WO2023023131A2 - Activatable inteferon polypeptides and methods of use thereof - Google Patents
Activatable inteferon polypeptides and methods of use thereof Download PDFInfo
- Publication number
- WO2023023131A2 WO2023023131A2 PCT/US2022/040564 US2022040564W WO2023023131A2 WO 2023023131 A2 WO2023023131 A2 WO 2023023131A2 US 2022040564 W US2022040564 W US 2022040564W WO 2023023131 A2 WO2023023131 A2 WO 2023023131A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- ifn
- prodrug
- inducible
- polypeptide
- protease
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/21—Interferons [IFN]
- A61K38/217—IFN-gamma
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/21—Interferons [IFN]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/21—Interferons [IFN]
- A61K38/212—IFN-alpha
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/21—Interferons [IFN]
- A61K38/215—IFN-beta
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/6425—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the peptide or protein in the drug conjugate being a receptor, e.g. CD4, a cell surface antigen, i.e. not a peptide ligand targeting the antigen, or a cell surface determinant, i.e. a part of the surface of a cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/643—Albumins, e.g. HSA, BSA, ovalbumin or a Keyhole Limpet Hemocyanin [KHL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/644—Transferrin, e.g. a lactoferrin or ovotransferrin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/65—Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6889—Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/555—Interferons [IFN]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/555—Interferons [IFN]
- C07K14/56—IFN-alpha
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
Definitions
- Interferons are a family of related signal proteins grouped in three major types, alpha, beta and gamma. Upon binding to specific receptors they lead to the activation of a signal transduction pathway that activates a broad range of genes, that are now known involved not only in antiviral but also in immunomodulatory and antiproliferative activities.
- IFN are a potent immune antagonist and has been considered a promising therapeutic agent for oncology.
- IFN have shown to have a narrow therapeutic window because they are highly potent and have a short serum half-life. Consequently, therapeutic administration of IFN produce undesirable systemic effects and toxicities. This is exacerbated by the need to administer large quantities of cytokines (i.e., IFN) in order to achieve the desired levels of cytokine at the intended site of cytokine action (e.g., a tumor microenvironment).
- cytokines i.e., IFN
- Inducible IFN protein constructs have been described in International Application Nos. PCT/US2019/032320 and PCT/US2020/060624 to overcome the toxicity and short half-life problems that have limited clinical use of IFN in oncology.
- the previously described inducible IFN polypeptide constructs comprise a polypeptide chain containing IFN and a human serum albumin or an antigen binding polypeptide that binds human serum albumin that also is capable of extending the half-life.
- the disclosure relates to inducible IFN prodrugs that contain at least one polypeptide chain, and can contain two or more polypeptides, if desired.
- the inducible IFN prodrug comprises a IFN polypeptide, a blocking element, a protease cleavable linker, and a half-life extension element.
- IFNs include IFN-alpha (e.g., human IFN-alphal, human IFN- alpha2, human IFN-alpha4, human IFN-alpha5, human IFN-alpha6, human IFN-alpha7, human IFN-alpha8, human IFN-alphalO, human IFN-alphal3, human IFN-alphal4, human IFN- alphal6, human IFN-alphal7, human IFN-alpha2), IFN-beta, IFN-kappa, or IFN-epsilon, and functional fragments or muteins of any of the foregoing.
- the IFN can be IFN alpha, IFN beta, IFN gamma, a mutein, or an active fragment of the foregoing.
- a preferred IFN is IFN alpha.
- Inducible IFN prodrugs of this disclosure have attenuated IFN receptor agonist activity and the circulating half-life is extended.
- the inducible IFN receptor agonist activity is attenuated through the blocking element.
- the half-life extension element can also contribute to attenuation, for example through steric effects.
- the blocking element is capable of blocking all or some of the receptor agonist activity of the IFN by noncovalently binding to the IFN and/or sterically blocking receptor binding. Upon cleavage of the protease cleavable linker a form of the IFN is released that is active (e.g., more active than the IFN polypeptide prodrug).
- the released IFN is at least 10 x more active than the IFN polypeptide prodrug.
- the released IFN is at least 20 x, at least 30 x, at least 50 x, at least 100 x, at least 200 x, at least 300 x, at least 500 x, at least 1000 x, at least about 10,000X or more active than the inducible IFN prodrug.
- the form of cytokine that is released upon cleavage of the inducible cytokine prodrug typically has a short half-life, which is often substantially similar to the half-life of naturally occurring cytokine. Even though the half-life of the inducible cytokine prodrug is extended, toxicity is reduced or eliminated because the agonist activity of the circulating inducible cytokine prodrug is attenuated and active cytokine is targeted to the desired site of activity (e.g., tumor microenvironment).
- the inducible IFN prodrug can comprise at least one of each of a IFN polypeptide [A], a IFN blocking element [D], a half-life extension element [H], and a protease-cleavable polypeptide linker [L],
- the IFN polypeptide and the IFN blocking element or the half-life extension element can be operably linked by the protease-cleavable polypeptide linker and the inducible IFN prodrug has attenuated IFN receptor activating activity.
- the IFN receptor activating activity of the inducible IFN prodrug is at least about 10X less than the IFN receptor activating activity of the polypeptide that contains the IFN polypeptide that is produced by cleavage of the protease cleavable linker.
- the inducible IFN prodrug of can have the formula: [010] [A]-[L1]-[H]-[L2]-[D]
- [A] is a IFN polypeptide
- [D] is a blocking element
- [H] is a half-life extension element
- [LI] is a protease-cleavable polypeptide linker
- [L2] is a polypeptide linker that is optionally protease-cleavable
- [L2’] is a protease-cleavable polypeptide linker.
- the half-life extension element can comprises a serum albumin binding domain, a serum albumin, transferrin, or immunoglobulin Fc, or fragment thereof.
- the half-life extension element can also a blocking element.
- the blocking element comprises a ligand-binding domain or fragment of a cognate receptor for the IFN, an antibody or antigen-binding fragment of an antibody that binds to the IFN polypeptide.
- the antibody or antigen-binding fragment can be a single domain antibody, a Fab, or a scFv that binds the IFN polypeptide.
- the cognate receptor for the IFN can be the IFN- a/p receptor.
- the cognate receptor for IFN can be the IFNAR1 chain or the IFNAR2 chain.
- the IFN blocking element inhibits activation of the IFN receptor by the inducible IFN prodrug.
- Each protease-cleavable polypeptide linker independently comprises a sequence that is capable of being cleaved by a protease selected from the group consisting of a kallikrein, thrombin, chymase, carboxypeptidase A, cathepsin G, cathepsin L, an elastase, PR-3, granzyme M, a calpain, a matrix metalloproteinase (MMP), an ADAM, a FAP, a plasminogen activator, a cathepsin, a caspase, a tryptase, and a tumor cell surface protease.
- L2 can be a protease-cleavable polypeptide linker. LI or L2 or both LI and L2 can cleaved by two or more different proteases.
- the cathepsin is cathepsin B, cathepsin C, cathepsin D, cathepsin E, cathepsin K, cathepsin L, cathepsin S, or cathepsin G.
- the matrix metalloprotease (MMP) can be MMP1, MMP2, MMP3, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13, MMP14, MMP19, or MMP20.
- the disclosure also relates to a nucleic acid encoding the inducible IFN prodrug disclosed herein. Also provided herein is a vector comprising the nucleic acid and a host cell comprising the vector. [022] The disclosure also relates to a pharmaceutical composition that contains the inducible IFN prodrug disclosed herein. Disclosed herein are methods of making the pharmaceutical composition comprising culturing the host cell under suitable conditions for expression and collection of the inducible IFN prodrug.
- the disclosure also relates to therapeutic methods that include administering to a subject in need thereof an effective amount of a inducible IFN prodrug, nucleic acid that encodes the inducible IFN prodrug, vector or host cells that contain such a nucleic acid, and pharmaceutical compositions of any of the foregoing.
- the subject has, or is at risk of developing cancer, a proliferative disease, a tumorous disease, an inflammatory disease, an immunological disorder, an autoimmune disease, an infectious disease, a viral disease, an allergic reaction, a parasitic reaction, a graft-versus-host disease or a host-versus-graft disease.
- the methods disclosed herein are particularly suitable for treating cancer.
- the inducible IFN prodrug can be administered intravenously.
- FIGS. 1A-1C depicts a graph showing activity of IFN inducible polypeptide, WW0888, having an antibody blocking element in an HEKBlue IFN reporter assay (FIG. 1 A), SDS-PAGE (FIG. IB), and a SEC analysis (FIG. 1C).
- FIG. 1A depicts activation of the IFN-a/p pathway in a comparison of WW0888 to human IFNalpha (control). Squares depict activity of the uncut WW0888 polypeptide (intact) and diamonds depict the activity of the cut polypeptide (cleaved). Circles depict activity of the control (human IFNalpha). EC50 values for each are shown in the table.
- FIG. IB shows results of protein cleavage assay. Fusion protein WW0888 was run on an SDS-PAGE gel in both cleaved and uncleaved form. As can be seen in the gel.
- FIG. 1C shows a graph from a SEC analysis of WW0888. [026] FIGS. 2A-2C depicts a graph showing activity of IFN inducible IFN prodrug, WW0889/890, having an antibody blocking element in an HEKBlue IFN reporter assay (FIG.
- FIG. 2A depicts activation of the IFN-a/p pathway in a comparison of WW0889/890 to human IFNalpha (control). Squares depict activity of the uncut WW0889/890 polypeptide (intact) and diamonds depict the activity of the cut polypeptide (cleaved). Circles depict activity of the control (human IFNalpha2b). EC50 values for each are shown in the table. Analysis was performed based on quantification of Secreted Alkaline Phosphatase (SEAP) activity using the reagent QUANTI-Blue® (InvivoGen). Results confirm that WW0889/890 was active and inducible.
- SEAP Secreted Alkaline Phosphatase
- FIG. 2B shows results of protein cleavage assay.
- WW0889/890 was run on an SDS-PAGE gel in both cleaved and uncleaved form. As can be seen in the gel, cleavage was complete.
- FIG. 2C shows a graph from a SEC analysis of WW0889/890.
- FIGS. 3A-3C depicts a graph showing activity of IFN inducible prodrug, WW0891/892, having an antibody blocking element in an HEKBlue IFN reporter assay (FIG. 3 A), SDS-PAGE (FIG. 3B), and a SEC analysis (FIG. 3C).
