WO2023010095A1 - Methods and compositions for treating cancer - Google Patents

Methods and compositions for treating cancer Download PDF

Info

Publication number
WO2023010095A1
WO2023010095A1 PCT/US2022/074279 US2022074279W WO2023010095A1 WO 2023010095 A1 WO2023010095 A1 WO 2023010095A1 US 2022074279 W US2022074279 W US 2022074279W WO 2023010095 A1 WO2023010095 A1 WO 2023010095A1
Authority
WO
WIPO (PCT)
Prior art keywords
domain
amino acid
bispecific antibody
seq
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/074279
Other languages
English (en)
French (fr)
Other versions
WO2023010095A8 (en
Inventor
Henry Kao
Christoph MARKERT
Christine MCINTYRE
Raymond D. MENG
Merlind Muecke
Volker Teichgraeber
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
F Hoffmann La Roche AG
Genentech Inc
Hoffmann La Roche Inc
Original Assignee
F Hoffmann La Roche AG
Genentech Inc
Hoffmann La Roche Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to IL309120A priority Critical patent/IL309120A/en
Application filed by F Hoffmann La Roche AG, Genentech Inc, Hoffmann La Roche Inc filed Critical F Hoffmann La Roche AG
Priority to MX2024001214A priority patent/MX2024001214A/es
Priority to CA3224180A priority patent/CA3224180A1/en
Priority to KR1020247005105A priority patent/KR20240038008A/ko
Priority to JP2024504960A priority patent/JP2024529451A/ja
Priority to CN202280052285.6A priority patent/CN117715936A/zh
Priority to AU2022317820A priority patent/AU2022317820A1/en
Priority to EP22764591.8A priority patent/EP4377351A1/en
Publication of WO2023010095A1 publication Critical patent/WO2023010095A1/en
Publication of WO2023010095A8 publication Critical patent/WO2023010095A8/en
Priority to US18/424,297 priority patent/US20240327519A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/522CH1 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/524CH2 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/526CH3 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/64Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71Decreased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin

Definitions

  • This invention relates to methods and compositions for use in treating cancer in a subject by administering to the subject a bispecific antibody targeting programmed cell death protein 1 (PD-1) and lymphocyte activation gene-3 (LAG3) (PD1-LAG3), optionally with an anti-TIG IT antagonist antibody (e.g., tiragolumab) or a VEGF antagonist (e.g., bevacizumab).
  • PD-1 programmed cell death protein 1
  • LAG3 lymphocyte activation gene-3
  • an anti-TIG IT antagonist antibody e.g., tiragolumab
  • a VEGF antagonist e.g., bevacizumab
  • Cancers are characterized by the uncontrolled growth of cell subpopulations. Cancers are the leading cause of death in the developed world and the second leading cause of death in developing countries, with over 14 million new cancer cases diagnosed and over eight million cancer deaths occurring each year. Cancer care thus represents a significant and ever-increasing societal burden.
  • Melanoma is a malignant tumor of melanocytes. This potentially deadly form of skin cancer is one of the fastest-growing malignancies. More than 300,000 people worldwide are currently diagnosed with melanoma each year, and 57,000 people die of the disease. Most people with advanced melanoma have a poor prognosis. Patients with lymph-node involvement (Stage III) have a high risk of local and distant relapse after surgery, and the 5-year survival rate is 32%-93% in this patient group. Few patients have metastatic disease (Stage IV) at presentation, but some develop metastases after their initial definitive treatment. Immunotherapy and targeted therapies have improved the outcomes of those patients, and the 5-year survival rate is around 50%. Melanoma continues to be a serious health issue, with a high medical need and a steadily increasing incidence over the past 30 years. Hence, there remains a significant need for novel therapeutic approaches in this population.
  • HCC Hepatocellular carcinoma
  • iCCA intrahepatic cholangiocarcinoma
  • angiosarcoma angiosarcoma
  • hepatoblastoma a stage when treatment with curative therapies.
  • the disclosure provides a method for treating a subject having a cancer, the method comprising administering to the subject one or more dosing cycles of a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the method comprises administering to the subject the bispecific antibody at a fixed dose of 600 mg every three weeks.
  • the cancer is a solid tumor.
  • the cancer is locally advanced or metastatic.
  • the cancer is a skin cancer, a liver cancer, a lung cancer, a renal cancer, a bladder cancer, a breast cancer or an esophageal cancer.
  • the skin cancer is a melanoma.
  • the skin cancer is a previously untreated unresectable or metastatic melanoma.
  • the melanoma is (a) a Stage III melanoma with measurable lymph node metastases; (b) an unresectable Stage III melanoma; or (c) a Stage IV melanoma, optionally wherein the melanoma is not a mucosal melanoma or a uveal melanoma.
  • the liver cancer is hepatocellular carcinoma (HCC).
  • the lung cancer is a non-small cell lung cancer (NSCLC).
  • the renal cancer is renal cell carcinoma (RCC).
  • the bladder cancer is metastatic urothelial carcinoma (mUC).
  • the breast cancer is a triple-negative breast cancer (TNBC).
  • the esophageal cancer is esophageal squamous cell carcinoma (ESCC).
  • the disclosure provides a method for treating a subject having a melanoma, the method comprising administering to the subject one or more dosing cycles of a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the method comprises administering to the subject the bispecific antibody at a fixed dose of 600 mg every three weeks, and wherein the melanoma is (a) an unresectable Stage III melanoma; or (b) a Stage IV melanoma. In some aspects, the subject does not have ocular melanoma.
  • the disclosure provides a method for treating a subject having a liver cancer, the method comprising administering to the subject one or more dosing cycles of a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the method comprises administering to the subject the bispecific antibody at a fixed dose of 600 mg every three weeks.
  • the liver cancer is hepatocellular carcinoma (HCC).
  • HCC hepatocellular carcinoma
  • the HCC is locally advanced, metastatic, and/or unresectable.
  • the subject has not previously received a systemic anti-cancer therapy.
  • the length of each of the one or more dosing cycles is 21 days.
  • the method comprises administering to the subject the bispecific antibody on Day 1 of each of the one or more dosing cycles.
  • the method comprises administering to the subject the bispecific antibody intravenously.
  • the method further comprises administering to the subject bevacizumab at a dose of about 15 mg/kg every three weeks.
  • the length of each of the one or more dosing cycles is 21 days and the method comprises administering to the subject the bevacizumab on Day 1 of each of the one or more dosing cycles.
  • the bevacizumab is administered intravenously.
  • the subject has not previously been treated for metastatic or unresectable disease.
  • the subject has not previously been treated with an anti-cancer therapy comprising an immunomodulatory agent.
  • the subject has not previously been treated with an anti-LAG3 therapy.
  • the bispecific antibody targeting PD-1 and LAG3 comprises a first antigen binding domain that specifically binds to PD-1 comprising a VH domain comprising (i) an HVR-H1 sequence comprising the amino acid sequence of SEQ ID NO: 25; (ii) an HVR-H2 sequence comprising the amino acid sequence GGR; and (iii) an HVR-H3 sequence comprising an amino acid sequence of SEQ ID NO: 26; and a VL domain comprising (i) an HVR-L1 sequence comprising the amino acid sequence of SEQ ID NO: 27; (ii) an HVR-L2 sequence comprising the amino acid sequence RSS; and (iii) an HVR-L3 sequence comprising the amino acid sequence of SEQ ID NO: 28.
  • the bispecific antibody targeting PD-1 and LAG3 comprises a second antigen binding domain that specifically binds to LAG3 comprising a VH domain comprising (i) an HVR-H1 sequence comprising the amino acid sequence of SEQ ID NO: 31 ; (ii) an HVR-H2 sequence comprising the amino acid sequence of SEQ ID NO: 32; and (iii) an HVR-H3 sequence comprising an amino acid sequence of SEQ ID NO: 33; and a VL domain comprising (i) an HVR-L1 sequence comprising the amino acid sequence of SEQ ID NO: 34; (ii) an HVR-L2 sequence comprising the amino acid sequence of SEQ ID NO: 35; and (iii) an HVR-L3 sequence comprising the amino acid sequence of SEQ ID NO: 36.
  • the first antigen-binding domain comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 29 and a VL domain comprising the amino acid sequence of SEQ ID NO: 30, and the second antigen-binding domain comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 37 and a VL domain comprising the amino acid sequence of SEQ ID NO: 38.
  • the bispecific antibody is a full-length antibody.
  • the bispecific antibody targeting PD-1 and LAG3 comprises a Fc domain that is an IgG, optionally wherein the IgG Fc domain is an IgG 1 Fc domain or an lgG4 Fc domain.
  • the Fc domain comprises one or more amino acid substitutions that reduce binding to an Fc receptor, optionally wherein the Fc receptor is an Fey receptor.
  • the bispecific antibody targeting PD-1 and LAG3 comprises (a) an Fc domain of human IgG 1 subclass with the amino acid mutations L234A, L235A, and P329G (numbering according to Kabat EU index); and/or (b) an Fc domain comprising a modification promoting the association of the first and second subunit of the Fc domain.
  • the first subunit of the Fc domain comprises the amino acid substitutions S354C and T366W (numbering according to Kabat EU index) and the second subunit of the Fc domain comprises the amino acid substitutions Y349C, T366S, and Y407V (numbering according to Kabat EU index).
  • the bispecific antibody targeting PD-1 and LAG3 comprises an Fc domain, a first Fab fragment comprising the first antigen-binding domain, and a second Fab fragment comprising the second antigen-binding domain.
  • the variable domains VL and VH are replaced by each other so that the VH domain is part of the light chain and the VL domain is part of the heavy chain, optionally wherein in the first Fab fragment the variable domains VL and VH are replaced by each other.
  • the amino acid at position 124 is substituted independently by lysine (K), arginine (R), or histidine (H) (numbering according to Kabat EU Index), and in the constant domain CH1 the amino acids at positions 147 and 213 are substituted independently by glutamic acid (E) or aspartic acid (D) (numbering according to Kabat EU index), optionally wherein in the constant domain CL of the second Fab fragment the amino acid at position 124 is substituted independently by lysine (K), arginine (R), or histidine (H) (numbering according to Kabat EU Index), and in the constant domain CH1 the amino acids at positions 147 and 213 are substituted independently by glutamic acid (E) or aspartic acid (D) (numbering according to Kabat EU index).
  • the bispecific antibody comprises a first heavy chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 39, a first light chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 40, a second heavy chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 41 , and a second light chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 42.
  • the bispecific antibody comprises a first heavy chain comprising the amino acid sequence of SEQ ID NO: 39, a first light chain comprising the amino acid sequence of SEQ ID NO: 40, a second heavy chain comprising the amino acid sequence of SEQ ID NO: 41 , and a second light chain comprising the amino acid sequence of SEQ ID NO: 42.
  • the bispecific antibody achieves at least 90% LAG3 receptor occupancy (RO) in the tumor.
  • the subject is a human.
  • the disclosure provides a bispecific antibody targeting PD-1 and LAG3 for use in a method of treating a subject having a cancer, wherein the bispecific antibody comprises a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, and wherein the method comprises administering to the subject the bispecific antibody at a fixed dose of 600 mg every three weeks.
  • the cancer is a solid tumor.
  • the cancer is locally advanced or metastatic.
  • the cancer is a skin cancer, a liver cancer, a lung cancer, a renal cancer, a bladder cancer, a breast cancer or an esophageal cancer.
  • the skin cancer is a melanoma.
  • the skin cancer is a previously untreated unresectable or metastatic melanoma.
  • the melanoma is (a) a Stage III melanoma with measurable lymph node metastases; (b) an unresectable Stage III melanoma; or (c) a Stage IV melanoma, optionally wherein the melanoma is not a mucosal melanoma or a uveal melanoma.
  • the liver cancer is hepatocellular carcinoma (HCC).
  • the lung cancer is a non-small cell lung cancer (NSCLC).
  • the renal cancer is renal cell carcinoma (RCC).
  • the bladder cancer is metastatic urothelial carcinoma (mUC).
  • the breast cancer is a triple-negative breast cancer (TNBC).
  • the esophageal cancer is esophageal squamous cell carcinoma (ESCC).
  • the disclosure provides a bispecific antibody targeting PD-1 and LAG3 for use in a method of treating a subject having a melanoma, wherein the bispecific antibody comprises a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the method comprises administering to the subject the bispecific antibody at a fixed dose of 600 mg every three weeks, and wherein the melanoma is (a) an unresectable Stage III melanoma; or (b) a Stage IV melanoma. In some aspects, the patient does not have ocular melanoma.
  • the disclosure provides a bispecific antibody targeting PD-1 and LAG3 for use in a method for treating a subject having a liver cancer, wherein the bispecific antibody comprises a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, and wherein the method comprises administering to the subject the bispecific antibody at a fixed dose of 600 mg every three weeks.
  • the liver cancer is HCC.
  • the HCC is locally advanced, metastatic, and/or unresectable.
  • the subject has not previously received a systemic anti-cancer therapy.
  • the length of each of the one or more dosing cycles is 21 days.
  • the method comprises administering to the subject the bispecific antibody on Day 1 of each of the one or more dosing cycles.
  • the method comprises administering to the subject the bispecific antibody intravenously.
  • the method further comprises administering to the subject bevacizumab at a dose of about 15 mg/kg every three weeks.
  • the length of each of the one or more dosing cycles is 21 days and the method comprises administering to the subject the bevacizumab on Day 1 of each of the one or more dosing cycles.
  • the bevacizumab is administered intravenously.
  • the subject has not previously been treated for metastatic or unresectable disease.
  • the subject has not previously been treated with an anti-cancer therapy comprising an immunomodulatory agent.
  • the subject has not previously been treated with an anti-LAG3 therapy.
  • the bispecific antibody targeting PD-1 and LAG3 comprises a first antigen binding domain that specifically binds to PD-1 comprising a VH domain comprising (i) an HVR-H1 sequence comprising the amino acid sequence of SEQ ID NO: 25; (ii) an HVR-H2 sequence comprising the amino acid sequence GGR; and (iii) an HVR-H3 sequence comprising an amino acid sequence of SEQ ID NO: 26; and a VL domain comprising (i) an HVR-L1 sequence comprising the amino acid sequence of SEQ ID NO: 27; (ii) an HVR-L2 sequence comprising the amino acid sequence RSS; and (iii) an HVR-L3 sequence comprising the amino acid sequence of SEQ ID NO: 28.
  • the bispecific antibody targeting PD-1 and LAG3 comprises a second antigen binding domain that specifically binds to LAG3 comprising a VH domain comprising (i) an HVR-H1 sequence comprising the amino acid sequence of SEQ ID NO: 31 ; (ii) an HVR-H2 sequence comprising the amino acid sequence of SEQ ID NO: 32; and (iii) an HVR-H3 sequence comprising an amino acid sequence of SEQ ID NO: 33; and a VL domain comprising (i) an HVR-L1 sequence comprising the amino acid sequence of SEQ ID NO: 34; (ii) an HVR-L2 sequence comprising the amino acid sequence of SEQ ID NO: 35; and (iii) an HVR-L3 sequence comprising the amino acid sequence of SEQ ID NO: 36.
  • the first antigen-binding domain comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 29 and a VL domain comprising the amino acid sequence of SEQ ID NO: 30, and the second antigen-binding domain comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 37 and a VL domain comprising the amino acid sequence of SEQ ID NO: 38.
  • the bispecific antibody is a full-length antibody.
  • the bispecific antibody targeting PD-1 and LAG3 comprises a Fc domain that is an IgG, optionally wherein the IgG Fc domain is an IgG 1 Fc domain or an lgG4 Fc domain.
  • the Fc domain comprises one or more amino acid substitutions that reduce binding to an Fc receptor, optionally wherein the Fc receptor is an Fey receptor.
  • the bispecific antibody targeting PD-1 and LAG3 comprises (a) an Fc domain of human IgG 1 subclass with the amino acid mutations L234A, L235A, and P329G (numbering according to Kabat EU index); and/or (b) an Fc domain comprising a modification promoting the association of the first and second subunit of the Fc domain.
  • the first subunit of the Fc domain comprises the amino acid substitutions S354C and T366W (numbering according to Kabat EU index) and the second subunit of the Fc domain comprises the amino acid substitutions Y349C, T366S, and Y407V (numbering according to Kabat EU index).
  • the bispecific antibody targeting PD-1 and LAG3 comprises an Fc domain, a first Fab fragment comprising the first antigen-binding domain, and a second Fab fragment comprising the second antigen-binding domain.
  • the variable domains VL and VH are replaced by each other so that the VH domain is part of the light chain and the VL domain is part of the heavy chain, optionally wherein in the first Fab fragment the variable domains VL and VH are replaced by each other.
  • the amino acid at position 124 is substituted independently by lysine (K), arginine (R), or histidine (H) (numbering according to Kabat EU Index), and in the constant domain CH1 the amino acids at positions 147 and 213 are substituted independently by glutamic acid (E) or aspartic acid (D) (numbering according to Kabat EU index), optionally wherein in the constant domain CL of the second Fab fragment the amino acid at position 124 is substituted independently by lysine (K), arginine (R), or histidine (H) (numbering according to Kabat EU Index), and in the constant domain CH1 the amino acids at positions 147 and 213 are substituted independently by glutamic acid (E) or aspartic acid (D) (numbering according to Kabat EU index).
  • the bispecific antibody comprises a first heavy chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 39, a first light chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 40, a second heavy chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 41 , and a second light chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 42.
  • the bispecific antibody comprises a first heavy chain comprising the amino acid sequence of SEQ ID NO: 39, a first light chain comprising the amino acid sequence of SEQ ID NO: 40, a second heavy chain comprising the amino acid sequence of SEQ ID NO: 41 , and a second light chain comprising the amino acid sequence of SEQ ID NO: 42.
  • the bispecific antibody achieves at least 90% LAG3 receptor occupancy (RO) in the tumor.
  • the subject is a human.
  • the disclosure provides use of a bispecific antibody targeting PD-1 and LAG3 in the manufacture of a medicament for treating a subject having a cancer, wherein the bispecific antibody comprises a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, and wherein the bispecific antibody is to be administered to the subject at a fixed dose of 600 mg every three weeks.
  • the cancer is a solid tumor.
  • the cancer is locally advanced or metastatic.
  • the cancer is a skin cancer, a liver cancer, a lung cancer, a renal cancer, a bladder cancer, a breast cancer or an esophageal cancer.
  • the skin cancer is a melanoma.
  • the skin cancer is a previously untreated unresectable or metastatic melanoma.
  • the melanoma is (a) a Stage III melanoma with measurable lymph node metastases; (b) an unresectable Stage III melanoma; or (c) a Stage IV melanoma, optionally wherein the melanoma is not a mucosal melanoma or a uveal melanoma.
  • the liver cancer is hepatocellular carcinoma (HCC).
  • the lung cancer is a non-small cell lung cancer (NSCLC).
  • the renal cancer is renal cell carcinoma (RCC).
  • the bladder cancer is metastatic urothelial carcinoma (mUC).
  • the breast cancer is a triple-negative breast cancer (TNBC).
  • the esophageal cancer is esophageal squamous cell carcinoma (ESCC).
  • the disclosure provides use of a bispecific antibody targeting PD-1 and LAG3 in the manufacture of a medicament for treating a subject having a melanoma
  • the bispecific antibody comprises a first antigen-binding domain that specifically binds to PD-1 and a second antigen binding domain that specifically binds to LAG3, wherein the bispecific antibody is to be administered to the subject at a fixed dose of 600 mg every three weeks, and wherein the melanoma is (a) an unresectable Stage III melanoma; or (b) a Stage IV melanoma.
  • the subject does not have ocular melanoma.
  • the disclosure provides use of a bispecific antibody targeting PD-1 and LAG3 in the manufacture of a medicament for treating a subject having a liver cancer, wherein the bispecific antibody comprises a first antigen-binding domain that specifically binds to PD-1 and a second antigen binding domain that specifically binds to LAG3, wherein the bispecific antibody is to be administered to the subject at a fixed dose of 600 mg every three weeks.
  • the liver cancer is HCC.
  • the HCC is locally advanced, metastatic, and/or unresectable.
  • the subject has not previously received a systemic anti-cancer therapy.
  • the length of each of the one or more dosing cycles is 21 days.
  • the bispecific antibody is to be administered to the subject on Day 1 of each of the one or more dosing cycles.
  • the bispecific antibody is to be administered to the subject intravenously.
  • bevacizumab is to be administered to the subject at a dose of about 15 mg/kg every three weeks. In some aspects, the length of each of the one or more dosing cycles is 21 days and the bevacizumab is to be administered to the subject on Day 1 of each of the one or more dosing cycles.
  • the bevacizumab is administered intravenously.
  • the subject has not previously been treated for metastatic or unresectable disease.
  • the subject has not previously been treated with an anti-cancer therapy comprising an immunomodulatory agent.
  • the subject has not previously been treated with an anti-LAG3 therapy.
  • the bispecific antibody targeting PD-1 and LAG3 comprises a first antigen binding domain that specifically binds to PD-1 comprising a VH domain comprising (i) an HVR-H1 sequence comprising the amino acid sequence of SEQ ID NO: 25; (ii) an HVR-H2 sequence comprising the amino acid sequence GGR; and (iii) an HVR-H3 sequence comprising an amino acid sequence of SEQ ID NO: 26; and a VL domain comprising (i) an HVR-L1 sequence comprising the amino acid sequence of SEQ ID NO: 27; (ii) an HVR-L2 sequence comprising the amino acid sequence RSS; and (iii) an HVR-L3 sequence comprising the amino acid sequence of SEQ ID NO: 28.
  • the bispecific antibody targeting PD-1 and LAG3 comprises a second antigen binding domain that specifically binds to LAG3 comprising a VH domain comprising (i) an HVR-H1 sequence comprising the amino acid sequence of SEQ ID NO: 31 ; (ii) an HVR-H2 sequence comprising the amino acid sequence of SEQ ID NO: 32; and (iii) an HVR-H3 sequence comprising an amino acid sequence of SEQ ID NO: 33; and a VL domain comprising (i) an HVR-L1 sequence comprising the amino acid sequence of SEQ ID NO: 34; (ii) an HVR-L2 sequence comprising the amino acid sequence of SEQ ID NO: 35; and (iii) an HVR-L3 sequence comprising the amino acid sequence of SEQ ID NO: 36.
  • the first antigen-binding domain comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 29 and a VL domain comprising the amino acid sequence of SEQ ID NO: 30, and the second antigen-binding domain comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 37 and a VL domain comprising the amino acid sequence of SEQ ID NO: 38.
  • the bispecific antibody is a full-length antibody.
  • the bispecific antibody targeting PD-1 and LAG3 comprises a Fc domain that is an IgG, optionally wherein the IgG Fc domain is an IgG 1 Fc domain or an lgG4 Fc domain.
  • the Fc domain comprises one or more amino acid substitutions that reduce binding to an Fc receptor, optionally wherein the Fc receptor is an Fey receptor.
  • the bispecific antibody targeting PD-1 and LAG3 comprises (a) an Fc domain of human IgG 1 subclass with the amino acid mutations L234A, L235A, and P329G (numbering according to Kabat EU index); and/or (b) an Fc domain comprising a modification promoting the association of the first and second subunit of the Fc domain.
  • the first subunit of the Fc domain comprises the amino acid substitutions S354C and T366W (numbering according to Kabat EU index) and the second subunit of the Fc domain comprises the amino acid substitutions Y349C, T366S, and Y407V (numbering according to Kabat EU index).
  • the bispecific antibody targeting PD-1 and LAG3 comprises an Fc domain, a first Fab fragment comprising the first antigen-binding domain, and a second Fab fragment comprising the second antigen-binding domain.
  • the variable domains VL and VH are replaced by each other so that the VH domain is part of the light chain and the VL domain is part of the heavy chain, optionally wherein in the first Fab fragment the variable domains VL and VH are replaced by each other.
  • the amino acid at position 124 is substituted independently by lysine (K), arginine (R), or histidine (H) (numbering according to Kabat EU Index), and in the constant domain CH1 the amino acids at positions 147 and 213 are substituted independently by glutamic acid (E) or aspartic acid (D) (numbering according to Kabat EU index), optionally wherein in the constant domain CL of the second Fab fragment the amino acid at position 124 is substituted independently by lysine (K), arginine (R), or histidine (H) (numbering according to Kabat EU Index), and in the constant domain CH1 the amino acids at positions 147 and 213 are substituted independently by glutamic acid (E) or aspartic acid (D) (numbering according to Kabat EU index).
  • the bispecific antibody comprises a first heavy chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 39, a first light chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 40, a second heavy chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 41 , and a second light chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 42.
  • the bispecific antibody comprises a first heavy chain comprising the amino acid sequence of SEQ ID NO: 39, a first light chain comprising the amino acid sequence of SEQ ID NO: 40, a second heavy chain comprising the amino acid sequence of SEQ ID NO: 41 , and a second light chain comprising the amino acid sequence of SEQ ID NO: 42.
