprising: (I) a TCR subunit comprising (i) at least a portion of a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain; and (II) an antibody domain comprising an anti-MSLN antigen binding domain; wherein the dose of anti-MSLN TFP T cells is about 1 x 108 transduced cells/m2. In some embodiments, the human subject does not exhibit any adverse event after administering the dose. In some embodiments, the human subject exhibits a response after administering the dose, such as a partial response (PR) or a complete response (CR) according to Response Evaluation Criteria in Solid Tumors (RECIST) v 1.1. In some embodiments, the human subject has received one or more lines of prior therapy prior to administering the dose. In some embodiments, the human subject has received 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more prior lines of therapy prior to administering the dose. In some embodiments, the human subject has received at least about 2, at least about 3, at least about 4, or at least about 5 prior lines of therapy prior to administering the dose. In some embodiments, the method provides surprisingly advantageous clinical results such as overall survival at least about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 months and/or progression-free survival (PFS) at least about 4, 5, 6, 7, 8, 9, or 10 months and/or overall response rate of at least about 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, or 30% and/or disease control rate of at least about 70%, 72%, 74%, 76%, 78%, or 80%. In some embodiments, overall survival for MPM patients is about 10 months, 11 months, about 12 months, about 13 months, about 14 months, or more. In some embodiments, overall survival for ovarian cancer patients is about 8 months, about 9 months, about 10 months, about 11 months, about 12 months, or more. In some embodiments, progression free survival for MPM patients is about 5 months, about 6 months, about 7 months, about 8 months, or more. In some embodiments, progression free survival for ovarian cancer patients is about 5 moths, about 6 months, about 7 months, about 8 months, or more.
[00456] In some embodiments, the persistence of TC-210 T cells in the tumor of patients lasts longer than the persistence of the TC-210 T cells in the peripheral blood.
[00457] In some embodiments, the method further comprises selecting the human subject by an expression level of mesothelin in a tumor sample from the human subject. In some embodiments, the tumor sample has been pathologically reviewed with confirmed positive mesothelin expression on at least about 50% tumor cells that are 1+ and/or 2+ and/or 3+ by immunohistochemistry. In some
embodiments, the tumor sample has been pathologically reviewed with confirmed positive mesothelin expression on at least about 50% tumor cells that are 2+ and/or 3+ by immunohistochemistry. In some embodiments, the tumor sample has been pathologically reviewed with confirmed positive mesothelin expression on at least about 50% tumor cells that are 1+, 2+, and/or 3+ by immunohistochemistry, wherein the cancer is non-small cell lung cancer (NSCLC) or cholangiocarcinoma. In some embodiments, the tumor sample has been pathologically reviewed with confirmed positive mesothelin expression on at least about 50% tumor cells that are 2+, and/or 3+ by immunohistochemistry, wherein the cancer is malignant pleural mesothelioma (MPM) or ovarian cancer.
[00458] In some embodiments, the MSLN-expressing cancer is mesothelioma. In some embodiments, the MSLN-expressing cancer is malignant pleural mesothelioma (MPM). In some embodiments, the MSLN-expressing cancer is ovarian adenocarcinoma. In some embodiments, the MSLN-expressing cancer is cholangiocarcinoma. In some embodiments, the MSLN-expressing cancer is non-small cell lung cancer (NSCLC). In some embodiments, the MSLN-expressing cancer is selected from the group consisting of squamous carcinoma, adenocarcinoma, sarcomata, endometrial cancer, breast cancer, ovarian cancer, cervical cancer, fallopian tube cancer, primary peritoneal cancer, colon cancer, colorectal cancer, melanoma, renal cell carcinoma, lung cancer, non- small cell lung cancer, stomach cancer, bladder cancer, gall bladder cancer, liver cancer, thyroid cancer, laryngeal cancer, salivary gland cancer, esophageal cancer, head and neck cancer, glioblastoma, glioma, prostate cancer, pancreatic cancer, mesothelioma, sarcoma, hematological cancer, leukemia, lymphoma, neuroma, and any combinations thereof. In some embodiments, at least one of the two or more lines of prior therapy comprises surgery, chemotherapy, hormonal therapy, biological therapy, antibody therapy, radiation therapy, or any combinations thereof, (e.g., a combination therapy).
[00459] In some embodiments, the human subject may have previously received one or more lines of prior treatment. The cancer in the human subject may be relapsed after one or more lines of prior treatment or is refractory or resistant to one or more lines of prior treatment. In some embodiments, the human subject may have previously received two or more lines of prior treatment. In some embodiments, the MSLN-expressing cancer is a relapsed cancer after two or more lines of prior therapy or is highly refractory or highly resistant to two or more lines of prior therapy.
[00460] In some embodiments, at least one of the lines of prior therapy comprises a systemic therapy. In some embodiments, the systemic therapy comprises a biologic or chemotherapy. In some embodiments, the biologic comprises an antibody, antibody drug conjugate (ADC), cellular therapy, peptide, polypeptide, enzyme, vaccine, oligonucleotide, oncolytic virus, polysaccharide, or gene
therapy. In some embodiments, the biologic comprises an antibody or antibody drug conjugate (ADC).
[00461] In some embodiments, the checkpoint inhibitor antibody comprises nivolumab, pembrolizumab, cemiplimab, atezolizumab, avelumab, durvalumab, ipilimumab, or a biosimilar thereof. In some embodiments, the biologic comprises a cellular therapy.
[00462] In some embodiments, at least one of the lines of prior therapy comprises two or more different treatment regimes. In some embodiments, the human subject received at least one line of prior therapy comprising a systemic therapy. In some embodiments, the human subject received at least one line of prior therapy comprising a chemotherapy. In some embodiments, the human subject received at least one line of prior therapy comprising a biologic. In some embodiments, the human subject received at least one line of prior therapy comprising a combination therapy including a systemic therapy. In some embodiments, the human subject received at least two lines of prior therapy comprising a systemic therapy. In some embodiments, the human subject received at least one line of prior therapy comprising a chemotherapy. In some embodiments, the human subject received at least two lines of prior therapy comprising a chemotherapy. In some embodiments, the human subject received at least one line of prior therapy comprising a biologic. In some embodiments, the human subject received at least two lines of prior therapy comprising a biologic. In some embodiments, the human subject received at least two lines of therapy prior therapy comprising combination therapy including a systemic therapy. In some embodiments, the human subject received at least one line of prior therapy comprising a chemotherapy and at least one line of prior therapy comprising a biologic. In some embodiments, the human subject received at least one line of prior therapy comprising a chemotherapy and at least one line of prior therapy comprising a combination therapy including a systemic therapy. In some embodiments, the human subject received at least one line of prior therapy comprising a biologic and at least one line of prior therapy comprising a combination therapy including a systemic therapy. In some embodiments, the human subject received at least one line of prior therapy comprising a systemic therapy and at least one line of prior therapy comprising a surgical treatment or a combination therapy comprising a surgical treatment. In some embodiments, the human subject received at least one line of prior therapy comprising a systemic therapy and at least one line of prior therapy comprising a radiation therapy or a combination therapy comprising a radiation therapy.
[00463] In some embodiments, the human subject is at risk of recurrence. In some embodiments, the human subject has a prior history of recurrence after at least one line of prior therapy. In some embodiments, the MSLN-expressing cancer is locally advanced. In some embodiments, the MSLN- expressing cancer is metastatic. In some embodiments, the MSLN-expressing cancer is refractory to
at least one line of prior therapy. In some embodiments, the MSLN-expressing cancer is refractory to at least two lines of prior therapy. In some embodiments, the MSLN-expressing cancer shows less than 20% regression after the human subject has received one line of prior therapy. In some embodiments, the MSLN-expressing cancer shows less than 20% regression after the human subject has received at least two lines of prior therapy. In some embodiments, the MSLN-expressing cancer is recurrent following one line of prior therapy. In some embodiments, the MSLN-expressing cancer is recurrent following at least two lines of prior therapy.
[00464] In some embodiments, the population of T cells is administered as a single agent. In some embodiments, a target dose of the population of T cell is about 5 x 107/m2. In some embodiments, a target dose of the population of T cells is about 1 x 108/m2. In some embodiments, a target dose of anti-MSLN TFP T cells is about 3 x 108/m2. In some embodiments, a target dose of anti-MSLN TFP T cells is about 5 x 108/m2. In some embodiments, a target dose of anti-MSLN TFP T cells is about 1 x 109/m2. In some embodiments, the administered dose is in range of ± 15% of the target dose. In some embodiments, a second portion of a dose of the population of T cells is administered no sooner than 60 days following administration of a first portion of a dose of the population of T cells and no later than 12 months following administration of the first portion of a dose.
[00465] In some embodiments, the method further comprises administering to the human subject a lymphodepleting chemotherapy regimen prior to administration of the first portion of a dose of the population of T cells. In some embodiments, the lymphodepleting chemotherapy regimen comprises administration of five doses of fludarabine and three doses of cyclophosphamide. In some embodiments, the lymphodepleting chemotherapy regimen comprises administration of four doses of fludarabine and three doses of cyclophosphamide. In some embodiments, the lymphodepleting chemotherapy regimen comprises administration of four doses of fludarabine and four doses of cyclophosphamide. In some embodiments, the lymphodepleting chemotherapy regimen comprises administration of fludarabine at a level of 20 mg/m2/day on days -9 through -3 relative to administration of the population of T cells, and further comprises administration of cyclophosphamide at a level of 700 mg/m2/day on days -7 through -4 relative to administration of the population of T cells. In some embodiments, the lymphodepleting chemotherapy regimen comprises administration of fludarabine at a level of 30 mg/m2/day on days -7 through -4 relative to administration of the population of T cells, and further comprises administration of cyclophosphamide at a level of 600 mg/m2/day on days -6 through -4 relative to administration of the population of T cells. In some embodiments, the lymphodepleting chemotherapy regimen comprises administration of fludarabine at a level of 40 mg/m2/day on days -6 through -4 relative to administration of the population of T cells, and further comprises administration of
cyclophosphamide at a level of 400 mg/m2/day on days -5 through -3 relative to administration of the population of T cells. In some embodiments, the method further comprises administering a checkpoint inhibitor agent to the human subject. In some embodiments, the checkpoint inhibitor is administered four times at three dose levels, comprising a first portion of a dose, a second portion of a dose, a third dose, and a fourth dose. In some embodiments, the first portion of a dose of the checkpoint inhibitor agent is administered three weeks after administration of the population of T cells, and wherein subsequent doses are administered every three weeks thereafter. In some embodiments, the checkpoint inhibitor agent is administered every three weeks.
[00466] In some embodiments, the method further comprises administering to the human subject an anti-PD-1 antibody. In some embodiments, the anti-PD-1 antibody is administered before administering the population of T cells, concurrently with the population of T cells, or after administering the population of T cells. In some embodiments, the anti-PD-1 antibody is administered in one, two, three or more doses. In some embodiments, the anti-PD-1 antibody is administered with a dose of at least about 2, 20 or 200 mg. In some embodiments, the anti-PD-1 antibody is administered at least every 3 weeks. In some embodiments, the anti-PD-1 antibody is administered for a total of at least about 12 weeks.
[00467] In some embodiments, the antibody domain is a murine, human or humanized antibody domain. In some embodiments, the anti-MSLN binding domain is a scFv or a VHH domain. In some embodiments, the anti-MSLN binding domain comprises a heavy chain variable domain having at least 80%, at least 85%, at least 90%, at least 95% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 11, SEQ ID NO: 15, SEQ ID NO: 19, SEQ ID NO: 23, SEQ ID NO: 27, SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 46, SEQ ID NO: 47, or SEQ ID NO: 48. In some embodiments, the anti-MSLN binding domain comprises a light chain variable domain having at least 80%, at least 85%, at least 90%, at least 95% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 5, SEQ ID NO: 9, SEQ ID NO: 13, SEQ ID NO: 17, SEQ ID NO: 21, SEQ ID NO: 25, SEQ ID NO: 29, or SEQ ID NO: 31. In some embodiments, the anti-MSLN binding domain comprises is a VHH domain having at least 80%, at least 85%, at least 90%, at least 95% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 46. In one embodiment, the anti-MSLN binding domain is a single domain antibody comprising a heavy chain variable domain having at least 80%, at least 85%, at least 90%, at least 95% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 46. In some embodiments, the anti-MSLN binding domain comprises is a VHH domain having at least 80%, at least 85%, at least 90%, at least 95% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 47. In some embodiments, the TFP includes an extracellular domain of a TCR subunit that
comprises an extracellular domain or portion thereof of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, TCR gamma chain, a TCR delta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications. In some embodiments, the TFP includes a transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, TCR gamma chain, a TCR delta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications. In some embodiments, the TCR intracellular domain comprises an intracellular domain of TCR alpha, TCR beta, TCR delta, or TCR gamma, or an amino acid sequence having at least one modification thereto. In some embodiments, the TCR intracellular domain comprises a stimulatory domain from an intracellular signaling domain of CD3 gamma, CD3 delta, or CD3 epsilon, or an amino acid sequence having at least one modification thereto. In some embodiments, the antibody domain is connected to the TCR extracellular domain by a linker sequence. In some embodiments, the linker is 120 amino acids in length or less. In some embodiments, the linker sequence comprises (G4S)n, wherein G is glycine, S is serine, and n is an integer from 1 to 10, e.g., 1 to 4. In some embodiments, at least two or three of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain are from a same TCR subunit. In some embodiments, at least two of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain are from the same TCR subunit. In some embodiments, at least two of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain are from CD3 epsilon. In some embodiments, at least two of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain are from CD3 delta. In some embodiments, at least of two of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain are from CD3 gamma. In some embodiments, all three of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain are from the same TCR subunit. In some embodiments, the TCR subunit comprises the amino acid sequence of SEQ ID NO: 49. In some embodiments, the TCR subunit comprises the amino acid sequence of SEQ ID NO: 50. In some embodiments, the TCR subunit comprises the amino acid sequence of SEQ ID NO: 51. In some embodiments, the TFP comprises the amino acid sequence of SEQ ID NO: 52. In some embodiments, the population of T cells are human T cells. In some embodiments, the population of T cells are CD8+ T cells or CD4+ T cells. In some embodiments, the population of T cells are alpha beta T cells or gamma delta T cells. In some embodiments, the population of T cells are autologous or allogeneic T cells. In some embodiments,
the method further comprises obtaining a population of cells from the human subject prior to administration of the one or more doses of the population of T cells, and transducing T cells from the population of cells with a recombinant nucleic acid comprising a sequence encoding the TFP, thereby generating the population of T cells.
[00468] In some embodiments, the method further comprises identifying the human subject as having a MSLN-expressing cancer. In some embodiments, the method does not induce cytokine release syndrome (CRS) above grade 1, above grade 2, or above grade 3.
[00469] Known adverse events after CAR T cell therapy include, but are not limited to, cytokine release syndrome (CRS), severe CRS (sCRS), CAR T cell-related encephalopathy syndrome (CRES) (more recently termed immune effector cell-associated neurotoxicity syndrome (ICANS)), Central Nervous System (CNS) toxicity, tumor lysis syndrome (TLS), infusion reactions, cytopenias, cardiac toxicity, hypogammaglobulinemia and graft-versus-host-disease (see, e.g., Yanez et al., CAR T Cell Toxicity: Current Management and Future Directions. HemaSphere, 2019;3 :2). Non-limiting examples of CRS symptoms can include back pain, skin rash, dizziness, chills, shortness of breath, chest pain, and neurologic events. Signs of CRS can include, but are not limited to tachycardia and hypotension. Other adverse effects of CAR T cell therapy include, but are not limited to, fever, hemodynamic changes, dyspnea and/or hypoxia and neurologic symptoms. Clinically, CRS can present with a variety of symptoms ranging from a prodromal syndrome to life-threatening manifestations. The prodromal syndrome of CRS includes a flu-like syndrome with fever, fatigue, headache, arthralgia, myalgia, and malaise. Pyrexia (fever > 38°C) is the most frequent, and usually the first, clinical sign of CRS. In some cases, it rises above 40°C and, compared to patients with mild or moderate CRS, fever in patients with sCRS peaks earlier and has a longer duration.
Gastrointestinal symptoms such as nausea, diarrhea and vomiting, are also common. Severe CRS (sCRS), characterized by hemodynamic instability and organ dysfunction, is often preceded by mild or moderate signs such as hypoxia and mild hypotension. The clinical features of neurotoxicity associated with CAR T are numerous and may vary from headache, pain, memory loss, meningismus, dizziness, alterations in mental status (somnolence, disorientation, impaired attention, agitation, delirium, coma), movement disorders (tremor, myoclonus, facial automatisms), impaired speech (dysartria, aphasia), seizures and encephalopathy to coma.
[00470] In various embodiments, the methods, provided herein can further comprise selecting the human subject for the treatment provided herein. The selection of the human subject can be determined by an expression level of mesothelin in a tumor sample from the human subject. The expression of mesothelin can be determined by various methods, for example, immunohistochemistry. For example, the tumor sample can be pathologically reviewed with
confirmed positive mesothelin expression on at least about 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more tumor cells that are 2+ and/or 3+ by immunohistochemistry. In some embodiments, the tumor sample has been pathologically reviewed with confirmed positive mesothelin expression on at least about 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more tumor cells that are 2+ and/or 3+ by immunohi stochemi stry .
[00471] The MSLN-expressing cancer may be a relapsed cancer after the two or more lines of prior therapy. The MSLN-expressing cancer may be highly refractory or highly resistant to the two or more lines of prior therapy. For example, the MSLN-expressing cancer can be mesothelioma (e.g., malignant pleural mesothelioma (MPM)), ovarian adenocarcinoma, cholangiocarcinoma, or nonsmall cell lung cancer (NSCLC). The MSLN-expressing cancer can be selected from the group consisting of squamous carcinoma, adenocarcinoma, sarcomata, endometrial cancer, breast cancer, ovarian cancer, cervical cancer, fallopian tube cancer, primary peritoneal cancer, colon cancer, colorectal cancer, melanoma, renal cell carcinoma, lung cancer, non-small cell lung cancer, stomach cancer, bladder cancer, gall bladder cancer, liver cancer, thyroid cancer, laryngeal cancer, salivary gland cancer, esophageal cancer, head and neck cancer, glioblastoma, glioma, prostate cancer, pancreatic cancer, mesothelioma, sarcoma, hematological cancer, leukemia, lymphoma, neuroma, and any combinations thereof.
[00472] In some aspects, at least one of the two or more lines of prior therapy can comprise surgery, chemotherapy, hormonal therapy, biological therapy, antibody therapy, radiation therapy, or any combinations thereof. Any combinations described herein can be referred to as a combination therapy. At least one of the two or more lines of prior therapy can comprise a systemic therapy. The systemic therapy can comprise a biologic or chemotherapy.
[00473] The biologic can comprise an antibody, antibody drug conjugate (ADC), cellular therapy, peptide, polypeptide, enzyme, vaccine, oligonucleotide, oncolytic virus, polysaccharide, or gene therapy. The antibody or ADC can comprise a checkpoint inhibitor antibody or ADC. The checkpoint inhibitor antibody can comprise nivolumab, pembrolizumab, cemiplimab, atezolizumab, avelumab, durvalumab, ipilimumab, or a biosimilar thereof.
[00474] In some aspects, at least one or at least one of the two or more lines of prior therapy can comprise two or more different treatment regimes, e.g., different doses or dosing schedules. For example, each treatment regimen may comprise administering a different amount of TFP T cells described herein. The human subject may have received at least one line of prior therapy comprising a systemic therapy. The human subject may have received at least one line of prior therapy comprising a chemotherapy. The human subject may have received at least one line of prior therapy
comprising a biologic. The human subject may have received at least one line of prior therapy comprising a combination therapy including a systemic therapy. The human subject may have received at least two lines of prior therapy comprising a systemic therapy. The human subject may have received at least two lines of prior therapy comprising a chemotherapy. The human subject may have received at least two lines of prior therapy comprising a biologic. The human subject may have received at least two lines of therapy prior therapy comprising combination therapy including a systemic therapy. The human subject may have received at least one line of prior therapy comprising a chemotherapy and at least one line of prior therapy comprising a biologic. The human subject may have received at least one line of prior therapy comprising a chemotherapy and at least one line of prior therapy comprising a combination therapy including a systemic therapy. The human subject may have received at least one line of prior therapy comprising a biologic and at least one line of prior therapy comprising a combination therapy including a systemic therapy. The human subject may have received at least one line of prior therapy comprising a systemic therapy and at least one line of prior therapy comprising a surgical treatment or a combination therapy comprising a surgical treatment. The human subject may have received at least one line of prior therapy comprising a systemic therapy and at least one line of prior therapy comprising a radiation therapy or a combination therapy comprising a radiation therapy.
[00475] The human subject described herein can have a cancer, e.g., a MSLN-expressing cancer. The human subject can be at risk of recurrence. The human subject may have a prior history of recurrence after at least one line of prior therapy. The MSLN-expressing cancer can be locally advanced. The MSLN-expressing cancer can be metastatic. The MSLN-expressing cancer can be refractory to one or more lines of prior therapy. The MSLN-expressing cancer can be refractory to at least two of two or more lines of prior therapy. The MSLN-expressing cancer may show less than 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10% or less regression after the human subject has received one or more, or two or more lines of prior therapy. The MSLN-expressing cancer can be recurrent following one or more, or two or more lines of prior therapy.
[00476] The population of T cells can be administered as a single agent. The target dose of the population of T cells (e.g., anti-MSLN TFP T cells) may be about 5 x 107/m2. The target dose of the population of T cells may be about 1 x 108/m2. The target dose of the population of T cells may be about 3 x 108/m2. The target dose of the population of T cells may be about 5 x 108/m2. The target dose of the population of T cells may be about 1 x 109/m2. The target dose of the population of T cells may be at least about lxl06/m2, 5xl06/m2, 1 x 107/m2, 5 x 107/m2, 1 x 108/m2, 3 x 108/m2, 5 x 108/m2, 1 x 109/m2, 5 x 109/m2, 1 x 1010/m2, 5 x 1010/m2 or more. The administered dose may be in range of ± 20%, ± 15%, ± 10%, or ± 5% of the target dose.
[00477] In some cases, a second portion of a dose of the population of T cells can be administered no sooner than 300, 250, 200, 250, 100, 90, 80, 70, 60, 50, 40, 30, 20, or 10 days following administration of a first portion of a dose of the population of T cells and no later than 18, 17, 16, 15, 14, 13, 12, or 11 months following administration of the first portion of a dose.
[00478] In some embodiments, administration of the TFP or population of T cells results in at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, or at least 70% regression in tumor volume. In some embodiments, the regression in tumor volume is maintained for at least 2 weeks, at least 1 month, at least 2 months, at least 3 months, at least 4 months, at least 5 months, at least 6 months, or at least 1 year.