- FIG. 3A depicts activation of the IFN-a/p pathway in a comparison of WW0891/892 to human IFNalpha2b (control). Squares depict activity of the uncut WW0891/892 polypeptide (intact) and diamonds depict the activity of the cut polypeptide (cleaved). Circles depict activity of the control (human IFNalpha). EC50 values for each are shown in the table.
- FIG. 3B shows results of protein cleavage assay. WW089 1/892 was run on an SDS-PAGE gel in both cleaved and uncleaved form. As can be seen in the gel, cleavage was complete.
- FIG. 3C shows a graph from a SEC analysis of WW0891/892.
- FIGS. 4A-4C depicts a graph showing activity of IFN inducible polypeptide, WW0894, having an IFNa2b receptor 1(R1) blocking element in an HEKBlue IFN reporter assay (FIG. 4A), SDS-PAGE (FIG. 4B), and a SEC analysis (FIG. 4C).
- FIG. 4A depicts activation of the IFN-a/p pathway in a comparison of WW0894 to human IFNalpha2b (control). Squares depict activity of the uncut WW0894 polypeptide (intact) and triangles depict the activity of the cut polypeptide (cleaved). Circles depict activity of the control (human IFNalpha). EC50 values for each are shown in the table.
- FIG. 4B shows results of protein cleavage assay. Fusion protein WW0894 was run on an SDS-PAGE gel in both cleaved and uncleaved form. As can be seen in the gel, cleavage was complete.
- FIG. 4C shows a graph from a SEC analysis of WW0894.
- FIGS. 5A-5C depicts a graph showing activity of IFN inducible polypeptide, WW0893, having an IFNa2b receptor 2, (R2) blocking element in an HEKBlue IFN reporter assay (FIG. 5A), SDS-PAGE (FIG. 5B), and a SEC analysis (FIG. 5C).
- FIG. 5A depicts activation of the IFN-a/p pathway in a comparison of WW0893 to human IFNalpha (control). Squares depict activity of the uncut WW0893 polypeptide (intact) and triangles depict the activity of the cut polypeptide (cleaved). Circles depict activity of the control (human IFNalpha). EC50 values for each are shown in the table.
- FIG. 5B shows results of protein cleavage assay. Fusion protein WW0893 was run on an SDS-PAGE gel in both cleaved and uncleaved form. As can be seen in the gel, cleavage was complete.
- FIG. 5C shows a graph from a SEC analysis of WW0893.
- FIGS. 6A-6C depicts a graph showing activity of IFN inducible polypeptide, WW0895, having an IFNa2b receptor 1, (Rl) blocking element in an HEKBlue IFN reporter assay (FIG. 6A), SDS-PAGE (FIG. 6B), and a SEC analysis (FIG. 6C).
- FIG. 6A depicts activation of the IFN-a/p pathway in a comparison of WW0895 to human IFNalpha (control). Squares depict activity of the uncut WW0895 polypeptide (intact) and triangles depict the activity of the cut polypeptide (cleaved). Circles depict activity of the control (human IFNalpha). EC50 values for each are shown in the table.
- FIG. 6B shows results of protein cleavage assay. Fusion protein WW0895 was run on an SDS-PAGE gel in both cleaved and uncleaved form. As can be seen in the gel, cleavage was complete.
- FIG. 6C shows a graph from a SEC analysis of WW0895.
- FIGS. 7A-7C depicts a graph showing activity of IFN inducible polypeptide, WW0896, having an IFNa2b receptor 1 and 2 (Rl and R2) blocking elements in an HEKBlue IFN reporter assay (FIG. 7A), SDS-PAGE (FIG. 7B), and a SEC analysis (FIG. 7C).
- FIG. 7A depicts activation of the IFN-a/p pathway in a comparison of WW0896 to human IFNalpha2b (control). Squares depict activity of the uncut WW0896 polypeptide (intact) and triangles depict the activity of the cut polypeptide (cleaved). Circles depict activity of the control (human IFNalpha2b).
- FIG. 7B shows results of protein cleavage assay. Fusion protein WW0896 was run on an SDS-PAGE gel in both cleaved and uncleaved form. As can be seen in the gel, cleavage was complete.
- FIG. 7C shows a graph from a SEC analysis of WW0896.
- FIGS. 8A-8C depicts a graph showing activity of IFN inducible prodrug, WW0897, having an IFNa2b receptor 1 and 2 (R1 and R2) blocking elements in an HEKBlue IFN reporter assay (FIG. 8A), SDS-PAGE (FIG. 8B), and a SEC analysis (FIG. 8C).
- FIG. 8A depicts activation of the IFN-a/p pathway in a comparison of WW0897 to human IFNalpha2b (control). Squares depict activity of the uncut WW0897 polypeptide (intact) and triangles depict the activity of the cut polypeptide (cleaved). Circles depict activity of the control (human IFNalpha2b).
- FIG. 8B shows results of protein cleavage assay. Fusion protein WW0897 was run on an SDS-PAGE gel in both cleaved and uncleaved form. As can be seen in the gel, cleavage was complete.
- FIG. 8C shows a graph from a SEC analysis of WW0897.
- FIGS. 9A-9C depicts a graph showing activity of IFN inducible prodrug, WW0898, having an IFNa2b receptor 1 and 2 (R1 and R2) blocking elements in an HEKBlue IFN reporter assay (FIG. 9A) SDS-PAGE (FIG. 9B), and a SEC analysis (FIG. 9C).
- FIG. 9A depicts activation of the IFN-a/p pathway in a comparison of WW0898 to human IFNalpha2b (control). Squares depict activity of the uncut WW0898 polypeptide (intact) and triangles depict the activity of the cut polypeptide (cleaved). Circles depict activity of the control (human IFNalpha2b).
- FIG. 9B shows results of protein cleavage assay. Fusion protein WW0898 was run on an SDS-PAGE gel in both cleaved and uncleaved form. As can be seen in the gel, cleavage was complete.
- FIG. 9C shows a graph from a SEC analysis of WW0898.
- FIG. 10 is a graph showing average MC38 tumor volumes (mm 3 ) over time after dosing in mice treated with vehicle (circles) and inducible IFN prodrug WW00901 at 75 pg (squares), 300 pg (triangles), 600 pg (star).
- FIGs. 11A-11D are graphs of MC38 tumor volume in individual mice treated with vehicle (FIG. 11 A), inducible IFN prodrug WW00901 at 75 pg (FIG. 1 IB), inducible IFN prodrug WW00901 at 300 pg (FIG. 11C), and inducible IFN prodrug WW00901 at 600 pg (FIG. 11D).
- FIG. 12 is a graph showing average body weights of mice treated with vehicle (circles) and inducible IFN prodrug WW00901 at 75 pg (squares), 300 pg (triangles), 600 pg (stars).
- FIGs. 13A-13G are a series of graphs showing activity of IFN inducible prodrugs in the B16-Blue IFN-a/p reporter assay.
- FIGs. 13A-13G depict activation of the IFN-a/p pathway in a comparison of inducible IFN prodrug to mouse INFal (control). Squares depict activity of the uncut inducible IFN prodrug (intact), and triangles (or diamonds in the case of FIG. 13 A) depict the activity of the cut inducible IFN prodrug (cleaved). Circles (filled and open) depict activity of the control (mouse IFNal).
- Each inducible IFN prodrug was run on an SDS-PAGE gel in both cleaved and uncleaved form. As can be seen in the gel, cleavage was complete.
- FIGs. 14A, 14C, 14E, 14G, 141, 14L, 14M depict graphs showing activity of IFN inducible prodrugs in an HEKBlue IFN reporter assay.
- the activity of the uncut IFN inducible prodrug intact, triangles in FIGs. 14A and 14B, and squares in FIGs. 14E, 14G, 141 and 14L
- the activity of the cut IFN inducible prodrug is shown. Circles and inverted triangles depict activity of the control (human IFNalpha2b).
- FIGs. 14B, 14D, 14F, 14H, 14J, and 14K show the results of protein cleavage assay. IFN inducible prodrugs were run on an SDS-PAGE gel in both cleaved and uncleaved form. As can be seen in the gel, cleavage was complete. 5. DETAILED DESCRIPTION
- This disclosure relates to inducible IFN polypeptides and to methods of using and compositions that contain the inducible IFN polypeptides.
- the inducible IFN polypeptides overcome the toxicity and short half-life problems that have severely limited the clinical use of cytokines in oncology.
- the inducible IFN disclosed herein comprises one or more polypeptide chains and includes an IFN polypeptide (e.g., IFN-alpha, IFN-beta, or IFN-gamma) that has receptor agonist activity of native IFN, including binding to and activating signally through a IFN receptor (e.g., IFN-a/p), a half-life extension element, an IFN blocking element, and a protease cleavable linker.
- IFN receptor e.g., IFN-a/p
- the inducible IFN in the form of a single polypeptide chain or a complex of two or more polypeptide chains, has attenuated IFN receptor activity, e.g., due to the action of the blocking element, and the circulating half-life is extended.
- the inducible IFN contain a protease cleavable linker that includes one or more protease cleave sites, which are cleaved by proteases that are associated with, and are typically enriched or selectively present in, the tumor microenvironment.
- the inducible IFNs are preferentially (or selectively) and efficiently cleaved in the tumor microenvironment to release active IFN, and to limit IFN activity substantially to the tumor microenvironment.
- the IFN that is released upon cleavage has a short half-life, which is substantially similar to the half-life of naturally occurring IFN, further restricting IFN activity to the tumor microenvironment. Even though the half-life of the inducible IFN prodrug is extended, toxicity is dramatically reduced or eliminated because the circulating prodrug has attenuated IFN activity, and active IFN is targeted to the tumor microenvironment.
- compositions that contain the inducible IFNs, as well as nucleic acids that encode the polypeptides, and recombinant expression vectors and host cells for making such inducible IFNs. Also provided herein are methods of using the disclosed inducible IFNs in the treatment of diseases, conditions, and disorders.
- the disclosure relates to inducible IFN polypeptide prodrugs that contain at least one polypeptide chain, and can contain two or more polypeptide chains, if desired.
- the inducible IFN prodrugs comprises a IFN or a mutein thereof, a half-life extension element, an IFN blocking element, and a protease cleavable linker.
- the IFN can be a Type I, Type II, or Type III IFN.
- Type I IFN examples that can be suitable include IFN-alpha (e.g., human IFN-alphal, human IFN- alpha2, human IFN-alpha4, human IFN-alpha5, human IFN-alpha6, human IFN-alpha7, human IFN-alpha8, human IFN-alphalO, human IFN-alphal3, human IFN-alphal4, human IFN- alphal 6, human IFN-alphal 7, human IFN-alpha2), IFN-beta, IFN-kappa, or IFN-epsilon. IFN- alpha and IFN-beta are preferred.