  • the bispecific antibody achieves at least 90% LAG3 receptor occupancy (RO) in the tumor.
  • the subject is a human.
  • Fig. 1 is a flow chart showing the study design of the phase Ib/ll clinical trial in patients with melanoma.
  • Atezo atezolizumab
  • CIT cancer immunotherapy
  • CLND completion lymph node dissection
  • Ipi ipilimumab
  • Nivo nivolumab
  • R randomization
  • Tira tiragolumab.
  • Fig.2 is a schematic diagram of the study schema showing an overview of the study schedule and activities in Cohort 1 of the phase Ib/ll clinical trial in patients with melanoma.
  • Fig.3 is a schematic diagram showing a minimal physiologically-based pharmacokinetics (mPBPK) model for pembrolizumab.
  • mPBPK minimal physiologically-based pharmacokinetics
  • Fig.4 is a schematic diagram showing the additional LAG3 receptor added to the mPBPK model for PD1-LAG3.
  • Fig.5 is a table showing an overview of adverse events in safety evaluable patients in the dose escalation (Part A1 , Q2W) portion of the NP41300 study.
  • Fig.6 is a table showing an overview of adverse events in safety evaluable patients in the dose escalation (Part A1 , Q2W) portion of the NP41300 study.
  • Fig.7 is a set of box plots showing predicted Ctrough after the first and third administrations PD1- LAG3 at a dose of 600 mg or 1200 mg in a Q2W (every 2 weeks) or Q3W (every 3 weeks) dosing regimen.
  • the lower and upper hinges correspond to the first and third quartiles (the 25th and 75th percentiles).
  • the upper whisker extends from the hinge to the largest value no further than 1.5 * IQR from the hinge (where IQR is the inter-quartile range, or distance between the first and third quartiles).
  • the lower whisker extends from the hinge to the smallest value at most 1 .5 * IQR of the hinge.
  • Fig.8 is a graph showing simulated PD1 and LAG3 engagement over a range of R07247669 doses administered Q3W after 3 cycles.
  • Fig.9 is a flow chart showing the study design of the BP43963 trial in patients with melanoma.
  • Fig. 10 is a flow chart showing the study design of the G042216 clinical trial.
  • CIT cancer immunotherapy
  • HCC hepatocellular carcinoma
  • R randomization.
  • Fig. 11 is a flow chart showing the detailed study design of the G042216 clinical trial.
  • Bev bevacizumab
  • FICC hepatocellular carcinoma
  • Q2W every 2 weeks
  • Q3W every 3 weeks
  • R randomization.
  • compositions, uses, and kits involving such combinations and/or dosing regimens are also provided herein.
  • TIGIT or “T -cell immunoreceptor with Ig and ITIM domains” as used herein refers to any native TIGIT from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated. TIGIT is also known in the art as
  • the term encompasses “full- length,” unprocessed TIGIT (e.g., full-length human TIGIT having the amino acid sequence of SEQ ID NO: 20), as well as any form of TIGIT that results from processing in the cell (e.g., processed human TIGIT without a signal sequence, having the amino acid sequence of SEQ ID NO: 21 ).
  • the term also encompasses naturally occurring variants of TIGIT, e.g., splice variants or allelic variants.
  • the amino acid sequence of an exemplary human TIGIT may be found under UniProt Accession Number Q495A1 .
  • tiragolumab is a fully human lgG1/kappa MAb-derived in Open Monoclonal Technology (OMT) rats that binds TIGIT and comprises the heavy chain sequence of SEQ ID NO: 23 and the light chain sequence of SEQ ID NO: 24.
  • Tiragolumab comprises two N-linked glycosylation sites (N306) in the Fc domain. Tiragolumab is also described in WHO Drug Information (International Nonproprietary Names for Pharmaceutical Substances), Proposed INN: List 117, Vol. 31 , No. 2, published July 7, 2017 (see page 343).
  • anti-TIGIT antagonist antibody refers to an antibody or an antigen-binding fragment or variant thereof that is capable of binding TIGIT with sufficient affinity such that it substantially or completely inhibits the biological activity of TIGIT.
  • an anti-TIGIT antagonist antibody may block signaling through PVR, PVRL2, and/or PVRL3 so as to restore a functional response by T-cells (e.g., proliferation, cytokine production, target cell killing) from a dysfunctional state to antigen stimulation.
  • an anti-TIGIT antagonist antibody may block signaling through PVR without impacting PVR- CD226 interaction.
  • an anti- TIGIT antagonist antibody may antagonize one TIGIT activity without affecting another TIGIT activity.
  • an anti-TIGIT antagonist antibody for use in certain of the methods or uses described herein is an anti-TIGIT antagonist antibody that antagonizes TIGIT activity in response to one of PVR interaction, PVRL3 interaction, or PVRL2 interaction, e.g., without affecting or minimally affecting any of the other TIGIT interactions.
  • the extent of binding of an anti-TIGIT antagonist antibody to an unrelated, non-TIGIT protein is less than about 10% of the binding of the antibody to TIGIT as measured, e.g., by a radioimmunoassay (RIA).
  • RIA radioimmunoassay
  • an anti-TIGIT antagonist antibody that binds to TIGIT has a dissociation constant (KD) of ⁇ 1 mM, ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g., 10 -8 M or less, e.g., from 10 -8 M to 10 -13 M, e.g., from 10 -9 M to 10 -13 M).
  • KD dissociation constant
  • an anti-TIGIT antagonist antibody binds to an epitope of TIGIT that is conserved among TIGIT from different species or an epitope on TIGIT that allows for cross-species reactivity.
  • the anti-TIGIT binding antibody has intact Fc-mediated effector function (e.g., tiragolumab, vibostolimab, etigilimab, EOS084448, or TJ-T6). In some aspects, the anti-TIGIT binding antibody has enhanced Fc- mediated effector function (e.g., SGN-TGT). In other aspects, the anti-TIGIT binding antibody lacks Fc- mediated effector function (e.g., domvanalimab, BMS-986207, ASP8374, or COM902).
  • the anti-TIGIT binding antibody is an IgG 1 class antibody (e.g., tiragolumab, vibostolimab, domvanalimab, BMS-986207, etigilimab, BGB-A1217, SGN-TGT, EOS084448 (EOS-448), TJ-T6, or AB308).
  • the anti-TIGIT binding antibody is an lgG4 class antibody (e.g., ASP8374 or COM902).
  • the anti-TIGIT antagonist antibody is tiragolumab.
  • PD-1 axis binding antagonist refers to a molecule that inhibits the interaction of a PD-1 axis binding partner with either one or more of its binding partners, so as to remove T-cell dysfunction resulting from signaling on the PD-1 signaling axis, with a result being to restore or enhance T-cell function (e.g., proliferation, cytokine production, and/or target cell killing).
  • a PD-1 axis binding antagonist includes a PD-L1 binding antagonist, a PD-1 binding antagonist, and a PD-L2 binding antagonist.
  • the PD-1 axis binding antagonist includes a PD-L1 binding antagonist or a PD-1 binding antagonist.
  • the PD-1 axis binding antagonist is a PD-L1 binding antagonist.
  • PD-L1 binding antagonist refers to a molecule that decreases, blocks, inhibits, abrogates, or interferes with signal transduction resulting from the interaction of PD-L1 with either one or more of its binding partners, such as PD-1 and/or B7-1.
  • a PD-L1 binding antagonist is a molecule that inhibits the binding of PD-L1 to its binding partners.
  • the PD-L1 binding antagonist inhibits binding of PD-L1 to PD-1 and/or B7-1.
  • the PD-L1 binding antagonists include anti-PD-L1 antibodies, antigen-binding fragments thereof, immunoadhesins, fusion proteins, oligopeptides and other molecules that decrease, block, inhibit, abrogate or interfere with signal transduction resulting from the interaction of PD-L1 with one or more of its binding partners, such as PD-1 and/or B7-1.
  • a PD-L1 binding antagonist reduces the negative co-stimulatory signal mediated by or through cell surface proteins expressed on T lymphocytes mediated signaling through PD- L1 so as to render a dysfunctional T-cell less dysfunctional (e.g., enhancing effector responses to antigen recognition).
  • the PD-L1 binding antagonist binds to PD-L1.
  • a PD- L1 binding antagonist is an anti-PD-L1 antibody (e.g., an anti-PD-L1 antagonist antibody).
  • anti-PD-L1 antagonist antibodies include atezolizumab, MDX-1105, MEDI4736 (durvalumab),
  • MSB0010718C (avelumab), SHR-1316, CS1001 , envafolimab, TQB2450, ZKAB001 , LP-002, CX-072, IMC-001, KL-A167, APL-502, cosibelimab, lodapolimab, FAZ053, TG-1501, BGB-A333, BCD-135, AK- 106, LDP, GR1405, HLX20, MSB2311, RC98, PDL-GEX, KD036, KY1003, YBL-007, and HS-636.
  • the anti-PD-L1 antibody is atezolizumab, MDX-1105, MEDI4736 (durvalumab), or MSB0010718C (avelumab).
  • the PD-L1 binding antagonist is MDX-1105.
  • the PD-L1 binding antagonist is MEDI4736 (durvalumab).
  • the PD-L1 binding antagonist is MSB0010718C (avelumab).
  • the PD-L1 binding antagonist may be a small molecule, e.g., GS-4224, INCB086550, MAX-10181, INCB090244, CA-170, or ABSK041 , which in some instances may be administered orally.
  • exemplary PD-L1 binding antagonists include AVA-004, MT-6035, VXM10, LYN192, GB7003, and JS-003.
  • the PD-L1 binding antagonist is atezolizumab.
  • PD-1 binding antagonist refers to a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of PD-1 with one or more of its binding partners, such as PD-L1 and/or PD-L2.
  • PD-1 (programmed death 1) is also referred to in the art as “programmed cell death 1 ,” “PDCD1 ,” “CD279,” and “SLEB2.”
  • An exemplary human PD-1 is shown in UniProtKB/Swiss-Prot Accession No. Q15116.
  • the PD-1 binding antagonist is a molecule that inhibits the binding of PD-1 to one or more of its binding partners.
  • the PD-1 binding antagonist inhibits the binding of PD-1 to PD-L1 and/or PD-L2.
  • PD-1 binding antagonists include anti-PD-1 antibodies, antigen-binding fragments thereof, immunoadhesins, fusion proteins, oligopeptides, and other molecules that decrease, block, inhibit, abrogate or interfere with signal transduction resulting from the interaction of PD-1 with PD-L1 and/or PD-L2.
  • a PD-1 binding antagonist reduces the negative co-stimulatory signal mediated by or through cell surface proteins expressed on T lymphocytes mediated signaling through PD-1 so as render a dysfunctional T-cell less dysfunctional (e.g., enhancing effector responses to antigen recognition).
  • the PD-1 binding antagonist binds to PD-1.
  • the PD-1 binding antagonist is an anti-PD-1 antibody (e.g., an anti-PD-1 antagonist antibody).
  • anti-PD-1 antagonist antibodies include nivolumab, pembrolizumab, MEDI-0680, PDR001 (spartalizumab), REGN2810 (cemiplimab), BGB-108, prolgolimab, camrelizumab, sintilimab, tislelizumab, toripalimab, dostarlimab, retifanlimab, sasanlimab, penpulimab, CS1003, HLX10, SCT-I10A, zimberelimab, balstilimab, genolimzumab, Bl 754091, cetrelimab, YBL-006, BAT1306, HX008, budigalimab, AMG 404, CX-188, JTX-4014, 609A, Sym021, LZM009, F520, SG001 , AM0001 , ENUM 244C8, ENUM 388D4, STI-1110,
  • a PD-1 binding antagonist is MDX-1106 (nivolumab). In another specific aspect, a PD-1 binding antagonist is MK-3475 (pembrolizumab). In another specific aspect, a PD-1 binding antagonist is a PD-L2 Fc fusion protein, e.g., AMP-224. In another specific aspect, a PD-1 binding antagonist is MED1- 0680. In another specific aspect, a PD-1 binding antagonist is PDR001 (spartalizumab). In another specific aspect, a PD-1 binding antagonist is REGN2810 (cemiplimab). In another specific aspect, a PD-1 binding antagonist is BGB-108.
  • a PD-1 binding antagonist is prolgolimab. In another specific aspect, a PD-1 binding antagonist is camrelizumab. In another specific aspect, a PD-1 binding antagonist is sintilimab. In another specific aspect, a PD-1 binding antagonist is tislelizumab. In another specific aspect, a PD-1 binding antagonist is toripalimab.
  • Other additonal exemplary PD-1 binding antagonists include BION-004, CB201 , AUNP-012, ADG104, and LBL-006.
  • PD-L2 binding antagonist refers to a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of PD-L2 with either one or more of its binding partners, such as PD-1.
  • PD-L2 (programmed death ligand 2) is also referred to in the art as “programmed cell death 1 ligand 2,” “PDCD1 LG2,” “CD273,” “B7-DC,” “Btdc,” and “PDL2.”
  • An exemplary human PD-L2 is shown in UniProtKB/Swiss-Prot Accession No. Q9BQ51.
  • a PD-L2 binding antagonist is a molecule that inhibits the binding of PD-L2 to one or more of its binding partners.
  • the PD-L2 binding antagonist inhibits binding of PD-L2 to PD-1.
  • Exemplary PD-L2 antagonists include anti-PD-L2 antibodies, antigen binding fragments thereof, immunoadhesins, fusion proteins, oligopeptides and other molecules that decrease, block, inhibit, abrogate or interfere with signal transduction resulting from the interaction of PD-L2 with either one or more of its binding partners, such as PD-1.
  • a PD-L2 binding antagonist reduces the negative co-stimulatory signal mediated by or through cell surface proteins expressed on T lymphocytes mediated signaling through PD-L2 so as render a dysfunctional T-cell less dysfunctional (e.g., enhancing effector responses to antigen recognition).
  • the PD-L2 binding antagonist binds to PD-L2.
  • a PD-L2 binding antagonist is an immunoadhesin.
  • a PD-L2 binding antagonist is an anti- PD-L2 antagonist antibody.
  • the terms “programmed death ligand 1” and “PD-L1” refer herein to native sequence human PD- L1 polypeptide.
  • Native sequence PD-L1 polypeptides are provided under Uniprot Accesion No. Q9NZQ7.
  • the native sequence PD-L1 may have the amino acid sequence as set forth in Uniprot Accesion No. Q9NZQ7-1 (isoform 1) (SEQ ID NO: 22).
  • the native sequence PD-L1 may have the amino acid sequence as set forth in Uniprot Accesion No. Q9NZQ7-2 (isoform 2).
  • the native sequence PD-L1 may have the amino acid sequence as set forth in Uniprot Accesion No.
  • PD-L1 is also referred to in the art as “programmed cell death 1 ligand 1 ,” “PDCD1 LG1 ,” “CD274,” “B7-H,” and “PDL1
  • the Kabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) (e.g., Kabat et al ., Sequences of Immunological Interest. 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991 )).
  • the “EU numbering system” or “EU index” is generally used when referring to a residue in an immunoglobulin heavy chain constant region (e.g., the EU index reported in Kabat et al., supra).
  • the “EU index as in Kabat” refers to the residue numbering of the human IgG 1 EU antibody.
  • atezolizumab is an Fc-engineered, humanized, non-glycosylated IgG 1 kappa immunoglobulin that binds PD-L1 and comprises the heavy chain sequence of SEQ ID NO: 62 and the light chain sequence of SEQ ID NO: 63.
  • Atezolizumab comprises a single amino acid substitution (asparagine to alanine) at position 297 on the heavy chain (N297A) using EU numbering of Fc region amino acid residues, which results in a non-glycosylated antibody that has minimal binding to Fc receptors.
  • Atezolizumab is also described in WHO Drug Information (International Nonproprietary Names for Pharmaceutical Substances), Proposed INN: List 112, Vol. 28, No. 4, published January 16, 2015 (see page 485).
  • cancer refers to a disease caused by an uncontrolled division of abnormal cells in a part of the body.
  • the cancer is skin cancer (e.g., melanoma, basal cell carcinoma (BCC), squamous cell carcinoma, cutaneous T-cell lymphoma, dermatofibrosarcoma protuberans (DFSP), Merkel cell carcinoma, or sebaceous carcinoma).
  • the cancer is a liver cancer (e.g., hepatocellular carcinoma (HCC), e.g., locally advanced or metastatic HCC and/or unresectable HCC).
  • HCC hepatocellular carcinoma
  • Cancers include solid tumor cancers and non-solid tumor cancers and locally advanced or metastatic cancers (e.g., locally advanced or metastatic tumors).
  • cancer examples include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include, but are not limited to urothelial carcinoma (UC), including locally advanced and metastatic UC (mUC), bladder cancer (e.g., muscle invasive bladder cancer (MIBC) and non-muscle invasive bladder cancer (NMIBC), e.g., BCG-refractory NMIBC), MIBC urothelial bladder cancer (UBC); kidney or renal cancer (e.g., renal cell carcinoma (RCC)); cancer of the urinary tract; lung cancer, such as small cell lung cancer (SCLC), which includes extensive stage SCLC (ES-SCLC); non small cell lung cancer (NSCLC), which includes squamous NSCLC or non-squamous NSCLC, including locally advanced unresectable NSCLC (e.g., Stage NIB NSCLC), or recurrent or metastatic NSCLC (e.g
  • the cancer e.g., the skin cancer (e.g., melanoma) or liver cancer (e.g., HCC)
  • the cancer is a tumor having a tumor microenvironment comprising LAG3-expressing CD8+ T cells.
  • the cancer may be unresectable (e.g., unresectable locally advanced or metastatic cancer).
  • cancers include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of cancers include, but are not limited to, esophageal cancer (e.g., squamous cell carcinoma (e.g., esophageal squamous-cell carcinoma (ESCC)), adenocarcinoma (e.g., esophageal adenocarcinoma (EAC)), or esophageal cancers having neuroendocrine histopathology (e.g., esophageal neuroendocrine carcinoma (ENEC)).
  • esophageal cancer e.g., squamous cell carcinoma (e.g., esophageal squamous-cell carcinoma (ESCC)
  • adenocarcinoma e.g., esophageal adenocarcinoma (EAC)
  • metastatic esophageal cancer e.g., metastatic ESCC, metastatic EAC, or metastatic ENEC
  • the cancer is a colorectal cancer (CRC).
  • CRC colorectal cancer
  • colon cancer colon cancer
  • bowel cancer refers to a cancer that develops from the large intestine, e.g., the colon or rectum (e.g., colorectal adenomacarcinoma).
  • cancers include, but are not limited to, hematologic cancers, such as mature B cell cancers, excluding Hodgkin’s lymphoma, but including non-Hodgkin’s lymphoma (NHL), such as diffuse large B cell lymphoma (DLBCL), which may be relapsed or refractory DLBCL or a Richter’s transformation.
  • NHL non-Hodgkin’s lymphoma
  • DLBCL diffuse large B cell lymphoma
  • cancer also include germinal-center B cell-like (GCB) diffuse large B cell lymphoma (DLBCL), activated B cell-like (ABC) DLBCL, follicular lymphoma (FL), transformed FL, mantle cell lymphoma (MCL), acute myeloid leukemia (AML), chronic lymphoid leukemia (CLL), marginal zone lymphoma (MZL), transformed MZL, high grade B-cell lymphoma, primary mediastinal (thymic) large B cell lymphoma (PMLBCL), small lymphocytic leukemia (SLL), lymphoplasmacytic lymphoma (LL), transformed LL, Waldenstrom macroglobulinemia (WM), central nervous system lymphoma (CNSL), Burkitt’s lymphoma (BL), B cell prolymphocytic leukemia, splenic marginal zone lymphoma, hairy cell leukemia, splenic lymphoma/leukemia, unclassifiable,
  • cancers include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies, including B cell lymphomas. More particular examples of such cancers include, but are not limited to, multiple myeloma (MM); low-grade/follicular NHL; small lymphocytic (SL) NHL; intermediate- grade/follicular NHL; intermediate-grade diffuse NHL; high-grade immunoblastic NHL; high-grade lymphoblastic NHL; high-grade small non-cleaved cell NHL; bulky disease NHL; AIDS-related lymphoma; and acute lymphoblastic leukemia (ALL); chronic myeloblastic leukemia; and post-transplant lymphoproliferative disorder (PTLD).
  • MM multiple myeloma
  • SL small lymphocytic
  • NHL intermediate- grade/follicular NHL
  • intermediate-grade diffuse NHL high-grade immunoblastic NHL
  • high-grade lymphoblastic NHL high-grade small non-clea
  • B cell proliferative disorder or “B cell malignancy” refer to disorders that are associated with some degree of abnormal B cell proliferation and include, for example, lymphomas, leukemias, myelomas, and myelodysplastic syndromes.
  • the B cell proliferative disorder is a lymphoma, such as non-Hodgkin’s lymphoma (NHL), including, for example, follicular lymphoma (FL) (e.g., a relapsed and/or refractory FL or transformed FL), diffuse large B cell lymphoma (DLBCL) (e.g., a relapsed or refractory DLBCL or a Richter’s transformation), MCL, high grade B-cell lymphoma, or PMLBCL).
  • NHL non-Hodgkin’s lymphoma
  • FL follicular lymphoma
  • DLBCL diffuse large B cell lymphoma
  • MCL high grade B-cell lymphoma
  • PMLBCL high grade B-cell lymphoma
  • the B cell proliferative disorder is a leukemia, such as chronic lymphocytic leukemia (CLL).
  • CLL chronic lymphocytic leukemia
  • tumor refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre
  • Tumor cell refers to any tumor cell present in a tumor or a sample thereof. Tumor cells may be distinguished from other cells that may be present in a tumor sample, for example, stromal cells and tumor-infiltrating immune cells, using methods known in the art and/or described herein.
  • Tumor immunity refers to the process in which tumors evade immune recognition and clearance. Thus, as a therapeutic concept, tumor immunity is “treated” when such evasion is attenuated, and the tumors are recognized and attacked by the immune system. Examples of tumor recognition include tumor binding, tumor shrinkage, and tumor clearance.
  • Metastasis is meant the spread of cancer from its primary site to other places in the body. Cancer cells can break away from a primary tumor, penetrate into lymphatic and blood vessels, circulate through the bloodstream, and grow in a distant focus (metastasize) in normal tissues elsewhere in the body. Metastasis can be local or distant. Metastasis is a sequential process, contingent on tumor cells breaking off from the primary tumor, traveling through the bloodstream, and stopping at a distant site. At the new site, the cells establish a blood supply and can grow to form a life-threatening mass. Both stimulatory and inhibitory molecular pathways within the tumor cell regulate this behavior, and interactions between the tumor cell and host cells in the distant site are also significant.
  • treating comprises effective cancer treatment with an effective amount of a therapeutic agent (e.g., a bispecific antibody targeting PD-1 and LAG3)).
  • a therapeutic agent e.g., a bispecific antibody targeting PD-1 and LAG3
  • Treating herein includes, inter alia, adjuvant therapy, neoadjuvant therapy, non-metastatic cancer therapy (e.g., locally advanced cancer therapy), and metastatic cancer therapy.
  • the treatment may be first-line treatment (e.g., the patient may be previously untreated or not have received prior systemic therapy), or second line or later treatment.
  • an “effective amount” refers to the amount of a therapeutic agent (e.g., a a bispecific antibody targeting PD-1 and LAG3 or a combination of therapeutic agents (e.g., a bispecific antibody targeting PD-1 and LAG3and an anti-TIG IT antagonist antibody, tiragolumab or a VEGF antagonist, e.g., an anti-VEGF antibody (e.g., bevacizumab)), that achieves a therapeutic result.
  • a therapeutic agent e.g., a a bispecific antibody targeting PD-1 and LAG3 or a combination of therapeutic agents (e.g., a bispecific antibody targeting PD-1 and LAG3and an anti-TIG IT antagonist antibody, tiragolumab or a VEGF antagonist, e.g., an anti-VEGF antibody (e.g., bevacizumab)
  • a therapeutic agent e.g., a bispecific antibody targeting PD-1 and LAG3 or a combination of therapeutic agents
  • the effective amount of a therapeutic agent or a combination of therapeutic agents is the amount of the agent or of the combination of agents that achieves a clinical endpoint of improved pathologic response rate (PRR), improved overall response rate (ORR), improved disease control rate (DCR), a complete response (CR), a pathological complete response (pCR), a partial response (PR), improved survival (e.g., disease- free survival (DFS), and/or progression-free survival (PFS) and/or overall survival (OS)), and/or improved duration of response (DOR).
  • PRR pathologic response rate
  • ORR improved overall response rate
  • DCR disease control rate
  • CR complete response
  • pCR pathological complete response
  • PR partial response
  • improved survival e.g., disease- free survival (DFS), and/or progression-free survival (PFS) and/or overall survival (OS)
  • DOR improved duration of response
  • partial response and “PR” refers to at least a 30% decrease in the sum of the longest diameters (SLD) of target lesions, taking as reference the baseline SLD prior to treatment.