[00479] In some embodiments, the TFP or population of T cells is administered at least 2 weeks, at least 1 month, at least 2 months, at least 3 months, at least 4 months, at least 5 months, or at least 6 months following one or more prior lines of therapy.
[00480] The method can further comprise administering to the human subject a lymphodepleting chemotherapy regimen prior to administration of the first portion of a dose of the population of T cells.
[00481] The lymphodepleting chemotherapy regimen can comprise administration of at least one dose of fludarabine and at least one dose of cyclophosphamide. The lymphodepleting chemotherapy regimen can comprise administration of five doses of fludarabine and three doses of cyclophosphamide. The lymphodepleting chemotherapy regimen can comprise administration of four doses of fludarabine and three doses of cyclophosphamide. The lymphodepleting chemotherapy regimen can comprise administration of four doses of fludarabine and four doses of cyclophosphamide.
[00482] The lymphodepleting chemotherapy regimen can comprise any dosing schedule of fludarabine or cyclophosphamide described herein. For example, the lymphodepleting chemotherapy regimen can comprise administration of fludarabine at a level of about 20 mg/m2/day on days -9 through -3 relative to administration of the population of T cells. The lymphodepleting chemotherapy regimen can further comprise administration of cyclophosphamide at a level of about 700 mg/m2/day on days -7 through -4 relative to administration of the population of T cells. The lymphodepleting chemotherapy regimen can comprise administration of fludarabine at a level of about 30 mg/m2/day on days -7 through -4 relative to administration of the population of T cells. The lymphodepleting chemotherapy regimen can further comprise administration of cyclophosphamide at a level of about 600 mg/m2/day on days -6 through -4 relative to administration of the population of T cells.
[00483] The lymphodepleting chemotherapy regimen can comprise administration of fludarabine at a level of about 40 mg/m2/day on days -6 through -4 relative to administration of the population of T cells. The lymphodepleting chemotherapy regimen can comprise administration of cyclophosphamide at a level of about 400 mg/m2/day on days -5 through -3 relative to administration of the population of T cells. The method further can comprise administering a checkpoint inhibitor agent to the human subject. The checkpoint inhibitor can be administered at least one time (e.g., two times, three times, four times, five times, six times, or more) at two or more dose levels (e.g., three or four dose levels). The two or more dose levels can comprise a first portion of a dose, a second portion of a dose, a third dose, and a fourth dose. The first portion of a dose of the checkpoint inhibitor agent can be administered at least one week, two weeks, three weeks or four weeks after administration of the population of T cells. The subsequent doses can be administered every one week, two weeks, three weeks or four weeks thereafter. The checkpoint inhibitor agent can be administered every one week, two weeks, three weeks or four weeks. The checkpoint inhibitor can comprise nivolumab. The checkpoint inhibitor can comprise pembrolizumab.
[00484] The TFP of the TFP T cell described herein can comprise an extracellular domain of a TCR subunit that comprises an extracellular domain or portion thereof of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, TCR gamma chain, a TCR delta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20, 15, 10, or 5 modifications. The TFP can comprise a transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, TCR gamma chain, a TCR delta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20, 15, 10, or 5 modifications. The TCR intracellular domain can comprise an intracellular domain of TCR alpha, TCR beta, TCR delta, or TCR gamma, or an amino acid sequence having at least one modification thereto. The TCR intracellular domain can comprise a stimulatory domain from an intracellular signaling domain of CD3 gamma, CD3 delta, or CD3 epsilon, or an amino acid sequence having at least one modification thereto. The antibody domain (e.g., an antibody domain comprising an anti-MSLN binding domain) can be connected to the TCR extracellular domain by a linker sequence. The linker can be 120 amino acids in length or less. The linker sequence can comprise (G4S)n, wherein G is glycine, S is serine, and n is an integer from 1 to 10, e.g., 1 to 4.
[00485] In some cases, at least two or three of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain can be from a same TCR subunit. In some
cases, at least two of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain can be from the same TCR subunit. For example, at least two of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain can be from CD3 epsilon. For example, at least two of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain can be from CD3 delta. For example, at least of two of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain can be from CD3 gamma. In some cases, all three of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain can be from the same TCR subunit.
[00486] The TCR subunit can comprise the amino acid sequence of SEQ ID NO: 49. The TCR subunit can comprise the amino acid sequence of SEQ ID NO: 50. The TCR subunit can comprise the amino acid sequence of SEQ ID NO: 51. The TFP can comprise the amino acid sequence of SEQ ID NO: 52. The population of T cells can be human T cells. The population of T cells can be CD8+ T cells or CD4+ T cells. The population of T cells can be alpha beta T cells or gamma delta T cells. The population of T cells can be autologous or allogeneic T cells.
[00487] The method can further comprise obtaining a population of cells from the human subject prior to administration of the one or more doses of the population of T cells. The method can further comprise transducing T cells from the population of cells with a recombinant nucleic acid comprising a sequence encoding the TFP, thereby generating the population of T cells (e.g., anti- MSLN TFP T cells). The method can further comprise identifying the human subject as having a MSLN-expressing cancer. The method may not induce cytokine release syndrome (CRS). For example, the method may not induce CRS above grade 1, above grade 2, or above grade 3.
[00488] Also provided herein is a method of treating a mesothelin (MSLN)-expressing cancer in a human subject in need thereof after two or more lines of prior therapy for treating the MSLN-expressing cancer. The method can comprise (a) obtaining a population of cells from the human subject; and (b) administering to the human subject one or more doses of a population of T cells transduced with a recombinant nucleic acid comprising a sequence encoding a T cell receptor (TCR) fusion protein (TFP) as described herein. The TFP can comprise (I) a TCR subunit comprising (i) a CD3 epsilon extracellular domain, (ii) a CD3 epsilon transmembrane domain, and (iii) a CD3 epsilon intracellular domain; and (II) an antibody domain comprising an anti-MSLN antigen binding domain. The human subject may have previously received the two or more lines of prior therapy for treating the MSLN-expressing cancer.
[00489] The TCR subunit and the antibody domain can be operatively linked. The TFP can be capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide.
[00490] The MSLN-expressing cancer may be relapsed after the two or more lines of prior therapy, or may be highly refractory or highly resistant to the two or more lines of prior therapy.
[00491] The population of cells obtained from the human subject can be PBMCs. The population of T cells can comprise a population of CD4+ and CD8+ T cells isolated from the PBMCs prior to transduction with the recombinant nucleic acid. The human subject may have previously been identified as having a MSLN-expressing cancer. The human subject can be identified as having a MSLN-expressing cancer by immunohistochemistry and/or flow cytometry to identify CD 19 expression on cancerous cells from the human subject. The human subject may have been diagnosed with the MSLN-expressing cancer.
[00492] Also provided herein are methods of treating a subject with a disease, disorder or condition. A method of treatment can comprise administering a pharmaceutical composition disclosed herein to a subject with a disease, disorder or condition. The present disclosure provides methods of treatment comprising an immunogenic therapy. Methods of treatment for a disease (such as cancer or a viral infection) are provided. A method can comprise administering to a subject an effective amount of a pharmaceutical composition comprising anti-MSLN TFP T cells.
[00493] In some embodiments, the method of treating a subject with a disease or condition comprises administering to the subject the pharmaceutical composition disclosed herein. In some embodiments, the method is a method of preventing resistance to a cancer therapy, wherein the method comprises administering to a subject in need thereof the pharmaceutical composition disclosed herein. In some embodiments, the method is a method of inducing an immune response, wherein the method comprises administering to a subject in need thereof the pharmaceutical composition disclosed herein. In some embodiments, the immune response is a humoral response. In some embodiments, the immune response is a cytotoxic T cell response.
[00494] In some embodiments, the subject has cancer, wherein the cancer is selected from the group consisting of mesothelioma, ovarian cancer, cholangiocarcinoma, lung adenocarcinoma, triplenegative breast cancer, and pancreatic adenocarcinoma.
[00495] In some embodiments, the method further comprises administering at least one additional therapeutic agent or modality. In some embodiments, the at least one additional therapeutic agent or modality is surgery, a checkpoint inhibitor, an antibody or fragment thereof, a chemotherapeutic agent, radiation, a vaccine, a small molecule, a T cell, a vector, and APC, a polynucleotide, an oncolytic virus or any combination thereof. In some embodiments, the at least one additional therapeutic agent is an anti-PD-1 agent and anti-PD-Ll agent, an anti-CTLA-4 agent, or an anti-CD40 agent. In some embodiments, the additional therapeutic agent is administered before, simultaneously, or after administering the pharmaceutical composition disclosed herein.
[00496] In some embodiments, the additional therapeutic agent is administered before, simultaneously, or after administering the pharmaceutical composition disclosed herein.
[00497] In some embodiments, the cancer is selected from the group consisting of carcinoma, lymphoma, blastoma, sarcoma, leukemia, squamous cell cancer, lung cancer (including small cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung), cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer (including gastrointestinal cancer), pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, melanoma, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, head and neck cancer, colorectal cancer, rectal cancer, soft-tissue sarcoma, Kaposi’s sarcoma, B-cell lymphoma (including low grade/follicular non-Hodgkin’s lymphoma (NHL), small lymphocytic (SL) NHL, intermediate grade/follicular NHL, intermediate grade diffuse NHL, high grade immunoblastic NHL, high grade lymphoblastic NHL, high grade small non-cleaved cell NHL, bulky disease NHL, mantle cell lymphoma, AIDS-related lymphoma, and Waldenstrom’s macroglobulinemia), chronic lymphocytic leukemia (CLL), acute lymphoblastic leukemia (ALL), myeloma, Hairy cell leukemia, chronic myeloblasts leukemia, and post-transplant lymphoproliferative disorder (PTLD), abnormal vascular proliferation associated with phakomatoses, edema, Meigs’ syndrome, and combinations thereof.
[00498] The methods of the disclosure can be used to treat any type of cancer known in the art. Nonlimiting examples of cancers to be treated by the methods of the present disclosure can include melanoma (e.g., metastatic malignant melanoma), renal cancer (e.g., clear cell carcinoma), prostate cancer (e.g., hormone refractory prostate adenocarcinoma), pancreatic adenocarcinoma, breast cancer, colon cancer, lung cancer (e.g., non-small cell lung cancer), esophageal cancer, squamous cell carcinoma of the head and neck, liver cancer, ovarian cancer, cervical cancer, thyroid cancer, glioblastoma, glioma, leukemia, lymphoma, and other neoplastic malignancies.
[00499] Additionally, the disease or condition provided herein includes refractory or recurrent malignancies whose growth may be inhibited using the methods of treatment of the present disclosure. In some embodiments, a cancer to be treated by the methods of treatment of the present disclosure is selected from the group consisting of carcinoma, squamous carcinoma, adenocarcinoma, sarcomata, endometrial cancer, breast cancer, ovarian cancer, cervical cancer, fallopian tube cancer, primary peritoneal cancer, colon cancer, colorectal cancer, squamous cell carcinoma of the anogenital region, melanoma, renal cell carcinoma, lung cancer, non-small cell lung cancer, squamous cell carcinoma of the lung, stomach cancer, bladder cancer, gall bladder cancer, liver cancer, thyroid cancer, laryngeal cancer, salivary gland cancer, esophageal cancer, head and neck cancer, glioblastoma, glioma,
squamous cell carcinoma of the head and neck, prostate cancer, pancreatic cancer, mesothelioma, sarcoma, hematological cancer, leukemia, lymphoma, neuroma, and combinations thereof. In some embodiments, a cancer to be treated by the methods of the present disclosure include, for example, carcinoma, squamous carcinoma (for example, cervical canal, eyelid, tunica conjunctiva, vagina, lung, oral cavity, skin, urinary bladder, tongue, larynx, and gullet), and adenocarcinoma (for example, prostate, small intestine, endometrium, cervical canal, large intestine, lung, pancreas, gullet, rectum, uterus, stomach, mammary gland, and ovary). In some embodiments, a cancer to be treated by the methods of the present disclosure further include sarcomata (for example, myogenic sarcoma), leukosis, neuroma, melanoma, and lymphoma. In some embodiments, a cancer to be treated by the methods of the present disclosure is breast cancer. In some embodiments, a cancer to be treated by the methods of treatment of the present disclosure is triple negative breast cancer (TNBC). In some embodiments, a cancer to be treated by the methods of treatment of the present disclosure is ovarian cancer. In some embodiments, a cancer to be treated by the methods of treatment of the present disclosure is colorectal cancer.
[00500] In some embodiments, a patient or population of patients to be treated with a pharmaceutical composition of the present disclosure have a solid tumor. In some embodiments, a solid tumor is a melanoma, renal cell carcinoma, lung cancer, bladder cancer, breast cancer, cervical cancer, colon cancer, gall bladder cancer, laryngeal cancer, liver cancer, thyroid cancer, stomach cancer, salivary gland cancer, prostate cancer, pancreatic cancer, or Merkel cell carcinoma. In some embodiments, a patient or population of patients to be treated with a pharmaceutical composition of the present disclosure have a hematological cancer. In some embodiments, the patient has a hematological cancer such as Diffuse large B cell lymphoma (“DLBCL”), Hodgkin’s lymphoma (“HL”), Non-Hodgkin’s lymphoma (“NHL”), Follicular lymphoma (“FL”), acute myeloid leukemia (“AML”), or Multiple myeloma (“MM”). In some embodiments, a patient or population of patients to be treated having the cancer selected from the group consisting of ovarian cancer, lung cancer and melanoma.
[00501] Specific examples of cancers that can be prevented and/or treated in accordance with present disclosure include, but are not limited to, malignant pleural mesothelioma (MPM), non-small cell lung cancer (NSCLC), serous ovarian adenocarcinoma, or cholangiocarcinoma.
[00502] The pharmaceutical compositions provided herein may be used alone or in combination with conventional therapeutic regimens such as surgery, irradiation, chemotherapy and/or bone marrow transplantation (autologous, syngeneic, allogeneic or unrelated).
[00503] In some embodiments, at least one or more chemotherapeutic agents may be administered in addition to the pharmaceutical composition comprising an immunogenic therapy. In some
embodiments, the one or more chemotherapeutic agents may belong to different classes of chemotherapeutic agents.
[00504] In practicing the methods of treatment or use provided herein, therapeutically-effective amounts of the pharmaceutical compositions can be administered to a subject having a disease or condition. A therapeutically-effective amount can vary widely depending on the severity of the disease, the age and relative health of the subject, the potency of the compounds used, and other factors.
[00505] In some embodiments, the methods of treatment include one or more rounds of leukapheresis prior to transplantation of T cells. The leukapheresis may include collection of peripheral blood mononuclear cells (PBMCs). Leukapheresis may include mobilizing the PBMCs prior to collection. Alternatively, non-mobilized PBMCs may be collected. A large volume of PBMCs may be collected from the subject in one round. Alternatively, the subject may undergo two or more rounds of leukapheresis. The volume of apheresis may be dependent on the number of cells required for transplant. For instance, 12-15 litres of non-mobilized PBMCs may be collected from a subject in one round. The number of PBMCs to be collected from a subject may be between IxlO8 to 5xl010 cells. The number of PBMCs to be collected from a subject may be IxlO8, 5xl08, IxlO9, 5xl09, IxlO10 or 5xl010 cells. The minimum number of PBMCs to be collected from a subject may be lxl06/kg of the subject’s weight. The minimum number of PBMCs to be collected from a subject may be lxl06/kg, 5xl06/kg, lxl07/kg, 5xl07/kg, lxl08/kg, 5xl08/kg of the subject’s weight.
[00506] In some embodiments, the methods of treatment include cancer treatment of a subject prior to administering anti-MSLN TFP cells. The cancer treatment may include chemotherapy, immunotherapy, targeted agents, radiation and high dose corticosteroid. The methods may include administering chemotherapy to a subject including lymphodepleting chemotherapy using high doses of myeloablative agents. In some embodiments, the methods include administering a preconditioning agent, such as a lymphodepleting or chemotherapeutic agent, such as cyclophosphamide, fludarabine, or combinations thereof, to a subject prior to the first or subsequent dose. For example, the subject may be administered a preconditioning agent at least 2 days prior, such as at least 3, 4, 5, 6, 7, 8, 9 or 10 days prior, to the first or subsequent dose. In some embodiments, the subject is administered a preconditioning agent no more than 10 days prior, such as no more than 9, 8, 7, 6, 5, 4, 3, or 2 days prior, to the first or subsequent dose.
[00507] In some embodiments, where the lymphodepleting agent comprises cyclophosphamide, the subject is administered between 0.3 grams per square meter of the body surface of the subject (g/m2) and 5 g/m2 cyclophosphamide. In some cases, the amount of cyclophosphamide administered to a subject is about at least 0.3 g/m2. In some cases, the amount of cyclophosphamide administered to a subject is about at most 5 g/m2. In some cases, the amount of cyclophosphamide administered to a
subject is about 0.3 g/m2 to 0.4 g/m2, 0.3 g/m2 to 0.5 g/m2, 0.3 g/m2 to 0.6 g/m2, 0.3 g/m2 to 0.7 g/m2, 0.3 g/m2 to 0.8 g/m2, 0.3 g/m2 to 0.9 g/m2, 0.3 g/m2 to 1 g/m2, 0.3 g/m2 to 2 g/m2, 0.3 g/m2 to 3 g/m2, 0.3 g/m2 to 4 g/m2, 0.3 g/m2 to 5 g/m2, 0.4 g/m2 to 0.5 g/m2, 0.4 g/m2 to 0.6 g/m2, 0.4 g/m2 to 0.7 g/m2, 0.4 g/m2 to 0.8 g/m2, 0.4 g/m2 to 0.9 g/m2, 0.4 g/m2 to 1 g/m2, 0.4 g/m2 to 2 g/m2, 0.4 g/m2 to 3 g/m2, 0.4 g/m2 to 4 g/m2, 0.4 g/m2 to 5 g/m2, 0.5 g/m2 to 0.6 g/m2, 0.5 g/m2 to 0.7 g/m2, 0.5 g/m2 to 0.8 g/m2, 0.5 g/m2 to 0.9 g/m2, 0.5 g/m2 to 1 g/m2, 0.5 g/m2 to 2 g/m2, 0.5 g/m2 to 3 g/m2, 0.5 g/m2 to 4 g/m2, 0.5 g/m2 to 5 g/m2, 0.6 g/m2 to 0.7 g/m2, 0.6 g/m2 to 0.8 g/m2, 0.6 g/m2 to 0.9 g/m2, 0.6 g/m2 to 1 g/m2, 0.6 g/m2 to 2 g/m2, 0.6 g/m2 to 3 g/m2, 0.6 g/m2 to 4 g/m2, 0.6 g/m2 to 5 g/m2, 0.7 g/m2 to 0.8 g/m2, 0.7 g/m2 to 0.9 g/m2, 0.7 g/m2 to 1 g/m2, 0.7 g/m2 to 2 g/m2, 0.7 g/m2 to 3 g/m2, 0.7 g/m2 to 4 g/m2, 0.7 g/m2 to 5 g/m2, 0.8 g/m2 to 0.9 g/m2, 0.8 g/m2 to 1 g/m2, 0.8 g/m2 to 2 g/m2, 0.8 g/m2 to 3 g/m2, 0.8 g/m2 to 4 g/m2, 0.8 g/m2 to 5 g/m2, 0.9 g/m2 to 1 g/m2, 0.9 g/m2 to 2 g/m2, 0.9 g/m2 to 3 g/m2, 0.9 g/m2 to 4 g/m2, 0.9 g/m2 to 5 g/m2, 1 g/m2 to 2 g/m2, 1 g/m2 to 3 g/m2, 1 g/m2 to 4 g/m2, 1 g/m2 to 5 g/m2, 2 g/m2 to 3 g/m2, 2 g/m2 to 4 g/m2, 2 g/m2 to 5 g/m2, 3 g/m2 to 4 g/m2, 3 g/m2 to 5 g/m2, or 4 g/m2 to 5 g/m2. In some cases, the amount of cyclophosphamide administered to a subject is about 0.3 g/m2, 0.4 g/m2, 0.5 g/m2, 0.6 g/m2, 0.7 g/m2, 0.8 g/m2, 0.9 g/m2, 1 g/m2, 2 g/m2, 3 g/m2, 4 g/m2, or 5 g/m2. In some embodiments, the subject is preconditioned with cyclophosphamide at a dose between or between about 200 mg/kg and 1000 mg/kg, such as between or between about 400 mg/kg and 800 mg/kg. In some aspects, the subject is preconditioned with or with about 600 mg/kg of cyclophosphamide. In some embodiments, the cyclophosphamide can be administered in a single dose or can be administered in a plurality of doses, such as given daily, every other day or every three days. For example, in some instances, the agent, e.g., cyclophosphamide, is administered between or between about 1 and 5 times, such as between or between about 2 and 4 times. In some embodiments, such plurality of doses is daily, such as on days -6 through -4 relative to administration of anti-MSLN TFP T cells.
[00508] In some embodiments, where the lymphodepleting agent comprises fludarabine, the subject is administered fludarabine at a dose between or between about 1 milligrams per square meter of the body surface of the subject (mg/m2) and 100 mg/m2. In some cases, the amount of fludarabine administered to a subject is about at least 1 mg/m2. In some cases, the amount of fludarabine administered to a subject is about at most 100 mg/m2. In some cases, the amount of fludarabine administered to a subject is about 1 mg/m2 to 5 mg/m2, 1 mg/m2 to 10 mg/m2, 1 mg/m2 to 15 mg/m2, 1 mg/m2 to 20 mg/m2, 1 mg/m2 to 30 mg/m2, 1 mg/m2 to 40 mg/m2, 1 mg/m2 to 50 mg/m2, 1 mg/m2 to 70 mg/m2, 1 mg/m2 to 90 mg/m2, 1 mg/m2 to 100 mg/m2, 5 mg/m2 to 10 mg/m2, 5 mg/m2 to 15 mg/m2, 5 mg/m2 to 20 mg/m2, 5 mg/m2 to 30 mg/m2, 5 mg/m2 to 40 mg/m2, 5 mg/m2 to 50 mg/m2, 5 mg/m2 to 70 mg/m2, 5 mg/m2 to 90 mg/m2, 5 mg/m2 to 100 mg/m2, 10 mg/m2 to 15 mg/m2, 10 mg/m2 to 20
mg/m2, 10 mg/m2 to 30 mg/m2, 10 mg/m2 to 40 mg/m2, 10 mg/m2 to 50 mg/m2, 10 mg/m2 to 70 mg/m2, 10 mg/m2 to 90 mg/m2, 10 mg/m2 to 100 mg/m2, 15 mg/m2 to 20 mg/m2, 15 mg/m2 to 30 mg/m2, 15 mg/m2 to 40 mg/m2, 15 mg/m2 to 50 mg/m2, 15 mg/m2 to 70 mg/m2, 15 mg/m2 to 90 mg/m2, 15 mg/m2 to 100 mg/m2, 20 mg/m2 to 30 mg/m2, 20 mg/m2 to 40 mg/m2, 20 mg/m2 to 50 mg/m2, 20 mg/m2 to 70 mg/m2, 20 mg/m2 to 90 mg/m2, 20 mg/m2 to 100 mg/m2, 30 mg/m2 to 40 mg/m2, 30 mg/m2 to 50 mg/m2, 30 mg/m2 to 70 mg/m2, 30 mg/m2 to 90 mg/m2, 30 mg/m2 to 100 mg/m2, 40 mg/m2 to 50 mg/m2, 40 mg/m2 to 70 mg/m2, 40 mg/m2 to 90 mg/m2, 40 mg/m2 to 100 mg/m2, 50 mg/m2 to 70 mg/m2, 50 mg/m2 to 90 mg/m2, 50 mg/m2 to 100 mg/m2, 70 mg/m2 to 90 mg/m2, 70 mg/m2 to 100 mg/m2, or 90 mg/m2 to 100 mg/m2. In some cases, the amount of fludarabine administered to a subject is about 1 mg/m2, 5 mg/m2, 10 mg/m2, 15 mg/m2, 20 mg/m2, 30 mg/m2, 40 mg/m2, 50 mg/m2, 70 mg/m2, 90 mg/m2, or 100 mg/m2. In some embodiments, the fludarabine can be administered in a single dose or can be administered in a plurality of doses, such as given daily, every other day or every three days. For example, in some instances, the agent, e.g., fludarabine, is administered between or between about 1 and 5 times, such as between or between about 3 and 5 times. In some embodiments, such plurality of doses is administered daily, such as on days -7 through -4 relative to administration of anti-MSLN TFP T cells.