- IFN-gamma A type II IFN that is suitable for the inducible IFN polypeptide prodrugs disclosed herein is IFN-gamma.
- the inducible IFNs of this disclosure have attenuated IFN receptor agonist activity and the circulating half-life is extended.
- the IFN receptor agonist activity is attenuated through the blocking element.
- the half-life extension element can also contribute to attenuation, for example through steric effects.
- the half-life extension element can also act as a blocking element that is capable of blocking all or some of the receptor agonist activity of IFN. For instance, the half-life extension element can contribute to blocking when the half-life extension element is adjacent to the IFN polypeptide.
- the blocking element is capable of blocking all or some of the receptor agonist activity of IFN by noncovalently binding to the IFN (e.g., to IFN-alpha or IFN-beta ) and/or sterically blocking receptor binding.
- IFN e.g., to IFN-alpha or IFN-beta
- a form of IFN is released that is active (e.g., more active than the inducible IFN prodrug).
- the released IFN is at least 10 x more active than the inducible IFN prodrug.
- the released IFN is at least 20 x, at least 30 x, at least 50 x, at least 100 x, at least 200 x, at least 300 x, at least 500 x, at least 1000 x, at least about 10,000X or more active than the inducible IFN prodrug.
- the form of IFN that is released upon cleavage of the inducible IFN prodrug typically has a short half-life, which is often substantially similar to the half-life of naturally occurring IFN. Even though the half-life of the inducible IFN prodrug is extended, toxicity is reduced or eliminated because the agonist activity of the circulating inducible IFN prodrug is attenuated and active IFN is targeted to the desired site of activity (e.g., tumor microenvironment).
- the inducible IFN prodrug can comprise a single polypeptide chain.
- the single polypeptide complex comprises a IFN polypeptide or a mutein thereof [A], a blocking element [D], a half-life extension element [H], and a protease cleavable linker [L],
- the IFN [A] polypeptide can be operably linked to the blocking element, the half-life extension element or both the blocking element, the half-life extension element by a protease cleavable linker.
- the protease cleavable linker can comprise the sequence GPAGLYAQ (SEQ ID NO: 195) or ALFKSSFP (SEQ ID NO: 198).
- the single polypeptide complex can comprise a IFN polypeptide [A], a blocking element [D], a half-life extension element [H], and a protease cleavable linker having the amino acid sequence GPAGLYAQ (SEQ ID NO: 195) or ALFKSSFP (SEQ ID NO: 198) [L],
- the IFN [A] polypeptide can be operably linked to the blocking element, the half-life extension element or both the blocking element, the half-life extension element by a protease cleavable linker.
- the single polypeptide complex can comprise a IFN polypeptide [A], a blocking element [D], a half-life extension element [H], and a protease cleavable linker having the amino acid sequence GPAGLYAQ (SEQ ID NO: 195) [L],
- the IFN [A] polypeptide can be operably linked to the blocking element, the half-life extension element or both the blocking element, the halflife extension element by a protease cleavable linker.
- the single polypeptide complex can comprise a IFN polypeptide [A], a blocking element [D], a half-life extension element [H], and a protease cleavable linker having the amino acid sequence ALFKSSFP (SEQ ID NO: 198) [L],
- the IFN [A] polypeptide can be operably linked to the blocking element, the half-life extension element or both the blocking element, the half-life extension element by a protease cleavable linker.
- the IFN polypeptide and the blocking element and the half-life extension element are operably linked by the protease-cleavable polypeptide.
- the polypeptide can be of any of Formulas (I)-(IX).
- IFNAR1 INF alpha receptor 1
- IFNAR2 IFNalpha receptor 2
- [H] is a half-life extension element
- [LI] is a protease-cle
- [LI] and [L2] or [LI] and [L2’] can have the same or different amino acid sequence and or protease-cleavage site (when L2 is protease-cleavable) as desired.
- [H] can also optionally provide blocking.
- the protease cleavable linker can comprise the sequence GPAGLYAQ (SEQ ID NO: 195) or ALFKSSFP (SEQ ID NO: 198).
- the inducible IFN prodrugs disclosed herein preferably contain one half-life extension element and one blocking element
- such elements can contain two or more components that are present on the same polypeptide chain or on different polypeptide chains.
- components of the blocking element can be present on separate polypeptide chains.
- a first polypeptide chain can include an antibody light chain (VL+CL) or light chain variable domain (VL)
- a second polypeptide can include an antibody heavy chain Fab fragment (VH + CHI) or heavy chain variable domain (VH) that is complementary to the VL+ CL or VL on the first polypeptide.
- these components can associate in the peptide complex to form an antigen-binding site, such as a Fab that binds IFN (e.g., IFNalpha, IFNbeta) and attenuates IFN activity.
- the inducible IFN prodrug can have a first polypeptide of Formulas (X-XI).
- Formula X [D]-[L]-[A]-[L2]-[H] or Formula XI: [H]-[L]-[A]-[L2]-[D],
- [A] is a IFN polypeptide
- [D] is a IFN antibody heavy chain Fab fragment (VH + CHI) or heavy chain variable domain (VH)
- [H] is a half-life extension element
- [LI] is a protease-cleavable polypeptide linker
- [L2] is an polypeptide linker that is optionally protease-cleavable
- [L2’] is a protease-cleavable polypeptide linker.
- [LI] and [L2] or [LI] and [L2’] can be have the same or different amino acid sequence and or protease-cleavage site (when L2 is protease-cleavable) as desired.
- the inducible IFN prodrug can have a second polypeptide antibody light chain (VL+CL) or light chain variable domain (VL) that is complementary to the VH + CHI or VH .
- the protease cleavable linker can comprise the sequence GPAGLYAQ (SEQ ID NO: 195) or ALFKSSFP (SEQ ID NO: 198).
- the inducible IFN prodrugs can comprise or consist of the amino acid sequence of SEQ ID NOs: 1, 6-11, 12-16, 18-23, or 30-35.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 1.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 6.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 7.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 8.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 9.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 10.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 11.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 12.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 13.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 14.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 15.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 16.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 18.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 19.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 20.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 21.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 22.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 23.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 30.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 31.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 32.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 33.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 34.
- the inducible IFN prodrug can comprise the amino acid sequence of SEQ ID NO: 35.
- the inducible IFN cytokine prodrug can contain a first polypeptide that is bonded covalently or non-covalently to a second polypeptide chain.
- the second polypeptide chain can contain an antibody VL-CL that comprises or consists of the amino acid sequence of SEQ ID NO: 3 or SEQ ID NO: 5.
- Such a second polypeptide can bond with a complimentary VH-CH1 polypeptide contained within the fusion protein, e.g., as contained within SEQ ID NO: 2 or SEQ ID NO: 4.
- the inducible IFN cytokine prodrug can comprise or consist the amino acid sequence of SEQ ID NO: 2 and the second polypeptide chain can comprise or consist the amino acid sequence of SEQ ID NO: 3.
- the inducible IFN cytokine prodrug can comprise or consist the amino acid sequence of SEQ ID NO: 4 and the second polypeptide chain can comprise or consist the amino acid sequence of SEQ ID NO: 5.
- the second polypeptide chain can contain an antibody VH-CH1 that comprises or consists of the amino acid sequence of SEQ ID NO: 17.
- Such a second polypeptide can bond with complimentary VL-CL polypeptide contained within the first polypeptide chain, e.g., as contained within SEQ ID NO: 24, 25 or 28.
- the inducible IFN cytokine prodrug can include a) a first polypeptide chain that comprises or consist of the amino acid sequence of SEQ ID NO: 24 and b) a second polypeptide chain that comprises or consists of the amino acid sequence of SEQ ID NO: 17.
- the inducible IFN cytokine prodrug can include a) a first polypeptide chain that comprises or consists the amino acid sequence of SEQ ID NO: 25 and b) a second polypeptide chain that comprises or consists of the amino acid sequence of SEQ ID NO: 17.
- the inducible IFN cytokine prodrug can include a) a first polypeptide chain that comprises or consists the amino acid sequence of SEQ ID NO: 28 and b) a second polypeptide chain that comprises or consists of the amino acid sequence of SEQ ID NO: 17.
- the inducible IFN cytokine prodrug can comprise a first polypeptide chain that comprises an IFN polypeptide and an antibody light chain (VL+CL) or light chain variable domain (VL) and a second polypeptide can include a half-life extension element and an antibody heavy chain Fab fragment (VH + CHI) or heavy chain variable domain (VH) that is complementary to the VL+ CL or VL on the first polypeptide.
- the inducible IFN cytokine prodrug can include a) a first polypeptide that comprises or consists of the amino acid sequence of SEQ ID NO: 26, and b) a second polypeptide chain that comprises or consists of the amino acid sequence of SEQ ID NO. 27.
- the inducible IFN cytokine prodrug can include a) a first polypeptide that comprises or consists of the amino acid sequence of SEQ ID NO: 26, and b) a second polypeptide chain that comprises or consists of the amino acid sequence of SEQ ID NO. 29.
- the inducible IFN cytokine prodrug can comprise a first polypeptide chain that comprises an IFN polypeptide and an antibody heavy chain Fab fragment (VH + CHI) or heavy chain variable domain (VH) and a second polypeptide can include a half-life extension element and an antibody light chain (VL+CL) or light chain variable domain (VL) that is complementary to the VH+ CHI or VH on the first polypeptide.
- the half-life extension element increases the in vivo half-life and provides altered pharmacodynamics and pharmacokinetics of the inducible IFN prodrugs.
- the half-life extension element alters pharmacodynamics properties including alteration of tissue distribution, penetration, and diffusion of the inducible IFN prodrug.
- the half-life extension element can improve tissue targeting, tissue penetration, diffusion within the tissue, and enhanced efficacy as compared with a protein without a half-life extension element.
- an exemplary way to improve the pharmacokinetics of a polypeptide is by expression of an element in the polypeptide chain that binds to receptors that are recycled to the plasma membrane of cells rather than degraded in the lysosomes, such as the FcRn receptor on endothelial cells and transferrin receptor.
- an element in the polypeptide chain that binds to receptors that are recycled to the plasma membrane of cells rather than degraded in the lysosomes, such as the FcRn receptor on endothelial cells and transferrin receptor.
- Three types of proteins, e.g., human IgGs, HSA (or fragments), and transferrin persist for much longer in human serum than would be predicted just by their size, which is a function of their ability to bind to receptors that are recycled rather than degraded in the lysosome.