  • progressive disease and “PD” refers to at least a 20% increase in the SLD of target lesions, taking as reference the smallest sum on study (nadir), including baseline. The appearance of one or more new lesions may also be considered PD.
  • stable disease and “SD” refers to neither sufficient shrinkage to qualify for PR nor sufficient increase to qualify for PD, taking as reference the smallest sum.
  • DCR disease control rate
  • PR metastatic cancer
  • SD stable disease
  • DCR may be defined as the proportion of patients with SD for >12 weeks or a CR or PR, as determined by the investigator according to RECIST v1.1.
  • all response rate refers interchangeably to the sum of CR rate and PR rate.
  • objective response may be defined as a CR or PR per Response Evaluation Criteria in Solid Tumors (RECIST) v.1.1 , as determined by investigator assessment and confirmed by repeat assessment > 4 weeks after initial documentation.
  • ORR may be defined as the proportion of patients with CR or PR on two consecutive occasions >4 weeks apart, as determined by the investigator according to RECIST v1.1.
  • pathologic response rate and “pRR” refer interchangeably to the proportion of patients with pathologic complete response (pCR, e.g., a complete absence of viable tumor in the treated tumor bed), pathologic near complete response (pnCR, e.g., ⁇ 10% of of the treated tumor bed is occupied by viable tumor cells), and pathologic partial response (pPR, e.g., ⁇ 50% of the treated tumor bed is occupied by viable tumor cells), e.g., at the time of surgery.
  • pCR pathologic complete response
  • pnCR pathologic near complete response
  • pPR pathologic partial response
  • progression-free survival and “PFS” refer to the length of time during and after treatment during which the cancer does not get worse.
  • PFS may include the amount of time patients have experienced a CR or a PR, as well as the amount of time patients have experienced stable disease.
  • PFS may be defined as the time from the first study treatment to the first occurrence of progression or death from any cause, whichever occurs first, per RECIST v.1.1 as determined by the investigator.
  • PFS may be defined as the time from study enrollment to the first occurrence of progression or death from any cause, whichever occurs first, per RECIST v.1.1 as determined by the investigator.
  • overall survival and “OS” refer to the length of time from either the date of diagnosis or the start of treatment for a disease (e.g., cancer) that the patient is still alive.
  • OS may be defined as the time from first study treatment to death from any cause.
  • DOR refers to a length of time from documentation of a tumor response until disease progression or death from any cause, whichever occurs first.
  • DOR may be defined as the time from the first occurrence of a documented objective response to the time of the first documented disease progression or death from any cause, whichever occurs first, per RECIST v1.1 as determined by the investigator.
  • chemotherapeutic agent refers to a compound useful in the treatment of cancer.
  • chemotherapeutic agents include EGFR inhibitors (including small molecule inhibitors (e.g., erlotinib (TARCEVA®, Genentech/OSI Pharm.); PD 183805 (Cl 1033, 2-propenamide, N- [4-[(3-chloro-4-fluorophenyl)amino]-7-[3-(4-morpholinyl)propoxy]-6-quinazolinyl]-, dihydrochloride, Pfizer Inc.); ZD1839, gefitinib (IRESSA®) 4-(3’-Chloro-4’-fluoroanilino)-7-methoxy-6-(3- morpholinopropoxy)quinazoline, AstraZeneca); ZM 105180 ((6-amino-4-(3-methylphenyl-amino)- quinazoline, Zeneca
  • a tyrosine kinase inhibitor e.g., an EGFR inhibitor; a small molecule HER2 tyrosine kinase inhibitor such as TAK165 (Takeda); CP- 724,714, an oral selective inhibitor of the ErbB2 receptor tyrosine kinase (Pfizer and OSI); dual-HER inhibitors such as EKB-569 (available from Wyeth) which preferentially binds EGFR but inhibits both HER2 and EGFR-overexpressing cells; PKI-166 (Novartis); pan-HER inhibitors such as canertinib (Cl- 1033; Pharmacia); Raf-1 inhibitors such as antisense agent ISIS-5132 (ISIS Pharmaceuticals) which inhibit Raf-1 signaling; non-HER-targeted tyrosine kinas
  • a tyrosine kinase inhibitor e.g., an EGFR inhibitor; a small HER2 tyrosine kina
  • Chemotherapeutic agents also include (i) anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including NOLVADEX®; tamoxifen citrate), raloxifene, droloxifene, iodoxyfene, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone, and FARESTON® (toremifine citrate); (ii) aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)-imidazoles, aminoglutethimide, MEGASE® (megestrol acetate), AROMASIN® (exemestane; Pfizer), formestanie, fadrozole, RIVISOR® (vorozole), FEMARA® (let
  • vaccines such as gene therapy vaccines, for example, ALLOVECTIN®, LEUVECTIN®, and VAXID®;
  • growth inhibitory agents including vincas (e.g., vincristine and vinblastine), NAVELBINE®
  • taxanes e.g., paclitaxel, nab-paclitaxel, and docetaxel
  • topoisomerase II inhibitors e.g., doxorubicin, epirubicin, daunorubicin, etoposide, and bleomycin
  • DNA alkylating agents e.g., tamoxigen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C
  • pharmaceutically acceptable salts, acids, prodrugs, and derivatives of any of the above e.g., paclitaxel, nab-paclitaxel, and docetaxel
  • topoisomerase II inhibitors e.g., doxorubicin, epirubicin, daunorubicin, etoposide, and bleomycin
  • DNA alkylating agents e.g., tamoxigen
  • Cytotoxic agent refers to any agent that is detrimental to cells (e.g., causes cell death, inhibits proliferation, or otherwise hinders a cellular function).
  • Cytotoxic agents include, but are not limited to, radioactive isotopes (e.g., At 211 , I 131 , 1 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 , Pb 212 and radioactive isotopes of Lu); chemotherapeutic agents; enzymes and fragments thereof such as nucleolytic enzymes; and toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof.
  • radioactive isotopes e.g., At 211 , I 131 , 1 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 , Pb 212 and radio
  • Exemplary cytotoxic agents can be selected from anti-microtubule agents, platinum coordination complexes, alkylating agents, antibiotic agents, topoisomerase II inhibitors, antimetabolites, topoisomerase I inhibitors, hormones and hormonal analogues, signal transduction pathway inhibitors, non-receptor tyrosine kinase angiogenesis inhibitors, immunotherapeutic agents, proapoptotic agents, inhibitors of LDH-A, inhibitors of fatty acid biosynthesis, cell cycle signaling inhibitors, HDAC inhibitors, proteasome inhibitors, and inhibitors of cancer metabolism.
  • the cytotoxic agent is a platinum-based chemotherapeutic agent (e.g., carboplatin or cisplatin).
  • the cytotoxic agent is an antagonist of EGFR, e.g., N-(3- ethynylphenyl)-6,7-bis(2-methoxyethoxy)quinazolin-4-amine (e.g., erlotinib).
  • the cytotoxic agent is a RAF inhibitor, e.g., a BRAF and/or CRAF inhibitor.
  • the RAF inhibitor is vemurafenib.
  • the cytotoxic agent is a PI3K inhibitor.
  • the term “patient” or “subject” refers to a human patient or subject.
  • the patient or subject may be an adult.
  • antibody herein specifically covers monoclonal antibodies (including full-length monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired biological activity.
  • the antibody is a full-length monoclonal antibody.
  • IgG immunoglobulins defined by the chemical and antigenic characteristics of their constant regions.
  • antibodies can be assigned to different classes.
  • immunoglobulins There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG 1 , lgG2, lgG3, lgG4, lgA1 , and lgA2.
  • the heavy chain constant domains that correspond to the different classes of immunoglobulins are called a, g, e, y, and m, respectively.
  • An antibody may be part of a larger fusion molecule, formed by covalent or non- covalent association of the antibody with one or more other proteins or peptides.
  • full-length antibody “intact antibody,” and “whole antibody” are used herein interchangeably to refer to an antibody in its substantially intact form, not antibody fragments as defined below.
  • the terms refer to an antibody comprising an Fc region.
  • Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region.
  • the term includes native sequence Fc regions and variant Fc regions.
  • a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain.
  • antibodies produced by host cells may undergo post-translational cleavage of one or more, particularly one or two, amino acids from the C- terminus of the heavy chain.
  • an antibody produced by a host cell by expression of a specific nucleic acid molecule encoding a full-length heavy chain may include the full-length heavy chain, or it may include a cleaved variant of the full-length heavy chain. This may be the case where the final two C- terminal amino acids of the heavy chain are glycine (G446) and lysine (K447). Therefore, the C-terminal lysine (Lys447), or the C-terminal glycine (Gly446) and lysine (Lys447), of the Fc region may or may not be present.
  • a heavy chain including an Fc region as specified herein, comprised in an antibody disclosed herein comprises an additional C-terminal glycine-lysine dipeptide (G446 and K447).
  • a heavy chain including an Fc region as specified herein, comprised in an antibody disclosed herein comprises an additional C-terminal glycine residue (G446).
  • a heavy chain including an Fc region as specified herein, comprised in an antibody disclosed herein comprises an additional C-terminal lysine residue (K447).
  • the Fc region contains a single amino acid substitution N297A of the heavy chain.
  • numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.
  • naked antibody refers to an antibody that is not conjugated to a heterologous moiety (e.g., a cytotoxic moiety) or radiolabel.
  • the naked antibody may be present in a pharmaceutical composition.
  • the term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
  • each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
  • the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies in accordance with the present invention may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci.
  • hypervariable region refers to each of the regions of an antibody variable domain which are hypervariable in sequence and which determine antigen binding specificity, for example “complementarity determining regions” (“CDRs”).
  • CDRs complementarity determining regions
  • antibodies comprise six CDRs: three in the VH (CDR-H1 , CDR-H2, CDR-H3), and three in the VL (CDR-L1 , CDR-L2, CDR-L3).
  • Exemplary CDRs herein include:
  • CDRs are determined according to Kabat et al., supra.
  • CDR designations can also be determined according to Chothia, supra, McCallum, supra, or any other scientifically accepted nomenclature system.
  • “Framework” or “FR” refers to variable domain residues other than complementary determining regions (CDRs).
  • the FR of a variable domain generally consists of four FR domains: FR1 , FR2, FR3, and FR4. Accordingly, the CDR and FR sequences generally appear in the following sequence in VH (or VL): FR1 -CDR-H1 (CDR-L1 )-FR2- CDR-H2(CDR-L2)-FR3- CDR-H3(CDR-L3)-FR4.
  • variable domain residue numbering as in Kabat or “amino acid position numbering as in Kabat,” and variations thereof, refers to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al., supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or HVR of the variable domain.
  • a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g., residues 82a, 82b, and 82c, etc., according to Kabat) after heavy chain FR residue 82.
  • the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence.
  • the term “monospecific” antibody as used herein denotes an antibody that has one or more binding sites each of which bind to the same epitope of the same antigen.
  • the term “bispecific” antibody as used herein means that the antibody is able to specifically bind to at least two distinct antigens, for example two binding sites each formed by a pair of an antibody heavy chain variable domain (VH) and an antibody light chain variable domain (VL) binding to different antigens or to different epitopes on the same antigen.
  • VH antibody heavy chain variable domain
  • VL antibody light chain variable domain
  • Such a bispecific antibody is an 1+1 format.
  • bispecific antibody formats are 2+1 formats (comprising two binding sites for a first antigen or epitope and one binding site for a second antigen or epitope) or 2+2 formats (comprising two binding sites for a first antigen or epitope and two binding sites for a second antigen or epitope).
  • a bispecific antibody comprises two antigen binding sites, each of which is specific for a different antigen.
  • a “PD-L1 -positive tumor cell fraction” is the percentage of viable tumor cells showing partial or complete membrane staining (exclusive of cytoplasmic staining) at any intensity relative to all viable tumor cells present in a sample, following staining of the sample in the context of an immunohistochemical (IHC) assay, e.g., an IHC assay staining for PD-L1 using the antibody SP142, SP263, 22C3, or 28-8.
  • IHC immunohistochemical
  • non-tumor cells e.g., tumor-infiltrating immune cells, normal cells, necrotic cells, and debris
  • any given diagnostic PD-L1 antibody may correspond with a particular IHC assay protocol and/or scoring terminology that can be used to derive a PD-L1 -positive tumor cell fraction.
  • a PD- L1 -positive tumor cell fraction can be derived from a tumor cell sample stained with SP263, 22C3, SP142, or 28-8 using OPTIVIEW® detection on Benchmark ULTRA, EnVision Flex on AutostainerLink 48, OPTIVIEW® detection and amplification on Benchmark ULTRA, or EnVision Flex on AutostainerLink 48, respectively.
  • Ventana SP142 IHC assay is conducted according to the Ventana PD-L1 (SP142) Assay package insert (Tucson, AZ: Ventana Medical Systems, Inc.), which is incorporated herein by reference in its entirety.
  • Ventana SP263 IHC assay is conducted according to the Ventana PD-L1 (SP263) Assay package insert (Tucson, AZ: Ventana Medical Systems, Inc.), which is incorporated herein by reference in its entirety.
  • the “pharmDx 22C3 IHC assay” is conducted according to the PD-L1 IHC 22C3 pharmDx package insert (Carpinteria, CA: Dako, Agilent Pathology Solutions), which is incorporated herein by reference in its entirety.
  • the “pharmDx 28-8 IHC assay” is conducted according to the PD-L1 IHC 28-8 pharmDx package insert (Carpinteria, CA: Dako, Agilent Pathology Solutions), which is incorporated herein by reference in its entirety.
  • package insert is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
  • “in combination with” refers to administration of one treatment modality in addition to another treatment modality, for example, a treatment regimen that includes administration of a bispecific antibody targeting programmed cell death protein 1 (PD-1) and lymphocyte activation gene-3 (LAG3) and an anti-TIG IT antagonist antibody (e.g., tiragolumab) or a VEGF antagonist, e.g., an anti- VEGF antibody (e.g., bevacizumab).
  • PD-1 programmed cell death protein 1
  • LAG3 lymphocyte activation gene-3
  • an anti-TIG IT antagonist antibody e.g., tiragolumab
  • a VEGF antagonist e.g., an anti- VEGF antibody (e.g., bevacizumab).
  • “in combination with” refers to administration of one treatment modality before, during, or after administration of the other treatment modality to the patient.
  • a drug that is administered “concurrently” with one or more other drugs is administered during the same treatment cycle, on the same day of treatment, as the one or more other drugs, and, optionally, at the same time as the one or more other drugs.
  • the concurrently administered drugs are each administered on day 1 of a 3-week cycle.
  • AE refers to any unfavorable and unintended sign (including an abnormal laboratory finding), symptom, or disease temporally associated with the use of a medical treatment or procedure that may or may not be considered related to the medical treatment or procedure.
  • Adverse events may be classified by “grade,” as defined by the National Cancer Institute Common Terminology Criteria for Adverse Events v4.0 or v5.0 (NIH CTCAE).
  • the AE is a low-grade AE, e.g., a Grade 1 or Grade 2 AE.
  • Grade 1 includes AEs that are asymptomatic or have mild symptoms.
  • Grade 2 includes AEs that are moderate and limit age-appropriate instrumental activities of daily living (e.g., preparing meals, shopping for groceries or clothes) and that indicate local or noninvasive intervention.
  • the AE is a high-grade AE, e.g., a Grade 3, Grade 4, or Grade 5 AE.
  • the AE is a Grade 3 or a Grade 4 AE.
  • Grade 3 includes AEs that are severe or medically significant, but not immediately life-threatening, and that indicate hospitalization or prolongation of hospitalization.
  • Grade 4 includes AEs that have life-threatening consequences and indicate urgent intervention.
  • Grade 5 includes AEs that result in or relate to death.
  • treatment-related AE refers to an AE that is judged by an investigator to have occurred as a result of a treatment, e.g., a PD-1 axis binding antagonist therapy (e.g., atezolizumab therapy) and/or an anti-TIG IT antagonist antibody therapy (e.g., tiragolumab therapy).
  • a PD-1 axis binding antagonist therapy e.g., atezolizumab therapy
  • an anti-TIG IT antagonist antibody therapy e.g., tiragolumab therapy
  • bispecific antibodies as used within the current application denotes the presence of a specified number of binding domains in an antigen binding molecule.
  • bispecific antibodies are at least “bivalent” and may be “trivalent” or “multivalent” (e.g., “tetravalent” or “hexavalent”).
  • the antibodies of the present invention have two or more binding sites and are bispecific. That is, the antibodies may be bispecific even in cases where there are more than two binding sites (i.e. , that the antibody is trivalent or multivalent).
  • antibody fragment refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds.
  • antibody fragments include but are not limited to Fv, Fab, Fab', Fab’-SH, F(ab')2; diabodies, triabodies, tetrabodies, cross-Fab fragments; linear antibodies; single-chain antibody molecules (e.g., scFv); multispecific antibodies formed from antibody fragments and single domain antibodies.
  • Diabodies are antibody fragments with two antigen-binding domains that may be bivalent or bispecific, see, for example, EP 404,097; WO 1993/01161 ; Hudson et al., Nat Med 9, 129-134 (2003); and Hollinger et al., Proc Natl Acad Sci USA 90, 6444-6448 (1993). Triabodies and tetrabodies are also described in Hudson et al., Nat Med 9, 129-134 (2003).
  • Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody.
  • a single-domain antibody is a human single-domain antibody (Domantis, Inc., Waltham,
  • antibody fragments comprise single chain polypeptides having the characteristics of a VH domain, namely being able to assemble together with a VL domain, or of a VL domain, namely being able to assemble together with a VH domain to a functional antigen binding site and thereby providing the antigen binding property of full-length antibodies.
  • Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g., E. coli or phage), as described herein.
  • Papain digestion of intact antibodies produces two identical antigen-binding fragments, called “Fab” fragments containing each the heavy- and light-chain variable domains and also the constant domain of the light chain and the first constant domain (CH1 ) of the heavy chain.
  • Fab fragment refers to an antibody fragment comprising a light chain fragment comprising a VL domain and a constant domain of a light chain (CL), and a VH domain and a first constant domain (CH1 ) of a heavy chain.
  • Fab’ fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CH1 domain including one or more cysteins from the antibody hinge region.
  • Fab’-SH are Fab’ fragments wherein the cysteine residue(s) of the constant domains bear a free thiol group. Pepsin treatment yields an F(ab')2 fragment that has two antigen-combining sites (two Fab fragments) and a part of the Fc region.
  • cross-Fab fragment or “xFab fragment” or “crossover Fab fragment” refers to a Fab fragment, wherein either the variable regions or the constant regions of the heavy and light chain are exchanged.
  • Two different chain compositions of a crossover Fab molecule are possible and comprised in the bispecific antibodies of the invention: On the one hand, the variable regions of the Fab heavy and light chain are exchanged, i.e. , the crossover Fab molecule comprises a peptide chain composed of the light chain variable region (VL) and the heavy chain constant region (CH1), and a peptide chain composed of the heavy chain variable region (VH) and the light chain constant region (CL).
  • This crossover Fab molecule is also referred to as CrossFab ⁇ VLVH).
  • the crossover Fab molecule comprises a peptide chain composed of the heavy chain variable region (VH) and the light chain constant region (CL), and a peptide chain composed of the light chain variable region (VL) and the heavy chain constant region (CH1 ).
  • This crossover Fab molecule is also referred to as CrossFab (CLCHI).
  • a “single chain Fab fragment” or “scFab” is a polypeptide consisting of an antibody heavy chain variable domain (VH), an antibody constant domain 1 (CH1 ), an antibody light chain variable domain (VL), an antibody light chain constant domain (CL) and a linker, wherein said antibody domains and said linker have one of the following orders in N-terminal to C-terminal direction: a) VH-CH1 -linker-VL-CL, b) VL-CL- linker-VH-CH1 , c) VH-CL-linker-VL-CH1 or d) VL-CH1 -linker-VH-CL; and wherein said linker is a polypeptide of at least 30 amino acids, preferably between 32 and 50 amino acids.
  • Said single chain Fab fragments are stabilized via the natural disulfide bond between the CL domain and the CH1 domain.
  • these single chain Fab molecules might be further stabilized by generation of interchain disulfide bonds via insertion of cysteine residues (e.g., position 44 in the variable heavy chain and position 100 in the variable light chain according to Kabat numbering).
  • a “crossover single chain Fab fragment” or “x-scFab” is a is a polypeptide consisting of an antibody heavy chain variable domain (VH), an antibody constant domain 1 (CH1 ), an antibody light chain variable domain (VL), an antibody light chain constant domain (CL) and a linker, wherein said antibody domains and said linker have one of the following orders in N-terminal to C-terminal direction: a) VH-CL- linker-VL-CH1 and b) VL-CH1 -linker-VH-CL; wherein VH and VL form together an antigen-binding domain which binds specifically to an antigen and wherein said linker is a polypeptide of at least 30 amino acids.
  • these x-scFab molecules might be further stabilized by generation of interchain disulfide bonds via insertion of cysteine residues (e.g., position 44 in the variable heavy chain and position 100 in the variable light chain according to Kabat numbering).
  • a “single-chain variable fragment (scFv)” is a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of an antibody, connected with a short linker peptide of ten to about 25 amino acids.
  • the linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa. This protein retains the specificity of the original antibody, despite removal of the constant regions and the introduction of the linker.
  • scFv antibodies are, e.g., described in Houston, J.S., Methods in Enzymol. 203 (1991) 46-96).
  • antibody fragments comprise single chain polypeptides having the characteristics of a VH domain, namely being able to assemble together with a VL domain, or of a VL domain, namely being able to assemble together with a VH domain to a functional antigen binding site and thereby providing the antigen binding property of full-length antibodies.
  • a single-domain antibody is an antibody fragment consisting of a single monomeric variable antibody domain.
  • the first single domains were derived from the variable domain of the antibody heavy chain from camelids (nanobodies or VHH fragments).
  • the term single-domain antibody includes an autonomous human heavy chain variable domain (aVH) or VNAR fragments derived from sharks.
  • Fibronectin is a scaffold which can be engineered to bind to antigen.
  • Adnectins consists of a backbone of the natural amino acid sequence of the 10th domain of the 15 repeating units of human fibronectin type III (FN3). Three loops at one end of the b-sandwich can be engineered to enable an Adnectin to specifically recognize a therapeutic target of interest. For further details see Protein Eng. Des.
  • Peptide aptamers are combinatorial recognition molecules that consist of a constant scaffold protein, typically thioredoxin (TrxA) which contains a constrained variable peptide loop inserted at the active site.
  • TrxA thioredoxin
  • Microbodies are derived from naturally occurring microproteins of 25-50 amino acids in length which contain 3-4 cysteine bridges - examples of microproteins include KalataBI and conotoxin and knottins. The microproteins have a loop which can beengineered to include upto 25 amino acids without affecting the overall fold of the microprotein. For further details of engineered knottin domains, see W02008098796.
  • a bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3
  • a bispecific antibody that specifically binds PD-1 and LAG3 “bispecific antigen binding molecule specific for PD-1 and LAG3” or an “anti-PD-1/anti-LAG3 antibody” are used interchangeably herein and refer to a bispecific antibody that is capable of binding PD-1 and LAG3 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting PD-1 and LAG3.
  • PD-1 also known as Programmed cell death protein 1
  • programmed cell death protein 1 is a type I membrane protein of 288 amino acids that was first described in 1992 (Ishida et al., EMBO J., 11 (1992), 3887-3895).
  • PD-1 is a member of the extended CD28/CTLA-4 family of T cell regulators and has two ligands, PD-L1 (B7-H 1 , CD274) and PD-L2 (B7-DC, CD273).
  • the protein's structure includes an extracellular IgV domain followed by a transmembrane region and an intracellular tail.
  • the intracellular tail contains two phosphorylation sites located in an immunoreceptor tyrosine-based inhibitory motif and an immunoreceptor tyrosine-based switch motif, which suggests that PD-1 negatively regulates TCR signals. This is consistent with binding of SH P-1 and SFIP-2 phosphatases to the cytoplasmic tail of PD-1 upon ligand binding. While PD-1 is not expressed on naive T cells, it is upregulated following T cell receptor (TCR)-mediated activation and is observed on both activated and exhausted T cells (Agata et al., Int. Immunology 8 (1996), 765-772). These exhausted T-cells have a dysfunctional phenotype and are unable to respond appropriately.
  • TCR T cell receptor
  • PD-1 has a relatively wide expression pattern its most important role is likely as a coinhibitory receptor on T cells (Chinai et al, Trends in Pharmacological Sciences 36 (2015), 587-595). Current therapeutic approaches thus focus on blocking the interaction of PD-1 with its ligands to enhance T cell response.
  • the terms “Programmed Death 1 ,” “Programmed Cell Death 1 ,” “Protein PD-1 ,” “PD-1 ,” PD1 ,” “PDCD1 ,” “hPD-1 ” and “hPD-1 ” can be used interchangeably, and include variants, isoforms, species homologs of human PD-1 , and analogs having at least one common epitope with PD-1 .