[00509] In some embodiments, the lymphodepleting agent comprises a combination of agents, such as a combination of cyclophosphamide and fludarabine. Thus, the combination of agents may include cyclophosphamide at any dose or administration schedule, such as those described above, and fludarabine at any dose or administration schedule, such as those described above. For example, in some aspects, the subject is administered 400 mg/m2 of cyclophosphamide and one or more doses of 20 mg/m2 fludarabine prior to the first or subsequent dose of T cells. In some examples, the subject is administered 500 mg/m2 of cyclophosphamide and one or more doses of 25 mg/m2 fludarabine prior to the first or subsequent dose of T cells. In some examples, the subject is administered 600 mg/m2 of cyclophosphamide and one or more doses of 30 mg/m2 fludarabine prior to the first or subsequent dose of T cells. In some examples, the subject is administered 700 mg/m2 of cyclophosphamide and one or more doses of 35 mg/m2 fludarabine prior to the first or subsequent dose of T cells. In some examples, the subject is administered 700 mg/m2 of cyclophosphamide and one or more doses of 40 mg/m2 fludarabine prior to the first or subsequent dose of T cells. In some examples, the subject is administered 800 mg/m2 of cyclophosphamide and one or more doses of 45 mg/m2 fludarabine prior to the first or subsequent dose of T cells.
[00510] Fludarabine and cyclophosphamide may be administered on alternative days. In some cases, fludarabine and cyclophosphamide may be administered concurrently. In some cases, an initial dose of fludarabine is followed by a dose of cyclophosphamide. In some cases, an initial dose of
cyclophosphamide may be followed by an initial dose of fludarabine. In some examples, a treatment regimen may include treatment of a subject with an initial dose of fludarabine 10 days prior to the transplant, followed by treatment with an initial dose of cyclophosphamide administered 9 days prior to the cell transplant, concurrently with a second portion of a dose of fludarabine. In some examples, a treatment regimen may include treatment of a subject with an initial dose of fludarabine 8 days prior to the transplant, followed by treatment with an initial dose of cyclophosphamide administered 7 days prior to the transplant concurrently with a second portion of a dose of fludarabine.
[00511] The anti-MSLN TFP T cell product may be administered as one or more infusions. In some cases, a subject is administered one dose of T cells. In some cases, a subject is administered more than one doses of T cells. In some cases, a subject is administered three doses of T cells. In some cases, a subject is administered four doses of T cells. In some cases, a subject is administered five or more doses of T cells. In some embodiments, two consecutive doses of T cells are administered no less than 60 days and no more than 12 months apart. In some embodiments, two doses of T cells are administered no more than 60 days apart. In some embodiments, the more than one doses of T cells are evenly spaced. In some embodiments, the one or more doses of T cells are not evenly spaced.
[00512] A single infusion may comprise a dose between lx 106 transduced cells per square meter body surface of the subject (cells/m2) and 5xl09 transduced cells/m2. A single infusion may comprise between about 2.5xl06 to about 5xl09 transduced cells/m2. A single infusion may comprise between at least about 2.5xl06 transduced cells/m2. A single infusion may comprise between at most 5xl09 transduced cells/m2. A single infusion may comprise between IxlO6 to IxlO8, IxlO6 to 2.5xl08, IxlO6 to 5xl08, IxlO6 to IxlO9, IxlO6 to 5xl09, 2.5xl06 to 5xl06, 2.5xl06 to 7.5xl06, 2.5xl06 to IxlO7, 2.5xl06 to 5xl07, 2.5xl06 to 7.5xl07, 2.5xl06 to IxlO8, 2.5xl06 to 2.5xl08, 2.5xl06 to 5xl08, 2.5xl06 to IxlO9, 2.5xl06 to 5xl09, 5xl06 to 7.5xl06, 5xl06 to IxlO7, 5xl06 to 5xl07, 5xl06 to 7.5xl07, 5xl06 to IxlO8, 5xl06 to 2.5xl08, 5xl06 to 5xl08, 5xl06 to IxlO9, 5xl06 to 5xl09, 7.5xl06 to IxlO7, 7.5xl06 to 5xl07, 7.5xl06 to 7.5xl07, 7.5xl06 to IxlO8, 7.5xl06 to 2.5xl08, 7.5xl06 to 5xl08, 7.5xl06 to IxlO9, 7.5xl06 to 5xl09, IxlO7 to 5xl07, IxlO7 to 7.5xl07, IxlO7 to IxlO8, IxlO7 to 2.5xl08, IxlO7 to 5xl08, IxlO7 to IxlO9, IxlO7 to 5xl09, 4.25xl07 to 7.5xl07, 5xl07 to 7.5xl07, 5xl07 to IxlO8, 5xl07 to 2.5xl08, 5xl07 to 5xl08, 5xl07 to IxlO9, 5xl07 to 5xl09, 7.5xl07 to IxlO8, 7.5xl07 to 2.5xl08, 7.5xl07 to 5xl08, 7.5xl07 to IxlO9, 7.5xl07 to 5xl09, IxlO8 to 2.5xl08, IxlO8 to 5xl08, IxlO8 to IxlO9, IxlO8 to 5xl09, 2.5xl08 to 5xl08, 2.5xl08 to IxlO9, 2.5xl08 to 5xl09, 5xl08 to IxlO9, 5xl08 to 5xl09, or IxlO9 to 5xl09 transduced cells/m2. A single infusion may comprise between IxlO6 transduced cells/m2, 2.5xl06 transduced cells/m2, 5xl06 transduced cells/m2, 7.5xl06 transduced cells/m2, IxlO7 transduced cells/m2, 4.25xl07 transduced cells/m2, 5xl07 transduced cells/m2, 7.5xl07 transduced
- I l l -
cells/m2, IxlO8 transduced cells/m2, 2.5xl08 transduced cells/m2, 5xlO8 transduced cells/m2, IxlO9 transduced cells/m2, or 5xl09 transduced cells/m2.
[00513] For example, a subject can be administered a dose of about 5xl07 transduced cells/m2. For example, a subject that has not undergone a lymphodepletion treatment can be administered a dose of about 5xl07 transduced cells/m2. For example, a subject that has undergone a lymphodepletion treatment can be administered a dose of about 5x107 transduced cells/m2.
[00514] For example, a subject can be administered a dose of about IxlO8 transduced cells/m2. For example, a subject that has not undergone a lymphodepletion treatment can be administered a dose of about IxlO8 transduced cells/m2. For example, a subject that has undergone a lymphodepletion treatment can be administered a dose of about IxlO8 transduced cells/m2.
[00515] For example, a subject can be administered a dose of about 3xl08 transduced cells/m2. For example, a subject that has not undergone a lymphodepletion treatment can be administered a dose of about 3xl08 transduced cells/m2. For example, a subject that has undergone a lymphodepletion treatment can be administered a dose of about 3x108 transduced cells/m2.
[00516] For example, a subject can be administered a dose of about 5xl08 transduced cells/m2. For example, a subject that has not undergone a lymphodepletion treatment can be administered a dose of about 5xl08 transduced cells/m2. For example, a subject that has undergone a lymphodepletion treatment can be administered a dose of about 5x108 transduced cells/m2.
[00517] In some embodiments, a subject is administered more than one dose of T cells and each dose has the same number of transduced T cells. In some embodiments, a subject is administered more than one dose of T cells and one or more of the doses do not have the same number of transduced T cells.
[00518] In one example, the method of treatment may comprise an initial PBMC collection from a subject. IxlO6 to IxlO8 PBMCs/kg of the subject weight may be collected. The PBMC fraction collected from the subject may then be enriched for T cells. Enriched T cells may be transduced as described herein to express anti-MSLN T cell receptor fusion protein (TFP). In some cases, the transduced T cells may be expanded and/or cryopreserved. The subject may undergo lymphodepleting chemotherapy following the leukapheresis. An alternating dose of fludarabine and cyclophosphamide may be administered to the subject. The dosing schedule may be one described elsewhere herein. In one example, the dose of fludarabine or an equivalent chemotherapeutic agent administered to the subject may be between 15 mg/m2 to 45 mg/m2. The dose of cyclophosphamide or an equivalent chemotherapeutic agent administered to the subject may be between 400g/m2 to 800 mg/m2. The doses of fludarabine and cyclophosphamide may be administered in an alternating manner, for instance in this scenario an initial dose of fludarabine may be followed by an initial dose of cyclophosphamide. The administration of lymphodepleting agents may be followed by the transplantation of anti-MSLN
TFP producing T cells. T cells may be administered intravenously as a single dose to the subject. A single infusion of cells may comprise between IxlO7 transduced cells/m2 to 5xl09 transduced cells/m2. [00519] In another example, the method of treatment may comprise an initial PBMC collection from a subject. IxlO6 to IxlO8 PBMCs/kg of the subject weight may be collected. The PBMC fraction collected from the subject may then be enriched for T cells. Enriched T cells may be transduced as described herein to express anti-MSLN T cell receptor fusion protein (TFP). An alternating dose of fludarabine and cyclophosphamide may be administered to the subject after the leukapheresis is complete. The dosing schedule may be one described elsewhere herein. In one example, the dose of fludarabine or an equivalent chemotherapeutic agent administered to the subject may be 20 mg/m2. The dose of cyclophosphamide or an equivalent chemotherapeutic agent administered to the subject may be 700g/m2. The doses of fludarabine and cyclophosphamide may be administered in an alternating manner, for instance in this scenario an initial dose of fludarabine may be followed by an initial dose of cyclophosphamide. An initial dose of fludarabine may be administered on day -9 of the T cell transplant. Other doses of fludarabine may be administered on days -8, -7, -6, -5, -4 and -3. An initial dose of cyclophosphamide may be administered on day -7 concurrently with the fludarabine. Other doses of cyclophosphamide may be administered on days -5 and -4. The administration of lymphodepleting agents may be followed by the transplantation of anti-MSLN TFP producing T cells. T cells may be administered intravenously as a single dose to the subject. A single infusion of cells may comprise at least IxlO7 transduced cells/m2. A single infusion of cells may comprise at most IxlO10 transduced cells/m2.
[00520] In another example, the method of treatment may comprise an initial PBMC collection from a subject. IxlO6 to IxlO8 PBMCs/kg of the subject weight may be collected. The PBMC fraction collected from the subject may then be enriched for T cells. Enriched T cells may be transduced as described herein to express anti-MSLN T cell receptor fusion protein (TFP). An alternating dose of fludarabine and cyclophosphamide may be administered to the subject after the leukapheresis is complete. The dosing schedule may be one described elsewhere herein. In one example, the dose of fludarabine or an equivalent chemotherapeutic agent administered to the subject may be 40 mg/m2. The dose of cyclophosphamide or an equivalent chemotherapeutic agent administered to the subject may be 400g/m2. The doses of fludarabine and cyclophosphamide may be administered in an alternating manner, for instance in this scenario an initial dose of fludarabine may be followed by an initial dose of cyclophosphamide. An initial dose of fludarabine may be administered on day -6 of the T cell transplant. Other doses of fludarabine may be administered on days -5 and -4. An initial dose of cyclophosphamide may be administered on day -5 concurrently with the fludarabine. Another dose of cyclophosphamide may be administered on day -3. The administration of lymphodepleting agents may
be followed by the transplantation of anti-MSLN TFP producing T cells. T cells may be administered intravenously as a single dose to the subject. A single infusion of cells may comprise at least IxlO8 transduced cells/m2. A single infusion of cells may comprise at most lx 109 transduced cells/m2.
[00521] In another example, the method of treatment may comprise an initial PBMC collection from a subject. IxlO6 to IxlO8 PBMCs/kg of the subject weight may be collected. The PBMC fraction collected from the subject may then be enriched for T cells. Enriched T cells may be transduced as described herein to express anti-MSLN T cell receptor fusion protein (TFP). In some cases, the transduced T cells may be expanded and/or cryopreserved. In this example, the subject does not undergo lymphodepleting chemotherapy following the leukapheresis. Anti-MSLN TFP producing T cells may be administered intravenously as a single dose to the subject. A single infusion of cells may comprise between IxlO8 cells/m2 to 10xl09 cells/m2.
[00522] In an aspect, the method of treating a subject in need thereof comprises administering to the subject a T cell comprising TFP as described herein and an anti-PD-1 antibody as described herein. In some embodiments, the anti-PD-1 antibody is administered before administering the T cell, concurrently with the T cell, or after administering the T cell. In some embodiments, the T cell, the anti-PD-1 antibody, or a combination thereof is administered in one, two, three or more doses. The anti-PD-1 antibody can be an anti- PD-1 antibody described herein, for example, Balstilimab, Camrelizumab, Cemiplimab, Cetrelimab, Dostarlimab, Pembrolizumab, Pidilizumab, Prolgolimab, Retifanlimab, Sintilimab, Spartalizumab, Tislelizumab, or Toripalimab2.
[00523] In some embodiments, the anti-PD-1 antibody is administered at least every 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, or 12 months. In some embodiments, the anti-PD-1 antibody is administered at least every 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 13 weeks, 14 weeks, 15 weeks, 16 weeks, 17 weeks, 18 weeks, 19 weeks, 20 weeks, 21 weeks, 22 weeks, 23 weeks, 24 weeks, 25 weeks, 26 weeks, 27 weeks, 28 weeks, 29 weeks, 30 weeks, 31 weeks, 32 weeks, 33 weeks, 34 weeks, 35 weeks, 36 weeks, 37 weeks, 38 weeks, 39 weeks, 40 weeks, 41 weeks, 42 weeks, 43 weeks, 44 weeks, 45 weeks, 46 weeks, 47 weeks, or 48 weeks. In some embodiments, the anti-PD-1 antibody is administered for at least about 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 13 weeks, 14 weeks, 15 weeks, 16 weeks, 17 weeks, 18 weeks, 19 weeks, 20 weeks, 21 weeks, 22 weeks, 23 weeks, 24 weeks, 25 weeks, 26 weeks, 27 weeks, 28 weeks, 29 weeks, 30 weeks, 31 weeks, 32 weeks, 33 weeks, 34 weeks, 35 weeks, 36 weeks, 37 weeks, 38 weeks, 39 weeks, 40 weeks, 41 weeks, 42 weeks, 43 weeks, 44 weeks, 45 weeks, 46 weeks, 47 weeks, or 48
weeks. In some embodiments, the anti-PD-1 antibody is administered at dose of at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32,
33, 34, 35, 36, 37, 38, 39, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125,
130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, 200, 205, 210, 215, 220, 225,
230, 235, 240, 245, 250, 255, 260, 265, 270, 275, 280, 285, 290, 295, 300, 310, 320, 330, 340, 350,
360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 500, 550, 600, 650, 700, 750, 800,
850, 900, 950, or 1000 mg.
[00524] For example, the anti-PD-1 antibody can be nivolumab. In some embodiments, the anti-PD- 1 antibody is nivolumab and is administered at dose of 240 mg. In some embodiments, the anti-PD-1 antibody is nivolumab and is administered at dose of 240 mg every two weeks. In some embodiments, the anti-PD-1 antibody is nivolumab and is administered at dose of 480 mg. In some embodiments, the anti-PD-1 antibody is nivolumab and is administered at dose of 480 mg every four weeks.
[00525] In some embodiments, a subject is first administered a dose of about 5xl07 transduced cells/m2 and then administered one or more doses of nivolumab.
[00526] For example, a subject that has not undergone a lymphodepletion treatment can be first administered a dose of about 5xl07 transduced cells/m2 and then administered nivolumab at dose of 240 mg. For example, a subject that has not undergone a lymphodepletion treatment can be first administered a dose of about 5xl07 transduced cells/m2 and then administered nivolumab at dose of 240 mg every two weeks. For example, a subject that has undergone a lymphodepletion treatment can be first administered a dose of about 5xl07 transduced cells/m2 and then administered nivolumab at dose of 240 mg. For example, a subject that has undergone a lymphodepletion treatment can be first administered a dose of about 5xl07 transduced cells/m2 and then administered nivolumab at dose of 240 mg every two weeks.
[00527] For example, a subject that has not undergone a lymphodepletion treatment can be first administered a dose of about lx 108 transduced cells/m2 and then administered nivolumab at dose of 240 mg. For example, a subject that has not undergone a lymphodepletion treatment can be first administered a dose of about lx 108 transduced cells/m2 and then administered nivolumab at dose of 240 mg every two weeks. For example, a subject that has undergone a lymphodepletion treatment can be first administered a dose of about lx 108 transduced cells/m2 and then administered nivolumab at dose of 240 mg. For example, a subject that has undergone a lymphodepletion treatment can be first administered a dose of about lx 108 transduced cells/m2 and then administered nivolumab at dose of 240 mg every two weeks.
[00528] For example, a subject that has not undergone a lymphodepletion treatment can be first administered a dose of about 3xl08 transduced cells/m2 and then administered nivolumab at dose of 240 mg. For example, a subject that has not undergone a lymphodepletion treatment can be first administered a dose of about 3xl08 transduced cells/m2 and then administered nivolumab at dose of 240 mg every two weeks. For example, a subject that has undergone a lymphodepletion treatment can be first administered a dose of about 3xl08 transduced cells/m2 and then administered nivolumab at dose of 240 mg. For example, a subject that has undergone a lymphodepletion treatment can be first administered a dose of about 3xl08 transduced cells/m2 and then administered nivolumab at dose of 240 mg every two weeks.
[00529] For example, a subject that has not undergone a lymphodepletion treatment can be first administered a dose of about 5xl08 transduced cells/m2 and then administered nivolumab at dose of 240 mg. For example, a subject that has not undergone a lymphodepletion treatment can be first administered a dose of about 5xl08 transduced cells/m2 and then administered nivolumab at dose of 240 mg every two weeks. For example, a subject that has undergone a lymphodepletion treatment can be first administered a dose of about 5xl08 transduced cells/m2 and then administered nivolumab at dose of 240 mg. For example, a subject that has undergone a lymphodepletion treatment can be first administered a dose of about 5xl08 transduced cells/m2 and then administered nivolumab at dose of 240 mg every two weeks.
[00530] For example, a subject that has not undergone a lymphodepletion treatment can be first administered a dose of about 5xl07 transduced cells/m2 and then administered nivolumab at dose of 480 mg. For example, a subject that has not undergone a lymphodepletion treatment can be first administered a dose of about 5xl07 transduced cells/m2 and then administered nivolumab at dose of 480 mg every four weeks. For example, a subject that has undergone a lymphodepletion treatment can be first administered a dose of about 5xl07 transduced cells/m2 and then administered nivolumab at dose of 480 mg. For example, a subject that has undergone a lymphodepletion treatment can be first administered a dose of about 5xl07 transduced cells/m2 and then administered nivolumab at dose of 480 mg every four weeks.
[00531] For example, a subject that has not undergone a lymphodepletion treatment can be first administered a dose of about lx 108 transduced cells/m2 and then administered nivolumab at dose of 480 mg. For example, a subject that has not undergone a lymphodepletion treatment can be first administered a dose of about lx 108 transduced cells/m2 and then administered nivolumab at dose of 480 mg every four weeks. For example, a subject that has undergone a lymphodepletion treatment can be first administered a dose of about lx 108 transduced cells/m2 and then administered nivolumab at dose of 480 mg. For example, a subject that has undergone a lymphodepletion treatment can be first
administered a dose of about lx 108 transduced cells/m2 and then administered nivolumab at dose of 480 mg every four weeks.
[00532] For example, a subject that has not undergone a lymphodepletion treatment can be first administered a dose of about 3xl08 transduced cells/m2 and then administered nivolumab at dose of 480 mg. For example, a subject that has not undergone a lymphodepletion treatment can be first administered a dose of about 3xl08 transduced cells/m2 and then administered nivolumab at dose of 480 mg every four weeks. For example, a subject that has undergone a lymphodepletion treatment can be first administered a dose of about 3xl08 transduced cells/m2 and then administered nivolumab at dose of 480 mg. For example, a subject that has undergone a lymphodepletion treatment can be first administered a dose of about 3xl08 transduced cells/m2 and then administered nivolumab at dose of 480 mg every four weeks.
[00533] For example, a subject that has not undergone a lymphodepletion treatment can be first administered a dose of about 5xl08 transduced cells/m2 and then administered nivolumab at dose of 480 mg. For example, a subject that has not undergone a lymphodepletion treatment can be first administered a dose of about 5xl08 transduced cells/m2 and then administered nivolumab at dose of 480 mg every four weeks. For example, a subject that has undergone a lymphodepletion treatment can be first administered a dose of about 5xl08 transduced cells/m2 and then administered nivolumab at dose of 480 mg. For example, a subject that has undergone a lymphodepletion treatment can be first administered a dose of about 5xl08 transduced cells/m2 and then administered nivolumab at dose of 480 mg every four weeks.