- HSA may also be directly bound to the pharmaceutical compositions or bound via a short linker. Fragments of HSA may also be used. HSA and fragments thereof can function as both a blocking element and a half-life extension element. Human IgGs and Fc fragments can also carry out a similar function.
- the serum half-life extension element can also be an antigen-binding polypeptide that binds to a protein with a long serum half-life such as serum albumin, transferrin and the like.
- polypeptides include antibodies and fragments thereof including, a polyclonal antibody, a recombinant antibody, a human antibody, a humanized antibody a single chain variable fragment (scFv), an antigen binding fragment (Fab), single-domain antibody such as a heavy chain variable domain (VH), a light chain variable domain (VL) and a variable domain of camelid-type nanobody (VHH), a dAb and the like.
- antigen-binding domain include non-immunoglobulin proteins that mimic antibody binding and/or structure such as, anticalins, affilins, affibody molecules, affimers, affitins, alphabodies, avimers, DARPins, fynomers, kunitz domain peptides, monobodies, and binding domains based on other engineered scaffolds such as SpA, GroEL, fibronectin, lipocallin and CTLA4 scaffolds.
- non-immunoglobulin proteins that mimic antibody binding and/or structure such as, anticalins, affilins, affibody molecules, affimers, affitins, alphabodies, avimers, DARPins, fynomers, kunitz domain peptides, monobodies, and binding domains based on other engineered scaffolds such as SpA, GroEL, fibronectin, lipocallin and CTLA4 scaffolds.
- antigen-binding polypeptides include a ligand for a desired receptor, a ligand-binding portion of a receptor, a lectin, and peptides that binds to or associates with one or more target antigens.
- the antibodies and fragments thereof can function as both a blocking element and a half-life extension element.
- the half-life extension element can also function as both a blocking element and a halflife extension element.
- the half-life extension element e.g., anti-HSA
- the half-life extension element can function as a blocking element when adjacent to the IFN polypeptide.
- the half-life extension element as provided herein is preferably a human serum albumin (HSA) binding domain, and antigen binding polypeptide that binds human serum albumin or an immunoglobulin Fc or fragment thereof.
- HSA human serum albumin
- the half-life extension element of a inducible IFN prodrug extends the half-life of the inducible IFN prodrug by at least about two days, about three days, about four days, about five days, about six days, about seven days, about eight days, about nine days, about 10 days or more.
- the blocking element can be any element that binds to IFN and/or inhibits the ability of the IFN polypeptide to bind and activate its receptor.
- the blocking element can inhibit the ability of the IFN to bind and/or activate its receptor e.g., by sterically blocking and/or by noncovalently binding to the inducible IFN prodrug.
- IFN-alpha e.g., human IFN-alphal, human IFN-alpha2, human IFN-alpha4, human IFN- alpha5, human IFN-alpha6, human IFN-alpha7, human IFN-alpha8, human IFN-alphal 0, human IFN-alphal3, human IFN-alphal4, human IFN-alphal6, human IFN-alphal7, human IFN- alpha
- IFN-beta IFN-gamma
- blocking elements include the full length or an IFN-binding fragment or mutein of the cognate receptor of an IFN.
- the cognate receptor for IFN can be the IFNGR receptor or a portion thereof.
- the blocking element can be the extracellular portion of the INF alpha receptor 1 (IFNAR1) or interferon binding portion or mutein thereof, or the extracellular portion of the IFNalpha receptor 2 (IFNAR2) or interferon binding portion or mutein thereof.
- the blocking element can be the extracelluar portion of the IFNgamma receptor 1 (IFNGR1) or interferon binding portion or mutein thereof, or the extracellular portion of the IFNgamma receptor 2 (IFNGR2) or interferon binding portion or mutein thereof.
- IFNGR1 IFNgamma receptor 1
- IFNGR2 IFNgamma receptor 2
- Antibodies and antigen-binding fragments thereof including, an antigen-binding fragment (Fab), a polyclonal antibody, a recombinant antibody, a human antibody, a humanized antibody a single chain variable fragment (scFv), single-domain antibody such as a heavy chain variable domain (VH), a light chain variable domain (VL) and a variable domain of camelid-type nanobody (VHH), a dAb and the like that bind IFN can also be used.
- Fab antigen-binding fragment
- scFv single chain variable fragment
- VH heavy chain variable domain
- VL light chain variable domain
- VHH camelid-type nanobody
- Suitable antigenbinding domain that bind IFN can also be used, include non-immunoglobulin proteins that mimic antibody binding and/or structure such as, anticalins, affilins, affibody molecules, affimers, affitins, alphabodies, avimers, DARPins, fynomers, kunitz domain peptides, monobodies, and binding domains based on other engineered scaffolds such as SpA, GroEL, fibronectin, lipocallin and CTLA4 scaffolds.
- suitable blocking polypeptides include polypeptides that sterically inhibit or block binding of IFN to its cognate receptor.
- moieties can also function as half-life extending elements.
- a peptide that is modified by conjugation to a water-soluble polymer can sterically inhibit or prevent binding of the cytokine to its receptor.
- a water-soluble polymer such as PEG
- Polypeptides, or fragments thereof, that have long serum half-lives can also be used, such as serum albumin (human serum albumin), immunoglobulin Fc, transferrin and the like, as well as fragments and muteins of such polypeptides.
- IFN blocking elements that are particularly suitable are single chain variable fragments (scFv) or Fab fragments.
- an inducible IFN polypeptide that contains a blocking element having specificity for IFN and further contains a half-life extension element.
- the blocking element can contain two or more components that are present on the same polypeptide chain or on separate polypeptide chains.
- a first polypeptide chain can include an antibody light chain (VL+CL) or light chain variable domain (VL) and a second polypeptide can include an antibody heavy chain Fab fragment (VH + CHI) or heavy chain variable domain (VH) that is complementary to the VL+ CL or VL on the first polypeptide.
- these components can associate in the peptide complex to form an antigen-binding site, such as a Fab that binds IFN (e.g., IFNalpha, IFNbeta) and attenuates IFN activity.
- the inducible IFN prodrug comprises one or more linker sequences.
- a linker sequence serves to provide flexibility between the polypeptides, such that, for example, the blocking element is capable of inhibiting the activity of IFN.
- the linker can be located between the IFN subunit, the half-life extension element, and/or the blocking element.
- the inducible IFN prodrug comprises a protease cleavable linker.
- the protease cleavable linker can comprise one or more cleavage sites for one or more desired protease.
- the desired protease is enriched or selectively expressed at the desired target site of IFN activity (e.g., the tumor microenvironment).
- the inducible IFN prodrug is preferentially or selectively cleaved at the target site of desired IFN activity.
- Suitable linkers are typically less than about 100 amino acids. Such linkers can be of different lengths, such as from 1 amino acid (e.g., Gly) to 30 amino acids, from 1 amino acid to 40 amino acids, from 1 amino acid to 50 amino acids, from 1 amino acid to 60 amino acids, from 1 to 70 amino acids, from 1 to 80 amino acids, from 1 to 90 amino acids, and from 1 to 100 amino acids.
- the linker is at least about 1, about 2, about 3, about 4, about 5, about 10, about 15, about 20, about 25, about 30, about 35, about 40, about 45, about 50, about 55, about 60, about 65, about 70, about 75, about 80, about 85, about 90, about 95, or about 100 amino acids in length.
- Preferred linkers are typically from about 5 amino acids to about 30 amino acids.
- the lengths of linkers vary from 2 to 30 amino acids, optimized for each condition so that the linker does not impose any constraints on the conformation or interactions of the linked domain.
- the linker is cleavable by a cleaving agent, e.g., an enzyme.
- the linker comprises a protease cleavage site.
- the linker comprises one or more cleavage sites.
- the linker can comprise a single protease cleavage site.
- the linker can also comprise 2 or more protease cleavage sites. For example, 2 cleavage sites, 3 cleavage sites, 4, cleavage sites, 5 cleavage sites, or more.
- the linker comprises 2 or more protease cleavage sites
- the cleavage sites can be cleaved by the same protease or different proteases.
- a linker comprising two or more cleavage sites is referred to as a “tandem linker.”
- the two or more cleavage sites can be arranged in any desired orientation, including, but not limited tom one cleavage site adjacent to another cleavage site, one cleavage site overlapping another cleavage site, or one cleavage site following by another cleavage site with intervening amino acids between the two cleavage sites.
- protease-cleavable linkers that are preferentially cleaved at a desired location in the body, such as the tumor microenvironment, relative to the peripheral circulation.
- the rate at which the protease-cleavable linker is cleaved in the tumor microenvironment can be at least about 10 times, at least about 100 times, at least about 1000 times or at least about 10,000 times faster in the desired location in the body, e.g., the tumor microenvironment, in comparison to in the peripheral circulation (e.g., in plasma).
- Proteases known to be associated with diseased cells or tissues include but are not limited to serine proteases, cysteine proteases, aspartate proteases, threonine proteases, glutamic acid proteases, metalloproteases, asparagine peptide lyases, serum proteases, cathepsins, Cathepsin B, Cathepsin C, Cathepsin D, Cathepsin E, Cathepsin G, Cathepsin S, Cathepsin K, Cathepsin L, kallikreins, hKl, hK10, hK15, plasmin, collagenase, Type IV collagenase, stromelysin, Factor Xa, chymotrypsin-like protease, trypsin-like protease, elastase-like protease, sub tili sin-like protease, actinidain
- Proteases capable of cleaving linker amino acid sequences can, for example, be selected from the group consisting of a prostate specific antigen (PSA), a matrix metalloproteinase (MMP), an A Disintigrin and a Metalloproteinase (ADAM), a plasminogen activator, a cathepsin, a caspase, a tumor cell surface protease, and an elastase.
- PSA prostate specific antigen
- MMP matrix metalloproteinase
- ADAM Metalloproteinase
- a plasminogen activator a cathepsin, a caspase, a tumor cell surface protease, and an elastase.
- the MMP can, for example, be matrix metalloproteinase 2 (MMP2), matrix metalloproteinase 9 (MMP9), matrix metalloproteinase 14 (MMP 14), matrix metalloproteinase 19 (MMP 19), or matrix metalloproteinase 20 (MMP20).
- MMP2 matrix metalloproteinase 2
- MMP9 matrix metalloproteinase 9
- MMP 14 matrix metalloproteinase 14
- MMP 19 matrix metalloproteinase 19
- MMP20 matrix metalloproteinase 20
- the linker can be cleaved by a cathepsin, such as, Cathepsin B, Cathepsin C, Cathepsin D, Cathepsin S, Cathepsin E, Cathepsin G, Cathepsin K and/or Cathepsin L.