  • the amino acid sequence of human PD-1 is shown in UniProt (www.uniprot.org) accession no. Q15116 (SEQ ID NO: 55).
  • LAG3 or “Lag-3” or “Lymphocyte activation gene-3” or “CD223” as used herein refer to any native LAG3 from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated.
  • the term encompasses “full-length,” unprocessed LAG3 as well as any form of LAG3 resulting from processing in the cell.
  • the term also encompasses naturally occurring variants of LAG3, e.g., splice variants or allelic variants.
  • the term “LAG3” refers to human LAG3.
  • the amino acid sequence of an exemplary processed (without signal sequences) LAG3 is shown in SEQ ID NO: 56.
  • the amino acid sequence of an exemplary Extracellular Domain (ECD) LAG3 is shown in SEQ ID NO: 57.
  • anti-LAG3 antibody and “an antibody that binds to LAG3” refer to an antibody that is capable of binding LAG3 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting LAG3.
  • the extent of binding of an anti-LAG3 antibody to an unrelated, non-LAG3 protein is less than about 10% of the binding of the antibody to LAG3 as measured, e.g., by a radioimmunoassay (RIA).
  • RIA radioimmunoassay
  • an antibody that binds to LAG3 has a dissociation constant (KD) of £ 1 mM, £ 100 nM, £ 10 nM, £ 1 nM, £ 0.1 nM, £ 0.01 nM, or £ 0.001 nM (e.g., 10 8 M or less, e.g., from 10 -8 M to 10 -13 M, e.g., from 10 -9 M to 10 -13 M).
  • KD dissociation constant
  • an anti- LAG3 antibody binds to an epitope of LAG3 that is conserved among LAG3 from different species.
  • an “anti-LAG3 antibody,” “an antibody that specifically binds to human LAG3,” and “an antibody that binds to human LAG3” refers to an antibody specifically binding to the human LAG3 antigen or its Extracellular Domain (ECD) with a binding affinity of a K ⁇ -value of 1 .0 x 10 -8 mol/l or lower, in one embodiment of a K ⁇ -value of 1 .0 x 10 -9 mol/l or lower, in one embodiment of a K ⁇ -value of 1 .0 x 10 -9 mol/l to 1 .0 x 10 -13 mol/l.
  • ECD Extracellular Domain
  • binding affinity is determined with a standard binding assay, such as surface plasmon resonance technique (BIAcore®, GE-Healthcare Uppsala, Sweden) e.g., using the LAG3 extracellular domain.
  • a standard binding assay such as surface plasmon resonance technique (BIAcore®, GE-Healthcare Uppsala, Sweden) e.g., using the LAG3 extracellular domain.
  • the term “anti-LAG3 antibody” also encompasses bispecific antibodies that are capable of binding LAG3 and a second antigen.
  • the “knob-into-hole” technology is described e.g., in US 5,731 ,168; US 7,695,936; Ridgway et al., Prot Eng 9, 617-621 (1996) and Carter, J Immunol Meth 248, 7-15 (2001).
  • the method involves introducing a protuberance (“knob”) at the interface of a first polypeptide and a corresponding cavity (“hole”) in the interface of a second polypeptide, such that the protuberance can be positioned in the cavity so as to promote heterodimer formation and hinder homodimer formation.
  • Protuberances are constructed by replacing small amino acid side chains from the interface of the first polypeptide with larger side chains (e.g., tyrosine or tryptophan).
  • Compensatory cavities of identical or similar size to the protuberances are created in the interface of the second polypeptide by replacing large amino acid side chains with smaller ones (e.g., alanine or threonine).
  • the protuberance and cavity can be made by altering the nucleic acid encoding the polypeptides, e.g., by site-specific mutagenesis, or by peptide synthesis.
  • a knob modification comprises the amino acid substitution T366W in one of the two subunits of the Fc domain
  • the hole modification comprises the amino acid substitutions T366S, L368A and Y407V in the other one of the two subunits of the Fc domain.
  • the subunit of the Fc domain comprising the knob modification additionally comprises the amino acid substitution S354C
  • the subunit of the Fc domain comprising the hole modification additionally comprises the amino acid substitution Y349C.
  • effector functions refers to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype.
  • antibody effector functions include: C1q binding and complement dependent cytotoxicity (CDC), Fc receptor binding, antibody-dependent cell- mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), cytokine secretion, immune complex-mediated antigen uptake by antigen presenting cells, down regulation of cell surface receptors (e.g., B cell receptor), and B cell activation.
  • an “activating Fc receptor” is an Fc receptor that following engagement by an Fc region of an antibody elicits signaling events that stimulate the receptor-bearing cell to perform effector functions.
  • Activating Fc receptors include FcyRIIIa (CD16a), FcyRI (CD64), FcyRIla (CD32), and FcaRI (CD89).
  • a particular activating Fc receptor is human FcyRIIIa (see UniProt accession no. P08637, version 141).
  • peptide linker refers to a peptide comprising one or more amino acids, typically about 2 to 20 amino acids. Peptide linkers are known in the art or are described herein. Suitable, non- immunogenic linker peptides are, for example, (G4S) n , (SG4)n or G4(SG4)n peptide linkers, wherein “n” is generally a number between 1 and 10, typically between 2 and 4, in particular 2, i.e.
  • GGGGS GGGSGGGGS
  • SEQ ID NO: 47 GGGGSGGGGS
  • SEQ ID NO: 48 SGGGGSGGGG
  • SEQ ID NO: 49 GGGGSGGGGSGGGG
  • GSPGSSSSGS SEQ ID NO: 50
  • G4S 3
  • G4S GSGSGSGS
  • SEQ ID NO: 53 GSGSGNGS
  • SEQ ID NO: 54 GGSGSGSG (SEQ ID NO: 55)
  • GGSGSG (SEQ ID NO: 56), GGSG (SEQ ID NO: 57), GGSGNGSG (SEQ ID NO: 58), GGNGSGSG (SEQ ID NO: 59) and GGNGSG (SEQ ID NO: 60).
  • Peptide linkers of particular interest are (G4S) (SEQ ID NO: 46), (G 4 S) 2 or GGGGSGGGGS (SEQ ID NO: 47), (G4S) 3 (SEQ ID NO: 51 ) and (G S) (SEQ ID NO: 53), more particularly (G S) 2 (SEQ ID NO: 47) or GGGGSGGGGS (SEQ ID NO: 47).
  • fused to or “connected to” is meant that the components (e.g., an antigen-binding domain and a Fc domain) are linked by peptide bonds, either directly or via one or more peptide linkers.
  • VEGF antagonist or “VEGF-specific antagonist” refers to a molecule capable of binding to VEGF, reducing VEGF expression levels, or neutralizing, blocking, inhibiting, abrogating, reducing, or interfering with VEGF biological activities, including, but not limited to, VEGF binding to one or more VEGF receptors, VEGF signaling, and VEGF mediated angiogenesis and endothelial cell survival or proliferation.
  • a molecule capable of neutralizing, blocking, inhibiting, abrogating, reducing, or interfering with VEGF biological activities can exert its effects by binding to one or more VEGF receptor (VEGFR) (e.g., VEGFR1 , VEGFR2, VEGFR3, membrane-bound VEGF receptor (mbVEGFR), or soluble VEGF receptor (sVEGFR)).
  • VEGFR VEGF receptor
  • mbVEGFR3 membrane-bound VEGF receptor
  • sVEGFR soluble VEGF receptor
  • VEGFFR inhibitors include polypeptides that specifically bind to VEGF, anti-VEGF antibodies and antigen-binding fragments thereof, receptor molecules and derivatives which bind specifically to VEGF thereby sequestering its binding to one or more receptors, fusions proteins (e.g., VEGF-Trap (Regeneron)), and VEGFi 2i -gelonin (Peregrine).
  • VEGF-specific antagonists also include antagonist variants of VEGF polypeptides, antisense nucleobase oligomers complementary to at least a fragment of a nucleic acid molecule encoding a VEGF polypeptide; small RNAs complementary to at least a fragment of a nucleic acid molecule encoding a VEGF polypeptide; ribozymes that target VEGF; peptibodies to VEGF; and VEGF aptamers.
  • VEGF antagonists also include polypeptides that bind to VEGFR, anti-VEGFR antibodies (e.g., bevacizumab), and antigen-binding fragments thereof, and derivatives which bind to VEGFR thereby blocking, inhibiting, abrogating, reducing, or interfering with VEGF biological activities (e.g., VEGF signaling), or fusions proteins.
  • VEGF- specific antagonists also include nonpeptide small molecules that bind to VEGF or VEGFR and are capable of blocking, inhibiting, abrogating, reducing, or interfering with VEGF biological activities.
  • VEGF biological activities specifically includes VEGF-mediated biological activities of VEGF.
  • the VEGF antagonist reduces or inhibits, by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more, the expression level or biological activity of VEGF.
  • the VEGF inhibited by the VEGF-specific antagonist is VEGF (8-109), VEGF (1 -109), or VEGFies.
  • VEGF antagonists can include, but are not limited to, anti-VEGFR2 antibodies and related molecules (e.g., ramucirumab, tanibirumab, aflibercept), anti-VEGFR1 antibodies and related molecules (e.g., icrucumab, aflibercept (VEGF Trap-Eye; EYLEA®), and ziv-aflibercept (VEGF Trap; ZALTRAP®)), bispecific VEGF antibodies (e.g., MP-0250, vanucizumab (VEGF-ANG2), and bispecific antibodies disclosed in US 2001/0236388), bispecific antibodies including combinations of two of anti- VEGF, anti-VEGFR1 , and anti-VEGFR2 arms, anti-VEGFA antibodies (e.g., bevacizumab, sevacizumab), anti-VEGFB antibodies, anti-VEGFC antibodies (e.g., VGX-100), anti-VEGFD antibodies, and nonpeptides,
  • the VEGF antagonist may be a tyrosine kinase inhibitor, including a receptor tyrosine kinase inhibitors (e.g., a multi-targeted receptor tyrosine kinase inhibitor such as sunitinib or axitinib).
  • a receptor tyrosine kinase inhibitors e.g., a multi-targeted receptor tyrosine kinase inhibitor such as sunitinib or axitinib.
  • an “anti-VEGF antibody” is an antibody that binds to VEGF with sufficient affinity and specificity.
  • the antibody will have a sufficiently high binding affinity for VEGF, for example, the antibody may bind hVEGF with a KD value of between 100 nM and 1 pM.
  • Antibody affinities may be determined, e.g., by a surface plasmon resonance-based assay (such as the BIAcore® assay as described in PCT Application Publication No. W02005/012359); enzyme-linked immunoabsorbent assay (ELISA); and competition assays (e.g., radioimmunoassays (RIAs)).
  • the anti-VEGF antibody can be used as a therapeutic agent in targeting and interfering with diseases or conditions wherein the VEGF activity is involved.
  • the antibody may be subjected to other biological activity assays, e.g., in order to evaluate its effectiveness as a therapeutic.
  • biological activity assays are known in the art and depend on the target antigen and intended use for the antibody. Examples include the HUVEC inhibition assay; tumor cell growth inhibition assays (as described in WO 89/06692, for example); antibody-dependent cellular cytotoxicity (ADCC) and complement-mediated cytotoxicity (CDC) assays (U.S. Pat. No.
  • anti-VEGF antibody will usually not bind to other VEGF homologues such as VEGF-B or VEGF-C, nor other growth factors such as PIGF, PDGF, or bFGF.
  • anti-VEGF antibody is a monoclonal antibody that binds to the same epitope as the monoclonal anti-VEGF antibody A4.6.1 produced by hybridoma ATCC HB 10709.
  • the anti-VEGF antibody is a recombinant humanized anti-VEGF monoclonal antibody generated according to Presta et al. ( Cancer Res. 57:4593-4599, 1997), including, but not limited to, the antibody known as bevacizumab (BV; AVASTIN®).
  • bevacizumab also known as “rhuMAb VEGF” or “AVASTIN®,” is a recombinant humanized anti-VEGF monoclonal antibody generated according to Presta et al. ( Cancer Res. 57:4593-4599, 1997). It comprises mutated human lgG1 framework regions and antigen-binding complementarity-determining regions from the murine anti-hVEGF monoclonal antibody A.4.6.1 that blocks binding of human VEGF to its receptors. Approximately 93% of the amino acid sequence of bevacizumab, including most of the framework regions, is derived from human IgG 1 , and about 7% of the sequence is derived from the murine antibody A4.6.1 .
  • Bevacizumab has a molecular mass of about 149,000 daltons and is glycosylated. Bevacizumab and other humanized anti-VEGF antibodies are further described in U.S. Pat. No. 6,884,879, issued Feb. 26, 2005, the entire disclosure of which is expressly incorporated herein by reference. II. Therapeutic Methods and Compositions for Cancer
  • the disclosure provides a method for treating a subject having a cancer, the method comprising administering to the subject one or more dosing cycles of a bispecific antibody targeting programmed cell death protein 1 (PD-1) and lymphocyte activation gene 3 (LAG3) comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the method comprises administering to the subject the bispecific antibody at a fixed dose of about 600 mg (e.g., a fixed dose of 600 mg) every three weeks.
  • PD-1 programmed cell death protein 1
  • LAG3 lymphocyte activation gene 3
  • bispecific antibodies targeting PD-1 and LAG3 are provided in Section VIII, below.
  • a particular example for a bispecific antibody targeting PD-1 and LAG3 is PD1-LAG3 as defined herein.
  • bispecific antibodies targeting PD-1 and LAG3 might avoid reinvigorating Treg mediated immunosuppressive effects while restoring the anti-tumor immune response.
  • the length of each of the one or more dosing cycles is 21 days.
  • the method comprises administering (e.g., intravenously administering) to the subject the bispecific antibody on Day 1 of each of the one or more dosing cycles.
  • the cancer may be a solid tumor (e.g., a solid tumor having a tumor microenvironment comprising LAG3-expressing CD8+ T cells).
  • the cancer may be a skin cancer (e.g., a melanoma), a liver cancer (e.g., a hepatocellular carcinoma (HCC)), a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), a kidney cancer, a renal cancer (e.g., a renal cell carcinoma (RCC)), a bladder cancer (e.g., a metastatic urothelial carcinoma (mUC)), a breast cancer (e.g., a triple negative breast cancer (TNBC)), an esophageal cancer (e.g., esophageal squamous cell carcinoma (ESCC)), a pancreatic cancer, a cervical cancer, a head and neck cancer, a gastric cancer, a colorectal cancer, or an ovarian
  • the cancer is a skin cancer (e.g., a melanoma), a liver cancer (e.g., a HCC), a lung cancer (e.g., a NSCLC), a kidney cancer, a renal cancer (e.g., a RCC), a bladder cancer (e.g., a mUC), a breast cancer (e.g., a TNBC), or an esophageal cancer (e.g., ESCC).
  • a skin cancer e.g., a melanoma
  • a liver cancer e.g., a HCC
  • a lung cancer e.g., a NSCLC
  • a kidney cancer e.g., a renal cancer
  • a bladder cancer e.g., a mUC
  • breast cancer e.g., a TNBC
  • an esophageal cancer e.g., ESCC
  • the cancer may be locally advanced or metastatic.
  • the melanoma may be, e.g., a previously untreated unresectable or metastatic melanoma (e.g., a histologically confirmed unresectable or metastatic melanoma per the American Joint Committee on Cancer (AJCC) staging system (unresectable Stage III or Stage IV).
  • the melanoma is (a) a Stage III melanoma with measurable lymph node metastases; (b) an unresectable Stage III melanoma; or (c) a Stage IV melanoma.
  • the melanoma is not a mucosal melanoma or a uveal melanoma.
  • the subject has not previously received a systemic anti-cancer therapy.
  • the subject has not previously been treated with an anti-cancer therapy comprising an immunomodulatory agent, e.g., has not been treated with an anti-cancer agent comprising a checkpoint inhibitor (CPI), e.g., has not been treated with an anti-programmed death-ligand 1 (PD- L1)/PD-1 agent or has not been treated with an anti-cytotoxic T lymphocyte-associated antigen (CTLA-4)) agent.
  • CPI checkpoint inhibitor
  • PD- L1/PD-1 agent e.g., has not been treated with an anti-programmed death-ligand 1 (PD- L1)/PD-1 agent or has not been treated with an anti-cytotoxic T lymphocyte-associated antigen (CTLA-4) agent.
  • CTLA-4 anti-cytotoxic T lymphocyte-associated antigen
  • the subject previously has been treated with an immunomodulatory agent (e.g., a CPI) as an adjuvant or neoadjuvant
  • the subject has not previously been treated for metastatic or unresectable disease.
  • the subject has not previously been treated with an anti-LAG3 therapy.
  • the bispecific antibody achieves at least 90% LAG3 receptor occupancy (RO) in the tumor, e.g., achieves at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% RO in the tumor.
  • RO LAG3 receptor occupancy
  • the subject is a human.
  • the method further comprises administering (e.g., intravenously administering) to the subject a VEGF antagonist, e.g., an anti-VEGF antibody (e.g., bevacizumab).
  • a VEGF antagonist e.g., an anti-VEGF antibody (e.g., bevacizumab).
  • an anti-VEGF antibody e.g., bevacizumab
  • Exemplary VEGF antagonists are provided in Section IX, below.
  • the VEGF antagonist is administered before the bispecific antibody targeting PD-1 and LAG3. In other aspects, the VEGF antagonist is administered after the bispecific antibody targeting PD-1 and LAG3. In still further aspects, the VEGF antagonist and the bispecific antibody targeting PD-1 and LAG3 are administered simultaneously.
  • the method comprises administering to the subject a VEGF antagonist (e.g., bevacizumab) at a dose of about 15 mg/kg (e.g., a dose of 15 mg/kg) every three weeks.
  • a VEGF antagonist e.g., bevacizumab
  • the length of each of the one or more dosing cycles is 21 days and the method comprises administering to the subject the VEGF antagonist (e.g., bevacizumab) on Day 1 of each of the one or more dosing cycles.
  • the VEGF antagonist e.g., bevacizumab
  • the disclosure provides a method for treating a subject having a cancer, the method comprising administering to the subject one or more dosing cycles of (1) a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to PD- 1 and a second antigen-binding domain that specifically binds to LAG3 (e.g., a bispecific antibody targeting PD-1 and LAG3 provided in Section VIII, below) and (2) a VEGF antagonist (e.g., bevacizumab), wherein the method comprises administering to the subject the bispecific antibody at a fixed dose of 600 mg every three weeks and the VEGF antagonist at a dose of 15 mg/kg every three weeks.
  • a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to PD- 1 and a second antigen-binding domain that specifically binds to LAG3
  • a VEGF antagonist e.g., bevacizumab
  • the method further comprises administering to the subject a VEGF antagonist (e.g., bevacizumab) at a dose of about 10 mg/kg (e.g., a dose of 10 mg/kg) every two weeks.
  • a VEGF antagonist e.g., bevacizumab
  • the length of each of the one or more dosing cycles is 28 days and the method comprises administering to the subject the VEGF antagonist (e.g., bevacizumab) on Days 1 and 15 of each of the one or more dosing cycles.
  • the disclosure provides a bispecific antibody targeting PD-1 and LAG3 for use in a method of treating a subject having a cancer (e.g., a bispecific antibody targeting PD-1 and LAG3 for use in any of the above methods), wherein the bispecific antibody comprises a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, and wherein the method comprises administering to the subject the bispecific antibody at a fixed dose of 600 mg every three weeks.
  • a bispecific antibody targeting PD-1 and LAG3 is PD1-LAG3 as defined herein.
  • the disclosure provides use of a bispecific antibody targeting PD-1 and LAG3 in the manufacture of a medicament for treating a subject having a cancer, wherein the bispecific antibody comprises a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, and wherein the bispecific antibody is to be administered to the subject at a fixed dose of 600 mg every three weeks.
  • the method further comprises administering (e.g., intravenously administering) to the subject an anti-TIGIT antagonist antibody (e.g., tiragolumab).
  • an anti-TIGIT antagonist antibody e.g., tiragolumab.
  • anti-TIGIT antagonist antibodies are provided in Section VII, below.
  • the anti-TIGIT antagonist antibody is administered before the bispecific antibody targeting PD-1 and LAG3. In other aspects, the anti-TIGIT antagonist antibody is administered after the bispecific antibody targeting PD-1 and LAG3. In still further aspects, the anti-TIGIT antagonist antibody and the bispecific antibody targeting PD-1 and LAG3 are administered simultaneously.
  • the method comprises administering to the subject an anti-TIGIT antagonist antibody (e.g., tiragolumab) at a fixed dose of about 600 mg (e.g., a fixed dose of 600 mg) every three weeks.
  • an anti-TIGIT antagonist antibody e.g., tiragolumab
  • the length of each of the one or more dosing cycles is 21 days and the method comprises administering to the subject the anti-TIGIT antagonist antibody on about Day 1 (e.g., on Day 1) of each of the one or more dosing cycles.
  • the disclosure provides a method for treating a subject having a cancer, the method comprising administering to the subject one or more dosing cycles of (1) a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to PD- 1 and a second antigen-binding domain that specifically binds to LAG3 (e.g., a bispecific antibody targeting PD-1 and LAG3 provided in Section VIII, below; in particular PD1-LAG3 as defined herein) and (2) an anti-TIGIT antagonist antibody (e.g., tiragolumab), wherein the method comprises administering to the subject the bispecific antibody at a fixed dose of 600 mg every three weeks and the anti-TIGIT antagonist antibody at a fixed dose of 600 mg every three weeks.
  • a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to PD- 1 and a second antigen-binding domain that specifically binds to LAG3
  • the disclosure provides a method for treating a subject having a liver cancer, the method comprising administering to the subject one or more dosing cycles of a bispecific antibody targeting programmed cell death protein 1 (PD-1) and lymphocyte activation gene 3 (LAG3) comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the method comprises administering to the subject the bispecific antibody at a fixed dose of about 600 mg (e.g., a fixed dose of 600 mg) every three weeks.
  • PD-1 programmed cell death protein 1
  • LAG3 lymphocyte activation gene 3
  • bispecific antibodies targeting PD-1 and LAG3 are provided in Section VIII, below.
  • a particular example for a bispecific antibody targeting PD-1 and LAG3 is PD1-LAG3 as defined herein.
  • the disclosure provides a method for treating a subject having a liver cancer, the method comprising administering to the subject one or more dosing cycles of a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the method comprises administering to the subject the bispecific antibody at a fixed dose of 1200 mg every three weeks.
  • the length of each of the one or more dosing cycles is 21 days.
  • the method comprises administering (e.g., intravenously administering) to the subject the bispecific antibody on Day 1 of each of the one or more dosing cycles.
  • the disclosure provides a method for treating a subject having a liver cancer, the method comprising administering to the subject one or more dosing cycles of a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to PD- 1 and a second antigen-binding domain that specifically binds to LAG3, wherein the method comprises administering to the subject the bispecific antibody at a fixed dose of 2100 mg every two weeks.
  • the length of each of the one or more dosing cycles is 28 days.
  • the method comprises administering (e.g., intravenously administering) to the subject the bispecific antibody on Days 1 and 15 of each of the one or more dosing cycles.
  • the liver cancer is a hepatocellular carcinoma (HCC).
  • HCC hepatocellular carcinoma
  • the liver cancer e.g., HCC
  • the HCC may be, e.g., locally advanced, metastatic, and/or unresectable.
  • the subject has not previously received a systemic anti-cancer therapy.
  • the subject has not previously been treated with an anti-cancer therapy comprising an immunomodulatory agent, e.g., has not been treated with an anti-cancer agent comprising a checkpoint inhibitor (CPI), e.g., has not been treated with an anti-programmed death-ligand 1 (PD- L1)/PD-1 agent or has not been treated with an anti-cytotoxic T lymphocyte-associated antigen (CTLA-4)) agent.
  • CPI checkpoint inhibitor
  • the subject previously has been treated with an immunomodulatory agent (e.g., a CPI) as an adjuvant or neoadjuvant therapy.
  • the subject has not previously been treated for metastatic or unresectable disease.
  • the subject has not previously been treated with an anti-LAG3 therapy.
  • the bispecific antibody achieves at least 90% LAG3 receptor occupancy (RO) in the tumor, e.g., achieves at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% RO in the tumor.
  • RO LAG3 receptor occupancy
  • the subject is a human.
  • Methods comprising a bispecific antibody targeting PD-1 and LAG3 and bevacizumab
  • the method further comprises administering (e.g., intravenously administering) to the subject a VEGF antagonist, e.g., an anti-VEGF antibody (e.g., bevacizumab).
  • a VEGF antagonist e.g., an anti-VEGF antibody (e.g., bevacizumab).
  • an anti-VEGF antibody e.g., bevacizumab
  • Exemplary VEGF antagonists are provided in Section IX, below.