[00534] In some embodiments, the first portion of a dose comprise a first number of transduced cells/m2 and wherein the second portion of a dose comprise a second number of transduced cells/m2, wherein the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 is from 1 : 10 to 10: 1 For example, the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 can be about 1 :9, 1 :8, 1 :7, 1 :6, 1 :5, 1 :4, 1 :3, 1 :2, 1 : 1, 2: 1, 3: 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1 or 9: 1. For example, the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 can be about 1 :9.5, 1 :8.5, 1 :7.5, 1 :6.5, 1 :5.5, 1 :4.5, 1 :3.5, 1 :2.5, 1 : 1.5, 2.5: 1, 3.5: 1, 4.5: 1, 5.5: 1, 6.5: 1, 7.5: 1, 8.5: 1 or 9.5: 1. For example, the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 can be about 2:9, 2:8, 2:7, 2:6, 2:5, 2:4, 2:3, 3:2, 4:2, 5:2, 6:2, 7:2, 8:2 or 9:2. For example, the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 can be about 3:8, 3:7, 3:5, 3:4, 4:3, 5:3, 7:3 or 8:3. For example, the ratio of the first number of transduced cells/m2to the second number of transduced cells/m2 can be about 4:9, 4:7, 4:5, 5:4, 7:4, or 9:4. For example, the ratio of the first number of transduced cells/m2to the second number of transduced cells/m2 can be about 5:9, 5:8,
5:7, 5:6, 6:5, 7:5, 8:5 or 9:5. For example, the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 can be about 6:7 or 7:6. For example, the ratio of the first number of transduced cells/m2to the second number of transduced cells/m2 can be about 7:8 or 8:7. For example, the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 can be about 8:9 or 9:8.
[00535] In some embodiments, the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 is not 1 : 1. In some embodiments, the first portion of a dose and the second portion of a dose comprise from about one-third to two-thirds of a reference dose, and wherein the reference dose is 1 x 105 to about 5 x io10 transduced cells/m2.
[00536] In some embodiments, the first portion of a dose and the second portion of a dose comprise from about 1 x io6 to about 5 x io9 transduced cells/m2. In some embodiments, the reference dose is from 1 x io6 to about 5 x io9 transduced cells/m2.
[00537] In some embodiments, the second portion of a dose is administered less than 50 days following administration of the first portion of a dose of anti-MSLN TFP T cells. For example, the second portion of a dose can be administered 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48 or 49 days following administration of the first portion of a dose of anti-MSLN TFP T cells
[00538] In some embodiments, the sum of the first portion of a dose and the second portion of a dose equals a reference dose. In some embodiments, the reference dose is from 1 x 106 to about 5 x io9 transduced cells/m2. In some embodiments, the reference dose is about 1 x io7 transduced cells/m2. In some embodiments, the reference dose is about 5 x io7 transduced cells/m2. In some embodiments, the reference dose is about 1 x io8 transduced cells/m2. In some embodiments, the reference dose is about 3 x io8 transduced cells/m2. In some embodiments, the reference dose is about 4 x io8 transduced cells/m2. In some embodiments, the reference dose is about 5 x io8 transduced cells/m2. In some embodiments, the reference dose is about 1 x io9 transduced cells/m2. In some embodiments, the first portion of a dose is about 3.33 x io6 transduced cells/m2. In some embodiments, the second portion of a dose is about 6.66 x io6 transduced cells/m2. In some embodiments, the first portion of a dose is about 1.66 x io7 transduced cells/m2. In some embodiments, the second portion of a dose is about 3.33 x io7 transduced cells/m2. In some embodiments, the first portion of a dose is about 3.33 x 107 transduced cells/m2. In some embodiments, the second portion of a dose is about 6.66 x io7 transduced cells/m2. In some embodiments, the first portion of a dose is about 1 x 108 transduced cells/m2. In some embodiments, the second portion of a dose is about 2 x 108 transduced cells/m2. In some embodiments, the first
portion of a dose is about 1.33 x 108 transduced cells/m2. In some embodiments, the second portion of a dose is about 2.66 x 108 transduced cells/m2. In some embodiments, the first portion of a dose is about 1.66 x io8 transduced cells/m2. In some embodiments, the second portion of a dose is about 3.33 x 107 transduced cells/m2. In some embodiments, the first portion of a dose is about 3.33 x 108 transduced cells/m2. In some embodiments, the second portion of a dose is about 6.66 x io8 transduced cells/m2.
[00539] In some embodiments, the second portion of a dose is administered less than 10 days following administration of the first portion of a dose of anti-MSLN TFP T cells. In some embodiments, the second portion of a dose is administered 7 or fewer days following administration of the first portion of a dose of anti-MSLN TFP T cells. In some embodiments, the second portion of a dose is administered at least three days after administering the first portion of a dose. In some embodiments, the second portion of a dose is administered three to seven days after administering the first portion of a dose. In some embodiments, the second portion of a dose is administered 3 days after administering the first portion of a dose. In some embodiments, the second portion of a dose is administered 4 days after administering the first portion of a dose. In some embodiments, the second portion of a dose is administered 5 days after administering the first portion of a dose. In some embodiments, the second portion of a dose is administered 6 days after administering the first portion of a dose. In some embodiments, the second portion of a dose is administered 7 days after administering the first portion of a dose.
[00540] In some embodiments, the human subject does not exhibit any adverse event after administering the first portion of a dose. In some embodiments, the human subject exhibits an adverse event after administering the first portion of a dose, and wherein the second portion of a dose is administered at least seven days after administering the first portion of a dose. In some embodiments, the adverse event is selected from the group consisting of cytokine release syndrome (CRS), neurotoxicity, severe CRS (sCRS), CAR T cell-related encephalopathy syndrome (CRES) or immune effector cell-associated neurotoxicity syndrome (ICANS), Central Nervous System (CNS) toxicity, tumor lysis syndrome (TLS), an infusion reaction, cytopenia, cardiac toxicity, hypogammaglobulinemia, graft-versus-host-disease and any combination thereof. In some embodiments, the adverse event is selected from the group consisting of cytokine release syndrome and neurotoxicity. In some embodiments, the adverse event is > grade 3 cytokine release syndrome and/or > grade 2 neurotoxicity.
[00541] In some embodiments, the human subject exhibits an adverse event and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti- MSLN TFP T cells, wherein the first timepoint is longer than the second timepoint. In some
embodiments, the human subject exhibits an adverse event that is grade 1 or lower and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells. In some embodiments, the human subject exhibits an adverse event that is grade 1 or higher and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells. In some embodiments, the human subject exhibits an adverse event that is grade 2 or higher and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells. In some embodiments, the human subject exhibits an adverse event that is grade 3 or higher and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells. In some embodiments, the first timepoint is more than 7 days after the first portion of a dose is administered. For example, the first timepoint can be 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48 or 49 days after the first portion of a dose is administered.
[00542] In some embodiments, the human subject does not exhibit an adverse event that is grade 2 or higher and the second portion of a dose is administered at a second timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells, wherein the first timepoint is longer than the second timepoint. In some embodiments, the human subject does not exhibit an adverse event that is grade 3 or higher and the second portion of a dose is administered at a second timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells. In some embodiments, the human subject exhibits an adverse event that is grade 1 or lower and the second portion of a dose is administered at a second timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells.
[00543] In some embodiments, the second timepoint is 7 days or less after the first portion of a dose is administered. For example, the second timepoint can be 1, 2, 3, 4, 5, 6 or 7 days after the first portion of a dose is administered. In some embodiments, the second timepoint is after the adverse event is no longer exhibited by the subject. In some embodiments, the second timepoint is after the adverse event exhibited by the subject is grade 1 or less.
[00544] In some embodiments, the method reduces or prevents a risk of adverse event associated with administering a dose with an amount equivalent to the sum of the amount of the first portion of a dose plus the second portion of a dose. In some embodiments, the adverse event comprises bacterial or fungal infection, tumor lysis syndrome, cytokine release syndrome, neurotoxicity, infusion reactions, cytopenias, cardiac toxicity, hypogammaglobulinemia or graft-versus-host disease.
[00545] In some embodiments, the human subject has or has not received one or more lines of prior therapy prior to administering the first portion of a dose. In some embodiments, the one or more lines of prior therapy comprises surgery, chemotherapy, hormonal therapy, biological therapy, antibody therapy, radiation therapy, systemic therapy, or any combinations thereof.
[00546] In some embodiments, the human subject has received a lymphodepleting chemotherapy regimen prior to administering the first portion of a dose. In some embodiments, the human subject has not received a lymphodepleting chemotherapy regimen prior to administering the first portion of a dose. In some embodiments, the method further comprises administering a lymphodepleting chemotherapy regimen to the human subject prior to administering the first portion of a dose. In some embodiments, the lymphodepleting chemotherapy regimen comprises administration of about four doses of fludarabine and about three doses of cyclophosphamide. In some embodiments, the lymphodepleting chemotherapy regimen comprises administration of four doses of fludarabine and three doses of cyclophosphamide. In some embodiments, the lymphodepleting chemotherapy regimen comprises administration of fludarabine at a level of about 30 mg/m2/day on days -7 through -4 relative to administration of the first portion of a dose of anti-MSLN TFP T cells, and further comprises administration of cyclophosphamide at a level of about 600 mg/m2/day on days -6 through -4 relative to administration of the first portion of a dose of anti-MSLN TFP T cells. In some embodiments, the lymphodepleting chemotherapy regimen comprises administration of fludarabine at a level of 30 mg/m2/day on days -7 through -4 relative to administration of the first portion of a dose of anti-MSLN TFP T cells, and further comprises administration of cyclophosphamide at a level of 600 mg/m2/day on days -6 through -4 relative to administration of the first portion of a dose of anti-MSLN TFP T cells.
EXAMPLES
[00547] The present disclosure is further described in detail by reference to the following experimental examples. These examples are provided for purposes of illustration only, and are not intended to be limiting unless otherwise specified. Thus, the present disclosure should in no way be construed as being limited to the following examples, but rather, should be construed to encompass any and all variations which become evident as a result of the teaching provided herein. Without further description, it is believed that one of ordinary skill in the art can, using the preceding description and the following illustrative examples, make and utilize the compounds of the present disclosure and practice the claimed methods. The following working examples specifically point out various aspects of the present disclosure, and are not to be construed as limiting in any way the remainder of the disclosure.
Example 1: Phase l/II Clinical Trial of anti-MSLN TFP
[00548] This example provides details of a first-in-human clinical trial is a phase 1/2 open-label study to evaluate the safety andefficacy of autologous genetically engineered TC-210 T cells (“gavo- cel”) in patients with advanced MSLN-expressing cancers.
Objectives
Phase 1
Primary
• To evaluate the safety of autologous genetically modified TC-210 T cells in patients with MSLN-expressing unresectable, metastatic, or recurrent cancers.
• To establish the recommended phase 2 dose (RP2D) according to dose-limiting toxicity (DLT) of defined adverse events.
Secondary
• To determine the overall response rate (ORR) (complete response [CR] + partial response [PR]) according to Response Evaluation Criteria in Solid Tumors (RECIST) v 1.1 and response duration when TC-210 T cells are administered with or without a lymphodepletion regimen.
• To determine the disease control rate (DCR), defined as a composite of ORR and stable disease (SD) lasting at least 8 weeks or at least 12 weeks.
• To evaluate the efficacy of autologous genetically modified TC-210 T cells in patients with MSLN-expressing unresectable, metastatic, or recurrent cancers as assessed by time to response (TTR), duration of response (DoR), progression-free survival (PFS), and overall survival (OS).
• To develop and validate an in vitro diagnostic (IVD) assay for the screening of MSLN expression for regulatory approval.
Phase 2
Primary
• To evaluate the efficacy of autologous genetically modified TC-210 T cells in patients with MSLN-expressing unresectable, metastatic, or recurrent cancers.
Endpoints: ORR (CR + PR) according to RECIST v 1.1.
DCR (ORR + SD > 8 weeks or > 12 weeks) according to RECIST v 1.1 (or mesothelioma-specific RECIST criteria, if applicable).
Secondary
• To evaluate the efficacy of autologous genetically modified TC-210 T cells in patients with
MSLN-expressing unresectable, metastatic, or recurrent cancers as assessed by TTR, DoR, PFS, and OS.
• To further evaluate the safety of autologous genetically modified TC-210 T cells in patients with MSLN-expressing unresectable, metastatic or recurrent cancers.
• To assess whether patients who experience progressive disease following TC-210 T cell therapy experience a response upon a second infusion.
• To develop and validate an IVD assay for the screening of MSLN expression for regulatory approval.
Exploratory
• To evaluate the correlation between resistance or response to TC-210 therapy with TC-210 expansion, persistence, phenotype, and functionality (Phase 1 and 2)
• To evaluate key TC-210 product attributes pre- and post-infusion (Phase 1 and 2)
• To evaluate candidate biomarkers in tumor tissue including TC-210 infiltration, pre- and post-evaluation of the tumor microenvironment, measurement of immune cell markers, and correlation with clinical response to treatment (Phase 1 and 2)
[00549] Study Design
[00550] This first-in-human clinical trial is a phase 1/2 open-label study to evaluate the safety and efficacy of autologous genetically engineered TC-210 T cells in patients with advanced MSLN-expressing cancers. Patients will be pre-screened for general health, performance status, MSLN diagnosis, and disease stage. Following pre-screening, patients meeting all leukapheresis eligibility criteria will undergo a large-volume leukapheresis at the enrolling institution to obtain cells for the manufacture of autologous TC-210 T cells. Patients’ peripheral blood mononuclear cells will be processed at the enrolling institution and frozen leukocytes will then be shipped to a central site for further processing. Then, the TC-210 T cells (lentivirally transduced T cells) will be formulated, cryopreserved, and shipped back to the enrolling institution. If patients then meet the treatment eligibility criteria, they will either receive TC-210 T cell infusion without lymphodepletion or after lymphodepl eting chemotherapy with cyclophosphamide and fludarabine.
[00551] The study will have 2 distinct phases:
[00552] Phase 1 : the objective of the dose-escalation phase of the study is the evaluation of DLTs and the determination of the RP2D. If the maximum tolerated dose (MTD) (defined as the dose administered at 1 dose level below the dose in which DLTs were observed in > 33% of patients) is determined during the dose escalation phase, then the MTD will be the recommended RP2D. Phase 1
will evaluate 4 doses of TC-210 T cells preceded or not by a lymphodepleting chemotherapy regimen.
• For dose levels (DLs) 0, or future dose levels where TC-210 T cells are to be administered WITHOUT lymphodepletion, TC-210 T cell dose escalation will proceed in cohorts of 1 patient each.
• Should the patient enrolled to DLO, or future dose levels without lymphodepletion develop a grade > 3 toxicity presumably related to TC-210 T cells, that cohort will expand to 3 patients and proceed according to a 3 + 3 dose-escalation schema.
• If the initial dose level (ie, DLO) is deemed not safe, a lower dose of 1 x 107/m2 will be evaluated (DL-1).
• For dose levels where TC-210 is to be administered WITH lymphodepletion, TC-210 T cell dose escalation will proceed according to a standard 3 + 3 dose-escalation strategy.
[00553] TC-210 T cells may be administered via a fractionated regimen at any point in the study if deemed appropriate for safety or efficacy reasons by either the SRT or the sponsor’s medical monitor. The TC-210 dose would be fractionated such that one-third (approximately 33%) of the TC- 210 T cell dose will be administered on Day 0 and, if well tolerated, the remaining two-thirds (approximately 67%) of the dose will be administered 3-7 days later (days 3-7 post-initial infusion). In the event the initial one-third (33%) dose elicits > grade 3 CRS and/or > grade 2 neurotoxicity, the infusion of the second fraction should be delayed until the CRS and/or neurotoxicity regresses to < grade 1, or otherwise until treatment is deemed safe by both the treating physician and the sponsor’s medical monitor.
[00554] Phase 2: this phase will evaluate preliminary antitumor activity (efficacy) and better characterize safety of the TC-210 T cells.
• Patients will receive TC-210 T cells at the RP2D and will be stratified according to their cancer diagnosis in 4 groups: malignant pleural/peritoneal mesothelioma (MPM), cholangiocarcinoma, serous ovarian adenocarcinoma, and non-small cell lung cancer (NSCLC).
• A total of at least 10 patients will be treated in each one of the following indications: MPM, cholangiocarcinoma, NSCLC, and ovarian adenocarcinoma.
• A total of 75 patients will be treated in the MPM cohort; a total of 20 patients will be treated in each one of the following indications: cholangiocarcinoma, ovarian adenocarcinoma, and NSCLC.
• In an aspect, a total of 20 patients in the NSCLC cohort will receive TC-210 T cells: the first 8 patients will receive TC-210 T cells as single agent and, if no additional toxi cities are identified,
the next 12 patients will receive TC-210 T cells in combination with the programmed death receptor- 1 -blocking antibody pembrolizumab, with pembrolizumab being dosed every 3 weeks for up to 12 weeks.
• In an aspect, in the MPM cohort, 25 patients will receive TC-210 as a single agent, and remaining patients will receive TC-210 in combination with one or more agent that inhibits an inhibitor signal. In an aspect, in each cohort, patients will receive TC-210 in combination with nivolumab.
• Overall, the phase 2 portion of the study will treat about 50 or about 135 patients.
[00555] If the transduced cell dose is less than the minimum dose, manufacturing of additional transduced T cells from excess banked leukapheresis product will be undertaken to achieve a total dose in the target range. In the event that no banked leukapheresis product is available, a second leukapheresis may be performed. If, in spite of the latter, a TC-210 T cell dose fails to meet the minimum dose requirement, patients may still be eligible to receive TC-210 T cells and participate in this trial. However, an additional patient whose TC-210 T cell dose meets the minimum cell dose requirement will be added to the cohort.
[00556] Patients treated in the phase 2 portion of the study who have a confirmed response (ie, PR or CR or at least SD for more than 4 months post-TC-210 T cell infusion may receive a second TC-210 T cell infusion, provided treatment eligibility criteria are met again (including adequate MSLN expression). The second infusion will be administered in the same manner as the first one. Patients meeting treatment eligibility criteria may receive a second TC-210 T cell infusion no sooner than 60 days and no later than 12 months following completion of the first TC-210 T cell infusion.
[00557] TC-210 T cell Dose and Treatment Schedule
[00558] Phase 1 portion of the study: Each patient will receive either a single dose of TC-210 T cells or a fractionated dosing regimen. Subsequent patients will receive TC-210 T cells at increasing doses. At each dose level, TC-210 T cells will be first given without lymphodepletion to 1 patient and, if well-tolerated, given to the subsequent 3 patients following lymphodepl eting chemotherapy.
[00559] Dose escalation will proceed in evenly spaced increments over 4 TC-210 T cells doses: (5 x 107/m2, 1 x 108/m2, 5 x 108/m2, and 1 x 109/m2). Prior to each dose escalation, the SRT will review the safety data. In the event of toxicity at DL5, two cell dose levels with lymphodepletion (DL3.5A and DL3.5B) will be explored. De-escalation can occur to DL3.5 and proceed with a cohort of 3 patients using the fractionated dosing regimen. If DL3.5A, with a fractionated regimen is cleared for safety by the SRT, an additional 3 -patient cohort can then be treated at the same dose with a single infusion. A similar strategy may be employed when exploring DL3.5B. Protocol stagger,
safety observation, and escalation rules would apply to both DL3.5A and DL3.5B using either a fractionated regimen or a single infusion.
[00560] All doses mentioned throughout the protocol denote transduced TC-210 T cells. A variation on the target dose of 15% (ie, ± 15%) will be allowed at each dose level. Patients will be enrolled at the following dose levels to determine the RP2D:
• Dose level -1 (DL-1): 1 x io7 transduced cells/m2 on day 0 (allowed if excessive toxicity is observed in dose level 0 [DL0])
• Dose level 0 (initial dose level) (DL0): 5 x io7 transduced cells/m2 on day 0.
• Dose level 1 (DL1): 5 x 107 transduced cells/m2 on day 0 following lymphodepleting therapy (fludarabine 30 mg/m2/d on days -7 through -4 and cyclophosphamide 600 mg/m2/d on days -6 through -4).
• Dose level 2 (DL2): 1 x io8 transduced cells/m2 on day 0.
• Dose level 3 (DL3): 1 x 108 transduced cells/m2 on day 0 following lymphodepleting therapy (fludarabine 30 mg/m2/d on days -7 through -4 and cyclophosphamide 600 mg/m2/d on days -6 through -4).
• Dose level 3.5A (DL3.5A): 3 x 108 transduced cells/m2 on day 0 following lymphodepleting therapy (fludarabine 30 mg/m2/d on days -7 through -4 and cyclophosphamide 600 mg/m2/d on days -6 through -4).
• Dose level 3.5B (DL3.5B): 4 x 108 transduced cells/m2 on day 0 following lymphodepleting therapy (fludarabine 30 mg/m2/d on days -7 through -4 and cyclophosphamide 600 mg/m2/d on days -6 through -4).
• Dose level 4 (DL4): 5 x io8 transduced cells/m2 on day 0.
• Dose level 5 (DL5): 5 x 108 transduced cells/m2 on day 0 following lymphodepleting therapy (fludarabine 30 mg/m2/d on days -7 through -4 and cyclophosphamide 600 mg/m2/d on days -6 through -4).
• Dose level 6 (DL6): 1 x io9 transduced cells/m2 on day 0.
• Dose level 7 (DL7): 1 x 109 transduced cells/m2 on day 0 following lymphodepleting therapy (fludarabine 30 mg/m2/d on days -7 through -4 and cyclophosphamide 600 mg/m2/d on days -6 through -4).
[00561] Phase 2 portion of the study: patients will receive TC-210 T cells at the RP2D determined in the phase 1 portion of the study. A total of at least 10 patients will be treated in each of the following indications: MPM, ovarian adenocarcinoma, NSCLC, and cholangiocarcinoma. In an aspect, a total of 75 patients will be treated in the MPM cohort and 20 patients will be treated in each of the ovarian adenocarcinoma, NSCLC, and cholangiocarcinoma cohorts. In an aspect, the first 8 patients with NSCLC will receive single agent TC-210 T cells and subsequently the following 12 patients will receive TC-210 T cells in combination with pembrolizumab after determination by the SRT of an acceptable safety profile. Pembrolizumab will be administered at 3 dose levels (2, 20, and 200 mg). The dose escalation of pembrolizumab will proceed based on the safety review by the SRT at each dose level. The first dose of pembrolizumab will be administered on day 21 (ie, 3 weeks post TC-210 T cell infusion). Subsequent doses of pembrolizumab will be administered every 3 weeks thereafter (ie, weeks 6, 9, and 12) for a total of 4 doses. In an aspect, patients in the MPM, cholangiocarcinoma, ovarian carcinoma, and NSCLC cohorts will receive TC-210 in combination with nivolumab. In the absence of disease progression, nivolumab will be administered at a dose of 360 mg every 3 weeks
starting on Week 3 (Day 21). In an aspect, in the MPM cohort, 25 patients will receive TC-210 as a single agent at the RP2D (1 x 108 transduced cells/m2 with LD).