- the linker can be cleaved by MMP14 or Cathepsin
- Proteases useful for cleavage of linkers and for use in the IFN polypeptide prodrug disclosed herein are presented in Table 1, and exemplary proteases and their cleavage site are presented in Table 2.
- Exemplary protease cleavable linkers include, but are not limited to kallikrein cleavable linkers, thrombin cleavable linkers, chymase cleavable linkers, carboxypeptidase A cleavable linkers, cathepsin cleavable linkers, elastase cleavable linkers, FAP cleavable linkers, ADAM cleavable linkers, PR-3 cleavable linkers, granzyme M cleavable linkers, a calpain cleavable linkers, a matrix metalloproteinase (MMP) cleavable linkers, a plasminogen activator cleavable linkers, a caspase cleavable linkers, a tryptase cleavable linkers, or a tumor cell surface protease.
- MMP matrix metalloproteinase
- MMP9 cleavable linkers Specifically, MMP9 cleavable linkers, ADAM cleavable linkers, CTSL1 cleavable linkers, FAPa cleavable linkers, and cathepsin cleavable linkers.
- Some preferred protease-cleavable linkers are cleaved by a MMP and/or a cathepsin.
- the linker sequences disclosed herein are typically less than 100 amino acids. Such linker sequences can be of different lengths, such as from 1 amino acid (e.g., Gly) to 30 amino acids, from 1 amino acid to 40 amino acids, from 1 amino acid to 50 amino acids, from 1 amino acid to 60 amino acids, from 1 to 70 amino acids, from 1 to 80 amino acids, from 1 to 90 amino acids, and from 1 to 100 amino acids.
- the linker is at least about 1, about 2, about 3, about 4, about 5, about 10, about 15, about 20, about 25, about 30, about 35, about 40, about 45, about 50, about 55, about 60, about 65, about 70, about 75, about 80, about 85, about 90, about 95, or about 100 amino acids in length.
- Preferred linkers are typically from about 5 amino acids to about 30 amino acids.
- the lengths of linkers vary from 2 to 30 amino acids, optimized for each condition so that the linker does not impose any constraints on the conformation or interactions of the linked domains.
- the linker comprises the sequence GPAGLYAQ (SEQ ID NO: 195); GPAGMKGL (SEQ ID NO: 196); PGGPAGIG (SEQ ID NO: 197); ALFKSSFP (SEQ ID NO: 198); ALFFSSPP (SEQ ID NO: 199); LAQRLRSS (SEQ ID NO: 200); LAQKLKSS (SEQ ID NO; 201); GALFKSSFPSGGGPAGLYAQGGSGKGGSGK (SEQ ID NO: 202);
- RGSGGGPAGLYAQGSGGGPAGLYAQGGSGK (SEQ ID NO: 203); KGGGPAGLYAQGPAGLYAQGPAGLYAQGSR (SEQ ID NO: 204); RGGPAGLYAQGGPAGLYAQGGGPAGLYAQK (SEQ ID NO: 205); KGGALFKSSFPGGPAGIGPLAQKLKSSGGS (SEQ ID NO: 206); SGGPGGPAGIGALFKSSFPLAQKLKSSGGG (SEQ ID NO: 207); RGPLAQKLKSSALFKSSFPGGPAGIGGGGK (SEQ ID NO: 208); GGGALFKSSFPLAQKLKSSPGGPAGIGGGR (SEQ ID NO: 209); RGPGGPAGIGPLAQKLKSSALFKSSFPGGG (SEQ ID NO: 210); RGGPLAQKLKSSPGGPAGIGALFKSSFPGK (SEQ ID NO: 211); RSGGPAGLYAQALFKSSFPLAQKLKSSGGG (SEQ ID NO:
- the linkers disclosed herein can comprise one or more cleavage motif or functional variants that are the same or different.
- the linkers can comprise 1, 2, 3, 4, 5, or more cleavage motifs or functional variants.
- Linkers comprising 30 amino acids can contain 2 cleavage motifs or functional variants, 3 cleavage motifs or functional variants or more.
- a “functional variant” of a linker retains the ability to be cleaved with high efficiency at a target site (e.g., a tumor microenvironment that expresses high levels of the protease) and are not cleaved or cleaved with low efficiency in the periphery (e.g., serum).
- the functional variants retain at least about 50%, about 55%, about 60%, about 70%, about 80%, about 85%, about 95% or more of the cleavage efficiency of a linker comprising any one of SEQ ID NOs: 195-220 or 447-448.
- linkers comprising more than one cleavage motif can be selected from SEQ ID NOs: 195-201 or 447-448 and combinations thereof.
- Preferred linkers comprising more than one cleavage motif comprise the amino acids selected from SEQ ID NO: 202-220.
- the linker can comprise both ALFKSSFP (SEQ ID NO: 198) and GPAGLYAQ (SEQ ID NO: 195).
- the linker can comprise two cleavage motifs that each have the sequence GPAGLYAQ (SEQ ID NO: 195).
- the linker can comprise two cleavage motifs that each have the sequence ALFKSSFP (SEQ ID NO: 198).
- the linker can comprise a third cleavage motif that is the same or different.
- the linker comprises an amino acid sequence that is at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least 99% identical to SEQ ID NOs: 195 to SEQ ID NO: 220 or 447-448 over the full length of SEQ ID NO: 195-220 or SEQ ID NOS 447-448.
- the disclosure also relates to functional variants of the linkers comprising SEQ ID NOs: 195-220 or 447-448.
- the functional variants of the linkers comprising SEQ ID NOs: 195-220 or 447-448 generally differ from SEQ ID NOs: 195-220 or 447-448 by one or a few amino acids (including substitutions, deletions, insertions, or any combination thereof), and substantially retain their ability to be cleaved by a protease.
- the functional variants can contain at least one or more amino acid substitutions, deletions, or insertions relative to the linkers comprising SEQ ID NOs: 195-220 or 447-448.
- the functional variant can comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid alterations comparted to the linkers comprising SEQ ID NOs: 195-220 or 447-448.
- the functional variant differs from the linker comprising SEQ ID NOs: 195-220 by less than 10, less, than 8, less than 5, less than 4, less than 3, less than 2, or one amino acid alterations, e.g., amino acid substitutions or deletions.
- the functional variant may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid substitutions compared to SEQ ID NOs: 195-220 or 447-448.
- the amino acid substitution can be a conservative substitution or a non-conservative substitution, but preferably is a conservative substitution.
- the functional variants of the linkers may comprise 1, 2, 3, 4, or 5 or more non-conservative amino acid substitutions compared to the linkers comprising SEQ ID NOs: 195-220 or 447-448.
- Non-conservative amino acid substitutions could be recognized by one of skill in the art.
- the functional variant of the linker preferably contains no more than 1, 2, 3, 4, or 5 amino acid deletions.
- linkers comprising 8 amino acid protease substrates (e.g., SEQ ID Nos: 195- 201 or 447-448) contain amino acid at positions P4, P3, P2, Pl, PE, P2’, P3’, P4’, wherein the sissile bond is between Pl and PE.
- amino acid positions for the linker comprising the sequence GPAGLYAQ SEQ ID NO: 195
- GPAGLYAQ disclosed as SEQ ID NO: 195.
- Amino acids positions for the linker comprising the sequence ALFKSSFP (SEQ ID NO: 198) can be described as follows:
- AFKSSFP disclosed as SEQ ID NO: 198.
- amino acids surrounding the cleavage site e.g., positions Pl and Pl’for SEQ ID NOs: 195-201 or 447-448) are not substituted.
- the linker comprises the sequence GPAGLYAQ (SEQ ID NO: 195) or ALFKSSFP (SEQ ID NO: 198) or a functional variant of SEQ ID NO: 195 or a function variant of SEQ ID NO: 198.
- a functional variant of PAGLYAQ (SEQ ID NO: 447) or ALFKSSFP (SEQ ID NO: 198) can comprise one or more amino acid substitutions, and substantially retain their ability to be cleaved by a protease.
- the functional variants of GPAGLYAQ (SEQ ID NO: 195) is cleaved by MMP14, and the functional variant of ALFKSSFP (SEQ ID NO: 198) is cleaved by Capthepsin L (CTSL1).
- the functional variants also retain their ability to be cleaved with high efficiency at a target site (e.g., a tumor microenvironment that expresses high levels of the protease).
- the functional variants of GPAGLYAQ (SEQ ID NO: 195) or ALFKSSFP (SEQ ID NO: 198) retain at least about 50%, about 55%, about 60%, about 70%, about 80%, about 85%, about 95% or more of the cleavage efficiency of a linker comprising amino acid sequence GPAGLYAQ (SEQ ID NO: 195) or ALFKSSFP (SEQ ID NO: 198), respectively.
- the functional variant of GPAGLYAQ (SEQ ID NO: 195) or ALFKSSFP (SEQ ID NO: 198) comprise no more than 1, 2, 3, 4, or 5 conservative amino acid substitutions compared to GPAGLYAQ (SEQ ID NO: 195) or ALFKSSFP (SEQ ID NO: 198).
- the amino acids at position Pl and PL are not substituted.
- the amino acids at positions Pl and PL in SEQ ID NO: 195 are G and L
- the amino acids at positions Pl and PL in SEQ ID NO: 198 are K and S.
- the functional variant of GPAGLYAQ can preferably comprise one or more of the following: a) an arginine amino acid substitution at position P4, b) a leucine, valine, asparagine, or proline amino acid substitution at position P3, c) a asparagine amino acid substitution at position P2, d) a histidine, asparagine, or glycine amino acid substitution at position Pl, e) a asparagine, isoleucine, or leucine amino acid substitution at position Pl’, f) a tyrosine or arginine amino acid substitution at position P2’, g) a glycine, arginine, or alanine amino acid substitution at position P3’, h) or a serine, glutamine, or lysine amino acid substitution at position P4’.
- GPAGLYAQ The following amino acid substitutions are disfavored in functional variants of GPAGLYAQ (SEQ ID NO: 195): a) arginine or isoleucine at position P3, b) alanine at position P2, c) valine at position Pl, d) arginine, glycine, asparagine, or threonine at position Pl’, e) aspartic acid or glutamic acid at position P2’, f) isoleucine at position P3’, g) valine at position P4’.
- the functional variant of GPAGLYAQ does not comprise an amino acid substitution at position Pl and/or PE.
- the amino acid substitution of the functional variant of GPAGLYAQ preferably comprises an amino acid substitution at position P4 and/or P4’.
- the functional variant of GPAGLYAQ (SEQ ID NO: 195) can comprise a leucine at position P4, or serine, glutamine, lysine, or phenylalanine at position P4.