  • the anti-TIGIT antagonist antibody is administered before the bispecific antibody targeting PD-1 and LAG3. In other aspects, the anti-TIGIT antagonist antibody is administered after the bispecific antibody targeting PD-1 and LAG3. In still further aspects, the anti-TIGIT antagonist antibody and the bispecific antibody targeting PD-1 and LAG3 are administered simultaneously.
  • the method comprises administering to the subject a VEGF antagonist (e.g., bevacizumab) at a dose of about 15 mg/kg (e.g., a dose of 15 mg/kg) every three weeks.
  • a VEGF antagonist e.g., bevacizumab
  • the length of each of the one or more dosing cycles is 21 days and the method comprises administering to the subject the VEGF antagonist (e.g., bevacizumab) on Day 1 of each of the one or more dosing cycles.
  • the VEGF antagonist e.g., bevacizumab
  • the disclosure provides a method for treating a subject having a liver cancer, the method comprising administering to the subject one or more dosing cycles of (1) a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to PD- 1 and a second antigen-binding domain that specifically binds to LAG3 (e.g., a bispecific antibody targeting PD-1 and LAG3 provided in Section VIII, below and in particular PD1-LAG3) and (2) a VEGF antagonist, wherein the method comprises administering to the subject the bispecific antibody at a fixed dose of 600 mg every three weeks and the VEGF antagonist at a dose of 15 mg/kg every three weeks.
  • a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to PD- 1 and a second antigen-binding domain that specifically binds to LAG3
  • a VEGF antagonist e.g., a bispecific antibody targeting PD-1
  • the disclosure provides a method for treating a subject having a liver cancer, the method comprising administering to the subject one or more dosing cycles of (1) a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3 (e.g., a bispecific antibody targeting PD-1 and LAG3 provided in Section VIII, below) and (2) a VEGF antagonist, wherein the method comprises administering to the subject the bispecific antibody at a fixed dose of 1200 mg every three weeks and the VEGF antagonist at a dose of 15 mg/kg every three weeks.
  • a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3
  • a VEGF antagonist e.g., a bispecific antibody targeting PD-1 and LAG3 provided in Section VIII, below
  • the method further comprises administering to the subject a VEGF antagonist (e.g., bevacizumab) at a dose of about 10 mg/kg (e.g., a dose of 10 mg/kg) every two weeks.
  • a VEGF antagonist e.g., bevacizumab
  • the length of each of the one or more dosing cycles is 28 days and the method comprises administering to the subject the VEGF antagonist (e.g., bevacizumab) on Days 1 and 15 of each of the one or more dosing cycles.
  • the disclosure provides a method for treating a subject having a liver cancer, the method comprising administering to the subject one or more dosing cycles of (1) a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3 (e.g., a bispecific antibody targeting PD-1 and LAG3 provided in Section VIII, below) and (2) a VEGF antagonist (e.g., bevacizumab), wherein the method comprises administering to the subject the bispecific antibody at a fixed dose of 2100 mg every two weeks and the VEGF antagonist at a dose of 10 mg/kg every two weeks.
  • a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3
  • a VEGF antagonist e.g., bevacizumab
  • the disclosure provides a method for treating a subject having a melanoma, the method comprising administering to the subject an anti-TIGIT antagonist antibody and a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to programmed cell death protein 1 (PD-1) and a second antigen-binding domain that specifically binds to lymphocyte activation gene 3 (LAG3).
  • the anti-TIGIT antagonist antibody and the bispecific antibody are administered to the subject in a dosing regimen that comprises one or more dosing cycles.
  • the method comprises administering to the subject (a) the anti-TIGIT antagonist antibody at a fixed dose of about 600 mg (e.g., a fixed dose of 600 mg) every three weeks; and (b) the bispecific antibody at a fixed dose of about 2100 mg (e.g., a fixed dose of 2100 mg) every three weeks.
  • the method comprises administering to the subject (a) the anti-TIGIT antagonist antibody at a fixed dose of about 600 mg (e.g., a fixed dose of 600 mg) every three weeks; and (b) the bispecific antibody at a fixed dose of about 600 mg (e.g., a fixed dose of 600 mg) every three weeks.
  • the disclosure provides a method for treating a subject having a melanoma, the method comprising administering to the subject one or more dosing cycles of a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3 (e.g., a bispecific antibody targeting PD-1 and LAG3 provided in Section VIII, below, and in particular PD1-LAG3), wherein the method comprises administering to the subject the bispecific antibody at a fixed dose of 600 mg every three weeks, and wherein the melanoma is: (a) an unresectable Stage III melanoma; or (b) a Stage IV melanoma (e.g., a histologically confirmed unresectable or metastatic melanoma per the American Joint Committee on Cancer (AJCC) staging system (unresectable Stage III or Stage IV).
  • AJCC American Joint Committee on Cancer
  • the length of each of the one or more dosing cycles is 21 days.
  • the method comprises administering to the subject the anti-TIGIT antagonist antibody and the bispecific antibody on about Day 1 (e.g., on Day 1) of each of the one or more dosing cycles.
  • the method comprises administering to the subject the bispecific antibody before the anti-TIGIT antagonist antibody. In other aspects, the method comprises administering to the subject the anti-TIGIT antagonist antibody before the bispecific antibody.
  • the method comprises administering to the subject the bispecific antibody and the anti-TIGIT antagonist antibody intravenously.
  • the one or more dosing cycles are administered as a neoadjuvant therapy.
  • the anti-TIGIT antagonist antibody and the bispecific antibody targeting PD-1 and LAG3 are administered as a neoadjuvant therapy.
  • the melanoma is a Stage III melanoma with measurable lymph node metastases. In some aspects, the subject has not had in-transit metastases within six months prior to the initiation of treatment.
  • the subject has not previously been treated with a cancer immunotherapy.
  • the melanoma is not a mucosal melanoma or a uveal melanoma.
  • a first dosing cycle is initiated prior to a surgery.
  • At least one dosing cycle or (e.g., one, two, three, four, or more than four dosing cycles) or at least two dosing cycles (e.g., two, three, four, or more than four dosing cycles) are completed prior to the surgery. In some aspects, two dosing cycles are completed prior to the surgery.
  • the surgery is performed within about one week after the last dosing cycle.
  • the surgery is a completion lymph node dissection (CLND).
  • CLND completion lymph node dissection
  • the treating results in an increase in pathologic response rate (pRR) as compared to a reference pRR.
  • the reference pRR is a pRR of a population of subjects who have received a control therapy.
  • the control therapy is a therapy comprising an anti-TIG IT antagonist antibody and not comprising a bispecific antibody targeting PD-1 and LAG3; a therapy comprising a bispecific antibody targeting PD-1 and LAG3 and not comprising an anti-TIGIT antagonist antibody; or a therapy comprising ipilimumab and nivolumab.
  • the treating results in an increase in event-free survival (EFS) as compared to a reference EFS; an increase in recurrence-free survival (RFS) as compared to a reference RFS; an increase in overall survival (OS) as compared to a reference OS; and/or an increase in overall response rate (ORR) as compared to a reference ORR.
  • EFS event-free survival
  • RFS recurrence-free survival
  • OS overall survival
  • ORR overall response rate
  • the reference EFS, RFS, OS, or ORR is one of a population of subjects who have received a control therapy.
  • control therapy is a therapy comprising an anti-TIGIT antagonist antibody and not comprising a bispecific antibody targeting PD-1 and LAG3; a therapy comprising a bispecific antibody targeting PD-1 and LAG3 and not comprising an anti-TIGIT antagonist antibody; or a therapy comprising ipilimumab and nivolumab.
  • the melanoma is a Stage IV melanoma.
  • the subject has received no more than two prior lines of systemic treatment; or (b) the melanoma is a BRAF-mutant melanoma and the subject has received no more than three prior lines of systemic treatment.
  • the treating results in an increase in overall response rate (ORR) as compared to a reference ORR.
  • the reference ORR is an ORR of a population of subjects who have received (a) a treatment comprising a bispecific antibody targeting PD-1 and LAG3 and not comprising an anti-TIGIT antagonist antibody; and/or (b) a treatment comprising an anti-TIGIT antagonist antibody and not comprising a bispecific antibody targeting PD-1 and LAG3.
  • the treating results in an increase in progression-free survival (PFS) as compared to a reference PFS; an increase in duration of response (DOR) as compared to a reference DOR; an increase in OS as compared to a reference OS; an increase in disease control rate (DCR, e.g., stable disease for 12 or more weeks, a complete response (CR), or a partial response (PR)) as compared to a reference DCR.
  • PFS progression-free survival
  • DOR duration of response
  • OS as compared to a reference OS
  • DCR disease control rate
  • the reference PFS, OS, DOR, or DCR is one of a population of subjects who have received a control therapy.
  • control therapy is a therapy comprising an anti-TIG IT antagonist antibody and not comprising a bispecific antibody targeting PD-1 and LAG3; a therapy comprising a bispecific antibody targeting PD-1 and LAG3 and not comprising an anti- TIGIT antagonist antibody; or a therapy comprising ipilimumab and nivolumab.
  • the subject is a human.
  • the disclosure features a method for treating a subject having a melanoma, the method comprising administering to the subject a bispecific antibody targeting PD-1 and LAG3 comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3.
  • the bispecific antibody is administered to the subject in a dosing regimen that comprises one or more dosing cycles.
  • the one or more dosing cycles are administered as a neoadjuvant therapy.
  • the method comprises administering to the subject the bispecific antibody at a fixed dose about 2100 mg (e.g., a fixed dose of 2100 mg) every three weeks.
  • the method comprises administering to the subject the bispecific antibody at a fixed dose about 600 mg (e.g., a fixed dose of 600 mg) every three weeks.
  • the length of each of the one or more dosing cycles is 21 days.
  • the method comprises administering to the subject the bispecific antibody on about Day 1 (e.g., on Day 1 ) of each of the one or more dosing cycles.
  • the method comprises administering to the subject the bispecific antibody intravenously.
  • the melanoma is a Stage III melanoma with measurable lymph node metastases.
  • the subject has not had in-transit metastases within six months prior to the initiation of treatment.
  • the subject has not previously been treated with a cancer immunotherapy.
  • the melanoma is not a mucosal melanoma or a uveal melanoma.
  • a first dosing cycle is initiated prior to a surgery.
  • At least one dosing cycle or (e.g., one, two, three, four, or more than four dosing cycles) or at least two dosing cycles (e.g., two, three, four, or more than four dosing cycles) are completed prior to the surgery. In some aspects, two dosing cycles are completed prior to the surgery.
  • the surgery is performed within about one week after the last dosing cycle.
  • the surgery is a completion lymph node dissection (CLND).
  • CLND completion lymph node dissection
  • the treating results in an increase in pathologic response rate (pRR) as compared to a reference pRR.
  • the reference pRR is a pRR of a population of subjects who have received a control therapy.
  • the control therapy is a therapy comprising ipilimumab and nivolumab.
  • the treating results in an increase in event-free survival (EFS) as compared to a reference EFS; an increase in recurrence-free survival (RFS) as compared to a reference RFS; an increase in overall survival (OS) as compared to a reference OS; and/or an increase in overall response rate (ORR) as compared to a reference ORR.
  • EFS event-free survival
  • RFS recurrence-free survival
  • OS overall survival
  • ORR overall response rate
  • the reference EFS, RFS, OS, or ORR is one of a population of subjects who have received a control therapy.
  • the control therapy is a therapy comprising ipilimumab and nivolumab.
  • the subject is a human.
  • the disclosure features a method for treating a subject having a melanoma, the method comprising administering to the subject one or more dosing cycles of an anti-TIGIT antagonist antibody and a PD-1 axis binding antagonist, wherein the one or more dosing cycles are administered as a neoadjuvant therapy.
  • the disclosure features a method for treating a subject having a melanoma, the method comprising administering to the subject an anti-TIGIT antagonist antibody and a PD-1 axis binding antagonist, wherein the anti-TIGIT antagonist antibody and the PD-1 axis binding antagonist are administered as a neoadjuvant therapy.
  • the method comprises administering to the subject (a) the anti-TIGIT antagonist antibody at a fixed dose of about 600 mg (e.g., a fixed dose of 600 mg) every three weeks; and (b) the PD-1 axis binding antagonist at a fixed dose of about 600 mg (e.g., a fixed dose of 600 mg) every three weeks.
  • the length of each of the one or more dosing cycles is 21 days.
  • the method comprises administering to the subject the anti-TIGIT antagonist antibody and the PD-1 axis binding antagonist on about Day 1 (e.g., on Day 1 ) each of the one or more dosing cycles.
  • the method comprises administering to the subject the PD-1 axis binding antagonist before the anti-TIGIT antagonist antibody. In other aspects, the method comprises administering to the subject the anti-TIGIT antagonist antibody before the PD-1 axis binding antagonist.
  • the method comprises administering to the subject the PD-1 axis binding antagonist and the anti-TIGIT antagonist antibody intravenously.
  • the melanoma is a Stage III melanoma with measurable lymph node metastases.
  • the subject has not had in-transit metastases within six months prior to the initiation of treatment.
  • the subject has not previously been treated with a cancer immunotherapy.
  • the melanoma is not a mucosal melanoma or a uveal melanoma.
  • a first dosing cycle is initiated prior to a surgery.
  • At least one dosing cycle or (e.g., one, two, three, four, or more than four dosing cycles) or at least two dosing cycles (e.g., two, three, four, or more than four dosing cycles) are completed prior to the surgery. In some aspects, two dosing cycles are completed prior to the surgery.
  • the surgery is performed within about one week after the last dosing cycle.
  • the surgery is a completion lymph node dissection (CLND).
  • CLND completion lymph node dissection
  • the treating results in an increase in pathologic response rate (pRR) as compared to a reference pRR.
  • the reference pRR is a pRR of a population of subjects who have received a control therapy.
  • the control therapy is a therapy comprising an anti-TIGIT antagonist antibody and not comprising a PD-1 axis binding antagonist; a therapy comprising a PD-1 axis binding antagonist and not comprising an anti-TIGIT antagonist antibody; or a therapy comprising ipilimumab and nivolumab.
  • the treating results in an increase in event-free survival (EFS) as compared to a reference EFS; an increase in recurrence-free survival (RFS) as compared to a reference RFS; an increase in overall survival (OS) as compared to a reference OS; and/or an increase in overall response rate (ORR) as compared to a reference ORR.
  • EFS event-free survival
  • RFS recurrence-free survival
  • OS overall survival
  • ORR overall response rate
  • the reference EFS, RFS, OS, or ORR is one of a population of subjects who have received a control therapy.
  • control therapy is a therapy comprising an anti-TIGIT antagonist antibody and not comprising a PD-1 axis binding antagonist; a therapy comprising a PD-1 axis binding antagonist and not comprising an anti-TIGIT antagonist antibody; or a therapy comprising ipilimumab and nivolumab.
  • the subject is a human.
  • bispecific antibodies targeting PD-1 and LAG3, and dosing regimens for the same are provided in Section VIII, below.
  • a particular example for a bispecific antibody targeting PD-1 and LAG3 is PD1-LAG3 as defined herein.
  • anti-TIGIT antagonist antibodies and dosing regimens for the same, are provided in Section VII, below.
  • PD-1 axis binding antagonists and dosing regimens for the same, are provided in Section X, below.
  • the expression of PD-L1 may be assessed in a subject treated according to any of the methods and compositions for use described herein.
  • the methods and compositions for use may include determining the expression level of PD-L1 in a biological sample (e.g., a tumor sample) obtained from the subject having a cancer (e.g., esophageal cancer (e.g., metastatic esophageal cancer)).
  • a biological sample e.g., a tumor sample
  • the expression level of PD-L1 in a biological sample (e.g., a tumor sample) obtained from the subject has been determined prior to initiation of treatment or after initiation of treatment.
  • PD-L1 expression may be determined using any suitable approach. For example, PD-L1 expression may be determined as described in U.S. Patent Application Nos.
  • Any suitable tumor sample may be used, e.g., a formalin-fixed and paraffin-embedded (FFPE) tumor sample, an archival tumor sample, a fresh tumor sample, or a frozen tumor sample.
  • FFPE formalin-fixed and paraffin-embedded
  • PD-L1 expression may be determined in terms of the percentage of a tumor sample comprised by tumor-infiltrating immune cells expressing a detectable expression level of PD-L1 , as the percentage of tumor-infiltrating immune cells in a tumor sample expressing a detectable expression level of PD-L1 , and/or as the percentage of tumor cells in a tumor sample expressing a detectable expression level of PD-L1.
  • the percentage of the tumor sample comprised by tumor-infiltrating immune cells may be in terms of the percentage of tumor area covered by tumor-infiltrating immune cells in a section of the tumor sample obtained from the subject, for example, as assessed by IHC using an anti-PD-L1 antibody (e.g., the SP142 antibody).
  • Any suitable anti- PD-L1 antibody may be used, including, e.g., SP142 (Ventana), SP263 (Ventana), 22C3 (Dako), 28-8 (Dako), E1L3N (Cell Signaling Technology), 4059 (ProSci, Inc.), h5H1 (Advanced Cell Diagnostics), and 9A11.
  • the anti-PD-L1 antibody is SP142.
  • the anti-PD-L1 antibody is SP263.
  • a tumor sample obtained from the subject has a detectable expression level of PD-L1 in less than 1 % of the tumor cells in the tumor sample, in 1 % or more of the tumor cells in the tumor sample, in from 1% to less than 5% of the tumor cells in the tumor sample, in 5% or more of the tumor cells in the tumor sample, in from 5% to less than 50% of the tumor cells in the tumor sample, or in 50% or more of the tumor cells in the tumor sample.
  • a tumor sample obtained from the subject has a detectable expression level of PD-L1 in tumor-infiltrating immune cells that comprise less than 1% of the tumor sample, more than 1% of the tumor sample, from 1% to less than 5% of the tumor sample, more than 5% of the tumor sample, from 5% to less than 10% of the tumor sample, or more than 10% of the tumor sample.
  • the esophageal cancer of a subject treated according to any of the methods provided herein has a PD-L1 -positive tumor cell (TC) fraction or tumor-infiltrating immune cell (IC) fraction of ⁇ 5%. In some aspects, the esophageal cancer has a PD-L1 -positive TC fraction of ⁇ 1%. In other aspects, the esophageal cancer of a subject treated according to any of the methods provided herein has a PD-L1 -positive TC fraction or IC fraction of > 5%.
  • TC tumor cell
  • IC tumor-infiltrating immune cell
  • PD-L1 is detected using a Ventana SP142 IHC assay, a Ventana SP263 IHC assay, a pharmDx 22C3 IHC assay, or a pharmDx 28-8 IHC assay.
  • tumor samples may be scored for PD-L1 positivity in tumor-infiltrating immune cells and/or in tumor cells according to the criteria for diagnostic assessment shown in Table 2 and/or Table 3, respectively.
  • the expression level of TIGIT may be assessed in a subject having a cancer (e.g., esophageal cancer (e.g., metastatic esophageal cancer)) who has been treated according to any of the methods, uses, and compositions for use described herein.
  • the methods, uses, and compositions for use may include determining the expression level of TIGIT in a biological sample (e.g., a tumor sample) obtained from the subject.
  • the expression level of TIGIT in a biological sample e.g., a tumor sample obtained from the subject has been determined prior to initiation of treatment or after initiation of treatment.
  • TIGIT expression may be determined using any suitable approach. Any suitable tumor sample may be used, e.g., a formalin-fixed and paraffin-embedded (FFPE) tumor sample, an archival tumor sample, a fresh tumor sample, or a frozen tumor sample.
  • FFPE formalin-fixed and paraffin-embedded
  • TIGIT expression may be determined in terms of the percentage of a tumor sample comprised by tumor-infiltrating immune cells expressing a detectable expression level of TIGIT, as the percentage of tumor-infiltrating immune cells in a tumor sample expressing a detectable expression level of TIGIT, and/or as the percentage of tumor cells in a tumor sample expressing a detectable expression level of TIGIT.
  • the percentage of the tumor sample comprised by tumor-infiltrating immune cells may be in terms of the percentage of tumor area covered by tumor-infiltrating immune cells in a section of the tumor sample obtained from the subject, for example, as assessed by IHC using an anti-TIG IT antagonist antibody. Any suitable anti-TIG IT antagonist antibody may be used.
  • the anti-TIG IT antagonist antibody is 10A7 (WO 2009/126688A3; U.S. Patent No: 9,499,596).
  • the invention provides anti-TIGIT antagonist antibodies useful for treating cancer in a subject (e.g., a human) having a cancer.
  • the anti-TIGIT antagonist antibody is tiragolumab (CAS Registry Number: 1918185-84-8). Tiragolumab (Genentech) is also known as MTIG7192A.
  • the anti-TIG IT antagonist antibody includes at least one, two, three, four, five, or six HVRs selected from: (a) an HVR-H1 comprising the amino acid sequence of SNSAAWN (SEQ ID NO: 1); (b) an HVR-H2 comprising the amino acid sequence of KTYYRFKWYSDYAVSVKG (SEQ ID NO: 2); (c) an HVR-H3 comprising the amino acid sequence of ESTTYDLLAGPFDY (SEQ ID NO: 3); (d) an HVR-L1 comprising the amino acid sequence of KSSQTVLYSSNNKKYLA (SEQ ID NO: 4), (e) an HVR- L2 comprising the amino acid sequence of WASTRES (SEQ ID NO: 5); and/or (f) an HVR-L3 comprising
  • anti-TIG IT antagonist antibodies may include (a) an HVR-H1 comprising the amino acid sequence of SNSAAWN (SEQ ID NO: 1); (b) an HVR-H2 comprising the amino acid sequence of KTYYRFKWYSDYAVSVKG (SEQ ID NO: 2); (c) an HVR-H3 comprising the amino acid sequence of ESTTYDLLAGPFDY (SEQ ID NO: 3); (d) an HVR-L1 comprising the amino acid sequence of KSSQTVLYSSNNKKYLA (SEQ ID NO: 4); (e) an HVR-L2 comprising the amino acid sequence of WASTRES (SEQ ID NO: 5); and (f) an HVR-L3 comprising the amino acid sequence of QQYYSTPFT (SEQ ID NO: 6).
  • the anti-TIGIT antagonist antibody has a VH domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of,
  • EVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGKTYYRFKWYSDYAVSVK GRITINPDTSKNQFSLQLNSVTPEDTAVFYCTRESTTYDLLAGPFDYWGQGTLVTVSS (SEQ ID NO: 17) or an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of,
  • QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGKTYYRFKWYSDYAVSVK GRITINPDTSKNQFSLQLNSVTPEDTAVFYCTRESTTYDLLAGPFDYWGQGTLVTVSS (SEQ ID NO: 18); and/or a VL domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, DIVMTQSPDSLAVSLGERATINCKSSQTVLYSSNNKKYLAWYQQKPGQPPNLLIYWASTRESGVPDRFSG SGSGTDFTLTISSLQAEDVAVYYCQQYYSTPFTFGPGTKVEIK (SEQ ID NO: 19).
  • the anti-TIGIT antagonist antibody has a VH domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, SEQ ID NO: 17 and/or a VL domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, SEQ ID NO: 19.
  • the anti-TIGIT antagonist antibody has a VH domain comprising the amino acid sequence of SEQ ID NO: 17 and a VL domain comprising the amino acid sequence of SEQ ID NO: 19. In some instances, the anti-TIGIT antagonist antibody has a VH domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, SEQ ID NO: 18 and/or a VL domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, SEQ ID NO: 19. In some instances, the anti-TIGIT antagonist antibody has a VH domain comprising the amino acid sequence of SEQ ID NO: 18 and a VL domain comprising the amino acid sequence of SEQ ID NO: 19.
  • the anti-TIG IT antagonist antibody includes a heavy chain and a light chain sequence, wherein: (a) the heavy chain comprises the amino acid sequence:
  • the anti-TIG IT antagonist antibody further comprises at least one, two, three, or four of the following light chain variable region framework regions (FRs): an FR-L1 comprising the amino acid sequence of DIVMTQSPDSLAVSLGERATINC (SEQ ID NO: 7); an FR-L2 comprising the amino acid sequence of WYQQKPGQPPNLLIY (SEQ ID NO: 8); an FR-L3 comprising the amino acid sequence of GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYC (SEQ ID NO: 9); and/or an FR-L4 comprising the amino acid sequence of FGPGTKVEIK (SEQ ID NO: 10), or a combination of one or more of the above FRs and one or more variants thereof having at least about 90% sequence identity (e.g.,
  • the antibody further comprises an FR-L1 comprising the amino acid sequence of DIVMTQSPDSLAVSLGERATINC (SEQ ID NO: 7); an FR-L2 comprising the amino acid sequence of WYQQKPGQPPNLLIY (SEQ ID NO: 8); an FR-L3 comprising the amino acid sequence of GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYC (SEQ ID NO: 9); and an FR-L4 comprising the amino acid sequence of FGPGTKVEIK (SEQ ID NO: 10).