[00562] Definition of Dose Limiting Toxicity
[00563] A DLT is defined as any of the following TC-210 T cell-related events with onset within the ensuing 28 days following TC-210 T cell infusion on Day 0:
• Any Common Terminology Criteria for Adverse Events (CTCAE) grade 5 organ toxicity.
• Any CTCAE grade 4 organ toxicity (cardiac, dermatologic, gastrointestinal, hepatic, pulmonary, renal/genitourinary, or neurologic) with an attribution of definitely or probably related to the TC- 210 T cell infusion that does not improve to grade < 2 within 4 weeks.
• Any lower grade toxicity present prior to TC-210 T cell infusion (eg, an effusion) that increases to a grade 3 or higher as a direct result of the TC-210 cell infusion and does not return to its original grade within 28 days from the date of its worsening (ie, upgrade) is documented.
• Any grade 3 or greater autoimmune toxicity related to TC-210 T cell therapy.
• Grade 4 CRS that does not improve to < 3 within 72 hours. If grade 4 CRS resolves to grade 3 within 72 hours, then the grade 3 CRS must further resolve to grade < 2 within the following 11 days so that the time between grade 4 CRS and its resolution to grade <2 does not exceed 14 days.
• Grade 3 CRS that does not improve to < Grade 2 within 14 days
• Grade 4 neurotoxicity that does not improve to < 3 within 72 hours. If grade 4 neurotoxicity resolves to grade 3 within 72 hours, then the grade 3 neurotoxicity must further resolve to grade < 2 within the following 11 days so that the time between grade 4 neurotoxicity and its resolution to grade <2 does not exceed 14 days.
• Grade 3 neurotoxicity which does not resolve to < Grade 2 within 14 days.
[00564] The following adverse events will NOT be considered DLTs:
• Grade 1 to 4 toxicities expected with lymphodepleting chemotherapy (eg, cytopenias).
• Fever grade < 3.
• Myelosuppression (includes bleeding in the setting of platelet count less than 50 x 109/L and documented bacterial infections in the setting of neutropenia), defined as lymphopenia, decreased hemoglobin, neutropenia and/or thrombocytopenia.
• Immediate hypersensitivity reactions occurring within 2 hours of TC-210 T cell infusion (related to cell infusion) that are reversible to a grade 2 or less within 24 hours of TC-210 T cell administration with standard therapy.
[00565] Leukapheresis Inclusion/Exclusion Criteria
[00566] Patients will be assessed for and must meet leukapheresis eligibility criteria for leukapheresis at the Leukapheresis Eligibility visit (Visit 2).
[00567] Leukapheresis Inclusion Criteria
[00568] A patient must meet the following inclusion criteria to be eligible for participation in this study:
• Patient (or legally authorized representative) has voluntarily agreed to participate by giving written informed consent in accordance with International Conference on Harmonisation (ICH) Good Clinical Practice (GCP) guidelines and applicable local regulations.
• Patient is > 18 years of age at the time the Informed Consent is signed.
• Patient has a pathologically confirmed diagnosis of either MPM, serous ovarian adenocarcinoma, cholangiocarcinoma, or NSCLC at screening (Note: Cytology is insufficient).
• Patient’s tumor has been pathologically reviewed by a TCR2 Therapeutics designated central laboratory with confirmed positive MSLN expression on > 50% of tumor cells that are
2+ and/or 3+ by immunohistochemistry. For MPM and Serous Ovarian Adenocarcinoma indications, patients must have confirmed positive MSLN expression on 50% of tumor cells that are 2+ and/or 3+ by immunohistochemistry. Cholangiocarcinoma and NSCLC patients must have a MSLN expression of 50% of tumor cells that are 1+, 2+, and/or 3+ by immunohistochemistry. A banked tumor biopsy is allowed at screening if obtained within the prior 12 months, otherwise a fresh tumor biopsy should be obtained.
• Patient has advanced (ie, metastatic or unresectable) cancer. Unresectable refers to a tumor lesion in which clear surgical excision margins cannot be obtained without leading to significant functional compromise.
• Patient has at least 1 lesion that meets evaluable and measurable criteria defined by RECIST v 1.1 after the pre-TC-210 T cell infusion fresh-tissue biopsy has been performed. Patients who have received prior local therapy (including but not limited to embolization, chemoembolization, radiofrequency ablation, or radiation therapy) are eligible provided measurable disease falls outside of the treatment field or within the field and has shown
> 20% growth in size since post-treatment assessment.
• Prior to TC-210 T cell infusion, patients must have received at least 1 systemic standard of care therapy for metastatic or unresectable disease (unless otherwise specified).
• Patient has an Eastern Cooperative Oncology Group performance status 0 or 1.
• Patient is fit for leukapheresis and has adequate venous access for the cell collection.
• Subjects must have an absolute lymphocyte count (ALC) > 350/pL prior to leukapheresis. Patients with an ALC < 350/pL would still be eligible to proceed with leukapheresis if they have a CD3 count of 150/pL..
[00569] Leukapheresis Exclusion Criteria
[00570] A patient meeting any of the following exclusion criteria is not eligible to undergo leukapheresis:
• Inability to follow the procedures of the study (eg, due to language problems, psychological disorders, dementia, confusional state).
• Patient has received or plans to receive the following therapy/treatment prior to leukapheresis:
• Cytotoxic chemotherapy within 3 weeks of leukapheresis
• Corticosteroids: therapeutic doses of steroids must be stopped > 72 hours prior to leukapheresis. Use of inhaled steroids or topical cutaneous steroids is not exclusionary. Corticosteroid therapy at a pharmacologic dose (> 5 mg/day of prednisone or equivalent doses of other corticosteroids) and other immunosuppressive drugs should be avoided until
3 months after TC-210 T cell administration, unless medically indicated to treat new toxicity. Physiological replacement doses of steroids (up to 5 mg/day of prednisone equivalent, or higher if warranted by the patient’s BMI) may be allowed.
• Immunosuppression: any other immunosuppressive medication must be stopped > 4 weeks prior to leukapheresis, including calcineurin inhibitors, methotrexate or other chemotherapy drugs, mycophenolate, steroids (see above), rapamycin, thalidomide, or immunosuppressive antibodies such as rituximab, anti-tumor necrosis factor, anti-interleukin (IL) 6 or anti-IL6R.
• Use of an anti-cancer vaccine within 2 months in the absence of tumor response. The patient should be excluded if their disease is responding to an experimental vaccine given within 6 months;
• Any previous gene therapy using an integrating vector;
• Tyrosine kinase inhibitor (eg, EGFR inhibitors) within 72 hours;
• Any previous allogeneic hematopoietic stem cell transplant;
• Investigational treatment or clinical trial within 4 weeks or 5 half-lives of investigational product, whichever is shorter.
• Patient has active infection with human immunodeficiency virus (HIV), hepatitis B virus, hepatitis C virus (HCV), or human T-lymphotropic virus (HTLV) as defined below:
• Positive serology for HIV, HTLV- 1 , or HTL V-2;
• Active hepatitis B infection as demonstrated by test for hepatitis B surface antigen. Patients who are hepatitis B surface antigen negative but are hepatitis B core antibody positive must have undetectable hepatitis B deoxyribonucleic acid (DNA) and receive prophylaxis against viral reactivation;
• Active hepatitis C infection as demonstrated by hepatitis C ribonucleic acid (RNA) test. Patients who are HCV antibody positive will be screened for HCV RNA by any reverse transcription polymerase chain reaction (PCR) or branched DNA assay. If HCV antibody is positive, eligibility will be determined based on a negative screening RNA value.
[00571] Treatment Inclusion/Exclusion Criteria
[00572] A patient must meet the following treatment inclusion criteria to be eligible to proceed with first protocol defined therapy (eg. Lymphodepletion or TC-210 Infusion). Treatment Eligibility will be formally assessed at Baseline (Visit 4).
[00573] Treatment Inclusion Criteria
[00574] A patient must meet the following inclusion criteria to be eligible to receive therapy on this study:
• Patient (or legally authorized representative) has voluntarily agreed to participate by giving written informed consent in accordance with International Conference on Harmonisation Good Clinical Practice guidelines and applicable local regulations.
• Patient has agreed to abide by all protocol required procedures including study -related assessments, and management by the treating institution for the duration of the study and LTFU.
• Patient is > 18 years of age at the time the Informed Consent is signed.
• Patient has a pathologically confirmed diagnosis of either MPM, serous ovarian adenocarcinoma, cholangiocarcinoma, or NSCLC at screening. (Note: cytology is insufficient).
• Patient’s tumor has been pathologically reviewed by a TCR2 Therapeutics designated central laboratory. For MPM and Serous Ovarian Adenocarcinoma indications, patients must have a confirmed positive MSLN expression on 50% of tumor cells that are 2+ and/or 3+ by immunohistochemistry. Cholangiocarcinoma and NSCLC patients must have a MSLN expression of 50% of tumor cells that are 1+, 2+ and/or 3+ by immunohistochemistry. If the patient had a fresh biopsy during pre-screening, that biopsy sample may be used for Baseline MSLN testing. If archival tissue was used during pre-screening, the patient must undergo a fresh biopsy, unless deemed unsafe by the PI and/or the lesion is inaccessible and upon discussion with the medical monitor. For TC-210 retreatment in phase 2, adequate MSLN expression should be confirmed again on a fresh biopsy for patients scheduled to receive TC-210retreatment beyond
the first 180 days after the prior TC-210 infusion. For patients scheduled to receive TC-210 retreatment within the first 180 days from the initial TC-210 infusion, the demonstration of adequate MSLN expression on any post-infusion biopsy (e.g. week 8 biopsy) will suffice.
• Patient has advanced (ie, metastatic or unresectable) cancer. Unresectable refers to a tumor lesion in which clear surgical excision margins cannot be obtained without leading to significant functional compromise.
• Patient has at least 1 lesion that meets evaluable and measurable criteria defined by RECIST v 1.1 after the pre-TC-210 T cell infusion fresh-tissue biopsy has been performed. Patients who have received prior local therapy (including but not limited to embolization, chemoembolization, radiofrequency ablation, or radiation therapy) are eligible provided measurable disease falls outside of the treatment field or within the field and has shown > 20% growth in size since posttreatment assessment.
• Prior to TC-210 T cell infusion, patients must have received at least 1 systemic standard of care therapy for metastatic or unresectable disease (unless otherwise specified), as follows:
• MPM
■ Patients must have received standard frontline therapy with a platinum-based regimen or they must have elected not to pursue frontline standard of care therapy.
■ In an aspect, the patient must not have required a paracentesis or thoracentesis within the preceding 4 weeks nor be projected to require a paracentesis or thoracentesis within the next 8 weeks.
• NSCLC
■ Patients must have a pathologically confirmed (by histology or cytology) diagnosis of NSCLC, which is currently stage 3B or stage 4 disease.
■ A patient with non-squamous NSCLC must have been tested for relevant epidermal growth factor receptor (EGFR) mutations, anaplastic lymphoma kinase translocation or other genomic aberrations (eg, ROS rearrangement, BRAF V600E mutation) for which FDA-approved targeted therapy is available and, if positive, the patient should have received at least one such therapy prior to study enrollment.
■ Patients with the EGFR T790M mutation must have received the FDA-approved tyrosine kinase inhibitor osimertinib.
■ For patients without an actionable mutation, the patient must have received a currently approved frontline regimen (eg, immune checkpoint inhibitor-based therapy).
Serous Ovarian Adenocarcinoma
■ The patient must have a histologically confirmed diagnosis of recurrent serous ovarian adenocarcinoma, which is currently stage 3 or stage 4 disease. A histologic diagnosis of borderline, low malignant potential epithelial carcinoma is not permitted.
■ Patients with a BReast CAncer genes 1 and 2 (BRCA1/2) mutation must have received an FDA-approved poly (ADP-ribose) polymerase (PARP) inhibitor.
■ The patient must not have required a paracentesis or thoracentesis within the preceding 4 weeks nor be projected to require a paracentesis or thoracentesis within the next 8 weeks.
■ The patient has no evidence of a bowel obstruction within the last 8 weeks.
• Cholangiocarcinoma
■ Patients must have received at least 1 standard systemic regimen for unresectable or metastatic disease (eg, gemcitabine- or 5-FU-containing regimens) or they must have elected not to pursue frontline standard of care therapy.
■ Patients must have measurable disease, defined as at least one lesion that can be accurately measured in at least one dimension (longest diameter to be recorded for non- nodal lesions and short axis for nodal lesions) as > 20 mm (> 2 cm) with conventional techniques or as > 10 mm (> 1 cm) with computed tomography scan or magnetic resonance imaging.
■ Prior to TC-210 T cell infusion, patients must have received at least 1 systemic standard of care therapy for metastatic or unresectable disease (unless otherwise specified).
■ Patients who have received systemic adjuvant chemotherapy will be permitted.
• Patient has an Eastern Cooperative Oncology Group performance status 0 or 1.
• All patients must have undergone a rapid influenza diagnostic test and/or a respiratory viral panel (as per Institutional guidelines) within 14 days prior to the planned TC-210 T cell infusion. If the patient is positive for influenza, oseltamivir phosphate or zanamivir should be administered for 10 days (see Tamiflu® or Relenza® package insert for dosing). The patient must complete their 10-day treatment course prior to receiving TC-210 T cells. For patients residing in the United States, Canada, Europe and Japan, influenza testing is required during the months of October through May (inclusive). For patients residing in the southern hemisphere such as Australia, influenza testing is required during the months of April through November (inclusive). For patients with significant international travel, both calendar intervals above may need to be considered. Respiratory viral panel should be performed according to institutional guidelines and include coronavirus disease 2019 (Covid- 19; SARS-CoV-2), when available. If patient is
symptomatic or tests positive, TC-210 T cell infusion should be delayed until the patient is asymptomatic and deemed fit for infusion by the treating physician.
• Patient has a left ventricular ejection fraction > 45% as measured by resting echocardiogram, with no clinically significant pericardial effusion.
• Female patient of childbearing potential (FPCP) must have a negative urine or serum pregnancy test (FPCP is defined as premenopausal and not surgically sterilized). FPCP must agree to use effective birth control or to abstain from heterosexual activity throughout the study, starting on the day of first dose of lymphodepl eting chemotherapy through 12 months post TC-210 T cell infusion or for 4 months after there is no evidence of persistence of gene modified cells in the blood, whichever is longer. Effective contraceptive methods include intra-uterine device, oral or injectable hormonal contraception, or 2 adequate barrier methods (eg, diaphragm with spermicide, cervical cap with spermicide, or female condom with spermicide). Spermicides alone are not an adequate method of contraception.
Or
Male patients must be surgically sterile or agree to use a double barrier contraception method or abstain from heterosexual activity with a female of childbearing potential starting at the first dose of protocol-defined treatment and for 4 months thereafter or longer (if indicated in the country specific monograph/label for cyclophosphamide).
• Patient must have adequate organ function as indicated by the laboratory values in the table below:
[00575] Treatment Exclusion Criteria
[00576] A patient meeting any of the following exclusion criteria is not eligible for participation in the treatment portion of this study:
• Inability to follow the procedures of the study (eg, due to language problems, psychological disorders, dementia, confusional state).
• Known or suspected non-compliance, drug, or alcohol abuse.
• Participation in another study with investigational drug within the 28 days or 5 half-lives of the drug, whichever is shorter, preceding and during the present study.
• Patient is pregnant (or intends to become pregnant during the course of the study) or breastfeeding.
• Patient has received or plans to receive the following therapy/treatment prior to the first protocol- defined therapy:
• Cytotoxic chemotherapy within 3 weeks of TC-210 T cell infusion.
• Corticosteroids: therapeutic doses of steroids must be stopped at least 2 weeks prior to TC- 210 T cell infusion. Use of inhaled steroids or topical cutaneous steroids is not exclusionary. Corticosteroid therapy at a pharmacologic dose (> 5 mg/day of prednisone or equivalent doses of other corticosteroids) and other immunosuppressive drugs should be avoided until
3 months after TC-210 T cell administration, unless medically indicated to treat new toxicity. Physiological replacement doses of steroids (up to 5 mg/day of prednisone equivalent, or higher if warranted by the patient’s BMI) may be allowed.
• Immunosuppression: any other immunosuppressive medication must be stopped > 4 weeks prior to first protocol defined treatment, including calcineurin inhibitors, methotrexate or other chemotherapy drugs, mycophenolate, steroids (see above), rapamycin, thalidomide, or immunosuppressive antibodies such as rituximab, anti-tumor necrosis factor, anti-interleukin (IL) 6 or anti-IL6R.
• Use of an anti-cancer vaccine within 2 months in the absence of tumor response. The patient should be excluded if their disease is responding to an experimental vaccine given within 6 months;
• Any previous gene therapy using an integrating vector;
• Tyrosine kinase inhibitor (eg, EGFR inhibitors) within 72 hours;
• Any previous allogeneic hematopoietic stem cell transplant;
• Investigational treatment or clinical trial within 4 weeks or 5 half-lives of investigational product, whichever is shorter;
• Radiotherapy to the target lesions within 3 months prior to lymphodepleting chemotherapy. A lesion with unequivocal progression may be considered a target lesion regardless of time from last radiotherapy dose. NOTE: There is no washout period for palliative radiation to non-target lesions;
• Hepatic radiation, chemoembolization, and/or radiofrequency ablation within 4 weeks.
• Current anticoagulative therapy (excluding deep vein thrombosis prophylaxis).
• Immune therapy (monoclonal antibody therapy, checkpoint inhibitors) within 4 weeks.
• Toxicity from previous anti-cancer therapy that has not recovered to < grade 1 (except for nonclinically significant toxicities, eg, alopecia, vitiligo). Patients with grade 2 toxicities that are deemed stable or irreversible (eg, peripheral neuropathy) can be enrolled.
• History of allergic reactions attributed to compounds of similar chemical or biologic composition to fludarabine, cyclophosphamide, or other agents used in the study.
• History of autoimmune or immune mediated disease such as multiple sclerosis, lupus, rheumatoid arthritis, inflammatory bowel disease, or small vessel vasculitis.
• Major surgery (other than diagnostic surgery) within 4 weeks prior to first protocol defined therapy, minor surgery including diagnostic surgery within 2 weeks (14 days) excluding central intravenous port placements and needle aspirate/core biopsies. Radio frequency ablation or transcatheter arterial chemoembolization within 6 weeks prior to enrollment.
• Central nervous system (CNS) disease/brain metastases:
• Patients with leptomeningeal disease, carcinomatous meningitis, or symptomatic CNS metastases: patients are eligible if they have completed their treatment, have recovered from the acute effects of radiation therapy or surgery prior to study entry, and a) have no evidence of brain metastases post treatment or b) are asymptomatic, have discontinued corticosteroid treatment or anti-seizure medications for these metastases for at least 4 weeks and have radiographically stable CNS metastases without associated edema or shift for at least 3 months prior to study entry (note: prophylactic anti-seizure medications are acceptable; up to 5 mg/day of prednisone or equivalent will be allowed; higher doses may be allowed if warranted due to patient BMI).
• Patient has any other prior or concurrent malignancy with the following exceptions:
• Adequately treated basal cell or squamous cell carcinoma (adequate wound healing is required prior to study entry)
• In situ carcinoma of the cervix or breast, treated curatively and without evidence of recurrence for at least 12 months prior to the study
• Treated non-melanoma skin cancer
• Stage 0 or 1 melanoma completely resected at least 12 months prior to enrollment
• Successfully treated organ-confined prostate cancer with no evidence of progressive disease based on prostate specific antigen (PSA) levels and are not on active therapy
• A primary malignancy which has been completely resected and in complete remission for > 5 years
• Malignancies deemed unlikely to be of clinical significance during TC-210 T cell therapy by principal investigator and as approved by sponsor
• Patient has an electrocardiogram showing a clinically significant abnormality at screening or showing an average QTc interval > 450 msec in males and > 470 msec in females (> 480 msec for patients with bundle branch block). Either Fridericia’s or Bazett’s formula may be used to correct the QT interval.
• Patient has uncontrolled intercurrent illness including, but not limited to:
• Ongoing or active infection; eg, sepsis, prolonged unresolved bacterial cholangitis with destruction of bile duct branches (eg, after endoprosthesis insertion) or 2 or more cholangitis in the last 6 months.
• Clinically significant cardiac disease defined by congestive heart failure New York Heart Association class 3 or class 4;
• Uncontrolled clinically significant arrhythmia;
• Acute coronary syndrome (angina or myocardial infarction), stroke, or peripheral vascular event in the last 6 months;
• Interstitial lung disease (patients with existing pneumonitis as a result of radiation are not excluded; however, patients must not be oxygen dependent as demonstrated by oxygen saturation < 92% on room air);
• Liver cirrhosis or primary sclerosing cholangitis.
• Patient has active infection with human immunodeficiency virus (HIV), hepatitis B virus, hepatitis C virus (HCV), or human T-lymphotropic virus (HTLV) as defined below:
• Positive serology for HIV, HTLV- 1 , or HTL V-2;
• Active hepatitis B infection as demonstrated by test for hepatitis B surface antigen. Patients who are hepatitis B surface antigen negative but are hepatitis B core antibody positive must have undetectable hepatitis B deoxyribonucleic acid (DNA) and receive prophylaxis against viral reactivation;
[00577] Active hepatitis C infection as demonstrated by hepatitis C ribonucleic acid (RNA) test. Patients who are HCV antibody positive will be screened for HCV RNA by any reverse transcription polymerase chain reaction (PCR) or branched DNA assay. If HCV antibody is positive, eligibility will be determined based on a negative screening RNA value.
[00578] Criteria for Evaluation
[00579] Safety
[00580] TC-210 T cells are the first TCR2 Therapeutics T cell receptor fusion construct (TRuC) to be studied in patients with cancer. No previous experience currently exists regarding the administration of TC-210 T cells to humans and therefore no safety profile is available. A series of common toxicities have been identified across a growing number of trials involving autologous T cells genetically engineered to express either CARs or TCRs targeting tumor antigens. The most important of such toxicities are CRS, neurotoxicity, and on-target off-tumor adverse events.
[00581] Most adoptive T cell therapy trials involve the use of lymphodepleting chemotherapy prior to T cell infusion. Frequently, lymphodepletion chemotherapy involves the use of high dose cyclophosphamide and fludarabine therapy, which are expected to be associated with toxicities, particularly cytopenias.
[00582] TC-210 T Cell Kinetics
[00583] Expansion/persistence of the adoptively transferred TC-210 T cells will be investigated to test whether clinical response correlates with the 1) degree of expansion (ie, peak expansion), and/or 2) persistence of the genetically modified cells in vivo. Presence of TC-210 T cells will be measured using PCR to transgene specific sequences and anti-idiotype antibodies against the MH1 binder of the TC-210 TRuC. Functional assays for reactivity toward the MSLN antigen will be conducted where possible.