- the functional variant of GPAGLYAQ (SEQ ID NO: 195) can comprise a glycine, phenylalanine, or a proline at position P4’.
- amino acid substitutions at position P2 or P2’ of GPAGLYAQ are not preferred.
- the functional variant of GPAGLYAQ comprises the amino acid sequence selected from SEQ ID NOs: 221- 295.
- Specific functional variants of GPAGLYAQ include GPLGLYAQ (SEQ ID NO: 259), and GPAGLKGA (SEQ ID NO: 249).
- the functional variants of LFKSSFP preferably comprises hydrophobic amino acid substitutions.
- the functional variant of LFKSSFP can preferably comprise one or more of the following: (a) lysine, histidine, serine, glutamine, leucine, proline, or phenylalanine at position P4; (b) lysine, histidine, glycine, proline, asparagine, phenylalanine at position P3; (c) arginine, leucine, alanine, glutamine, or histatine at position P2; (d) phenylalanine, histidine, threonine, alanine, or glutamine at position Pl; (e) histidine, leucine, lysine, alanine, isoleucine, arginine, phenylalanine, asparagine, glutamic acid, or glycine at position Pl’,
- aspartic acid and/or glutamic acid are generally disfavored and avoided.
- the following amino acid substitutions are also disfavored in functional variants of LFKSSFP (SEQ ID NO: 448): (a) alanine, serine, or glutamic acid at position P3; (b) proline, threonine, glycine, or aspartic acid at position P2; (c) proline at position Pl; (d) proline at position PE; (e) glycine at position P2’; (f) lysine or glutamic acid at position P3’; (g) aspartic acid at position P4’.
- the amino acid substitution of the functional variant of LFKSSFP preferably comprises an amino acid substitution at position P4 and/or Pl. In some embodiments, an amino acid substitution of the functional variant of LFKSSFP (SEQ ID NO: 448) at position P4’ is not preferred.
- the functional variant of LFKSSFP comprises the amino acid sequence selected from SEQ ID NOs: 296- 374.
- Specific functional variants of LFKSSFP include ALFFSSPP (SEQ ID NO: 199), ALFKSFPP (SEQ ID NO: 346), ALFKSLPP (SEQ ID NO: 347); ALFKHSPP (SEQ ID NO: 335); ALFKSIPP (SEQ ID NO: 348); ALFKSSLP (SEQ ID NO: 356); or SPFRSSRQ (SEQ ID NO: 297).
- the linkers disclosed herein can form a stable prodrug under physiological conditions with the amino acid sequences (e.g. domains) that they link, while being capable of being cleaved by a protease.
- the linker is stable (e.g., not cleaved or cleaved with low efficiency) in the circulation and cleaved with higher efficiency at a target site (i.e. a tumor microenvironment).
- fusion polypeptides that include the linkers disclosed herein can, if desired, have a prolonged circulation half-life and/or lower biological activity in the circulation in comparison to the components of the fusion polypeptide as separate molecular entities.
- the linkers when in the desired location (e.g., tumor microenvironment) the linkers can be efficiently cleaved to release the components that are joined together by the linker and restoring or nearly restoring the half-life and biological activity of the components as separate molecular entities.
- the linker desirably remains stable in the circulation for at least 2 hours, at least 5, hours, at least 10 hours, at least 15 hours, at least 20 hours, at least 24 hours, at least 30 hours, at least 35 hours, at least 40 hours, at least 45 hours, at least 50 hours, at least 60 hours, at least 65 hours, at least 70 hours, at least 80 hours, at least 90 hours, or longer.
- the linker is cleaved by less than 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 20%, 5%, or 1% in the circulation as compared to the target location.
- the linker is also stable in the absence of an enzyme capable of cleaving the linker. However, upon expose to a suitable enzyme (i.e., a protease), the linker is cleaved resulting in separation of the linked domain.
- compositions comprising a IFN polypeptide prodrug described herein, a vector comprising the polynucleotide encoding the IFN polypeptide prodrug or a host cell transformed by this vector and at least one pharmaceutically acceptable carrier.
- compositions comprising the IFN polypeptide prodrugs as described herein are suitable for administration in vitro or in vivo.
- pharmaceutically acceptable carrier includes, but is not limited to, any carrier that does not interfere with the effectiveness of the biological activity of the ingredients and that is not toxic to the subject to whom it is administered.
- suitable pharmaceutical carriers include phosphate buffered saline solutions, water, emulsions, such as oil/water emulsions, various types of wetting agents, sterile solutions etc.
- compositions are sterile.
- compositions may also contain adjuvants such as preservative, emulsifying agents and dispersing agents. Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents.
- Suitable carriers and their formulations are described in Remington: The Science and Practice of Pharmacy, 21st Edition, David B. Troy, ed., Lippicott Williams & Wilkins (2005).
- an appropriate amount of a pharmaceutically-acceptable salt is used in the formulation to render the formulation isotonic, although the formulate can be hypertonic or hypotonic if desired.
- the pharmaceutically-acceptable carriers include, but are not limited to, sterile water, saline, buffered solutions like Ringer's solution, and dextrose solution.
- the pH of the solution is generally about 5 to about 8 or from about 7 to 7.5.
- Carriers are those suitable for administration of the IFN or polypeptide prodrugs or nucleic acid sequences encoding the IFN polypeptide prodrugs to humans or other subjects.
- the inducible IFN prodrug described herein is encapsulated in nanoparticles.
- the nanoparticles are fullerenes, liquid crystals, liposome, quantum dots, superparamagnetic nanoparticles, dendrimers, or nanorods.
- the inducible IFN prodrug is attached to liposomes.
- the inducible IFN prodrugs are conjugated to the surface of liposomes.
- the inducible IFN prodrug are encapsulated within the shell of a liposome.
- the liposome is a cationic liposome.
- the IFN polypeptide prodrugs described herein are contemplated for use as a medicament.
- Administration is effected by different ways, e.g. by intravenous, intraperitoneal, subcutaneous, intramuscular, topical or intradermal administration.
- the route of administration depends on the kind of therapy and the kind of compound contained in the pharmaceutical composition.
- the dosage regimen will be determined by the attending physician and other clinical factors. Dosages for any one patient depends on many factors, including the patient's size, body surface area, age, sex, the particular compound to be administered, time and route of administration, the kind of therapy, general health and other drugs being administered concurrently.
- An "effective dose” refers to amounts of the active ingredient that are sufficient to affect the course and the severity of the disease, leading to the reduction or remission of such pathology and may be determined using known methods.
- the inducible IFN prodrug or nucleic acid sequences encoding the inducible IFN prodrug are administered by a vector.
- a vector There are a number of compositions and methods which can be used to deliver the nucleic acid molecules and/or polypeptides to cells, either in vitro or in vivo via, for example, expression vectors. These methods and compositions can largely be broken down into two classes: viral based delivery systems and non-viral based delivery systems. Such methods are well known in the art and readily adaptable for use with the compositions and methods described herein.
- compositions and methods can be used to transfect or transduce cells in vitro or in vivo, for example, to produce cell lines that express and preferably secrete the encoded chimeric polypeptide or to therapeutically deliver nucleic acids to a subject.
- the components of the IFN polypeptide disclosed herein are typically operably linked in frame to encode a fusion protein.
- plasmid or viral vectors are agents that transport the disclosed nucleic acids into the cell without degradation and include a promoter yielding expression of the nucleic acid molecule and/or polypeptide in the cells into which it is delivered.
- Viral vectors are, for example, Adenovirus, Adeno-associated virus, herpes virus, Vaccinia virus, Polio virus, Sindbis, and other RNA viruses, including these viruses with the HIV backbone. Also preferred are any viral families which share the properties of these viruses which make them suitable for use as vectors. Retroviral vectors, in general and methods of making them are described by Coffin et al., Retroviruses, Cold Spring Harbor Laboratory Press (1997).
- replicationdefective adenoviruses has been described (Berkner et al., J. Virol. 61 :1213-20 (1987); Massie et al., Mol. Cell. Biol. 6:2872-83 (1986); Haj-Ahmad et al., J. Virol. 57:267-74 (1986); Davidson et al., J. Virol. 61 : 1226-39 (1987); Zhang et al., BioTechniques 15:868-72 (1993)).
- the benefit and the use of these viruses as vectors is that they are limited in the extent to which they can spread to other cell types, since they can replicate within an initial infected cell, but are unable to form new infectious viral particles.
- Recombinant adenoviruses have been shown to achieve high efficiency after direct, in vivo delivery to airway epithelium, hepatocytes, vascular endothelium, CNS parenchyma, and a number of other tissue sites.
- Other useful systems include, for example, replicating and host-restricted non-replicating vaccinia virus vectors.
- VLPs Virus like particles
- Methods for making and using virus like particles are described in, for example, Garcea and Gissmann, Current Opinion in Biotechnology 15:513-7 (2004).
- the IFN polypeptide prodrugs disclosed herein can be delivered by subviral dense bodies (DBs).
- DBs transport proteins into target cells by membrane fusion.
- Methods for making and using DBs are described in, for example, Pepperl-Klindworth et al., Gene Therapy 10:278-84 (2003).
- the provided polypeptides can be delivered by tegument aggregates. Methods for making and using tegument aggregates are described in International Publication No. WO 2006/110728.
- Non-viral based delivery methods can include expression vectors comprising nucleic acid molecules and nucleic acid sequences encoding polypeptides, wherein the nucleic acids are operably linked to an expression control sequence.
- Suitable vector backbones include, for example, those routinely used in the art such as plasmids, artificial chromosomes, BACs, YACs, or PACs. Numerous vectors and expression systems are commercially available from such corporations as Novagen (Madison, Wis.), Clonetech (Pal Alto, Calif.), Stratagene (La Jolla, Calif.), and Invitrogen/Life Technologies (Carlsbad, Calif.). Vectors typically contain one or more regulatory regions.
- Regulatory regions include, without limitation, promoter sequences, enhancer sequences, response elements, protein recognition sites, inducible elements, protein binding sequences, 5' and 3' untranslated regions (UTRs), transcriptional start sites, termination sequences, polyadenylation sequences, and introns.
- a suitable host cell such as CHO cells.
- Preferred promoters controlling transcription from vectors in mammalian host cells may be obtained from various sources, for example, the genomes of viruses such as polyoma, Simian Virus 40 (SV40), adenovirus, retroviruses, hepatitis B virus, and most preferably cytomegalovirus (CMV), or from heterologous mammalian promoters, e.g., P-actin promoter or EFla promoter, or from hybrid or chimeric promoters (e.g., CMV promoter fused to the P-actin promoter).