  • the anti-TIG IT antagonist antibody further comprises at least one, two, three, or four of the following heavy chain variable region FRs: an FR-H1 comprising the amino acid sequence of XiVQLQQSGPGLVKPSQTLSLTCAISGDSVS (SEQ ID NO: 11), wherein Xi is E or Q; an FR-H2 comprising the amino acid sequence of WIRQSPSRGLEWLG (SEQ ID NO: 12); an FR-H3 comprising the amino acid sequence of RITINPDTSKNQFSLQLNSVTPEDTAVFYCTR (SEQ ID NO: 13); and/or an FR- H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 14), or a combination of one or more of the above FRs and one or more variants thereof having at least about 90% sequence identity (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity)
  • the anti-TIGIT antagonist antibody may further include, for example, at least one, two, three, or four of the following heavy chain variable region FRs: an FR-H1 comprising the amino acid sequence of EVQLQQSGPGLVKPSQTLSLTCAISGDSVS (SEQ ID NO: 15); an FR-H2 comprising the amino acid sequence of WIRQSPSRGLEWLG (SEQ ID NO: 12); an FR-H3 comprising the amino acid sequence of RITINPDTSKNQFSLQLNSVTPEDTAVFYCTR (SEQ ID NO: 13); and/or an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 14), or a combination of one or more of the above FRs and one or more variants thereof having at least about 90% sequence identity (e.g., 90%, 91%, 92%,
  • the anti-TIGIT antagonist antibody includes an FR-H1 comprising the amino acid sequence of EVQLQQSGPGLVKPSQTLSLTCAISGDSVS (SEQ ID NO: 15); an FR-H2 comprising the amino acid sequence of WIRQSPSRGLEWLG (SEQ ID NO: 12); an FR-H3 comprising the amino acid sequence of RITINPDTSKNQFSLQLNSVTPEDTAVFYCTR (SEQ ID NO: 13); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 14).
  • the anti-TIGIT antagonist antibody may further include at least one, two, three, or four of the following heavy chain variable region FRs: an FR-H1 comprising the amino acid sequence of
  • QVQLQQSGPGLVKPSQTLSLTCAISGDSVS (SEQ ID NO: 16); an FR-H2 comprising the amino acid sequence of WIRQSPSRGLEWLG (SEQ ID NO: 12); an FR-H3 comprising the amino acid sequence of RITINPDTSKNQFSLQLNSVTPEDTAVFYCTR (SEQ ID NO: 13); and/or an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 14), or a combination of one or more of the above FRs and one or more variants thereof having at least about 90% sequence identity (e.g., 90%, 91%, 92%,
  • the anti-TIGIT antagonist antibody includes an FR-H1 comprising the amino acid sequence of QVQLQQSGPGLVKPSQTLSLTCAISGDSVS (SEQ ID NO: 16); an FR-H2 comprising the amino acid sequence of WIRQSPSRGLEWLG (SEQ ID NO: 12); an FR-H3 comprising the amino acid sequence of RITINPDTSKNQFSLQLNSVTPEDTAVFYCTR (SEQ ID NO: 13); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 14).
  • an anti-TIGIT antagonist antibody comprising a VH as in any of the instances provided above, and a VL as in any of the instances provided above, wherein one or both of the variable domain sequences include post-translational modifications.
  • any one of the anti-TIGIT antagonist antibodies described above is capable of binding to rabbit TIG IT, in addition to human TIGIT. In some instances, any one of the anti-TIGIT antagonist antibodies described above is capable of binding to both human TIGIT and cynomolgus monkey (cyno) TIGIT. In some instances, any one of the anti-TIGIT antagonist antibodies described above is capable of binding to human TIGIT, cyno TIGIT, and rabbit TIGIT. In some instances, any one of the anti-TIGIT antagonist antibodies described above is capable of binding to human TIGIT, cyno TIGIT, and rabbit TIGIT, but not murine TIGIT.
  • the anti-TIGIT antagonist antibody binds human TIGIT with a KD of about 10 nM or lower and cyno TIGIT with a KD of about 10 nM or lower (e.g., binds human TIGIT with a KD of about 0.1 nM to about 1 nM and cyno TIGIT with a KD of about 0.5 nM to about 1 nM, e.g., binds human TIGIT with a KD of about 0.1 nM or lower and cyno TIGIT with a KD of about 0.5 nM or lower).
  • the anti-TIGIT antagonist antibody specifically binds TIGIT and inhibits or blocks TIGIT interaction with poliovirus receptor (PVR) (e.g., the antagonist antibody inhibits intracellular signaling mediated by TIGIT binding to PVR).
  • PVR poliovirus receptor
  • the antagonist antibody inhibits or blocks binding of human TIGIT to human PVR with an IC50 value of 10 nM or lower (e.g., 1 nM to about 10 nM).
  • the anti-TIGIT antagonist antibody specifically binds TIGIT and inhibits or blocks TIGIT interaction with PVR, without impacting PVR-CD226 interaction.
  • the antagonist antibody inhibits or blocks binding of cyno TIGIT to cyno PVR with an IC50 value of 50 nM or lower (e.g., 1 nM to about 50 nM, e.g., 1 nM to about 5 nM).
  • the anti-TIG IT antagonist antibody inhibits and/or blocks the interaction of CD226 with TIGIT.
  • the anti-TIGIT antagonist antibody inhibits and/or blocks the ability of TIGIT to disrupt CD226 homodimerization.
  • the methods or uses described herein may include using or administering an isolated anti-TIGIT antagonist antibody that competes for binding to TIGIT with any of the anti-TIGIT antagonist antibodies described above.
  • the method may include administering an isolated anti-TIGIT antagonist antibody that competes for binding to TIGIT with an anti-TIGIT antagonist antibody having the following six HVRs: (a) an HVR-H1 comprising the amino acid sequence of SNSAAWN (SEQ ID NO: 1); (b) an HVR-H2 comprising the amino acid sequence of KTYYRFKWYSDYAVSVKG (SEQ ID NO: 2); (c) an HVR-H3 comprising the amino acid sequence of ESTTYDLLAGPFDY (SEQ ID NO: 3); (d) an HVR-L1 comprising the amino acid sequence of KSSQTVLYSSNNKKYLA (SEQ ID NO: 4), (e) an HVR-L2 comprising the amino acid sequence of WASTRES (SEQ ID NO: 5); and (f) an HVR-H1
  • the anti-TIGIT antagonist antibody exhibits Fc-mediated effector function, e.g., participates in antibody-dependent cellular cytotoxicity (ADCC).
  • the anti-TIGIT antagonist antibody is an antibody having intact Fc-mediated effector function (e.g., tiragolumab, vibostolimab, etigilimab, EOS084448, or TJ-T6) or enhanced effector function (e.g., SGN-TGT).
  • the anti-TIGIT antagonist antibody is an antibody that lacks Fc-mediated effector function (e.g., domvanalimab, BMS-986207, ASP8374, or COM902).
  • Fc-mediated effector function e.g., domvanalimab, BMS-986207, ASP8374, or COM902.
  • the anti-TIGIT antagonist antibody is an IgG class antibody.
  • the anti-TIGIT antagonist antibody is an IgG 1 class antibody, e.g., tiragolumab, vibostolimab, domvanalimab, BMS-986207, etigilimab, BGB-A1217, SGN-TGT, EOS084448 (EOS-448), TJ-T6, or AB308.
  • the antibody is a human monoclonal full-length lgG1 class antibody comprising an Fc region.
  • the anti-TIGIT antagonist antibody is a human, monoclonal full-length IgG 1 subclass antibody comprising a human lgG1 Fc region, a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 17, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 19.
  • the anti-TIGIT antagonist antibody is an lgG4 class antibody, e.g., ASP8374 or COM902.
  • the anti-TIGIT antagonist antibodies useful in this invention, including compositions containing such antibodies, may be used in combination with a PD-1 axis binding antagonist (e.g., PD-L1 binding antagonists (e.g., anti-PD-L1 antagonist antibodies, e.g., atezolizumab), PD-1 binding antagonists (e.g., anti-PD-1 antagonist antibodies, e.g., pembrolizumab), and PD-L2 binding antagonists (e.g., anti-PD-L2 antagonist antibodies)).
  • a PD-1 axis binding antagonist e.g., PD-L1 binding antagonists (e.g., anti-PD-L1 antagonist antibodies, e.g., atezolizumab)
  • PD-1 binding antagonists e.g., anti-PD-1 antagonist antibodies, e.g., pembrolizumab
  • PD-L2 binding antagonists e.g., anti-PD-L2 antagonist antibodies
  • the anti-TIGIT antagonist antibody functions to inhibit TIGIT signaling. In some embodiments, the anti-TIGIT antagonist antibody inhibits the binding of TIGIT to its binding partners. Exemplary TIGIT binding partners include CD155 (PVR), CD112 (PVRL2 or Nectin-2), and CD113 (PVRL3 or Nectin-3). In some embodiments, the anti-TIG IT antagonist antibody is capable of inhibiting binding between TIGIT and CD155. In some embodiments, the anti-TIGIT antagonist antibody may inhibit binding between TIGIT and CD112. In some embodiments, the anti-TIGIT antagonist antibody inhibits binding between TIGIT and CD113.
  • the anti-TIGIT antagonist antibody inhibits TIGIT-mediated cellular signaling in immune cells. In some embodiments, the anti-TIGIT antagonist antibody inhibits TIGIT by depleting regulatory T cells (e.g., when engaging a FcyR).
  • the anti-TIGIT antibody is a monoclonal antibody. In some embodiments, the anti-TIGIT antibody is an antibody fragment selected from the group consisting of Fab, Fab’-SH, Fv, scFv, and (Fab’)2 fragments. In some embodiments, the anti-TIGIT antibody is a humanized antibody. In some embodiments, the anti-TIGIT antibody is a human antibody. In some embodiments, the anti-TIGIT antibody described herein binds to human TIGIT. In some embodiments, the anti-TIGIT antibody is an Fc fusion protein.
  • the anti-TIGIT antibody is selected from the group consisting of tiragolumab (MTIG7192A, RG6058 or RO7092284), vibostolimab (MK-7684), ASP8374 (PTZ-201), EOS884448 (EOS-448), SEA-TGT (SGN-TGT)), BGB-A1217, BMS-986207 (ONO-4686), COM902 (CGEN-15137), IBI939, domvanalimab (AB154), M6223, AB308, AB154, TJ-T6, MG1131 , NB6253, HLX301 , HLX53, SL-9258 (TIGIT-Fc-LIGHT), STW264, and YBL-012.
  • the anti- TIGIT antibody is selected from the group consisting of tiragolumab (MTIG7192A, RG6058 or RO7092284), vibostolimab (MK-7684), ASP8374 (PTZ-201), EOS-448, and SEA-TGT (SGN-TGT).
  • the anti-TIGIT antibody may be tiragolumab (MTIG7192A, RG6058 or RO7092284).
  • the anti-TIGIT antibody comprises at least one, two, three, four, five, or six complementarity determining regions (CDRs) of any of the anti-TIGIT antibodies disclosed herein. In some embodiments, the anti-TIGIT antibody comprises the six CDRs of any of the anti-TIGIT antibodies disclosed herein.
  • the anti-TIGIT antibody comprises the six CDRs of any one of the antibodies selected from the group consisting of tiragolumab, ASP8374 (PTZ-201 ), BGB-A1217, BMS- 986207 (ONO-4686), COM902 (CGEN-15137), M6223, IBI939, EOS884448 (EOS-448), domvanalimab (AB154), vibostolimab (MK-7684), and SEA-TGT (SGN-TGT).
  • tiragolumab ASP8374
  • BGB-A1217 BMS- 986207 (ONO-4686)
  • COM902 CGEN-15137
  • M6223 IBI939
  • EOS884448 EOS-448
  • domvanalimab AB154
  • vibostolimab MK-7684
  • SEA-TGT SGN-TGT
  • the anti-TIGIT antibody comprises a heavy chain and a light chain, wherein the heavy chain comprises a heavy chain variable region (VH) sequence of any one of the anti- TIGIT antibodies disclosed herein and the light chain comprises a light chain variable region (VL) of the same antibody.
  • VH heavy chain variable region
  • VL light chain variable region
  • the anti-TIGIT antibody comprises the VH and VL of an anti-TIGIT antibody selected from the group consisting of tiragolumab, ASP8374 (PTZ-201 ), BGB-A1217, BMS- 986207 (ONO-4686), COM902 (CGEN-15137), M6223, IBI939, EOS884448 (EOS-448), domvanalimab (AB154), vibostolimab (MK-7684), and SEA-TGT (SGN-TGT).
  • an anti-TIGIT antibody selected from the group consisting of tiragolumab, ASP8374 (PTZ-201 ), BGB-A1217, BMS- 986207 (ONO-4686), COM902 (CGEN-15137), M6223, IBI939, EOS884448 (EOS-448), domvanalimab (AB154), vibostolimab (MK-7684), and SEA-TGT (SGN-
  • the anti-TIGIT antibody comprises the heavy chain and the light chain of any of the anti-TIGIT antibodies disclosed herein.
  • the anti-TIGIT antibody comprises the heavy chain and the light chain of an anti-TIGIT antibody selected from the group consisting of tiragolumab, ASP8374 (PTZ-201), BGB-A1217, BMS-986207 (ONO-4686), COM902 (CGEN-15137), M6223, IBI939, EOS884448 (EOS-448), domvanalimab (AB154), vibostolimab (MK- 7684), and SEA-TGT (SGN-TGT).
  • the invention provides a bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein said first antigen-binding domain specifically binding to PD-1 comprises a VH domain comprising:
  • HVR-H1 comprising the amino acid sequence of GFSFSSY (SEQ ID NO: 25),
  • HVR-H2 comprising the amino acid sequence GGR
  • HVR-H3 comprising an amino acid sequence of TGRVYFALD (SEQ ID NO: 26); and a VL domain comprising
  • HVR-L1 comprising the amino acid sequence of SESVDTSDNSF (SEQ ID NO: 27);
  • HVR-L2 comprising the amino acid sequence RSS
  • HVR-L3 comprising the amino acid sequence of NYDVPW (SEQ ID NO: 28).
  • the bispecific antibody comprises a Fc domain that is an IgG, particularly an IgG 1 Fc domain or an lgG4 Fc domain and wherein the Fc domain has reduced or even abolished effector function.
  • the Fc domain comprises one or more amino acid substitution that reduces binding to an Fc receptor, in particular towards Fey receptor.
  • a bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the bispecific antibody comprises a Fc domain that is an IgG, particularly an IgG 1 Fc domain or an lgG4 Fc domain and wherein the Fc domain comprises one or more amino acid substitution that reduces binding to an Fc receptor, in particular towards Fey receptor.
  • a bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the second antigen-binding domain that specifically binds to LAG3 comprises a VH domain comprising:
  • HVR-H1 comprising the amino acid sequence of DYTMN (SEQ ID NO: 31),
  • HVR-H2 comprising the amino acid sequence of VISWDGGGTYYTDSVKG (SEQ ID NO: 32), and
  • HVR-H3 comprising an amino acid sequence of GLTDTTLYGSDY (SEQ ID NO: 33); and a VL domain comprising
  • HVR-L1 comprising the amino acid sequence of RASQSISSYLN (SEQ ID NO:34),
  • HVR-L2 comprising the amino acid sequence of AASTLQS (SEQ ID NO:35), and
  • HVR-L3 comprising the amino acid sequence of QQTYSSPLT (SEQ ID NO:36).
  • a bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the first antigen-binding domain specifically binding to PD-1 comprises a VH domain comprising the amino acid sequence of
  • a bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the second antigen-binding domain specifically binding to LAG3 comprises a VH domain comprising the amino acid sequence of EVQLLESGGGLVQPGGSLRL SCAASGFIFDDYTMNWVRQAPGKGLEWVAVISWDGGGTYYTDSVKGRFTISRDDFKNTLY LQMNSLRAEDTAVYYCAKGLTDTTLYGSDYWGQGTLVTVSS (SEQ ID NO: 37) and a VL domain comprising the amino acid sequence of
  • the bispecific antibody targeting PD-1 and LAG3 comprises a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the first antigen-binding domain specifically binding to PD-1 comprises a VH domain having at least 90% identity to (e.g., having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more than 99% identity to) the amino acid sequence of SEQ ID NO: 29 and a VL domain having at least 90% identity to (e.g., having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more than 99% identity to) the amino acid sequence of SEQ ID NO: 30.
  • the first antigen-binding domain specifically binding to PD-1 comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 29 and a VL domain comprising the amino acid sequence of
  • the bispecific antibody targeting PD-1 and LAG3 comprises a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the second antigen-binding domain specifically binding to LAG3 comprises a VH domain having at least 90% identity to (e.g., having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more than 99% identity to) the amino acid sequence of SEQ ID NO: 37 and a VL domain having at least 90% identity to (e.g., having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more than 99% identity to) the amino acid sequence of SEQ ID NO: 38.
  • the second antigen-binding domain specifically binding to LAG3 comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 37 and a VL domain comprising the amino acid sequence of
  • the bispecific antibody targeting PD-1 and LAG3 comprises a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the first antigen-binding domain specifically binding to PD-1 comprises a VH domain having at least 90% identity to (e.g., having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more than 99% identity to) the amino acid sequence of SEQ ID NO: 29 and a VL domain having at least 90% identity to (e.g., having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more than 99% identity to) the amino acid sequence of SEQ ID NO: 30 and the second antigen-binding domain specifically binding to LAG3 comprises a VH domain having at least 90% identity to (e.g., having 90%, 91%, 92%, 93%, 94%, 95%, 95%,
  • a bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the first antigen-binding domain specifically binding to PD-1 comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 29 and a VL domain comprising the amino acid sequence of SEQ ID NO: 30, and the second antigen-binding domain specifically binding to LAG3 comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 37 and a VL domain comprising the amino acid sequence of SEQ ID NO: 38.
  • the bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3 is a human, humanized or chimeric antibody. In particular, it is a humanized or chimeric antibody.
  • the bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3 is bivalent. This means that the bispecific antibody comprises one antigen-binding domain that specifically binds to PD-1 and one antigen-binding domain that specifically binds to LAG3 (1 +1 format).
  • a bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the bispecific antibody comprises an Fc domain, a first Fab fragment comprising the antigen-binding domain that specifically binds to PD-1 and a second Fab fragment comprising the antigen-binding domain that specifically binds to LAG3.
  • the variable domains VL and VH are replaced by each other so that the VH domain is part of the light chain and the VL domain is part of the heavy chain.
  • the variable domains VL and VH are replaced by each other.
  • a bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the bispecific antibody comprises a first heavy chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 39, a first light chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 40, a second heavy chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 41 , and a second light chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO:42.
  • the bispecific antibody comprises a first heavy chain comprising the amino acid sequence of SEQ ID NO: 39, a first light chain comprising the amino acid sequence of SEQ ID NO: 40, a second heavy chain comprising the amino acid sequence of SEQ ID NO: 41 , and a second light chain comprising the amino acid sequence of SEQ ID NO:42 (PD1 - LAG3).
  • a bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the bispecific antibody comprises an Fc domain, a first Fab fragment comprising the antigen-binding domain that specifically binds to PD-1 and a second Fab fragment comprising the antigen-binding domain that specifically binds to LAG3 that is fused to the C-terminus of the Fc domain.
  • the Fab fragment comprising the antigen-binding domain that specifically binds to LAG3 is fused to the C-terminus of the Fc domain via its VH domain (trans 1 +1 format).
  • the bispecific antibody comprises a first heavy chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 39, a first light chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 40, a second heavy chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 61 , and a second light chain comprising an amino acid sequence with at least 95% sequence identity to the sequence of SEQ ID NO: 42.
  • the bispecific antibody may comprise a first heavy chain comprising an amino acid sequence of SEQ ID NO: 39, a first light chain comprising an amino acid sequence of SEQ ID NO: 40, a second heavy chain comprising an amino acid sequence of SEQ ID NO: 61 , and a second light chain comprising an amino acid sequence of SEQ ID NO: 42.
  • a bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the bispecific antibody comprises a Fc domain comprising one or more amino acid modifications that reduce binding to an Fc receptor, in particular towards Fey receptor, and reduce or abolish effector function.
  • one or more amino acid modifications may be introduced into the Fc region of an antibody provided herein, thereby generating an Fc region variant.
  • the Fc region variant may comprise a human Fc region sequence (e.g., a human IgG 1 , lgG2, lgG3 or lgG4 Fc region) comprising an amino acid modification (e.g., a substitution) at one or more amino acid positions.
  • the invention relates to a bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the Fc domain comprises one or more amino acid substitution that reduces binding to an Fc receptor, in particular towards Fey receptor.
  • the Fc domain is of human IgG 1 subclass with the amino acid mutations L234A, L235A and P329G (numbering according to Kabat EU index).
  • the Fc domain confers favorable pharmacokinetic properties to the bispecific antibodies of the invention, including a long serum half-life which contributes to good accumulation in the target tissue and a favorable tissue-blood distribution ratio. At the same time it may, however, lead to undesirable targeting of the bispecific antibodies of the invention to cells expressing Fc receptors rather than to the preferred antigen-bearing cells. Accordingly, in particular embodiments the Fc domain of the the bispecific antibodies of the invention exhibits reduced binding affinity to an Fc receptor and/or reduced effector function, as compared to a native IgG Fc domain, in particular an lgG1 Fc domain or an lgG4 Fc domain. More particularly, the Fc domain is an IgG 1 FC domain.
  • the Fc domain (or the bispecific antigen binding molecule of the invention comprising said Fc domain) exhibits less than 50%, preferably less than 20%, more preferably less than 10% and most preferably less than 5% of the binding affinity to an Fc receptor, as compared to a native IgG 1 Fc domain (or the bispecific antigen binding molecule of the invention comprising a native lgG1 Fc domain), and/or less than 50%, preferably less than 20%, more preferably less than 10% and most preferably less than 5% of the effector function, as compared to a native lgG1 Fc domain (or the bispecific antigen binding molecule of the invention comprising a native lgG1 Fc domain).
  • the Fc domain (or the bispecific antigen binding molecule of the invention comprising said Fc domain) does not substantially bind to an Fc receptor and/or induce effector function.
  • the Fc receptor is an Fey receptor.
  • the Fc receptor is a human Fc receptor.
  • the Fc receptor is an activating Fc receptor.
  • the Fc receptor is an activating human Fey receptor, more specifically human FcyRIIIa, FcyRI or FcyRIla, most specifically human FcyRIIIa.
  • the Fc receptor is an inhibitory Fc receptor.
  • the Fc receptor is an inhibitory human Fey receptor, more specifically human FcyRIIB.
  • the effector function is one or more of CDC, ADCC, ADCP, and cytokine secretion.
  • the effector function is ADCC.
  • the Fc domain domain exhibits substantially similar binding affinity to neonatal Fc receptor (FcRn), as compared to a native lgG1 Fc domain.
  • Substantially similar binding to FcRn is achieved when the Fc domain (or the the bispecific antigen binding molecule of the invention comprising said Fc domain) exhibits greater than about 70%, particularly greater than about 80%, more particularly greater than about 90% of the binding affinity of a native lgG1 Fc domain (or the the bispecific antigen binding molecule of the invention comprising a native IgG 1 Fc domain) to FcRn.
  • the Fc domain is engineered to have reduced binding affinity to an Fc receptor and/or reduced effector function, as compared to a non-engineered Fc domain.
  • the Fc domain of the bispecific antigen binding molecule of the invention comprises one or more amino acid mutation that reduces the binding affinity of the Fc domain to an Fc receptor and/or effector function. Typically, the same one or more amino acid mutation is present in each of the two subunits of the Fc domain.
  • the amino acid mutation reduces the binding affinity of the Fc domain to an Fc receptor.
  • the amino acid mutation reduces the binding affinity of the Fc domain to an Fc receptor by at least 2-fold, at least 5-fold, or at least 10-fold.
  • the bispecific antigen binding molecule of the invention comprising an engineered Fc domain exhibits less than 20%, particularly less than 10%, more particularly less than 5% of the binding affinity to an Fc receptor as compared to bispecific antibodies of the invention comprising a non-engineered Fc domain.
  • the Fc receptor is an Fey receptor.
  • the Fc receptor is a human Fc receptor.
  • the Fc receptor Is an inhibitory Fc receptor.
  • the Fc receptor is an inhibitory human Fey receptor, more specifically human FcyRIIB.
  • the Fc receptor is an activating Fc receptor.
  • the Fc receptor is an activating human Fey receptor, more specifically human FcyRIIIa, FcyRI or FcyRIla, most specifically human FcyRIIIa.
  • binding to each of these receptors is reduced.
  • binding affinity to a complement component, specifically binding affinity to C1q is also reduced.
  • binding affinity to neonatal Fc receptor (FcRn) is not reduced. Substantially similar binding to FcRn, i.e.
  • the Fc domain or the bispecific antigen binding molecule of the invention comprising said Fc domain
  • the Fc domain, or the bispecific antigen binding molecule of the invention comprising said Fc domain may exhibit greater than about 80% and even greater than about 90% of such affinity.