[00584] Statistical Methods
[00585] The co-primary clinical endpoints for efficacy are ORR, defined as the proportion of patients with a CR or PR via independently reviewed RECIST v 1.1 relative to the total number of patients in the analysis population, and DCR, defined as the ORR plus the proportion of patients with SD for at least 8 weeks or at least 12 weeks via independently reviewed RECIST v 1.1 relative to the total number of patients in the analysis population.
Study Populations
• Intent-to-treat population: all patients who have signed the informed consent form and have undergone leukapheresis.
• Modified intent-to-treat (mITT) population: all patients enrolled and treated with the planned dose of study drug.
• DLT Evaluable population: (phase 1 only) patients treated in the phase 1 portion of the study who received study drug and were followed for at least 28 days post-administration or who have a DLT within 28 days of the first study drug dose.
• Safety Set: all patients treated with any dose of study drug.
[00586] The primary analysis population for safety and efficacy will be the mITT defined as all patients who received a TC-210 T cell infusion.
[00587] No specific statistical hypotheses are being evaluated with respect to the primary, secondary, or exploratory objectives and endpoints. The primary focus will be on determining the safety profile and a preliminary efficacy profile of TC-210 T cells, as well as on establishing the kinetics of TC-210 T cells following infusion. All analyses will be descriptive and exploratory. Descriptive statistics on continuous data will include means, medians, standard deviations, and ranges.
Categorical data will be summarized using frequency counts and percentages. Graphical summaries of the data may be presented. Assessments will be displayed by cohort and time as well as across cohorts for specific parameters. Time to event endpoints will be summarized and displayed graphically using Kaplan -Meier (KM) methodology to estimate the median, and the 25th and 75th percentiles. Two-sided 80% confidence intervals will be produced. Overall survival may be assessed at fixed time points such as 1 year and 2 years using KM methods.
[00588] Study Treatment and Concomitant Therapy
[00589] During the course of the study, investigators may prescribe any concomitant medications or treatment deemed necessary to provide adequate supportive care except those medications listed in the excluded medication. All concurrent therapies, including medications and supportive therapy (eg, intubation, dialysis, and blood products), should be recorded from the date the patient is enrolled into the study through 3 months after completing TC-210 T cell therapy. After 3 months post TC-210 T cell infusion, only targeted concomitant medication will be collected, including immunosuppressive drugs, anti-infective drugs, vaccinations, and any therapy for the treatment of the patient’s malignancy for 1 year beyond disease progression. Specific concomitant medication collection requirements and instructions are included in the case report form (CRF) completion guidelines.
[00590] Prohibited Concomitant Medications
[00591] See the exclusion criteria a detailed list of prohibited concomitant medications.
• In general, medications that might interfere with the evaluation of the investigational product should not be used unless absolutely necessary. Medications in this category include (but are not limited to): immunosuppressants and corticosteroid anti-inflammatory agents including prednisone, dexamethasone, solumedrol, and cyclosporine.
• Treatment for the patient’s cancer such as chemotherapy, immunotherapy, targeted agents, radiation, and high dose corticosteroid, other than defined/allowed in this protocol, and other investigational agents are prohibited except as needed for treatment of disease progression.
[00592] Study Restrictions: Contraception
[00593] There are no data regarding the safety of TC-210 T cell during pregnancy or lactation in humans. Female patients who are pregnant, intending to become pregnant, or breast feeding are excluded from this study.
[00594] Female and male patients of reproductive potential must agree to avoid becoming pregnant or impregnating a partner, respectively. The required duration of contraception is described below:
• Female patients of childbearing potential must agree to use an effective method of contraception starting at the first dose of chemotherapy for at least 12 months thereafter and 4 months after the TC-210 T cell gene modified cells are no longer detected in the blood.
• Male patients must agree to use an effective method of contraception starting at the first dose of chemotherapy and for 4 months thereafter or longer (if indicated in the country specific monograph/label for cyclophosphamide).
[00595] Female patients of childbearing potential is defined as premenopausal and not surgically sterilized.
[00596] Effective methods of contraception include intra-uterine device, injectable hormonal contraception, oral contraception, or 2 adequate barrier methods (eg, diaphragm with spermicide, cervical cap with spermicide, or female condom with spermicide [spermicides alone is not an adequate method of contraception]).
[00597] Abstinence (relative to heterosexual activity) can be used as the sole method of contraception if it is consistently employed as the patient’s preferred and usual lifestyle and if considered acceptable by local regulatory agencies and IRBs. Periodic abstinence (eg, calendar, ovulation, sympto-thermal, post-ovulation methods, etc) and withdrawal are not acceptable methods of contraception.
[00598] Leukapheresis and TC-210 T Cell Manufacturing
[00599] TC-210 T cells are an engineered autologous ACT. Patients who complete screening procedures and who meet leukapheresis eligibility criteria will be eligible to undergo leukapheresis to obtain starting material for the manufacture of autologous TC-210 T cells. A large-volume non-mobilized PBMC collection will be performed (12- to 15-liter apheresis) according to Institutional standard procedures for collection of the starting material. The goal will be to collect approximately 5 to 10 * 109 total PBMCs (minimum collection goal 1.5 x 107 PMBC/kg). The leukapheresed cells will then be frozen and transported either the same day or overnight to the TCR2 Therapeutics approved Cell Processing Facility (CPF). In cases where the minimum number of PBMCs are not collected or the manufacturing of sufficient TC-210 T cells is not successful, a second leukapheresis may be performed. Citrate anticoagulant should be used during the procedure and prophylaxis against the adverse effects of this anticoagulant (eg, CaCh infusions) may be employed at the Investigator’s discretion.
[00600] Upon arrival at the CPF, each patient’s leukapheresed product will be processed to enrich for the T cells containing PBMC fraction. T cells will be then stimulated to expand and transduced with a lentiviral vector to introduce the TC-210 transgene to obtain TC-210 T cells. Transduced
T cells (ie, TC-210 T cells or TC-210 product) are then expanded and cryopreserved to generate the investigational product per CPF standard operating procedures (SOPs). Once the TC-210 product has passed certain release tests, the CPF will ship it back to the treating facility.
[00601] Patients must confirm treatment eligibility at the baseline visit (Visit 4). TC-210 T cells have never been previously administered to human patients. TC-210 T cells will be administered first during the phase 1 portion of the study (ie, dose-escalation phase) at the initial dose of 5 x io7 transduced T cells/m2 (ie, DL0). The dose-escalation phase will evaluate 4 TC-210 T cell doses:
5 x 107/m2, 1 x 108/m2, 5 x 108/m2, and 1 x 109/m2. At each dose, TC-210 transduced T cells will be first administered alone and, if deemed safe, will then be administered following lymphodepletion with fludarabine and cyclophosphamide. For the purpose of dose escalation, the addition of lymphodepletion will be considered a higher dose level even when using the same TC-210 T cell dose. At each dose level, a dose range of ± 15% of the target dose may be administered.
[00602] Bridging Therapy
[00603] During the time between the patient undergoing leukapheresis and starting protocol-defined therapy, patients may receive a therapy aimed at maintaining control over or stabilizing his or her disease. The therapy used during this time will be considered a ‘bridging’ therapy aimed at bridging the gap between prior treatment and treatment with TC-210 T cells. The protocol will allow for patients to receive appropriate therapies for the indication and disease status. The patients must be off-treatment for specific timeframes based on the product mechanism as follows before receiving first protocol-defined therapy, including:
• Cytotoxic chemotherapy within 3 weeks;
• Immune therapy (monoclonal antibody therapy, checkpoint inhibitors) within 4 weeks;
• Corticosteroids or any other immunosuppressive therapy within 2 weeks. Use of inhaled steroids or topical cutaneous steroids is not exclusionary;
• TKI (eg, EGFR inhibitors) within 72 hours;
• Hepatic radiation, chemoembolization, and/or radiofrequency ablation within 4 weeks.
[00604] Lymphodepleting Chemotherapy
[00605] Patients who receive lymphodepleting chemotherapy will receive a non-myeloablative chemotherapy regimen consisting of fludarabine 30 mg/m2/day on days -7 through -4 and cyclophosphamide 600 mg/m2/day on days -6 through -4 (ie, 3 doses). In the event the patient has an unforeseeable delay or missed dosing day for this lymphodepleting regimen, the missed dose will be administered, and the TC-210 T cell dosing day will be moved back, maintaining the last dosing day
at day-4 relative to TC-210 T cell infusion. The intent of this regimen is to induce lymphocyte depletion to promote an optimal environment for the expansion of TC-210 T cells in vivo.
[00606] TC-210 T Cell Infusion
[00607] On day 0 of the study, patients participating in the phase 1 portion of the study will receive TC-210 T cells within the dose range of 5 * 107 to 1 * 109 transduced cells/square meter of surface area (depending on the dose level) by iv infusion. The recommended dose for patients participating in the phase 2 portion will be determined at the end of the dose-escalating phase 1.
[00608] TC-210 T cells is a patient-specific product.
[00609] Thirty to 60 minutes prior to cell infusion, patients will be premedicated against potential infusion reactions with antihistamines and acetaminophen (paracetamol) as per institutional practice. Steroids must not be administered as premedication for T cell infusion due to their lymphotoxic potential against the TC-210 T cell product.
[00610] TC-210 T cells must not be thawed until immediately prior to infusion. The product can be thawed either in a water bath at the patient’s bedside or with a device such as GE ViaThaw in a centralized facility, according to Institutional standard procedures. The cells must be infused without delay and, if thawed centrally, must be transported to the patient by appropriately trained clinical staff, to preserve the chain of custody. The TC-210 T cell product must not be washed or otherwise processed.
[00611] It is expected that the infusion will commence within approximately 10 minutes of thawing (or within 10 minutes of receipt if thawed centrally) and complete within 45 minutes of thawing (or receipt from centralized thawing facility) to minimize exposure of the TC-210 T cell product to cryoprotectant. If the cells are provided in multiple bags, the additional bag(s) must not be thawed until half of the first bag has been infused without reaction.
[00612] TC-210 T cells are to be administered using a dual spike infusion set by gravity over 15 to 30 minutes (in the absence of reaction) via non-filtered tubing. The bag should be gently agitated during infusion to avoid cell clumping. Infusion pumps must not be used.
[00613] For administration of the TC-210 T cells, 100 to 250 ml of 0.9% NaCl should be connected to the second lumen of the infusion set, used to prime the line, and then the lumen closed. On completion of the infusion of a bag of TC-210 T cells, the main line should be closed and approximately 50 ml NaCl transferred into the cell bag, and then infused to minimize cell loss. This process should be repeated for each cell bag if multiple bags are provided.
[00614] On completion of the cell infusion the set should be flushed using additional saline from the attached bag. In the event that institutional practice requires a single spike infusion set, the line must be flushed with 0.9% NaCl once the infusion is complete. In the event of adverse reaction to TC-210 T cell infusion, the infusion rate should be reduced, and the reaction managed according to Institutional standard procedures.
[00615] Corticosteroids should be avoided unless medically required.
[00616] In the event a patient develops a febrile episode following the infusion, appropriate cultures and medical management should be initiated, with attention to the initiation of empirical antibiotic treatment in the case of febrile neutropenia.
[00617] The infusion of the TC-210 T cell product may be delayed by up to 5 days should a patient develop significant chemotherapy-related complications, if it is judged to be in the patient’s best interest by the investigator.
[00618] Cytopenias alone should not be a reason to delay T-cell infusion unless complications (eg, uncontrolled infection or bleeding) are present.
[00619] The volume of T cells infused, the thaw time, the start time, and the stop time will all be noted in the patient medical record.
[00620] Vital signs will be recorded within 10 minutes prior to the infusion and at 5 (±3 minutes), 15 (±3 minutes), and 30 minutes (±5 minutes) and at 1 (±5 minutes), 1.5 (±5 minutes),
2 (±5 minutes), and 4 hours (±5 minutes) after the infusion has started. For the phase 1 portion of the study, patients should be observed overnight following the infusion of TC-210 T cells.
[00621] TC-210 T cells may be administered via a fractionated regimen at any point in the study if deemed appropriate for safety or efficacy reasons by either the SRT or the sponsor’s medical monitor. The TC-210 dose would be fractionated such that one-third (approximately 33%) of the TC- 210 T cell dose will be administered on Day 0 and, if well tolerated, the remaining two-thirds (approximately 67%) of the dose will be administered 3-7 days later (days +3 to +7 post-initial infusion). In the event the initial one-third (33%) dose elicits > grade 3 CRS and/or > grade 2 neurotoxicity, the infusion of the second fraction should be delayed until the CRS and/or neurotoxicity regresses to < grade 1, or otherwise until treatment is deemed safe by both the treating physician and the sponsor’s medical monitor.
[00622] Toxicity Management
[00623] Patients should be monitored and/or treated for toxicities, including the following: infection with Pneumocystis Jiroveci pneumonia, herpes virus, varicella zoster, and fungal infections; tumor lysis syndrome; cytokine release syndrome (CRS); fever and neutropenia; low hemoglobin or platelet count; any new onset neurotoxicity.
[00624] Study Procedures and Schedule of Events
[00625] Mesothelin Screening
[00626] Only patients with tumor MSLN expression above the cut-off (> 50% of cells that are 2+ and/or 3+ for MPM and serous ovarian adenocarcinoma indications; > 50% of cells that are 1+, 2+, and/or 3+ for cholangiocarcinoma and NSLCL indications) as determined by IHC at a designated central laboratory are eligible to receive gavo-cel therapy.
[00627] Clinical Assessments and Procedures
[00628] Demographics, medical history, and disease history will be collected and recorded. Physical examination, measurement of vital signs, performance status using ECOG performance scale, clinical safety assessments, laboratory assessments, and cardiac assessments will all be performed. [00629] Tumor Response Assessments
[00630] Imaging scans of the chest, abdomen, and pelvis will be performed at leukapheresis eligibility, baseline, week 4, week 8, week 12, week 24, and every 12 weeks or every 3 months until confirmed disease progression, study completion, or withdrawal. Acceptable imaging modalities for this study include:
• Diagnostic-quality CT scan with oral and/or iv iodinated contrast of the chest and abdomen/pelvis (CT is the preferred modality for tumor assessments)
• MRI of the abdomen/pelvis acquired before and after gadolinium contrast agent administration and a non-contrast enhanced CT of the chest, if a patient is contraindicated for contrast enhanced CT
[00631] In addition to CT scans and/or MRIs, patients will undergo PET scans of the chest, abdomen, and pelvis at baseline, Week 4, Week 12, and as clinically indicated thereafter, as well as at time of disease progression, study completion, or withdrawal from the study.
[00632] Tumor assessments will be evaluated according to the RECIST vl.l.
[00633] TC-210 T Cell Retreatment (Applicable During Phase 2)
[00634] Patients treated in the phase 2 portion of the study who have a confirmed response (ie, PR or CR) or at least SD for at least 8 weeks or for more than 4 months post-TC-210 T cell infusion will have an option to receive a second treatment regimen, consisting of a course of lymphodepleting chemotherapy followed by a second infusion of TC-210 T cells, should their disease progress after the first TC-210 T cell infusion.
[00635] The second infusion will be administered following the same procedural requirements as the first one, including the post-treatment study requirements. Patients meeting treatment eligibility criteria for a second infusion may proceed to TC-210 T cell infusion no sooner than 60 days and no later than 12 months following completion of the first TC-210 T cell infusion.
[00636] Correlative Studies and Research Assessments
[00637] Correlative studies and research assays will be performed during the trial to monitor the biological parameters that may impact TC-210 T cell treatment outcome. Such studies include phenotype, function, and persistence of the infused TC-210 T cells, cytokine measurements, and antigenicity studies, among others. Studies will be conducted on tumor biopsies, PBMCs, serum or plasma.
[00638] Dose Escalation
The objective of the dose-escalation phase of the study (phase 1) will be the evaluation of DLTs and the determination of the RP2D. If the maximum tolerated dose (MTD) (defined as the dose administered at 1 dose level below the dose in which DLTs were observed in > 33% of patients) is determined during the dose escalation phase, then the MTD will be the recommended RP2D. See Table 4 for the TC-210 T Cell dose levels.
[00639] Dose escalation will proceed in evenly spaced increments over 4 TC-210 T cell doses: (5 x 107/m2, 1 x 108/m2, 5 x 108/m2, and 1 x 109/m2).
[00640] In the event of toxicity at DL5, two cell dose levels with lymphodepletion (DL3.5A and DL3.5B) will be explored. From DL5, de-escalation will proceed to DL3.5 (first to DL3.5A and, if cleared for safety, then to DL3.5B) with a cohort of 3 patients using a fractionated dosing regimen. If DL3.5A, with a fractionated regimen is cleared for safety by the SRT, an additional 3-patient cohort can then be treated employing the same dose but this time administered as a single infusion. A similar strategy will be employed when exploring DL3.5B. Protocol stagger, safety observation, and escalation rules would apply to both DL3.5A and DL3.5B using either a fractionated regimen or a single infusion.
[00641] All doses mentioned throughout the protocol denote transduced TC-210 T cells. A variation on the target dose of 15% (ie, ± 15%) will be allowed at each dose level:
• Dose level -1 (DL-1): 1 x 107 transduced cells/m2 on day 0 (allowed if excessive toxicity is observed in dose level 0)
• Dose level 0 (initial dose level) (DLO): 5 x 107 transduced cells/m2 on day 0
• Dose level 1 (DL1): 5 x 107 transduced cells/m2 on day 0 following lymphodepleting therapy (fludarabine 30 mg/m2/d on days -7 through -4 and cyclophosphamide 600 mg/m2/d on days -6 through -4)
• Dose level 2 (DL2): 1 x 108 transduced cells/m2 on day 0
• Dose level 3 (DL3): 1 x 108 transduced cells/m2 on day 0 following lymphodepleting therapy (fludarabine 30 mg/m2/d on days -7 through -4 and cyclophosphamide 600 mg/m2/d on days -6 through -4)
• Dose Level 3.5A (DL3.5A): 3 x 108 transduced cells/m2 on day 0 following lymphodepleting therapy (fludarabine 30 mg/m2/d on days -7 through -4 and cyclophosphamide 600 mg/m2/d on days -6 through -4)
• Dose Level 3.5B (DL3.5B): 4 x 108 transduced cells/m2 on day 0 following lymphodepleting therapy (fludarabine 30 mg/m2/d on days -7 through -4 and cyclophosphamide 600 mg/m2/d on days -6 through -4)
• Dose level 4 (DL4): 5 x 108 transduced cells/m2 on day 0
• Dose level 5 (DL5): 5 x 108 transduced cells/m2 on day 0 following lymphodepleting therapy (fludarabine 30 mg/m2/d on days -7 through -4 and cyclophosphamide 600 mg/m2/d on days -6 through -4)
• Dose level 6 (DL6): 1 x 109 transduced cells/m2 on day 0
• Dose level 7 (DL7): 1 x 109 transduced cells/m2 on day 0 following lymphodepleting therapy (fludarabine 30 mg/m2/d on days -7 through -4 and cyclophosphamide 600 mg/m2/d on days -6 through -4)
Dose Levels WITHOUT Lymphodepletion:
• Dose escalation (Dose Levels [DLs] 0, 2, 4, and 6) will proceed in cohorts of 1 patient each.
• If the initial dose level (ie, DLO) is deemed not safe, a lower dose of 1 x 107/m2 will be evaluated.
• Should the patient enrolled to DLO, or future dose levels without lymphodepletion develop a grade > 3 toxicity presumably related to TC-210 T cells, that cohort will expand to 3 patients and proceed according to a 3 + 3 dose-escalation schema.
• A minimum of 14 days will be required between TC-210 T cell infusion of patient 1 in a without lymphodepletion cohort and TC-210 T cell infusion of patient 1 in the subsequent with lymphodepletion cohort.
• Should dose levels without lymphodepletion require expansion to a 3 -patient cohort, patients 2 and 3 in such cohort may be infused only after a minimum of 14 days have elapsed since the infusion of patient 1 in that cohort.
Dose levels WITH lymphodepletion:
• Dose escalation (Dose Levels [DL] 1, 3, 5, and 7) will always proceed in cohorts of 3 patients
• Patients in any given cohort may be infused only after a minimum of 14 days have elapsed since the infusion of the prior patient in that cohort
• Should none of the 3 patients in a cohort experience a protocol defined DLT within 28 days post TC-210 T cell infusion, the SRT should recommend treating a cohort of 3 patients at the next higher dose level.
• Should 1 of the first 3 patients experience a DLT, 3 more patients will be treated at the same dose level.
• Should 2 of the first 3 patients experience a DLT, the dose administered to patients in the previous dose level will be declared the MTD.
• Should 1 or 2 patients in a cohort of 6 participants experience DLTs, the SRT should recommend treating a cohort of 3 patients at the next higher dose level.
• Should 3 or more patients in a cohort of 6 participants experience DLTs, the dose administered to patients in the previous dose level will be declared the MTD.
• For the purpose of safety onboarding, a 14-day stagger will be implemented for the first
3 patients treated at each new site (ie, with no prior experience administering TC-210 T cells).
• The sample size of the RP2D cohort may be further expanded to include 6 additional patients (at the discretion of the SRT) in order to better characterize safety prior to launching the phase 2 of the study. There will be no requirement to stagger patients during this portion of the study.
• The SRT may declare the RP2D at any time based on available safety data independent of whether the MTD has been reached or not.
Example 2: TFP Constructs
[00642] Anti-MSLN TFP constructs were engineered by cloning the MSLN VHH domains (or scFv domains) DNA fragment linked to a CD3 or TCR DNA fragment by either a DNA sequence encoding a short linker (SL): AAAGGGGSGGGGSGGGGSLE or a long linker (LL): AAAIEVMYPPPYLGGGGSGGGGSGGGGSLE into the pLRPO vector. Various other vector may
be used to generate fusion protein constructs. Examples of the anti-MSLN TFP constructs generated include anti-MSLN-linker-human CD3s chain (including extracellular, transmembrane, and intracellular domains), with the anti-MSLN antigen binding domain being the scFv or sdAb with sequences disclosed in Table Al.
Source of TCR Subunits
[00643] Subunits of the human T Cell Receptor (TCR) complex all contain an extracellular domain and a transmembrane domain. The CD3 epsilon, CD3 delta, and CD3 gamma subunits have an intracellular domain. A human TCR complex contains the CD3 -epsilon polypeptide, the CD3- gamma poly peptide, the CD3-delta polypeptide, and the TCR alpha chain polypeptide and the TCR beta chain polypeptide or the TCR delta chain polypeptide and the TCR gamma chain polypeptide. TCR alpha, TCR beta, TCR gamma, and TCR delta recruit the CD3 zeta polypeptide. The human CD3-epsilon polypeptide canonical sequence is Uniprot Accession No. P07766. The human CD3- gamma polypeptide canonical sequence is Uniprot Accession No. P09693. The human CD3-delta polypeptide canonical sequence is Uniprot Accession No. P043234. The human CD3-zeta polypeptide canonical sequence is Uniprot Accession No. P20963. The human TCR alpha chain canonical sequence is Uniprot Accession No. Q6ISU1. The human TCR beta chain C region canonical sequence is Uniprot Accession No. P01850, a human TCR beta chain V region sequence is P04435.