- viruses such as polyoma, Simian Virus 40 (SV40), adenovirus, retroviruses, hepatitis B virus, and most preferably cytomegalovirus (CMV), or from heterologous mammalian promoters, e.g., P-actin promoter or EFla promoter, or from hybrid or chimeric promoters (e.g., CMV promoter fused to the
- Enhancer generally refers to a sequence of DNA that functions at no fixed distance from the transcription start site and can be either 5' or 3' to the transcription unit. Furthermore, enhancers can be within an intron as well as within the coding sequence itself. They are usually between 10 and 300 base pairs (bp) in length, and they function in cis. Enhancers usually function to increase transcription from nearby promoters. Enhancers can also contain response elements that mediate the regulation of transcription. While many enhancer sequences are known from mammalian genes (globin, elastase, albumin, fetoprotein, and insulin), typically one will use an enhancer from a eukaryotic cell virus for general expression.
- the promoter and/or the enhancer can be inducible (e.g., chemically or physically regulated).
- a chemically regulated promoter and/or enhancer can, for example, be regulated by the presence of alcohol, tetracycline, a steroid, or a metal.
- a physically regulated promoter and/or enhancer can, for example, be regulated by environmental factors, such as temperature and light.
- the promoter and/or enhancer region can act as a constitutive promoter and/or enhancer to maximize the expression of the region of the transcription unit to be transcribed.
- the promoter and/or enhancer region can be active in a cell type specific manner.
- the promoter and/or enhancer region can be active in all eukaryotic cells, independent of cell type.
- Preferred promoters of this type are the CMV promoter, the SV40 promoter, the P-actin promoter, the EFla promoter, and the retroviral long terminal repeat (LTR).
- the vectors also can include, for example, origins of replication and/or markers.
- a marker gene can confer a selectable phenotype, e.g., antibiotic resistance, on a cell.
- the marker product is used to determine if the vector has been delivered to the cell and once delivered is being expressed.
- selectable markers for mammalian cells are dihydrofolate reductase (DHFR), thymidine kinase, neomycin, neomycin analog G418, hygromycin, puromycin, and blasticidin. When such selectable markers are successfully transferred into a mammalian host cell, the transformed mammalian host cell can survive if placed under selective pressure. Examples of other markers include, for example, the E.
- an expression vector can include a tag sequence designed to facilitate manipulation or detection (e.g., purification or localization) of the expressed polypeptide.
- Tag sequences such as GFP, glutathione S-transferase (GST), polyhistidine, c-myc, hemagglutinin, or FLAGTM tag (Kodak; New Haven, Conn.) sequences typically are expressed as a fusion with the encoded polypeptide.
- GFP glutathione S-transferase
- GST glutathione S-transferase
- polyhistidine polyhistidine
- c-myc hemagglutinin
- FLAGTM tag FLAGTM tag
- a disease, disorder or condition associated with a target antigen comprising administering to a subject in need thereof a inducible IFN prodrug as described herein.
- Diseases, disorders, or conditions include, but are not limited to, cancer, inflammatory disease, an immunological disorder, autoimmune disease, infectious disease (i.e., bacterial, viral, or parasitic disease).
- the disease, disorder, or condition is cancer.
- any suitable cancer may be treated with the IFN polypeptide prodrugs provided herein.
- suitable cancers include, for example, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), adrenocortical carcinoma, anal cancer, appendix cancer, astrocytoma, basal cell carcinoma, brain tumor, bile duct cancer, bladder cancer, bone cancer, breast cancer, bronchial tumor, carcinoma of unknown primary origin, cardiac tumor, cervical cancer, chordoma, colon cancer, colorectal cancer, craniopharyngioma, ductal carcinoma, embryonal tumor, endometrial cancer, ependymoma, esophageal cancer, esthesioneuroblastoma, fibrous histiocytoma, Ewing sarcoma, eye cancer, germ cell tumor, gallbladder cancer, gastric cancer, gastrointestinal carcinoid tumor, gastrointestinal stromal tumor, gestational trophoblastic disease, gli
- provided herein is a method of enhancing an immune response in a subject in need thereof by administering an effective amount of an inducible IFN prodrug provided herein to the subject.
- the enhanced immune response may prevent, delay, or treat the onset of cancer, a tumor, or a viral disease.
- the inducible IFN prodrug enhances the immune response by activating the innate and adaptive immunities.
- the methods described herein increase the activity of Natural Killer Cells and T lymphocytes.
- the inducible IFN prodrug provided herein can induce IFNy release from Natural Killer cells as well as CD4+ and CD8+ T cells.
- the method can further involve the administration of one or more additional agents to treat cancer, such as chemotherapeutic agents (e.g., Adriamycin, Cerubidine, Bleomycin, Alkeran, Velban, Oncovin, Fluorouracil, Thiotepa, Methotrexate, Bisantrene, Noantrone, Thiguanine, Cytaribine, Procarabizine), immuno-oncology agents (e.g., anti-PD-Ll, anti- CTLA4, anti-PD-1, anti-CD47, anti-GD2), cellular therapies (e.g., CAR-T, T-cell therapy), oncolytic viruses and the like.
- chemotherapeutic agents e.g., Adriamycin, Cerubidine, Bleomycin, Alkeran, Velban, Oncovin, Fluorouracil, Thiotepa, Methotrexate, Bisantrene, Noantrone, Thiguanine, Cytaribine, Procarabizine
- immuno-oncology agents e
- Non-limiting examples of anti-cancer agents include acivicin; aclarubicin; acodazole hydrochloride; acronine; adozelesin; aldesleukin; altretamine; ambomycin; ametantrone acetate; aminoglutethimide; amsacrine; anastrozole; anthramycin; asparaginase; asperlin; azacitidine; azetepa; azotomycin; batimastat; benzodepa; bicalutamide; bisantrene hydrochloride; bisnafide dimesylate; bizelesin; bleomycin sulfate; brequinar sodium; bropirimine; busulfan; cactinomycin; calusterone; caracemide; carbetimer; carboplatin; carmustine; carubicin hydrochloride; carzelesin; cedefingol; chlorambucil;
- the inducible IFN prodrug or the inducible IFN prodrug is administered in combination with an agent for the treatment of the particular disease, disorder, or condition.
- Agents include, but are not limited to, therapies involving antibodies, small molecules (e.g., chemotherapeutics), hormones (steroidal, peptide, and the like), radiotherapies (y-rays, C-rays, and/or the directed delivery of radioisotopes, microwaves, UV radiation and the like), gene therapies (e.g., antisense, retroviral therapy and the like) and other immunotherapies.
- the inducible IFN prodrug or is administered in combination with anti-diarrheal agents, anti-emetic agents, analgesics and/or non-steroidal anti-inflammatory agents.
- the terms “at least,” “less than,” and “about,” or similar terms preceding a series of elements or a range are to be understood to refer to every element in the series or range.
- Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.
- the terms “activatable,” “activate,” “induce,” and “inducible” refers to a inducible IFN prodrug that has an attenuated activity form (e.g., attenuated receptor binding and/or agonist activity) and an activated form.
- the inducible IFN prodrug is activated by protease cleavage of the linker that causes the blocking element and half-life extension element to dissociate from the inducible IFN prodrug.
- the induced/activated IFN prodrug can bind with increased affinity/avidity to the IFN receptor.
- an antibody or immunoglobulin is intended to refer to immunoglobulin molecules comprised of two heavy (H) chains.
- H heavy chain
- mammals e.g., humans, rodents, and monkey
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region.
- the heavy chain constant region is comprised of three domains, CHI, CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- the VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
- Antibodies can include, for example, monoclonal antibodies, recombinantly produced antibodies, monospecific antibodies, multi specific antibodies (including bispecific antibodies), human antibodies, humanized antibodies, chimeric antibodies, immunoglobulins, synthetic antibodies, or tetrameric antibodies comprising two heavy chain and two light chain molecules.
- monospecific antibodies monospecific antibodies
- multi specific antibodies including bispecific antibodies
- human antibodies humanized antibodies
- chimeric antibodies immunoglobulins
- synthetic antibodies or tetrameric antibodies comprising two heavy chain and two light chain molecules.
- tetrameric antibodies comprising two heavy chain and two light chain molecules.
- the term “attenuated” as used herein is an IFN receptor agonist that has decreased receptor agonist activity as compared to the IFN receptor’s naturally occurring agonist.
- An attenuated IFN agonist can have at least about 10X, at least about 50X, at least about 100X, at least about 250X, at least about 500X, at least about 1000X or less agonist activity as compared to the receptor’s naturally occurring agonist.
- a inducible IFN prodrug that contains IFN as described herein is described as “attenuated” or having “attenuated activity”, it is meant that the inducible IFN prodrug is an attenuated IFN receptor agonist.
- cancer refers to the physiological condition in mammals in which a population of cells is characterized by uncontrolled proliferation, immortality, metastatic potential, rapid growth and proliferation rate and/or certain morphological features. Often cancers can be in the form of a tumor or mass, but may exist alone within the subject, or may circulate in the blood stream as independent cells, such a leukemic or lymphoma cells.
- the term cancer includes all types of cancers and metastases, including hematological malignancy, solid tumors, sarcomas, carcinomas and other solid and non-solid tumors. Examples of cancers include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia.
- cancers include squamous cell cancer, small cell lung cancer, nonsmall cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer (e.g., triple negative breast cancer), osteosarcoma, melanoma, colon cancer, colorectal cancer, endometrial (e.g., serous) or uterine cancer, salivary gland carcinoma, kidney cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, and various types of head and neck cancers.
- Triple negative breast cancer refers to breast cancer that is negative for expression of the genes for estrogen receptor (ER), progesterone receptor (PR), and Her2/neu.
- a “conservative" amino acid substitution generally refers to substitution of one amino acid residue with another amino acid residue from within a recognized group which can change the structure of the peptide but biological activity of the peptide is substantially retained.
- Conservative substitutions of amino acids are known to those skilled in the art. Conservative substitutions of amino acids can include, but not limited to, substitutions made amongst amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D.
- half-life extension element in the context of the inducible IFN prodrug disclosed herein, refers to a chemical element, preferable a polypeptide that increases the serum half-life and improve pK, for example, by altering its size (e.g., to be above the kidney filtration cutoff), shape, hydrodynamic radius, charge, or parameters of absorption, biodistribution, metabolism, and elimination.
- the term “operably linked” in the context of a inducible IFN prodrug refers to the orientation of the components of a inducible IFN prodrug that permits the components to function in their intended manner.