  • the Fc domain of the bispecific antigen binding molecule of the invention is engineered to have reduced effector function, as compared to a non- engineered Fc domain.
  • the reduced effector function can include, but is not limited to, one or more of the following: reduced complement dependent cytotoxicity (CDC), reduced antibody-dependent cell-mediated cytotoxicity (ADCC), reduced antibody-dependent cellular phagocytosis (ADCP), reduced cytokine secretion, reduced immune complex-mediated antigen uptake by antigen-presenting cells, reduced binding to NK cells, reduced binding to macrophages, reduced binding to monocytes, reduced binding to polymorphonuclear cells, reduced direct signaling inducing apoptosis, reduced dendritic cell maturation, or reduced T cell priming.
  • CDC complement dependent cytotoxicity
  • ADCC reduced antibody-dependent cell-mediated cytotoxicity
  • ADCP reduced antibody-dependent cellular phagocytosis
  • reduced immune complex-mediated antigen uptake by antigen-presenting cells reduced binding to NK cells, reduced binding to macrophages, reduced binding to monocytes, reduced binding to polymorphonuclear cells, reduced direct signaling inducing apoptosis, reduced dend
  • Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Patent No. 6,737,056).
  • Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called “DANA” Fc mutant with substitution of residues 265 and 297 to alanine (US Patent No. 7,332,581). Certain antibody variants with improved or diminished binding to FcRs are described.
  • the Fc domain comprises an amino acid substitution at a position of E233, L234, L235, N297, P331 and P329.
  • the Fc domain comprises the amino acid substitutions L234A and L235A (“LALA”).
  • the Fc domain is an lgG1 Fc domain, particularly a human lgG1 Fc domain.
  • the Fc domain comprises an amino acid substitution at position P329.
  • the amino acid substitution is P329A or P329G, particularly P329G.
  • the Fc domain comprises an amino acid substitution at position P329 and a further amino acid substitution selected from the group consisting of E233P, L234A, L235A, L235E, N297A, N297D or P331 S.
  • the Fc domain comprises the amino acid mutations L234A, L235A and P329G (“P329G LALA”).
  • P329G LALA amino acid mutations L234A, L235A and P329G
  • the “P329G LALA” combination of amino acid substitutions almost completely abolishes Fey receptor binding of a human IgG 1 Fc domain, as described in PCT Patent Application No. WO 2012/130831 A1. Said document also describes methods of preparing such mutant Fc domains and methods for determining its properties such as Fc receptor binding or effector functions.
  • Such antibody is an IgG 1 with mutations L234A and L235A or with mutations L234A, L235A and P329G (numbering according to EU index of Kabat et al., Sequences of Proteins of Immunological Interest, 5 th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991).
  • the bispecific antibody of the invention comprises (all positions according to EU index of Kabat) (i) a homodimeric Fc-region of the human IgG 1 subclass optionally with the mutations P329G, L234A and L235A, or (ii) a homodimeric Fc-region of the human lgG4 subclass optionally with the mutations P329G, S228P and L235E, or (iii) a homodimeric Fc-region of the human IgG 1 subclass optionally with the mutations P329G, L234A, L235A, I253A, H310A, and H435A, or optionally with the mutations P329G, L234A, L235A, H310A, H433A, and Y436A, or (iv) a heterodimeric Fc-region wherein one Fc-region polypeptide comprises the mutation T366W, and the other Fc-region polypeptide comprises the mutations T
  • the Fc domain is an lgG4 Fc domain.
  • the Fc domain is an lgG4 Fc domain comprising an amino acid substitution at position S228 (Kabat numbering), particularly the amino acid substitution S228P.
  • the Fc domain is an lgG4 Fc domain comprising amino acid substitutions L235E and S228P and P329G. This amino acid substitution reduces in vivo Fab arm exchange of lgG4 antibodies (see Stubenrauch et al., Drug Metabolism and Disposition 38, 84-91 (2010)).
  • a bispecific antibody comprising (all positions according to EU index of Kabat) a heterodimeric Fc-region of the human lgG4 subclass wherein both Fc-region polypeptides comprise the mutations P329G, S228P and L235E and one Fc-region polypeptide comprises the mutation T366W, and the other Fc-region polypeptide comprises the mutations T366S, L368A and Y407V, or wherein one Fc-region polypeptide comprises the mutations T366W and Y349C, and the other Fc-region polypeptide comprises the mutations T366S, L368A, Y407V, and S354C, or wherein one Fc-region polypeptide comprises the mutations T366W and S354C, and the other Fc-region polypeptide comprises the mutations T366S, L368A, Y407V and Y349C.
  • Antibodies with increased half lives and improved binding to the neonatal Fc receptor (FcRn), which is responsible for the transfer of maternal IgGs to the fetus are described in US 2005/0014934.
  • Those antibodies comprise an Fc region with one or more substitutions therein which improve binding of the Fc region to FcRn.
  • Such Fc variants include those with substitutions at one or more of Fc region residues: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc region residue 434 (US Patent No. 7,371 ,826).
  • Binding to Fc receptors can be easily determined, e.g., by ELISA, or by Surface Plasmon Resonance (SPR) using standard instrumentation such as a BIAcore instrument (GE Healthcare), and Fc receptors such as may be obtained by recombinant expression.
  • a suitable such binding assay is described herein.
  • binding affinity of Fc domains or cell activating bispecific antigen binding molecules comprising an Fc domain for Fc receptors may be evaluated using cell lines known to express particular Fc receptors, such as human NK cells expressing Fcyllla receptor. Effector function of an Fc domain, or bispecific antibodies of the invention comprising an Fc domain, can be measured by methods known in the art.
  • a suitable assay for measuring ADCC is described herein.
  • PBMC peripheral blood mononuclear cells
  • NK Natural Killer
  • ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al., Proc Natl Acad Sci USA 95, 652-656 (1998).
  • the invention relates to the bispecific comprising a first antigen-binding domain that specifically binds PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the Fc domain comprises one or more amino acid substitution that reduces the binding affinity of the antibody to an Fc receptor, in particular towards Fey receptor.
  • the invention relates to the bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the Fc domain comprises one or more amino acid substitution that reduces effector function.
  • the Fc domain is of human IgG 1 subclass with the amino acid mutations L234A, L235A and P329G (numbering according to Kabat EU index).
  • the bispecific antigen binding molecules of the invention comprise different antigen-binding domains, fused to one or the other of the two subunits of the Fc domain, thus the two subunits of the Fc domain may be comprised in two non-identical polypeptide chains. Recombinant co-expression of these polypeptides and subsequent dimerization leads to several possible combinations of the two polypeptides. To improve the yield and purity of the bispecific antibodies of the invention in recombinant production, it will thus be advantageous to introduce in the Fc domain of the bispecific antigen binding molecules of the invention a modification promoting the association of the desired polypeptides.
  • the invention relates to a bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3, wherein the Fc domain comprises a modification promoting the association of the first and second subunit of the Fc domain.
  • the site of most extensive protein-protein interaction between the two subunits of a human IgG Fc domain is in the CH3 domain of the Fc domain.
  • said modification is in the CH3 domain of the Fc domain.
  • said modification is a so-called “knob-into-hole” modification, comprising a “knob” modification in one of the two subunits of the Fc domain and a “hole” modification in the other one of the two subunits of the Fc domain.
  • the invention relates to a bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding site that specifically binds to LAG3, wherein the first subunit of the Fc domain comprises knobs and the second subunit of the Fc domain comprises holes according to the knobs into holes method.
  • the first subunit of the Fc domain comprises the amino acid substitutions S354C and T366W (EU numbering) and the second subunit of the Fc domain comprises the amino acid substitutions Y349C, T366S and Y407V (numbering according to Kabat EU index).
  • the method involves introducing a protuberance (“knob”) at the interface of a first polypeptide and a corresponding cavity (“hole”) in the interface of a second polypeptide, such that the protuberance can be positioned in the cavity so as to promote heterodimer formation and hinder homodimer formation.
  • Protuberances are constructed by replacing small amino acid side chains from the interface of the first polypeptide with larger side chains (e.g., tyrosine or tryptophan).
  • Compensatory cavities of identical or similar size to the protuberances are created in the interface of the second polypeptide by replacing large amino acid side chains with smaller ones (e.g., alanine or threonine).
  • an amino acid residue is replaced with an amino acid residue having a larger side chain volume, thereby generating a protuberance within the CFI3 domain of the first subunit which is positionable in a cavity within the CFI3 domain of the second subunit, and in the CFI3 domain of the second subunit of the Fc domain an amino acid residue is replaced with an amino acid residue having a smaller side chain volume, thereby generating a cavity within the CH3 domain of the second subunit within which the protuberance within the CH3 domain of the first subunit is positionable.
  • the protuberance and cavity can be made by altering the nucleic acid encoding the polypeptides, e.g., by site-specific mutagenesis, or by peptide synthesis.
  • the threonine residue at position 366 is replaced with a tryptophan residue (T366W)
  • T366W tryptophan residue
  • Y407V valine residue
  • the threonine residue at position 366 is replaced with a serine residue (T366S) and the leucine residue at position 368 is replaced with an alanine residue (L368A).
  • the serine residue at position 354 is replaced with a cysteine residue (S354C)
  • the tyrosine residue at position 349 is replaced by a cysteine residue (Y349C).
  • the first subunit of the Fc domain comprises the amino acid substitutions S354C and T366W (EU numbering) and the second subunit of the Fc domain comprises the amino acid substitutions Y349C, T366S and Y407V (numbering according to Kabat EU index).
  • the multispecific antibody comprises the mutations R409D and K370E in the CH3 domain of the “knobs chain” and the mutations D399K and E357K in the CH3 domain of the “hole-chain” (numbering according to Kabat EU index).
  • the bispecific antibody comprises a T366W mutation in the CH3 domain of the “knobs chain” and the mutations T366S, L368A and Y407V in the CH3 domain of the “hole chain” and additionally the mutations R409D and K370E in the CH3 domain of the “knobs chain” and the mutations D399K and E357K in the CH3 domain of the “hole chain” (numbering according to the Kabat EU index).
  • the bispecific antibody comprises the mutations Y349C and T366W in one of the two CH3 domains and the mutations S354C, T366S, L368A and Y407V in the other of the two CH3 domains
  • the multispecific antibody comprises the mutations Y349C and T366W in one of the two CH3 domains and the mutations S354C, T366S, L368A and Y407V in the other of the two CH3 domains and additionally the mutations R409D and K370E in the CH3 domain of the “knobs chain” and the mutations D399K and E357K in the CH3 domain of the “hole chain” (numbering according to the Kabat EU index).
  • a modification promoting association of the first and the second subunit of the Fc domain comprises a modification mediating electrostatic steering effects, e.g., as described in PCT publication WO 2009/089004.
  • this method involves replacement of one or more amino acid residues at the interface of the two Fc domain subunits by charged amino acid residues so that homodimer formation becomes electrostatically unfavorable but heterodimerization electrostatically favorable.
  • the approach described in EP 1870459 is used to support heterodimerization of the first heavy chain and the second heavy chain of the multispecific antibody.
  • This approach is based on the introduction of charged amino acids with opposite charges at specific amino acid positions in the CH3/CH3-domain-interface between both, the first and the second heavy chain.
  • the CH3 domain of the first heavy chain and the CH3 domain of the second heavy chain form an interface that is located between the respective antibody CH3 domains, wherein the respective amino acid sequences of the CH3 domain of the first heavy chain and the amino acid sequence of the CH3 domain of the second heavy chain each comprise a set of amino acids that is located within said interface in the tertiary structure of the antibody, wherein from the set of amino acids that is located in the interface in the CH3 domain of one heavy chain a first amino acid is substituted by a positively charged amino acid and from the set of amino acids that is located in the interface in the CH3 domain of the other heavy chain a second amino acid is substituted by a negatively charged amino acid.
  • the bispecific antibody according to this aspect is herein also referred to as “CH3(+/-)-engineered bispecific antibody” (wherein the abbreviation “+/-” stands for the oppositely charged amino acids that were introduced in the respective CH3 domains).
  • the positively charged amino acid is selected from K, R and H, and the negatively charged amino acid is selected from E or D.
  • the positively charged amino acid is selected from K and R, and the negatively charged amino acid is selected from E or D.
  • the positively charged amino acid is K
  • the negatively charged amino acid is E
  • the amino acid R at position 409 is substituted by D and the amino acid K at position is substituted by E
  • the amino acid D at position 399 is substituted by K and the amino acid E at position 357 is substituted by K (numbering according to Kabat EU index).
  • the approach described in WO 2013/157953 is used to support heterodimerization of the first heavy chain and the second heavy chain of the multispecific antibody.
  • the amino acid T at position 366 is substituted by K
  • the amino acid L at position 351 is substituted by D (numbering according to Kabat EU index).
  • the amino acid T at position 366 is substituted by K and the amino acid L at position 351 is substituted by K
  • the amino acid L at position 351 is substituted by D (numbering according to Kabat EU index).
  • the amino acid T at position 366 is substituted by K and the amino acid L at position 351 is substituted by K
  • the amino acid L at position 351 is substituted by D (numbering according to Kabat EU index).
  • the amino acid Y at position 349 is substituted by E
  • the amino acid Y at position 349 is substituted by D
  • the amino acid L at position 368 is substituted by E (numbering according to Kabat EU index).
  • the amino acid L at position 368 is substituted by E (numbering according to Kabat EU index).
  • the approach described in WO 2012/058768 is used to support heterodimerization of the first heavy chain and the second heavy chain of the multispecific antibody.
  • the amino acid L at position 351 is substituted by Y and the amino acid Y at position 407 is substituted by A
  • the amino acid T at position 366 is substituted by A and the amino acid K at position 409 is substituted by F (numbering according to Kabat EU index).
  • the bispecific antibody is engineered according to WO 2012/058768), i.e. in the CH3 domain of one heavy chain the amino acid L at position 351 is substituted by Y and the amino acid Y at position 407 is substituted by A, and in the CH3 domain of the other heavy chain the amino acid T at position 366 is substituted by V and the amino acid K at position 409 is substituted by F (numbering according to Kabat EU index).
  • the amino acid Y at position 407 is substituted by A
  • the amino acid T at position 366 is substituted by A
  • the amino acid K at position 409 is substituted by F (numbering according to Kabat EU index).
  • the amino acid K at position 392 is substituted by E
  • the amino acid T at position 411 is substituted by E
  • the amino acid D at position 399 is substituted by R
  • the amino acid S at position 400 is substituted by R (numbering according to Kabat EU index).
  • the approach described in WO 2011/143545 is used to support heterodimerization of the first heavy chain and the second heavy chain of the multispecific antibody.
  • amino acid modifications in the CH3 domains of both heavy chains are introduced at positions 368 and/or 409 (numbering according to Kabat EU index).
  • WO 2011/090762 relates to amino acid modifications according to the “knob-into-hole” (KiH) technology.
  • KiH knock-into-hole
  • the amino acid T at position 366 is substituted by W
  • the amino acid Y at position 407 is substituted by A (numbering according to Kabat EU index).
  • the amino acid T at position 366 is substituted by Y
  • the amino acid Y at position 407 is substituted by T (numbering according to Kabat EU index).
  • the approach described in WO 2009/089004 is used to support heterodimerization of the first heavy chain and the second heavy chain of the bispecific antibody.
  • the amino acid K or N at position 392 is substituted by a negatively charged amino acid (in one embodiment by E or D, in one preferred embodiment by D)
  • the amino acid D at position 399 the amino acid E or D at position 356 or the amino acid E at position 357 is substituted by a positively charged amino acid (in one embodiment K or R, in one preferred embodiment by K, in one preferred embodiment the amino acids at positions 399 or 356 are substituted by K) (numbering according to Kabat EU index).
  • the amino acid K or R at position 409 is substituted by a negatively charged amino acid (in one embodiment by E or D, in one preferred embodiment by D) (numbering according to Kabat EU index).
  • the amino acid K at position 439 and/or the amino acid K at position 370 is substituted independently from each other by a negatively charged amino acid (in one embodiment by E or D, in one preferred embodiment by D) (numbering according to Kabat EU index).
  • the approach described in WO 2007/147901 is used to support heterodimerization of the first heavy chain and the second heavy chain of the multispecific antibody.
  • the amino acid K at position 253 is substituted by E
  • the amino acid D at position 282 is substituted by K and the amino acid K at position 322 is substituted by D
  • the amino acid D at position 239 is substituted by K
  • the amino acid E at position 240 is substituted by K
  • the amino acid K at position 292 is substituted by D (numbering according to Kabat EU index).
  • the C-terminus of the heavy chain of the bispecific antibody as reported herein can be a complete C-terminus ending with the amino acid residues PGK.
  • the C-terminus of the heavy chain can be a shortened C-terminus in which one or two of the C terminal amino acid residues have been removed.
  • the C-terminus of the heavy chain is a shortened C-terminus ending PG.
  • a bispecific antibody comprising a heavy chain including a C-terminal CH3 domain as specified herein comprises the C-terminal glycine-lysine dipeptide (G446 and K447, numbering according to Kabat EU index).
  • a bispecific antibody comprising a heavy chain including a C-terminal CH3 domain, as specified herein comprises a C-terminal glycine residue (G446, numbering according to Kabat EU index).
  • the invention relates to a bispecific antibody comprising a first Fab fragment that specifically binds to PD-1 and a second Fab fragment that specifically binds to LAG3, wherein in one of the Fab fragments either the variable domains VH and VL or the constant domains CH1 and CL are exchanged.
  • the bispecific antibodies are prepared according to the Crossmab technology.
  • Multispecific antibodies with a domain replacement/exchange in one binding arm are described in detail in W02009/080252, W02009/080253 and Schaefer, W. et al, PNAS, 108 (2011) 11187-1191. They clearly reduce the byproducts caused by the mismatch of a light chain against a first antigen with the wrong heavy chain against the second antigen (compared to approaches without such domain exchange).
  • the invention relates to a bispecific antibody comprising a first Fab fragment that specifically binds to PD-1 and a second Fab fragment that specifically binds to LAG3, wherein in one of the Fab fragments the variable domains VL and VH are replaced by each other so that the VH domain is part of the light chain and the VL domain is part of the heavy chain.
  • the bispecific antibody is one, wherein in the first Fab fragment comprising the antigen-binding domain that specifically binds to PD-1 the variable domains VL and VH are replaced by each other.
  • the bispecific antibody comprising a first Fab fragment that specifically binds to PD-1 and a second Fab fragment that specifically binds to LAG3, can contain different charged amino acid substitutions (so-called “charged residues”). These modifications are introduced in the crossed or non-crossed CH1 and CL domains. Such modifiactions are described e.g., in WO2015/150447, WO2016/020309 and PCT/EP2016/073408.
  • the invention is concerned with a bispecific antibody comprising a first Fab fragment that specifically binds to PD-1 and a second Fab fragment that specifically binds to LAG3, wherein in one of the Fab fragments in the constant domain CL the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat EU Index), and in the constant domain CH1 the amino acids at positions 147 and 213 are substituted independently by glutamic acid (E) or aspartic acid (D) (numbering according to Kabat EU index).
  • the bispecific antibody is one, wherein in the second Fab fragment comprising the antigen-binding domain that specifically binds to TIM3 the constant domain CL the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat EU Index), and in the constant domain CH1 the amino acids at positions 147 and 213 are substituted independently by glutamic acid (E) or aspartic acid (D) (numbering according to Kabat EU index).
  • the invention relates to a bispecific antibody comprising a first Fab fragment that specifically binds to PD-1 and a second Fab fragment that specifically binds to LAG3, wherein in one of CL domains the amino acid at position 123 (EU numbering) has been replaced by arginine (R) and the amino acid at position 124 (EU numbering) has been substituted by lysine (K) and wherein in one of the CH1 domains the amino acids at position 147 (EU numbering) and at position 213 (EU numbering) have been substituted by glutamic acid (E).
  • a bispecific antibody comprising a first Fab fragment that specifically binds to PD-1 and a second Fab fragment that specifically binds to LAG3, wherein in one of CL domains the amino acid at position 123 (EU numbering) has been replaced by arginine (R) and the amino acid at position 124 (EU numbering) has been substituted by lysine (K) and wherein in one of the CH1 domains the amino acids
  • the bispecific antibody is one, wherein in the second Fab fragment comprising the antigen-binding domain that specifically binds to LAG3 the amino acid at position 123 (EU numbering) has been replaced by arginine (R) and the amino acid at position 124 (EU numbering) has been substituted by lysine (K) and wherein in one of the CH1 domains the amino acids at position 147 (EU numbering) and at position 213 (EU numbering) have been substituted by glutamic acid (E).
  • the bispecific antibody is a bivalent antibody comprising a) a first light chain and a first heavy chain of an antibody specifically binding to a first antigen, and b) a second light chain and a second heavy chain of an antibody specifically binding to a second antigen, wherein the variable domains VL and VH of the second light chain and the second heavy chain are replaced by each other.
  • the antibody under a) does not contain a modification as reported under b) and the heavy chain and the light chain under a) are isolated chains.
  • variable light chain domain VL is replaced by the variable heavy chain domain VH of said antibody
  • variable heavy chain domain VH is replaced by the variable light chain domain VL of said antibody
  • the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat) (in one preferred embodiment independently by lysine (K) or arginine (R)), and wherein in the constant domain CH1 of the first heavy chain under a) the amino acid at position 147 or the amino acid at position 213 is substituted independently by glutamic acid (E) or aspartic acid (D) (numbering according to Kabat EU index), or (ii) in the constant domain CL of the second light chain under b) the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat) (in one preferred embodiment independently by lysine (K) or arginine (R)), and wherein in the constant domain CH1 of the second heavy chain under b) the amino acid
  • the amino acids at position 147 and 213 are substituted by E (numbering according to EU index of Kabat).
  • the amino acids at position 124 and 123 are substituted by K
  • the amino acids at position 147 and 213 are substituted by E (numbering according to Kabat EU index).
  • the amino acid at position 123 is substituted by R and the amino acid at position 124 is substituted by K
  • the amino acids at position 147 and 213 are both substituted by E (numbering according to Kabat EU index).
  • the bispecific antibody is a bivalent antibody comprising a) a first light chain and a first heavy chain of an antibody specifically binding to a first antigen, and b) a second light chain and a second heavy chain of an antibody specifically binding to a second antigen, wherein the variable domains VL and VH of the second light chain and the second heavy chain are replaced by each other, and wherein the constant domains CL and CH1 of the second light chain and the second heavy chain are replaced by each other.
  • the antibody under a) does not contain a modification as reported under b) and the heavy chain and the light chain und a) are isolated chains.
  • the variable light chain domain VL is replaced by the variable heavy chain domain VH of said antibody, and the constant light chain domain CL is replaced by the constant heavy chain domain CH1 of said antibody; and within the heavy chain the variable heavy chain domain VH is replaced by the variable light chain domain VL of said antibody, and the constant heavy chain domain CH1 is replaced by the constant light chain domain CL of said antibody.
  • the bispecific antibody is a bivalent antibody comprising a) a first light chain and a first heavy chain of an antibody specifically binding to a first antigen, and b) a second light chain and a second heavy chain of an antibody specifically binding to a second antigen, wherein the constant domains CL and CH1 of the second light chain and the second heavy chain are replaced by each other.
  • the antibody under a) does not contain a modification as reported under b) and the heavy chain and the light chain under a) are isolated chains.
  • the constant light chain domain CL is replaced by the constant heavy chain domain CH1of said antibody; and within the heavy chain the constant heavy chain domain CH1 is replaced by the constant light chain domain CL of said antibody.
  • the bispecific antibody is a bispecific antibody comprising a) a full-length antibody specifically binding to a first antigen and consisting of two antibody heavy chains and two antibody light chains, and b) one, two, three or four single chain Fab fragments specifically binding to a second antigen, wherein said single chain Fab fragments under b) are fused to said full-length antibody under a) via a peptide linker at the C- or N- terminus of the heavy or light chain of said full length antibody.
  • one or two identical single chain Fab fragments binding to a second antigen are fused to the full-length antibody via a peptide linker at the C terminus of the heavy or light chains of said full-length antibody.
  • one or two identical single chain Fab (scFab) fragments binding to a second antigen are fused to the full-length antibody via a peptide linker at the C terminus of the heavy chains of said full-length antibody.
  • one or two identical single chain Fab (scFab) fragments binding to a second antigen are fused to the full-length antibody via a peptide linker at the C terminus of the light chains of said full-length antibody.
  • two identical single chain Fab (scFab) fragments binding to a second antigen are fused to the full-length antibody via a peptide linker at the C-terminus of each heavy or light chain of said full-length antibody
  • two identical single chain Fab (scFab) fragments binding to a second antigen are fused to the full-length antibody via a peptide linker at the C-terminus of each heavy chain of said full- length antibody.