[00644] The human CD3-epsilon polypeptide canonical sequence is: MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQH NDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENC MEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPP VPNPDYEPIRKGQRDLYSGLNQRRI.
[00645] The signal peptide of human CD3s is:
[00646] MQSGTHWRVLGLCLLSVGVWGQ.
[00647] The extracellular domain of human CD3s is:
[00648] DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDE DHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD.
[00649] The transmembrane domain of human CD3s is:
[00650] VMSVATIVIVDICITGGLLLLVYYWS.
[00651] The intracellular domain of human CD3s is:
[00652] KNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI. [00653] The human CD3-gamma polypeptide canonical sequence is: MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKM
IGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAE IVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN.
[00654] The signal peptide of human CD3y is:
[00655] MEQGKGLAVLILAIILLQGTLA.
[00656] The extracellular domain of human CD3y is:
[00657] QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSN
AKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS.
[00658] The transmembrane domain of human CD3 y is:
[00659] GFLFAEIVSIFVLAVGVYFIA.
[00660] The intracellular domain of human CD3y is:
[00661] GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN.
[00662] The human CD3-delta polypeptide canonical sequence is:
MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRI
LDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFA GHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKS.
[00663] The signal peptide of human CD36 is:
[00664] MEHSTFLSGLVLATLLSQVSP.
[00665] The extracellular domain of human CD36 is:
[00666] FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYK
DKEST VQVHYRMCQ SCVELDP AT VA.
[00667] The transmembrane domain of human CD36 is:
[00668] GIIVTDVIATLLLALGVFCFA.
[00669] The intracellular domain of human CD36 is:
[00670] GHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK.
[00671] The human CD3-zeta polypeptide canonical sequence is:
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPA
YQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAE AYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR.
[00672] The human TCR alpha chain canonical sequence is:
MAGTWLLLLLALGCPALPTGVGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDSPI
WFSAGNGSALDAFTYGPSPATDGTWTNLAHLSLPSEELASWEPLVCHTGPGAEGHSRSTQP MHLSGEASTARTCPQEPLRGTPGGALWLGVLRLLLFKLLLFDLLLTCSCLCDPAGPLPSPAT TTRLRALGSHRLHPATETGGREATSSPRPQPRDRRWGDTPPGRKPGSPVWGEGSYLSSYPTC PAQAWCSRSALRAPSSSLGAFFAGDLPPPLQAGAA.
[00673] The human TCR alpha chain C region canonical sequence is:
PNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNS
AVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLL K V AGFNLLMTLRLW S S .
[00674] The human TCR alpha chain human IgC sequence is:
[00675] PNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSM
DFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLS.
[00676] The transmembrane domain of the human TCR alpha chain is:
[00677] VIGFRILLLKV AGFNLLMTLRLW.
[00678] The intracellular domain of the human TCR alpha chain is:
[00679] SS
[00680] The human TCR alpha chain V region CTL-L17 canonical sequence is:
MAMLLGASVLILWLQPDWVNSQQKNDDQQVKQNSPSLSVQEGRISILNCDYTNSMFDYFL
WYKKYPAEGPTFLISISSIKDKNEDGRFTVFLNKSAKHLSLHIVPSQPGDSAVYFCAAKGAGT ASKLTFGTGTRLQVTL.
[00681] The human TCR beta chain C region canonical sequence is:
EDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQ
PLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVS AEAWGRADCGFTSVSYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF.
[00682] The human TCR beta chain human IgC sequence is:
[00683] EDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGV STDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPV TQIVSAEAWGRADCGFTSVSYQQGVLSATILYE.
[00684] The transmembrane domain of the human TCR beta chain is:
[00685] ILLGKATLYAVLVSALVLMAM.
[00686] The human TCR beta chain V region CTL-L17 canonical sequence is:
MGTSLLCWMALCLLGADHADTGVSQNPRHNITKRGQNVTFRCDPISEHNRLYWYRQTLGQ
GPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSLAGLNQPQ HFGDGTRLSIL.
[00687] The intracellular domain of the human TCR beta chain is:
[00688] VKRKDF.
[00689] The human TCR beta chain V region YT35 canonical sequence is:
MDSWTFCCVSLCILVAKHTDAGVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMR
GLELLIYFNNNVPIDD SGMPEDRF S AKMPNASF STLKIQPSEPRDS AVYFC AS SF STC S ANYG YTFGSGTRLTVV.
[00690] The human TCR gamma chain C region canonical sequence is:
[00691] DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWQEKKSNTILGSQ EGNTMKTNDTYMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPKD NCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS.
[00692] The human TCR beta gamma human IgC sequence is:
[00693] DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWQEKKSNTILGSQ EGNTMKTNDTYMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPKD NCSKDANDTLLLQLTNTSA.
[00694] The transmembrane domain of the human TCR gamma chain is:
[00695] YYMYLLLLLKSVVYFAIITCCLL.
[00696] The intracellular domain of the human TCR gamma chain is:
[00697] RRTAFCCNGEKS.
[00698] The human TCR delta chain C region canonical sequence is:
[00699] SQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAV KLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHT EKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL.
[00700] The human TCR delta human IgC sequence is:
[00701] SQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAV KLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHT EKVNMMSLTV.
[00702] The transmembrane domain of the human TCR delta chain is:
[00703] LGLRMLFAKTVAVNFLLTAKLFF.
[00704] The intracellular domain of the human TCR delta chain is:
[00705] L
TFP Expression Vectors
[00706] Expression vectors are provided that include: a promoter (eukaryotic elongation factor 1 alpha (EFla promoter), a signal sequence to enable secretion, a polyadenylation signal and transcription terminator (Bovine Growth Hormone (BGH) gene), an element allowing episomal replication and replication in prokaryotes (e.g., SV40 origin and ColEl or others known in the art) and elements to allow selection (ampicillin resistance gene and zeocin marker).
[00707] The TFP-encoding nucleic acid construct was cloned into the pLRPO lentiviral expression vector as is described above. The anti-MSLN.TFP lentiviral transfer vectors were used to produce
the genomic material packaged into the VSV-G pseudotyped lentiviral particles. Expi293F-cells were suspended in free-style (FS) media and allowed to incubate at 37 degrees C, 8% CO2, 150 rpm for 1-3 hours. The transfer DNA plasmid, Gag/Pol plasmid, Rev plasmid, and VSV-G plasmid were diluted in FS media. PEIpro was then diluted in FS media and added to the mixture of DNA and media. The incubated cells were added to this mixture and are incubated at 37 degrees C, 8% CO2, 150 rpm for 18-24 hours. The following day, the supernatant was replaced with fresh media and supplemented with sodium butyrate and incubated at 37°C for an additional 24 hours. The lentivirus containing supernatant was then collected into a 50 mL sterile, capped conical centrifuge tube and put on ice. After centrifugation at 3000 rpm for 30 minutes at 4°C, the cleared supernatant was filtered with a low-protein binding 0.45 pm sterile filter. The virus was subsequently concentrated by Lenti-X. The virus stock preparation was either used for infection immediately or aliquoted and stored at -80°C for future use.
Example 3: Treatment of patients with anti-MSLN TFP T cells
[00708] The example provided here summarizes initial findings of the study described in Example 1. Provided is data for 12 patients with mesothelioma, 4 patients with ovarian cancer, and 1 patient with cholangiocarcinoma having received a single infusion of anti-MSLN TFP T cells (also referred to as TC-210, TC-210 TRuC-T Cells, or gavo-cel). 14 of the 17 patients received lymphodepleting chemotherapy prior to treatment (Fludarabine (30 mg/m2/day x4) and Cyclophosphamide (600 mg/m2/day x3)). The key clinical findings were that TC-210 was well-tolerated, the Overall Response Rate (ORR) was 25%, and the Disease Control Rate (DCR) was 81%. Lymphodepletion linked to higher peak expansion and greater tumor regression. The Maximum Tolerated Dose was identified (5xl08/m2 with LD). The pre-screening enrolment and manufacturing activity is shown in Table 5. MSLN expression was above enrollment cutoff in -50% of screened patients.
Characteristics of treated patents are shown in Table 6. This shows that all patients had received at least three prior treatments. A summary of grade >3 treatment emergent adverse events is shown in Table 7. Adverse events of special interest are shown in Table 8. The RECIST vl. l response assessment summary is shown in Table 9. Table 10 shows the specific prior treatments that patients 1-5 received.
* Dose limiting toxicity
DCR = PR or SD lasting at least 3 months
[00709] The percent tumor regression is shown in Figure 1.
[00710] Subject (or patient) 2 is a 74-year old male and a former smoker, with obstructive sleep apnea (OSA) and epithelioid pleural mesothelioma. The cancer was refractory to the prior therapy. In February 2018: Subject 2 showed disease progression following extensive surgeries including thoracotomy, pleurectomy, pneumonectomy, reconstruction of diaphragm/pericardium, thoracic and mediastinal lymphadenectomy. In September 2018, Subject 2 showed disease progression following pembrolizumab. In April 2019, Subject 2 showed disease progression following carboplatin/pemetrexed (x4). In this study, the subject was treated with lymphodepletion including cyclophosphamide and fludarabine followed by the administration of TC-210 (5xl06/m2) in September 2019. Scans of two target lesions for Subject 2 following treatment are shown in Figure 2. Soluble mesothelin and MPF levels are also shown. In this study, Subject 2 showed a partial response overall and in target lesions.
[00711] Subject 3 is a 36-year old male, with epithelial peritoneal mesothelioma. Subject 3 showed significant (64%) tumor regression in this study. In March 2015, subject 3 was diagnosed with mesothelioma. Subject 3 then had a left parietal pleurectomy. In October 2015, Subject 3 had stable disease after cisplatin/pemetrexed. In May 2019, Subject 3 had extensive cervical, mediastinal, abd/pelvic masses, bone metastases. In July 2019, Subject 3 had disease progression following carboplatin/pemetrexed (x3). The cancer was refractory to the prior therapy. In this study, the subject was treated with lymphodepletion including cyclophosphamide and fludarabine followed by the administration of TC-210 (5xl07/m2) in April 2020. Scans of one target lesion for Subject 3 is shown in Figure 3. Subject 3 showed significant (64%) tumor regression in this study, showing a partial response in the target lesions with progressive disease overall due to a new pelvic lesion.
[00712] Subject 4 is a 36-year-old male with epithelioid peritoneal mesothelioma diagnosed in March 2016. The subject developed unresectable large pancreatic lesions in 2018. The cancer has failed nine prior lines of therapy including treatment with pembrolizumab from September 2019 to
December 2019. In this study, the Subject was treated with lymphodepletion including cyclophosphamide and fludarabine followed by the administration of TC-210 (5xl07/m2) in April 2020. Scans of one target lesion for Subject 4 are shown in Figure 4. Subject 4 showed a 75% tumor regression, with a partial response in the target lesions and overall. The Subject showed progressive disease due to a new lymph node lesion.
[00713] Subject 5 is a 70-year old female with stage IV high grade serous ovarian cancer diagnosed in April 2016. Mutational analysis indicated that she had BRAC 1/2 WT, amplification of AKT2, amplification of ARAF, amplification of CCNE1, and TP53R248Q mutation. The subject had prior therapy including suboptimal cytoreductive surgery with +LVI and +LNs in June 2016, 6 times of adjuvant paclitaxel/carboplatin completed in November 2016, IP paclitaxel/cisplatin (with poor tolerance), two times of IP paclitaxel/carboplatin completed in April 2017, and six times of paclitaxel/carboplatin + bevacizumab until January 2019, and bevacizumab maintenance until Nov 2019. The cancer was refractory to the prior therapy. In this study, the subject was treated with lymphodepletion including cyclophosphamide and fludarabine followed by the administration of TC- 210 (5xl07/m2) in May 2020. The response of Subject 5 to treatment is shown in Figure 5. Subject 5 showed a 61% tumor regression, with a partial response in the target lesions at months 1, 2, 3, 6, a complete response in non-target lesions at months 1, 2, 3, 6, and overall a partial response at month 3.
[00714] Subject 14 is a 63-year-old female with metastatic intrahepatic cholangiocarcinoma. Mutational analysis indicated that she had mutated KRAS and RBI genes. The cancer had previously failed 5 prior lines of therapy. In this study, the subject was treated with lymphodepletion including cyclophosphamide and fludarabine followed by the administration of TC-210 (lxl08/m2). The response of Subject 14 to treatment is shown in Figure 6. The subject showed a partial response and tumor regression of 56%.
[00715] Subject 15 is a 66-year old female with relapsed pleural mesothelioma. The cancer had failed 4 prior lines of therapy, including nivolumab/ipilimumab and anti-MSLN antibody-drug conjugate. In this study, the subject was treated with lymphodepletion including cyclophosphamide and fludarabine followed by the administration of TC-210 (5xl08/m2). The response of Subject 15 to treatment is shown in Figure 7. The subject showed a partial response and tumor regression of 55%. [00716] Figure 8 shows the subject response and follow up for the subjects in this study, with SD indicating stable disease, PR indicating partial response, CR indicating complete response, PD indicating progressive disease, and LD indicating lymphodepleting chemotherapy.
[00717] Figure 9 shows TC-210 T Cell expansion in peripheral blood by qPCR for the 17 subjects. Expansion of TC-210 T Cells in peripheral blood observed in all patients. Peak expansion occurred
between days 3-10 post infusion. A roughly 10-fold increase in expansion was observed with escalation from the 5xl07/m2 to lxl08/m2 dose of TC-210. Little expansion was observed in subjects who did not receive lymphodepleting chemotherapy.
[00718] The progression free survival and overall survival in this study for MPM subjects are shown in Figure 10. In this study, the Overall Response Rate (ORR) was found to be 38%, with a Progression Free Survival (PFS) of 5.9 Months, and Overall Survival (OS) of 11.2 Months. ORR, PFS, and OS for MPM subjects treated with standard of care therapy, Vinorelbine or Pembrolizumab, from previous studies is shown in Table 11 below. As is shown, both Vinorelbine and Pembrolizumab have dramatically lower ORR and PFS than TC-210.
1. Fennell et al Phase 2 VIM Study. ASCO 2021
2. Popat et al Phase 3 PROMISE-meso Study. Ann Oncol 2020
[00719] The results presented herein demonstrate that patients who were resistant or refractory to multiple lines of prior therapy, including systemic therapy, exhibited significant tumor regression and increased progression free survival in response to treatment with TC-210, for all three target indications tested.
Example 4: Treatment of patients with anti-MSLN TFP T cells
[00720] The example provided here summarizes additional findings of the study described in Example 1, and builds on the findings described in Example 3.
[00721] Thirty two patients (23 mesothelioma, 8 ovarian cancer and one cholangiocarcinoma) received a single TC-210 infusion. Thirty were evaluable for efficacy. The median number of prior lines of therapy was five (range, 1-13), including immune checkpoint inhibitors in 66% of patients and mesothelin-directed therapies in 19% of patients.
[00722] A dose-limiting toxicity (DLT) was identified at dose level (DL) 5 (5xl08/m2 following lymphodepletion). Subsequently, the study proceeded to dose de-escalation, at DL3.5 (3xl08/m2 following lymphodepletion) using a split-dosing (fractionated dosing) approach, and at DL3 (lxl08/m2 following lymphodepletion) which was declared the recommended Phase 2 dose (RP2D).
No new DLTs were observed. In total, the patient data provided herein is for 22 patients with mesothelioma, 7 patients with ovarian cancer, and 1 patient with cholangiocarcinoma, each of which received a single infusion of anti-MSLN TFP T cells (also referred to as TC-210, TC-210 TRuC-T Cells, or gavo-cel), with or without lymphodepleting chemotherapy prior to treatment (Fludarabine (30 mg/m2/day x4) and Cyclophosphamide (600 mg/m2/day x3), referred to herein as “LD”). Table 12. provides patient tumor characteristics across the dose levels tested.
[00723] Table 13 provides the Grade > 3 treatment emergent adverse effects identified in the study.
*Dose Limiting Toxicity
[00724] In an initial analysis of MPM and platinum refractory ovarian cancer patients, the overall survival (OS) for patients with MPM was 11.8 months, and the median progression-free survival (PFS) was 5.6 months (Figure 14). In the ovarian cancer patients, the median progression-free survival (PFS) was 5.8 months, and the median overall survival (OS) was 8.2 months.
[00725] By blinded independent central review (BICR), 28 of the 30 patients evaluable for efficacy experienced tumor regression of their target lesions, ranging in magnitude from 4% to 80%, for a disease control rate (DCR) of 77% (Figure 11). Thus, there was consistent tumor regression of 93% across all three tumor types tested. As also shown in Figure 11, eight patients experienced target lesion regression greater than 30%, six of whom (four with mesothelioma and two with ovarian cancer) achieved a partial response (PR) according to RECIST 1.1 criteria, including one who also achieved a complete metabolic response. The patient with cholangiocarcinoma was also considered to have achieved a PR (patient 14). Figure 12 provides the ovarian cancer patients in the study, and shows that 6/7 patients experienced tumor regression, two of whom achieved PR according to RECIST 1.1 criteria, a significant outcome for the ovarian cancer indication. A graph providing the same data for just the mesothelioma patients in the study is provided as Figure 13.
[00726] Table 14 provides a summary of the response rates and disease control rates. The overall response rate (ORR) among patients who received TC-210 following lymphodepletion chemotherapy was 22% by BICR and 26% by investigator assessment. By BICR, the ORR was 21% among
patients with malignant pleural/peritoneal mesothelioma (MPM) and 29% among those with ovarian cancer.
DCR (Disease Control Rate) = PR or SD lasting at least 3 months
[00727] Figure 15 shows TC-210 T Cell expansion in peripheral blood by qPCR for the 32 subjects. Peak TC-210 expansion (Cmax) occurred between days 7 and 23. Cmax markedly increased when T- 210 was administered following lymphodepletion. Figure 16 shows that cytokine induction post TC- 210 infusion was observed in evaluable patients at all dose levels, which was indicative of mesothelin target engagement.
[00728] Figure 17 shows that circulating mesothelin markers trended with the clinical response. Mesothelin markers detected were soluble mesothelin-related peptide (SMRP) and megakaryocyte potentiating factor (MPF), each of which are markers for diagnosis and monitoring of mesothelin- expressing cancers. In the patients tested, 4/5 patients with a partial response exhibited a reduction in circulating SMRP from baseline and 5/5 patients with a partial response exhibited a reduction in MPF from baseline.
[00729] In addition, persistence of TC-210 cells in the tumor outlasted persistence in the blood in the indicated patients exhibiting a partial response or stable disease as shown in Table 15, indicating TC-210 migration and tumor infiltration. OPRE (transgene) copies per pg DNA in serosal effusion or peripheral blood at the indicated timepoints is shown.
[00730] Together, the data showed that TC-210 was generally well tolerated with a manageable adverse event profile. Two DLTs were observed: one case of Grade 3 pneumonitis at DL1 that resolved with anti-cytokine therapy, and one case of Grade 5 bronchioalveolar hemorrhage at DL5 (5xl08 cells/m2 following lymphodepletion). All three patients treated at DL5 experienced severe cytokine release syndrome (CRS) which resulted in the Safety Review Team recommending de- escalation to DL3.5 and subsequently to DL3, which was declared the RP2D. The most frequent Grade 3 non-hematological toxicity among patients treated at the RP2D was CRS, which was reported in 15% of patients.
[00731] Thirty patients were evaluable for response. Tumor regression was observed in 28 (93%) patients with a DCR of 77%. Eight patients experienced target lesion regression greater than 30%, including six patients who achieved a PR by RECISTvl .1 criteria (four with MPM and two with ovarian cancer). The ORR by RECISTvl.1 criteria among patients infused with TC-210 following lymphodepletion chemotherapy was 22% by BICR, including one patient who achieved a complete metabolic response, and 26% by investigator assessment, which included an additional PR reported on a patient with metastatic cholangiocarcinoma.
[00732] When analyzing separately the patients with mesothelioma, their median OS and PFS were 11.8 months and 5.6 months, respectively, which compare favorably with the outcomes of patients with relapsed refractory MPM treated in the second line setting with standard therapy.
[00733] In summary, the data showed TC-210 provides a safe, effective method for treating solid tumors, where there have been significant challenges with current therapies including CAR-T therapies. The RECIST responses achieved confirmed the clinically meaningful efficacy of TC-210 as a monotherapy including in ovarian cancer. Further, TC-210 delivers consistent tumor regression for heavily pre-treated patients with mesothelioma.
Endnotes
[00734] While preferred embodiments of the present disclosure have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the disclosure. It should be understood that various alternatives to the embodiments of the present disclosure described herein may be employed in practicing the disclosure. It is intended
that the following claims define the scope of the present disclosure and that methods and structures within the scope of these claims and their equivalents be covered thereby.
APPENDIX A: SEQUENCE SUMMARY
Claims
1. A method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising
(a) administering to the human subject a first portion of a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti-MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising:
(I) a TCR subunit comprising
(i) at least a portion of a TCR extracellular domain,
(ii) a TCR transmembrane domain, and
(iii) a TCR intracellular domain; and
(II) an antibody domain comprising an anti-MSLN antigen binding domain and
(b) administering a second portion of a dose of transduced anti-MSLN TFP T cells, wherein the second portion of a dose is administered less than 50 days following administration of the first portion of a dose of anti-MSLN TFP T cells, and wherein the first portion of a dose and the second portion of a dose comprise from about 1 x 105 to about 5 x io10 transduced cells/m2.
2. A method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising
(a) administering to the human subject a first portion of a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti-MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising:
(I) a TCR subunit comprising
(i) at least a portion of a TCR extracellular domain,
(ii) a TCR transmembrane domain, and
(iii) a TCR intracellular domain; and
(II) an antibody domain comprising an anti-MSLN antigen binding domain and
(b) administering a second portion of a dose of transduced anti-MSLN TFP T cells, wherein the second portion of a dose is administered following administration of the first portion of a dose of anti-MSLN TFP T cells, and wherein the first portion of a dose and the second portion of a dose comprise about one-third to two-thirds of a reference dose, and wherein the reference dose is 1 x 105 to about 5 x io10 transduced cells/m2.