- a polypeptide comprising an IFN subunit and an IFN blocking element are operably linked by a protease cleavable linker in a inducible IFN prodrug when the IFN blocking element is capable of inhibiting the IFN receptoractivating activity of the IFN polypeptide, but upon cleavage of the protease cleavable linker the inhibition of the IFN receptor-activating activity of the IFN polypeptide by the IFN blocking element is decreased or eliminated, for example because the IFN blocking element can diffuse away from the IFN.
- peptide As used herein, the terms “peptide”, “polypeptide”, or “protein” are used broadly to mean two or more amino acids linked by a peptide bond. Protein, peptide, and polypeptide are also used herein interchangeably to refer to amino acid sequences. It should be recognized that the term polypeptide is not used herein to suggest a particular size or number of amino acids comprising the molecule and that a peptide of the invention can contain up to several amino acid residues or more.
- the mammal is a mouse.
- the mammal is a human.
- the term “therapeutically effective amount” refers to an amount of a compound described herein (i.e., a inducible IFN prodrug) that is sufficient to achieve a desired pharmacological or physiological effect under the conditions of administration.
- a “therapeutically effective amount” can be an amount that is sufficient to reduce the signs or symptoms of a disease or condition (e.g., a tumor).
- a therapeutically effective amount of a pharmaceutical composition can vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the pharmaceutical composition to elicit a desired response in the individual. An ordinarily skilled clinician can determine appropriate amounts to administer to achieve the desired therapeutic benefit based on these and other considerations.
- HEK-Blue IFN-a/p cells (InvivoGen) were plated in suspension at a density of 50,000 cells/well in culture media with or without 15 mg/ml human serum albumin (HSA) and stimulated with a dilution series IFN a and activatable human IFN a for 18 hours at 37°C and 5% CO2. Activity of uncleaved and cleaved activatable IFNa was tested. Cleaved inducible IFNa was generated by incubation with active recombinant protease.
- HSA human serum albumin
- B16-Blue IFN- a/p cells (InvivoGen) will be plated in suspension at a density of 75,000 cells/well in culture media with or without 15 mg/ml mouse serum albumin (HSA) and stimulated with a dilution series of recombinant mouse IFNa and activatable mouse IFNa for 20- 24 hours at 37oC and 5% CO2. Activity of uncleaved and cleaved activatable IFNa will be tested. Cleaved inducible IFNa will be generated by incubation with active recombinant protease.
- HSA mouse serum albumin
- Proteins were analyzed by analytical SEC for high molecular weight species quantitation to characterize purity.
- a Waters XBridge BEH sizing column was used for SEC.
- 20 pg of protein was injected on the column and eluted under isocratic conditions in 100 mM sodium phosphate pH7 for 15 minutes.
- the MC38 cell line a rapidly growing colon adenocarcinoma cell line, was used as a tumor model to examine the ability of fusion proteins to affect tumor growth and body weight.
- mice were anaesthetized with isoflurane for implant of cells to reduce the ulcerations.
- Female C57BL/6 mice were set up with 5xl0 5 MC38 tumor cells (without Matrigel) subcutaneously in flank. Cell injection volume was 0.1 mL/mouse.
- Mouse age at start date was 8 to 12 weeks. Pair matches was performed when tumors reached an average size of 100 - 150 mm 3 and treatment began as shown in Table 3. This was Day 1 of the study. Body weights were taken at initiation and then biweekly to the end. Caliper measurements were taken biweekly to the end. Any adverse reactions were reported immediately. Any individual animal with a single observation of > than 25% body weight loss or three consecutive measurements of >20% body weight loss was euthanized.
- X refers to a linker.
- X refers to a cleavable linker.
- Linker 3 refers to a linker that comprises a CTSL-1 substrate motif sequence.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Toxicology (AREA)
- Cell Biology (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Virology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicinal Preparation (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3228927A CA3228927A1 (en) | 2021-08-18 | 2022-08-17 | Activatable inteferon polypeptides and methods of use thereof |
| JP2024509376A JP2024531338A (ja) | 2021-08-18 | 2022-08-17 | 活性化可能インターフェロンポリペプチド及びその使用方法 |
| CN202280070171.4A CN118119634A (zh) | 2021-08-18 | 2022-08-17 | 可活化干扰素多肽及其使用方法 |
| EP22792938.7A EP4387987A2 (en) | 2021-08-18 | 2022-08-17 | Activatable inteferon polypeptides and methods of use thereof |
| US18/440,841 US20240216474A1 (en) | 2021-08-18 | 2024-02-13 | Activatable interferon polypeptides and methods of use thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163234284P | 2021-08-18 | 2021-08-18 | |
| US63/234,284 | 2021-08-18 |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US63234284 Continuation | 2021-08-18 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US18/440,841 Continuation US20240216474A1 (en) | 2021-08-18 | 2024-02-13 | Activatable interferon polypeptides and methods of use thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2023023131A2 true WO2023023131A2 (en) | 2023-02-23 |
| WO2023023131A3 WO2023023131A3 (en) | 2023-04-20 |
Family
ID=83899708
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/040564 Ceased WO2023023131A2 (en) | 2021-08-18 | 2022-08-17 | Activatable inteferon polypeptides and methods of use thereof |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US20240216474A1 (https=) |
| EP (1) | EP4387987A2 (https=) |
| JP (1) | JP2024531338A (https=) |
| CN (1) | CN118119634A (https=) |
| CA (1) | CA3228927A1 (https=) |
| TW (1) | TW202321284A (https=) |
| WO (1) | WO2023023131A2 (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12303567B2 (en) | 2020-05-13 | 2025-05-20 | Bonum Therapeutics, Inc. | Compositions of protein complexes and methods of use thereof |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006110728A2 (en) | 2005-04-12 | 2006-10-19 | The Uab Research Foundation | Immunogenic cmv tegument aggregates |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2010215761B2 (en) * | 2009-02-23 | 2017-04-06 | Cytomx Therapeutics, Inc | Proproteins and methods of use thereof |
| JP2020528878A (ja) * | 2017-06-20 | 2020-10-01 | ザ ボード オブ リージェンツ オブ ザ ユニバーシティー オブ テキサス システム | がん治療用インターフェロンプロドラッグ |
| US20210130430A1 (en) * | 2018-05-14 | 2021-05-06 | Werewolf Therapeutics, Inc. | Activatable cytokine polypeptides and methods of use thereof |
| US20220002370A1 (en) * | 2018-09-27 | 2022-01-06 | Xilio Development, Inc. | Masked cytokine polypeptides |
| MX2022005666A (es) * | 2019-11-14 | 2022-10-07 | Werewolf Therapeutics Inc | Polipeptidos de citocina activables y metodos de uso de los mismos. |
| US20210252142A1 (en) * | 2020-02-06 | 2021-08-19 | Aetio Biotherapy, Inc. | Compositions and methods for treating viral infections |
-
2022
- 2022-08-17 CN CN202280070171.4A patent/CN118119634A/zh active Pending
- 2022-08-17 EP EP22792938.7A patent/EP4387987A2/en active Pending
- 2022-08-17 CA CA3228927A patent/CA3228927A1/en active Pending
- 2022-08-17 WO PCT/US2022/040564 patent/WO2023023131A2/en not_active Ceased
- 2022-08-17 JP JP2024509376A patent/JP2024531338A/ja active Pending
- 2022-08-18 TW TW111131193A patent/TW202321284A/zh unknown
-
2024
- 2024-02-13 US US18/440,841 patent/US20240216474A1/en active Pending
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006110728A2 (en) | 2005-04-12 | 2006-10-19 | The Uab Research Foundation | Immunogenic cmv tegument aggregates |
Non-Patent Citations (9)
| Title |
|---|
| "Remington: The Science and Practice of Pharmacy", 2005, LIPPICOTT WILLIAMS & WILKINS |
| COFFIN ET AL.: "Retroviruses", 1997, COLD SPRING HARBOR LABORATORY PRESS |
| DAVIDSON ET AL., J. VIROL., vol. 61, 1987, pages 1226 - 39 |
| GARCEAGISSMANN, CURRENT OPINION IN BIOTECHNOLOGY, vol. 15, 2004, pages 513 - 7 |
| HAJ-AHMAD ET AL., J. VIROL., vol. 57, 1986, pages 267 - 74 |
| MASSIE ET AL., MOL. CELL. BIOL., vol. 6, 1986, pages 2872 - 83 |
| PEPPERL-KLINDWORTH ET AL., GENE THERAPY, vol. 10, 2003, pages 278 - 84 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 2012, COLD SPRING HARBOR LABORATORY PRESS |
| ZHANG ET AL., BIOTECHNIQUES, vol. 15, 1993, pages 868 - 72 |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12303567B2 (en) | 2020-05-13 | 2025-05-20 | Bonum Therapeutics, Inc. | Compositions of protein complexes and methods of use thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2023023131A3 (en) | 2023-04-20 |
| CA3228927A1 (en) | 2023-02-23 |
| US20240216474A1 (en) | 2024-07-04 |
| EP4387987A2 (en) | 2024-06-26 |
| TW202321284A (zh) | 2023-06-01 |
| CN118119634A (zh) | 2024-05-31 |
| JP2024531338A (ja) | 2024-08-29 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240043488A1 (en) | Activatable il-12 polypeptides and methods of use thereof | |
| US12036266B2 (en) | Activatable cytokine polypeptides and methods of use thereof | |
| US20220324930A1 (en) | Activatable interleukin 12 polypeptides and methods of use thereof | |
| EP3794024B1 (en) | Activatable interleukin-2 polypeptides and methods of use thereof | |
| US20240216505A1 (en) | Inducible cytokine prodrug and pd-1/pd-l1 combination therapy | |
| US20240216474A1 (en) | Activatable interferon polypeptides and methods of use thereof | |
| WO2023196897A1 (en) | Il-12 prodrugs | |
| WO2025151274A1 (en) | Inducible il-18 prodrugs | |
| WO2025072443A2 (en) | Activatable il-21 polypeptides and methods of use thereof and single domain human serum albumin antibodies | |
| WO2024192195A2 (en) | Interferon prodrugs | |
| US20260125436A1 (en) | Il-12 prodrugs, methods of use and pharmaceutical compositions | |
| HK40098030A (en) | Activatable interleukin-2 polypeptides and methods of use thereof | |
| HK40048553B (en) | Activatable interleukin-2 polypeptides and methods of use thereof | |
| HK40048553A (en) | Activatable interleukin-2 polypeptides and methods of use thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22792938 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3228927 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024509376 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022792938 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022792938 Country of ref document: EP Effective date: 20240318 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280070171.4 Country of ref document: CN |