A method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising
(a) administering to the human subject a first portion of a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti-MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising:
(I) a TCR subunit comprising
(i) at least a portion of a TCR extracellular domain,
(ii) a TCR transmembrane domain, and
(iii) a TCR intracellular domain; and
(II) an antibody domain comprising an anti-MSLN antigen binding domain and
(b) administering a second portion of a dose of transduced anti-MSLN TFP T cells, wherein:
(A) the human subject elicits an adverse event and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells, or
(B) the human subject does not elicit an adverse event that is grade 2 or higher and the second portion of a dose is administered at a second timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells; wherein the first timepoint is longer than the second timepoint. A method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising
(a) administering to the human subject a first portion of a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti-MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising:
(I) a TCR subunit comprising
(i) at least a portion of a TCR extracellular domain,
(ii) a TCR transmembrane domain, and
(iii) a TCR intracellular domain; and
(II) an antibody domain comprising an anti-MSLN antigen binding domain and
(b) administering a second portion of a dose of transduced anti-MSLN TFP T cells, wherein the second portion of a dose is administered following administration of the first portion of a dose of anti-MSLN TFP T cells, and wherein the first portion of a dose comprises a first number of
transduced cells/m2 and wherein the second portion of a dose comprises a second number of transduced cells/m2, wherein the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 is from 1 : 10 to 10: 1, and wherein the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 is not 1 : 1. A method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising
(a) administering to the human subject a first portion of a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti-MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising:
(I) a TCR subunit comprising
(i) at least a portion of a TCR extracellular domain,
(ii) a TCR transmembrane domain, and
(iii) a TCR intracellular domain; and
(II) an antibody domain comprising an anti-MSLN antigen binding domain and
(b) administering a second portion of a dose of transduced anti-MSLN TFP T cells, wherein the second portion of a dose is administered following administration of the first portion of a dose of anti-MSLN TFP T cells, and wherein the first portion of a dose comprises a first number of transduced cells/m2 and wherein the second portion of a dose comprises a second number of transduced cells/m2, and wherein the method reduces or prevents a risk of adverse event associated with administering a reference dose with a number of transduced cells/m2 equivalent to the sum of the first number of transduced cells/m2 and the second number of transduced cells/m2; wherein each of the first portion of a dose and the second portion of a dose comprise less transduced cells/m2 than the reference dose. A method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising
(a) administering to the human subject a first dose or first portion of a dose of transduced anti- MSLN T cell receptor fusion protein (TFP) T cells, wherein a T cell of the transduced anti- MSLN TFP T cells comprises a recombinant nucleic acid comprising a sequence encoding a TFP comprising:
(I) a TCR subunit comprising
(i) at least a portion of a TCR extracellular domain,
(ii) a TCR transmembrane domain, and
(iii) a TCR intracellular domain; and
- 175 -
(II) an antibody domain comprising an anti-MSLN antigen binding domain, wherein the first dose or the first portion of a dose comprises about 3 * 108 transduced cells/m2. The method of claim 5, wherein the first number of transduced cells/m2 is different than the second number of transduced cells/m2. The method of claim 6, wherein the method further comprises administering a second dose or second portion of a dose of transduced anti-MSLN TFP T cells. The method of any one of claims 1-3, 5, 7, and 8, wherein the first portion of a dose comprise a first number of transduced cells/m2 and wherein the second portion of a dose comprise a second number of transduced cells/m2, wherein the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 is from 1 : 10 to 10: 1. The method of claim 9, wherein the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 is not 1 : 1. The method of any one of claims 1, 3-5, and 8, wherein the first portion of a dose and the second portion of a dose comprise from about one-third to two-thirds of a reference dose, and wherein the reference dose is 1 x 105 to about 5 x io10 transduced cells/m2. The method of any one of claims 4, 9, and 10, wherein the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 is from 1 :5 to 5: 1 or 1 :3 to 3: 1. The method of any one of claims 4, 9, and 10, wherein the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 is from 1 :2 to 2: 1. The method of any one of claims 4, 9, and 10, wherein the ratio of the first number of transduced cells/m2 to the second number of transduced cells/m2 is about 1 :2 or about 2: 1. The method of any one of claims 1-5 and 7-14, wherein the first portion of a dose and the second portion of a dose comprise from about 1 x io6 to about 5 x io9 transduced cells/m2. The method of claim 2, wherein the reference dose is from 1 x 106 to about 5 x io9 transduced cells/m2. The method of claim 2 or 3 or 4 or 5 or 8, wherein the second portion of a dose is administered less than 50 days following administration of the first portion of a dose of anti-MSLN TFP T cells. The method of any one of claims 1-5 and 7-17, wherein the sum of the first portion of a dose and the second portion of a dose equals a reference dose. The method of claim 18, wherein the reference dose is from 1 x 106 to about 5 x io9 transduced cells/m2. The method of claim 18, wherein the reference dose is about 1 x io7 transduced cells/m2. The method of claim 18, wherein the reference dose is about 5 x io7 transduced cells/m2.
- 176 -
The method of claim 18, wherein the reference dose is about 1 108 transduced cells/m2. The method of claim 18, wherein the reference dose is about 3 108 transduced cells/m2. The method of claim 18, wherein the reference dose is about 4 108 transduced cells/m2. The method of claim 18, wherein the reference dose is about 5 108 transduced cells/m2. The method of claim 18, wherein the reference dose is about 1 109 transduced cells/m2. The method of any one of claims 1-20, wherein the first portion of a dose is about 3.33 x 106 transduced cells/m2. The method of claim 27, wherein the second portion of a dose is about 6.66 x io6 transduced cells/m2. The method of any one of claims 1-19 and 21, wherein the first portion of a dose is about 1.66 x
107 transduced cells/m2. The method of claim 29, wherein the second portion of a dose is about 3.33 x io7 transduced cells/m2. The method of any one of claims 1-19 and 22, wherein the first portion of a dose is about 3.33 x
107 transduced cells/m2. The method of claim 31, wherein the second portion of a dose is about 6.66 x io7 transduced cells/m2. The method of any one of claims 1-19 and 23, wherein the first portion of a dose is about 1 x 108 transduced cells/m2. The method of claim 33, wherein the second portion of a dose is about 2 x io8 transduced cells/m2. The method of any one of claims 1-19 and 24, wherein the first portion of a dose is about 1.33 x
108 transduced cells/m2. The method of claim 35, wherein the second portion of a dose is about 2.66 x 108 transduced cells/m2. The method of any one of claims 1-19 and 25, wherein the first portion of a dose is about 1.66 x 108 transduced cells/m2. The method of claim 37, wherein the second portion of a dose is about 3.33 x io7 transduced cells/m2. The method of any one of claims 1-19 and 26, wherein the first portion of a dose is about 3.33 x 108 transduced cells/m2. The method of claim 39, wherein the second portion of a dose is about 6.66 x io8 transduced cells/m2.
- 177 -
The method of any one of claims 1-5 and 7-40, wherein the second portion of a dose is administered less than 10 days following administration of the first portion of a dose of anti- MSLN TFP T cells. The method of any one of claims 1-5 and 7-41, wherein the second portion of a dose is administered 7 or fewer days following administration of the first portion of a dose of anti- MSLN TFP T cells. The method of any one of claims 1-5 and 7-42, wherein the second portion of a dose is administered at least three days after administering the first portion of a dose. The method of any one of claims 1-5 and 7-43, wherein the second portion of a dose is administered three to seven days after administering the first portion of a dose. The method of any one of claims 1-5 and 7-43, wherein the second portion of a dose is administered 3 days after administering the first portion of a dose. The method of any one of claims 1-5 and 7-43, wherein the second portion of a dose is administered 4 days after administering the first portion of a dose. The method of any one of claims 1-5 and 7-43, wherein the second portion of a dose is administered 5 days after administering the first portion of a dose. The method of any one of claims 1-5 and 7-43, wherein the second portion of a dose is administered 6 days after administering the first portion of a dose. The method of any one of claims 1-5 and 7-43, wherein the second portion of a dose is administered 7 days after administering the first portion of a dose. The method of claim 6 or 44, wherein the human subject does not exhibit any adverse event after administering the first portion of a dose. The method of any one of claims 1-5 and 7-43, wherein the human subject exhibits an adverse event after administering the first portion of a dose, and wherein the second portion of a dose is administered at least seven days after administering the first portion of a dose. The method of claim 51, wherein the adverse event is selected from the group consisting of cytokine release syndrome (CRS), neurotoxicity, severe CRS (sCRS), CAR T cell-related encephalopathy syndrome (CRES) or immune effector cell-associated neurotoxicity syndrome (ICANS), Central Nervous System (CNS) toxicity, tumor lysis syndrome (TLS), an infusion reaction, cytopenia, cardiac toxicity, hypogammaglobulinemia, graft-versus-host-disease and any combination thereof. The method of claim 51, wherein the adverse event is selected from the group consisting of cytokine release syndrome and neurotoxicity.
- 178 -
The method of claim 51, wherein the adverse event is > grade 3 cytokine release syndrome and/or > grade 2 neurotoxicity. The method of any one of claims 1-5 and 7-54, wherein the human subject exhibits an adverse event and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells, wherein the first timepoint is longer than the second timepoint. The method of claim 55, wherein the human subject exhibits an adverse event that is grade 1 or lower and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells. The method of claim 55, wherein the human subject exhibits an adverse event that is grade 1 or higher and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells. The method of claim 57, wherein the human subject exhibits an adverse event that is grade 2 or higher and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells. The method of claim 58, wherein the human subject exhibits an adverse event that is grade 3 or higher and the second portion of a dose is administered at a first timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells. The method of any one of claims 3 and 55-59, wherein the first timepoint is more than 7 days after the first portion of a dose is administered. The method of any one of claims 1-5 and 7-54, wherein the human subject does not exhibit an adverse event that is grade 2 or higher and the second portion of a dose is administered at a second timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells, wherein the first timepoint is longer than the second timepoint. The method of claim 61, wherein the human subject does not exhibit an adverse event that is grade 3 or higher and the second portion of a dose is administered at a second timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells. The method of claim 61 or 62, wherein the human subject exhibits an adverse event that is grade 1 or lower and the second portion of a dose is administered at a second timepoint after administration of the first portion of a dose of anti-MSLN TFP T cells. The method of any one of claims 3 and 61-62, wherein the second timepoint is 7 days or less after the first portion of a dose is administered. The method of any one of claims 3 and 55-64, wherein the second timepoint is after the adverse event is no longer exhibited by the subject.
The method of any one of claims 3, 55-62 and 64, wherein the second timepoint is after the adverse event exhibited by the subject is grade 1 or less. The method of any one of claims 1-5 and 7-66, wherein the method reduces or prevents a risk of adverse event associated with administering a dose with an amount equivalent to the sum of the amount of the first portion of a dose plus the second portion of a dose. The method of claim 67, wherein the adverse event comprises bacterial or fungal infection, tumor lysis syndrome, cytokine release syndrome, neurotoxicity, infusion reactions, cytopenias, cardiac toxicity, hypogammaglobulinemia or graft-versus-host disease. The method of any one of claims 1-68, wherein the human subject has or has not received one or more lines of prior therapy prior to administering the first portion of a dose. The method of claim 69, wherein the one or more lines of prior therapy comprises surgery, chemotherapy, hormonal therapy, biological therapy, antibody therapy, radiation therapy, systemic therapy, or any combinations thereof. The method of any one of claims 1-70, wherein the human subject has or has not received a lymphodepleting chemotherapy regimen prior to administering the first portion of a dose. The method of any one of claims 1-71, further comprising administering a lymphodepleting chemotherapy regimen to the human subject prior to administering the first portion of a dose. The method of claim 71 or 72, wherein the lymphodepleting chemotherapy regimen comprises administration of about four doses of fludarabine and about three doses of cyclophosphamide. The method of any one of claims 71-73, wherein the lymphodepleting chemotherapy regimen comprises administration of four doses of fludarabine and three doses of cyclophosphamide. The method of any one of claims 71-74, wherein the lymphodepleting chemotherapy regimen comprises administration of fludarabine at a level of about 30 mg/m2/day on days -7 through -4 relative to administration of the first portion of a dose of anti-MSLN TFP T cells, and further comprises administration of cyclophosphamide at a level of about 600 mg/m2/day on days -6 through -4 relative to administration of the first portion of a dose of anti-MSLN TFP T cells. The method of any one of claims 71-75, wherein the lymphodepleting chemotherapy regimen comprises administration of fludarabine at a level of 30 mg/m2/day on days -7 through -4 relative to administration of the first portion of a dose of anti-MSLN TFP T cells, and further comprises administration of cyclophosphamide at a level of 600 mg/m2/day on days -6 through -4 relative to administration of the first portion of a dose of anti-MSLN TFP T cells. The method of any one of claims 1-76, wherein the TCR subunit and the anti-MSLN antigen binding domain are operatively linked.
The method of any one of claims 1-77, wherein the TFP functionally interacts with an endogenous TCR complex in the T cell. The method of any one of claims 1-78, wherein the antibody domain is a murine, human or humanized antibody domain. The method of any one of claims 1-79, wherein the anti-MSLN binding domain is a scFv or a VHH domain. The method of claim 80, wherein the anti-MSLN binding domain comprises a heavy chain variable domain having at least 80%, at least 85%, at least 90%, at least 95% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 46 or SEQ ID NO: 47. The method of claim 81, wherein the anti-MSLN binding domain is a VHH domain. The method of any one of the preceding claims, wherein the TFP includes an extracellular domain of a TCR subunit that comprises an extracellular domain or portion thereof of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, TCR gamma chain, a TCR delta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications. The method of any one of the preceding claims, wherein the TFP includes a transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, TCR gamma chain, a TCR delta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications. The method of any one of the preceding claims, wherein the TCR intracellular domain comprises an intracellular domain of TCR alpha, TCR beta, TCR delta, or TCR gamma, or an amino acid sequence having at least one modification thereto. The method of any one of the preceding claims, wherein the TCR intracellular domain comprises a stimulatory domain from an intracellular signaling domain of CD3 gamma, CD3 delta, or CD3 epsilon, or an amino acid sequence having at least one modification thereto. The method of any one of the preceding claims, wherein the antibody domain is connected to the TCR extracellular domain by a linker sequence. The method of claim 87, wherein the linker sequence is 120 amino acids in length or less. The method of claim 87, wherein the linker sequence comprises (G4S)n, wherein G is glycine, S is serine, and n is an integer from 1 to 10, e.g., 1 to 4.
The method of any one of the preceding claims, wherein at least two or three of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular do-main are from a same TCR subunit. The method of any one of the preceding claims, wherein at least two of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain are from the same TCR subunit. The method of claim 91, wherein at least two of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain are from CD3 epsilon. The method of claim 91, wherein at least two of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain are from CD3 delta. The method of claim 91, wherein at least of two of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain are from CD3 gamma. The method of any one of the preceding claims, wherein all three of the TCR extracellular domain, the TCR transmembrane domain, and the TCR intracellular domain are from the same TCR subunit. The method of claim 95, wherein the TCR subunit comprises the amino acid sequence of SEQ ID NO: 49. The method of claim 95, wherein the TCR subunit comprises the amino acid sequence of SEQ ID NO: 50. The method of claim 95, wherein the TCR subunit comprises the amino acid sequence of SEQ ID NO: 51. The method of claim 95, wherein the TFP comprises the amino acid sequence of SEQ ID NO: 52. . The method of any one of the preceding claims, wherein the anti-MSLN TFP T cells are human T cells. . The method of any one of the preceding claims, wherein the anti-MSLN TFP T cells are CD8+ T cells or CD4+ T cells. . The method of any one of the preceding claims, wherein the anti-MSLN TFP T cells are alpha beta T cells or gamma delta T cells. . The method of any one of the preceding claims, wherein the anti-MSLN TFP T cells are autologous or allogeneic T cells. . The method of any one of claims 1-103, wherein the method further comprises obtaining a population of cells from the human subject prior to administering the first portion of a dose of the anti-MSLN TFP T cells, and transducing T cells from the population of cells with a
- 182 -
recombinant nucleic acid comprising a sequence encoding the TFP, thereby generating the anti- MSLN TFP T cells. The method of any one of claims 1-104, wherein the method further comprises identifying the human subject as having a MSLN-expressing cancer. The method of any one of claims 1-105, wherein the method does not induce cytokine release syndrome (CRS) above grade 1, above grade 2, or above grade 3. The method of any one of claims 1-106, wherein the MSLN-expressing cancer is mesothelioma. The method of any one of claims 1-106, wherein the MSLN-expressing cancer is malignant pleural mesothelioma (MPM). The method of any one of claims 1-106, wherein the MSLN-expressing cancer is ovarian adenocarcinoma. The method of any one of claims 1-106, wherein the MSLN-expressing cancer is cholangiocarcinoma. The method of any one of claims 1-106, wherein the MSLN-expressing cancer is non-small cell lung cancer (NSCLC). The method of any one of claims 1-106, wherein the MSLN-expressing cancer is selected from the group consisting of squamous carcinoma, adenocarcinoma, sarcomata, endometrial cancer, breast cancer, ovarian cancer, cervical cancer, fallopian tube cancer, primary peritoneal cancer, colon cancer, colorectal cancer, melanoma, renal cell carcinoma, lung cancer, non-small cell lung cancer, stomach cancer, bladder cancer, gall bladder cancer, liver cancer, thyroid cancer, laryngeal cancer, salivary gland cancer, esophageal cancer, head and neck cancer, glioblastoma, glioma, prostate cancer, pancreatic cancer, mesothelioma, sarcoma, hematological cancer, leukemia, lymphoma, neuroma, and any combinations thereof. The method of any one of claims 1-5 and 7-112, wherein the method comprises administering one or more additional doses of anti-MSLN TFP T cells after the second portion of a dose. The method of any one of claims 1-113, wherein the anti-MSLN TFP T cells are administered via intravenous infusion. The method of any one of claims 1-114, wherein the human subject is at risk of recurrence. The method of any one of claims 1-115, wherein the human subject has a prior history of recurrence after a prior therapy. The method of any one of claims 1-116, wherein the MSLN-expressing cancer is locally advanced. The method of any one of claims 1-117, wherein the MSLN-expressing cancer is metastatic.
- 183 -
. A method for the treatment of a mesothelin (MSLN)-expressing cancer in a human subject in need thereof, the method comprising administering to the human subject a dose of transduced anti-MSLN T cell receptor fusion protein (TFP) T cells comprising a recombinant nucleic acid comprising a sequence encoding a TFP comprising:
(I) a TCR subunit comprising
(i) at least a portion of a TCR extracellular domain,
(ii) a TCR transmembrane domain, and
(iii) a TCR intracellular domain; and
(II) an antibody domain comprising an anti-MSLN antigen binding domain; wherein the dose of anti-MSLN TFP T cells is about 1 x 108 transduced cells/m2, and wherein the human subject has received at least 5 prior lines of therapy prior to administering the dose.
- 184 -
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202163244969P | 2021-09-16 | 2021-09-16 | |
US63/244,969 | 2021-09-16 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2023044039A1 true WO2023044039A1 (en) | 2023-03-23 |
Family
ID=85602041
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2022/043850 WO2023044039A1 (en) | 2021-09-16 | 2022-09-16 | Compositions and methods for treating cancer |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2023044039A1 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11965012B2 (en) | 2015-05-18 | 2024-04-23 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2013083809A1 (en) * | 2011-12-09 | 2013-06-13 | Amgen Research (Munich) Gmbh | Prevention of adverse effects caused by epcamxcd3 bispecific antibodies |
US20170224837A1 (en) * | 2016-02-10 | 2017-08-10 | Immunomedics, Inc. | Combination of abcg2 inhibitors with sacituzumab govitecan (immu-132) overcomes resistance to sn-38 in trop-2 expressing cancers |
WO2020198033A1 (en) * | 2019-03-22 | 2020-10-01 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
-
2022
- 2022-09-16 WO PCT/US2022/043850 patent/WO2023044039A1/en unknown
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2013083809A1 (en) * | 2011-12-09 | 2013-06-13 | Amgen Research (Munich) Gmbh | Prevention of adverse effects caused by epcamxcd3 bispecific antibodies |
US20170224837A1 (en) * | 2016-02-10 | 2017-08-10 | Immunomedics, Inc. | Combination of abcg2 inhibitors with sacituzumab govitecan (immu-132) overcomes resistance to sn-38 in trop-2 expressing cancers |
WO2020198033A1 (en) * | 2019-03-22 | 2020-10-01 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11965012B2 (en) | 2015-05-18 | 2024-04-23 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20220064316A1 (en) | Treatment of cancer using humanized anti-bcma chimeric antigen receptor | |
AU2017302668B2 (en) | Combination therapies of chimeric antigen receptors and PD-1 inhibitors | |
US20200339651A1 (en) | Methods for b cell preconditioning in car therapy | |
JP6736540B2 (en) | Treatment of cancer using CLL-1 chimeric antigen receptor | |
CN107580628B (en) | Targeted cytotoxic cells with chimeric receptors for adoptive immunotherapy | |
ES2781175T3 (en) | Optimized subset of T cells containing a chimeric antigen receptor | |
US20220362295A1 (en) | Compositions and methods for tcr reprogramming using fusion proteins | |
CN105358576B (en) | Treatment of cancer using humanized anti-EGFRvIII chimeric antigen receptors | |
CN105392888B (en) | Treatment of cancer using humanized anti-CD 19 chimeric antigen receptor | |
KR20210020932A (en) | BCMA chimeric antigen receptor and uses thereof | |
EP3856779A1 (en) | Cd22 chimeric antigen receptor (car) therapies | |
US20220347214A1 (en) | Compositions and methods for tcr reprogramming using fusion proteins | |
WO2022056321A1 (en) | Compositions and methods for tcr reprogramming using gpc3 specific fusion proteins | |
WO2022020720A1 (en) | Compositions and methods for treating cancer | |
WO2022056304A1 (en) | Compositions and methods for tcr reprogramming using nectin-4 specific fusion proteins | |
WO2023044039A1 (en) | Compositions and methods for treating cancer | |
WO2021226289A2 (en) | Compositions and methods for tcr reprogramming using cd70 specific fusion proteins | |
US20230065936A1 (en) | Compositions and methods for treating cancer | |
WO2023060231A1 (en) | Compositions and methods for treating cancer using tcr fusion proteins in a combination therapy | |
WO2023235479A1 (en) | Compositions and methods for treating cancer | |
WO2023086379A2 (en) | Compositions and methods for tcr reprogramming using fusion proteins | |
WO2023172967A2 (en) | Compositions and methods for tcr reprogramming using gpc3 specific fusion proteins | |
Devenport | The Biomedical Application of Chimeric Antigen Receptor T cell Therapy | |
WO2023034220A2 (en) | Compositions and methods for tcr reprogramming using fusion proteins and cxcr6 | |
IL302700A (en) | Combination therapies with chimeric antigen receptor (car)-expressing cells |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22870769 Country of ref document: EP Kind code of ref document: A1 |