  • two identical single chain Fab (scFab) fragments binding to a second antigen are fused to the full-length antibody via a peptide linker at the C-terminus of each light chain of said full-length antibody.
  • the bispecific antibody is a trivalent antibody comprising a) a full-length antibody specifically binding to a first antigen and consisting of two antibody heavy chains and two antibody light chains, b) a first polypeptide consisting of ba) an antibody heavy chain variable domain (VH), or bb) an antibody heavy chain variable domain (VH) and an antibody constant domain 1 (CH1), wherein said first polypeptide is fused with the N-terminus of its VH domain via a peptidic linker to the C-terminus of one of the two heavy chains of said full-length antibody, c) a second polypeptide consisting of ca) an antibody light chain variable domain (VL), or cb) an antibody light chain variable domain (VL) and an antibody light chain constant domain (CL), wherein said second polypeptide is fused with the N-terminus of the VL domain via a peptide linker to the C-terminus of the other of the two heavy chains of said full-length antibody, and wherein the antibody heavy chain variable domain (V
  • the antibody heavy chain variable domain (VH) of the polypeptide under b) and the antibody light chain variable domain (VL) of the polypeptide under c) are linked and stabilized via an interchain disulfide bridge by introduction of a disulfide bond between the following positions:
  • the optional disulfide bond between the variable domains of the polypeptides under b) and c) is between heavy chain variable domain position 44 and light chain variable domain position 100.
  • the optional disulfide bond between the variable domains of the polypeptides under b) and c) is between heavy chain variable domain position 105 and light chain variable domain position 43 (numbering always according to Kabat).
  • a trivalent, bispecific antibody without said optional disulfide stabilization between the variable domains VH and VL of the single chain Fab fragments is preferred.
  • the bispecific antibody is a trispecific or tetraspecific antibody, comprising a) a first light chain and a first heavy chain of a full-length antibody which specifically binds to a first antigen, and b) a second (modified) light chain and a second (modified) heavy chain of a full-length antibody which specifically binds to a second antigen, wherein the variable domains VL and VH are replaced by each other, and/or wherein the constant domains CL and CH1 are replaced by each other, and c) wherein one to four antigen-binding domains which specifically bind to one or two further antigens (i.e., to a third and/or fourth antigen) are fused via a peptide linker to the C- or N-terminus of the light chains or heavy chains of a) and/or b).
  • the antibody under a) does not contain a modification as reported under b) and the heavy chain and the light chain und a) are isolated chains.
  • the trispecific or tetraspecific antibody comprises under c) one or two antigen binding domains which specifically bind to one or two further antigens.
  • the antigen-binding domains are selected from the group of a scFv fragment and a scFab fragment.
  • the antigen-binding domains are scFv fragments.
  • the antigen-binding domains are scFab fragments.
  • the antigen-binding domains are fused to the C-terminus of the heavy chains of a) and/or b).
  • the trispecific or tetraspecific antibody comprises under c) one or two antigen binding domains which specifically bind to one further antigen. In one aspect, the trispecific or tetraspecific antibody comprises under c) two identical antigen binding domains which specifically bind to a third antigen. In one preferred embodiment such two identical antigen-binding domains are fused both via the same peptidic linker to the C-terminus of the heavy chains of a) and b). In one preferred embodiment the two identical antigen-binding domains are either a scFv fragment or a scFab fragment.
  • the trispecific or tetraspecific antibody comprises under c) two antigen-binding domains which specifically bind to a third and a fourth antigen.
  • said two antigen binding domains are fused both via the same peptide connector to the C-terminus of the heavy chains of a) and b).
  • said two antigen-binding domains are either a scFv fragment or a scFab fragment.
  • the bispecific antibody is a bispecific, tetravalent antibody comprising a) two light chains and two heavy chains of an antibody, which specifically bind to a first antigen (and comprise two Fab fragments), b) two additional Fab fragments of an antibody, which specifically bind to a second antigen, wherein said additional Fab fragments are fused both via a peptidic linker either to the C- or N-termini of the heavy chains of a), and wherein in the Fab fragments the following modifications were performed
  • variable domains VL and VH are replaced by each other, and/or the constant domains CL and CH1 are replaced by each other, or
  • variable domains VL and VH are replaced by each other, and the constant domains CL and CH1 are replaced by each other, and in both Fab fragments of b) the variable domains VL and VH are replaced by each other, or the constant domains CL and CH1 are replaced by each other, or
  • variable domains VL and VH are replaced by each other, or the constant domains CL and CH1 are replaced by each other, and in both Fab fragments of b) the variable domains VL and VH are replaced by each other, and the constant domains CL and CH1 are replaced by each other, or
  • said additional Fab fragments are fused both via a peptidic linker either to the C- termini of the heavy chains of a), or to the N-termini of the heavy chains of a).
  • said additional Fab fragments are fused both via a peptidic linker to the C-termini of the heavy chains of a).
  • said additional Fab fragments are fused both via a peptide linker to the N-termini of the heavy chains of a).
  • the following modifications are performed: in both Fab fragments of a), or in both Fab fragments of b), the variable domains VL and VH are replaced by each other, and/or the constant domains CL and CH1 are replaced by each other.
  • the bispecific antibody is a tetravalent antibody comprising: a) a (modified) heavy chain of a first antibody, which specifically binds to a first antigen and comprises a first VH-CH1 domain pair, wherein to the C terminus of said heavy chain the N-terminus of a second VH-CH1 domain pair of said first antibody is fused via a peptide linker, b) two light chains of said first antibody of a), c) a (modified) heavy chain of a second antibody, which specifically binds to a second antigen and comprises a first VH-CL domain pair, wherein to the C-terminus of said heavy chain the N-terminus of a second VH-CL domain pair of said second antibody is fused via a peptide linker, and d) two (modified) light chains of said second antibody of c), each comprising a CL-CH1 domain pair.
  • the bispecific antibody comprises a) the heavy chain and the light chain of a first full-length antibody that specifically binds to a first antigen, and b) the heavy chain and the light chain of a second full-length antibody that specifically binds to a second antigen, wherein the N-terminus of the heavy chain is connected to the C-terminus of the light chain via a peptide linker.
  • the antibody under a) does not contain a modification as reported under b) and the heavy chain and the light chain are isolated chains.
  • the bispecific antibody comprises a) a full-length antibody specifically binding to a first antigen and consisting of two antibody heavy chains and two antibody light chains, and b) an Fv fragment specifically binding to a second antigen comprising a VH2 domain and a VL2 domain, wherein both domains are connected to each other via a disulfide bridge, wherein only either the VH2 domain or the VL2 domain is fused via a peptide linker to the heavy or light chain of the full-length antibody specifically binding to a first antigen.
  • the heavy chains and the light chains under a) are isolated chains.
  • the other of the VH2 domain or the VL2 domain is not fused via a peptide linker to the heavy or light chain of the full-length antibody specifically binding to a first antigen.
  • the first light chain comprises a VL domain and a CL domain and the first heavy chain comprises a VH domain, a CH1 domain, a hinge region, a CH2 domain and a CH3 domain.
  • the bispecific antibody is a trivalent antibody comprising a) two Fab fragments that specifically binds to a first antigen, b) one CrossFab fragment that specifically binds to a second antigen in which the CH1 and the CL domain are exchanged for each other, c) one Fc-region comprising a first Fc-region heavy chain and a second Fc region heavy chain, wherein the C-terminus of CH1 domains of the two Fab fragments are connected to the N-terminus of the heavy chain Fc-region polypeptides, and wherein the C-terminus of the CL domain of the CrossFab fragment is connected to the N-terminus of the VH domain of one of the Fab fragments.
  • the bispecific antibody is a trivalent antibody comprising a) two Fab fragments that specifically binds to a first antigen, b) one CrossFab fragment that specifically binds to a second antigen in which the CH1 and the CL domain are exchanged for each other, c) one Fc-region comprising a first Fc-region heavy chain and a second Fc region heavy chain, wherein the C-terminus of CH1 domain of the first Fab fragment is connected to the N-terminus of one of the heavy chain Fc-region polypeptides and the C-terminus of the CL-domain of the CrossFab fragment is connected to the N-terminus of the other heavy chain Fc-region polypeptide, and wherein the C-terminus of the CH1 domain of the second Fab fragment is connected to the N-terminus of the VFI domain of the first Fab fragment or to the N-terminus of the VFI domain of the CrossFab fragment.
  • the bispecific antibody comprises a) a full-length antibody specifically binding to a first antigen and consisting of two antibody heavy chains and two antibody light chains, and b) a Fab fragment specifically binding to a second antigen comprising a VH2 domain and a VL2 domain comprising a heavy chain fragment and a light chain fragment, wherein within the light chain fragment the variable light chain domain VL2 is replaced by the variable heavy chain domain VH2 of said antibody, and within the heavy chain fragment the variable heavy chain domain VH2 is replaced by the variable light chain domain VL2 of said antibody wherein the heavy chain Fab fragment is inserted between the CH1 domain of one of the heavy chains of the full-length antibody and the respective Fc-region of the full-length antibody, and the N- terminus of the light chain Fab fragment is conjugated to the C-terminus of the light chain of the full-length antibody that is paired with the heavy chain of the full-length antibody into which the heavy chain Fab fragment has been inserted.
  • the bispecific antibody comprises a) a full-length antibody specifically binding to a first antigen and consisting of two antibody heavy chains and two antibody light chains, and b) a Fab fragment specifically binding to a second antigen comprising a VH2 domain and a VL2 domain comprising a heavy chain fragment and a light chain fragment, wherein within the light chain fragment the variable light chain domain VL2 is replaced by the variable heavy chain domain VH2 of said antibody, and within the heavy chain fragment the variable heavy chain domain VH2 is replaced by the variable light chain domain VL2 of said antibody and wherein the C-terminus of the heavy chain fragment of the Fab fragment is conjugated to the N-terminus of one of the heavy chains of the full-length antibody and the C-terminus of the light chain fragment of the Fab fragment is conjugated to the N-terminus of the light chain of the full-length antibody that pairs with the heavy chain of the full-length antibody to which the heavy chain fragment of the Fab fragment is conjugated.
  • the appropriate dosage of a bispecific antibodies comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3 of the invention will depend on the type of disease to be treated, the route of administration, the body weight of the subject, the type of fusion protein, the severity and course of the disease, whether the bispecific antibody is administered for preventive or therapeutic purposes, previous or concurrent therapeutic interventions, the subject's clinical history and response to the fusion protein, and the discretion of the attending physician.
  • the practitioner responsible for administration will, in any event, determine the concentration of active ingredient(s) in a composition and appropriate dose(s) for the individual subject.
  • Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
  • the bispecific antibody comprising a first antigen-binding domain that specifically binds to PD-1 and a second antigen-binding domain that specifically binds to LAG3 as defined herein is suitably administered to the subject at one time or over a series of treatments.
  • about 1 pg/kg to 15 mg/kg (e.g., 0.1 mg/kg - 10 mg/kg) of the bispecific antibody can be an initial candidate dosage for administration to the subject, whether, for example, by one or more separate administrations, or by continuous infusion.
  • One typical daily dosage might range from about 1 pg/kg to 100 mg/kg or more, depending on the factors mentioned above.
  • a dose may also comprise from about 1 pg/kg body weight, about 5 pg/kg body weight, about 10 pg/kg body weight, about 50 pg/kg body weight, about 100 pg/kg body weight, about 200 pg/kg body weight, about 350 pg/kg body weight, about 500 pg/kg body weight, about 1 mg/kg body weight, about 5 mg/kg body weight, about 10 mg/kg body weight, about 50 mg/kg body weight, about 100 mg/kg body weight, about 200 mg/kg body weight, about 350 mg/kg body weight, about 500 mg/kg body weight, to about 1000 mg/kg body weight or more per administration, and any range derivable therein.
  • a range of about 5 mg/kg body weight to about 100 mg/kg body weight, about 5 pg/kg body weight to about 500 mg/kg body weight etc. can be administered, based on the numbers described above.
  • one or more doses of about 0.5 mg/kg, 2.0 mg/kg, 5.0 mg/kg or 10 mg/kg (or any combination thereof) may be administered to the subject.
  • Such doses may be administered intermittently, e.g. every week or every three weeks (e.g. such that the subject receives from about two to about twenty, or e.g. about six doses of the fusion protein).
  • An initial higher loading dose, followed by one or more lower doses may be administered.
  • other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
  • the bispecific antibody targeting PD-1 and LAG3 is administered to the subject at a fixed dose of about 600 mg every three weeks (Q3W), e.g., at a fixed dose of 600 mg Q3W.
  • the bispecific antibody targeting PD-1 and LAG3 is administered to the subject at a fixed dose of about 1200 mg every three weeks, e.g., at a fixed dose of 1200 mg Q3W.
  • the bispecific antibody targeting PD-1 and LAG3 is administered to the subject at a fixed dose of about 2100 mg every two weeks (Q2W), e.g., at a fixed dose of 2100 mg Q2W.
  • VEGF antagonists include any molecule capable of binding VEGF, reducing VEGF expression levels, or neutralizing, blocking, inhibiting, abrogating, reducing, or interfering with VEGF biological activities.
  • An exemplary human VEGF is shown under UniProtKB/Swiss-Prot Accession No. P15692, Gene ID (NCBI): 7422.
  • the VEGF antagonist is an anti-VEGF antibody.
  • the anti-VEGF antibody is bevacizumab, also known as “rhuMab VEGF” or “AVASTIN®.”
  • Bevacizumab is a recombinant humanized anti-VEGF monoclonal antibody generated according to Presta et al. ( Cancer Res. 57:4593-4599, 1997). It comprises mutated human IgG 1 framework regions and antigen-binding complementarity-determining regions from the murine anti-hVEGF monoclonal antibody A.4.6.1 that blocks binding of human VEGF to its receptors.
  • Bevacizumab has a molecular mass of about 149,000 daltons and is glycosylated. Bevacizumab and other humanized anti-VEGF antibodies are further described in U.S. Pat. No. 6,884,879, issued Feb. 26, 2005, the entire disclosure of which is expressly incorporated herein by reference.
  • Additional preferred antibodies include the G6 or B20 series antibodies (e.g., G6-31, B20-4.1), as described in PCT Application Publication No. WO 2005/012359.
  • G6 or B20 series antibodies e.g., G6-31, B20-4.1
  • For additional preferred antibodies see U.S. Pat. Nos. 7,060,269, 6,582,959, 6,703,020; 6,054,297; W098/45332; WO 96/30046; W094/10202; EP 0666868B1 ; U.S. Patent Application Publication Nos. 2006009360, 20050186208, 20030206899, 20030190317, 20030203409, and 20050112126; and Popkov et al. (Journal of Immunological Methods 288:149-164, 2004).
  • Other preferred antibodies include those that bind to a functional epitope on human VEGF comprising of residues F17, M18, D19, Y21 , Y25, Q89, 191, K101 , E103, and C104 or, alternatively, comprising residues F17, Y21, Q22, Y25, D63, 183, and Q89.
  • the VEGF antagonist is an anti-VEGFR2 antibody or related molecule (e.g., ramucirumab, tanibirumab, aflibercept); an anti-VEGFR1 antibody or related molecules (e.g., icrucumab, aflibercept (VEGF Trap-Eye; EYLEA®), or ziv-aflibercept (VEGF Trap; ZALTRAP®)); a bispecific VEGF antibody (e.g., MP-0250, vanucizumab (VEGF-ANG2), or bispecific antibodies disclosed in US 2001/0236388); a bispecific antibody including a combination of two of anti-VEGF, anti-VEGFR1 , and anti-VEGFR2 arms; an anti-VEGFA antibody (e.g., bevacizumab, sevacizumab); an anti-VEGFB antibody; an anti-VEGFC antibody (e.g., VGX-100), an anti-VEGFD antibody
  • the VEGF antagonist may be a tyrosine kinase inhibitor, including a receptor tyrosine kinase inhibitors (e.g., a multi-targeted receptor tyrosine kinase inhibitor such as sunitinib or axitinib).
  • a receptor tyrosine kinase inhibitors e.g., a multi-targeted receptor tyrosine kinase inhibitor such as sunitinib or axitinib.
  • PD-1 axis binding antagonists may include PD-L1 binding antagonists, PD-1 binding antagonists, and PD-L2 binding antagonists. Any suitable PD-1 axis binding antagonist may be used for treating a subject having a cancer.
  • the PD-L1 binding antagonist inhibits the binding of PD-L1 to one or more of its ligand binding partners. In other instances, the PD-L1 binding antagonist inhibits the binding of PD-L1 to PD-1. In yet other instances, the PD-L1 binding antagonist inhibits the binding of PD-L1 to B7-1. In some instances, the PD-L1 binding antagonist inhibits the binding of PD-L1 to both PD-1 and B7-1.
  • the PD-L1 binding antagonist may be, without limitation, an antibody, an antigen-binding fragment thereof, an immunoadhesin, a fusion protein, an oligopeptide, or a small molecule.
  • the PD-L1 binding antagonist is a small molecule that inhibits PD-L1 (e.g., GS-4224, INCB086550, MAX-10181 , INCB090244, CA-170, or ABSK041 ).
  • the PD-L1 binding antagonist is a small molecule that inhibits PD-L1 and VISTA.
  • the PD-L1 binding antagonist is CA-170 (also known as AUPM-170).
  • the PD-L1 binding antagonist is a small molecule that inhibits PD-L1 and TIM3.
  • the small molecule is a compound described in WO 2015/033301 and/or WO 2015/033299.
  • the PD-L1 binding antagonist is an anti-PD-L1 antibody.
  • a variety of anti-PD- L1 antibodies are contemplated and described herein.
  • the isolated anti- PD-L1 antibody can bind to a human PD-L1 , for example a human PD-L1 as shown in UniProtKB/Swiss- Prot Accession No. Q9NZQ7-1 , or a variant thereof.
  • the anti-PD-L1 antibody is capable of inhibiting binding between PD-L1 and PD-1 and/or between PD-L1 and B7-1.
  • the anti-PD-L1 antibody is a monoclonal antibody.
  • the anti-PD-L1 antibody is an antibody fragment selected from the group consisting of Fab, Fab’-SH, Fv, scFv, and (Fab’)2 fragments.
  • the anti-PD-L1 antibody is a humanized antibody. In some instances, the anti-PD-L1 antibody is a human antibody.
  • Exemplary anti-PD-L1 antibodies include atezolizumab, MDX- 1105, MEDI4736 (durvalumab), MSB0010718C (avelumab), SHR-1316, CS1001 , envafolimab, TQB2450, ZKAB001 , LP-002, CX-072, IMC-001 , KL-A167, APL-502, cosibelimab, lodapolimab, FAZ053, TG-1501, BGB-A333, BCD-135, AK-106, LDP, GR1405, HLX20, MSB2311, RC98, PDL-GEX, KD036, KY1003, YBL-007, and HS-636.
  • anti-PD-L1 antibodies useful in the methods of this invention and methods of making them are described in International Patent Application Publication No. WO 2010/077634 and U.S. Patent No. 8,217,149, each of which is incorporated herein by reference in its entirety.
  • the anti-PD-L1 antibody comprises:
  • HVR-H1 , HVR-H2, and HVR-H3 sequence of GFTFSDSWIH SEQ ID NO: 64
  • AWISPYGGSTYYADSVKG SEQ ID NO: 65
  • RHWPGGFDY SEQ ID NO: 66
  • the anti-PD-L1 antibody comprises:
  • VH heavy chain variable region
  • VL the light chain variable region (VL) comprising the amino acid sequence: DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSGSGTD FTLTISSLQPEDFATYYCQQYLYHPATFGQGTKVEIKR (SEQ ID NO: 71).
  • the anti-PD-L1 antibody comprises (a) a VH comprising an amino acid sequence comprising having at least 95% sequence identity (e.g., at least 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of SEQ ID NO: 9; (b) a VL comprising an amino acid sequence comprising having at least 95% sequence identity (e.g., at least 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of SEQ ID NO: 10; or (c) a VH as in (a) and a VL as in (b).
  • the anti-PD-L1 antibody comprises atezolizumab, which comprises:
  • the anti-PD-L1 antibody is avelumab (CAS Registry Number: 1537032-82-8).
  • Avelumab also known as MSB0010718C, is a human monoclonal lgG1 anti-PD-L1 antibody (Merck KGaA, Pfizer).
  • the anti-PD-L1 antibody is durvalumab (CAS Registry Number: 1428935-60- 7).
  • Durvalumab also known as MEDI4736, is an Fc-optimized human monoclonal lgG1 kappa anti-PD-L1 antibody (Medlmmune, AstraZeneca) described in WO 2011/066389 and US 2013/034559.
  • the anti-PD-L1 antibody is MDX-1105 (Bristol Myers Squibb).
  • MDX-1105 also known as BMS-936559, is an anti-PD-L1 antibody described in WO 2007/005874.
  • the anti-PD-L1 antibody is LY3300054 (Eli Lilly).
  • the anti-PD-L1 antibody is STI-A1014 (Sorrento).
  • STI-A1014 is a human anti- PD-L1 antibody.
  • the anti-PD-L1 antibody is KN035 (Suzhou Alphamab).
  • KN035 is single domain antibody (dAB) generated from a camel phage display library.
  • the anti-PD-L1 antibody comprises a cleavable moiety or linker that, when cleaved (e.g., by a protease in the tumor microenvironment), activates an antibody antigen-binding domain to allow it to bind its antigen, e.g., by removing a non-binding steric moiety.
  • the anti-PD-L1 antibody is CX-072 (CytomX Therapeutics).
  • the anti-PD-L1 antibody comprises the six HVR sequences (e.g., the three heavy chain HVRs and the three light chain HVRs) and/or the heavy chain variable domain and light chain variable domain from an anti-PD-L1 antibody described in US 20160108123, WO 2016/000619, WO 2012/145493, U.S. Pat. No. 9,205,148, WO 2013/181634, or WO 2016/061142.
  • the anti-PD-L1 antibody has reduced or minimal effector function.
  • the minimal effector function results from an “effector-less Fc mutation” or aglycosylation mutation.
  • the effector-less Fc mutation is an N297A or D265A/N297A substitution in the constant region.
  • the effector-less Fc mutation is an N297A substitution in the constant region.
  • the isolated anti-PD-L1 antibody is aglycosylated. Glycosylation of antibodies is typically either N-linked or O- linked. N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
  • the tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
  • O-linked glycosylation refers to the attachment of one of the sugars N- acetylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
  • Removal of glycosylation sites from an antibody is conveniently accomplished by altering the amino acid sequence such that one of the above- described tripeptide sequences (for N-linked glycosylation sites) is removed.
  • the alteration may be made by substitution of an asparagine, serine or threonine residue within the glycosylation site with another amino acid residue (e.g., glycine, alanine, or a conservative substitution).
  • the PD-1 axis binding antagonist is a PD-1 binding antagonist.
  • the PD-1 binding antagonist inhibits the binding of PD-1 to one or more of its ligand binding partners.
  • the PD-1 binding antagonist inhibits the binding of PD-1 to PD-L1.
  • the PD-1 binding antagonist inhibits the binding of PD-1 to PD-L2. In yet other instances, the PD-1 binding antagonist inhibits the binding of PD-1 to both PD-L1 and PD-L2.
  • the PD-1 binding antagonist may be, without limitation, an antibody, an antigen-binding fragment thereof, an immunoadhesin, a fusion protein, an oligopeptide, or a small molecule.
  • the PD-1 binding antagonist is an immunoadhesin (e.g., an immunoadhesin comprising an extracellular or PD-1 binding portion of PD-L1 or PD-L2 fused to a constant region (e.g., an Fc region of an immunoglobulin sequence).
  • the PD-1 binding antagonist is an Fc-fusion protein.
  • the PD-1 binding antagonist is AMP-224.
  • AMP-224 also known as B7-DCIg, is a PD-L2- Fc fusion soluble receptor described in WO 2010/027827 and WO 2011/066342.
  • the PD-1 binding antagonist is a peptide or small molecule compound.
  • the PD-1 binding antagonist is AUNP-12 (PierreFabre/Aurigene). See, e.g., WO 2012/168944, WO 2015/036927, WO 2015/044900, WO 2015/033303, WO 2013/144704, WO 2013/132317, and WO 2011/161699.
  • the PD-1 binding antagonist is a small molecule that inhibits PD-1.
  • the PD-1 binding antagonist is an anti-PD-1 antibody.
  • a variety of anti-PD-1 antibodies can be utilized in the methods and uses disclosed herein. In any of the instances herein, the PD-1 antibody can bind to a human PD-1 or a variant thereof.
  • the anti-PD-1 antibody is a monoclonal antibody. In some instances, the anti-PD-1 antibody is an antibody fragment selected from the group consisting of Fab, Fab’, Fab’-SH, Fv, scFv, and (Fab’)2 fragments. In some instances, the anti-PD-1 antibody is a humanized antibody. In other instances, the anti-PD-1 antibody is a human antibody.
  • anti-PD-1 antagonist antibodies include nivolumab, pembrolizumab, MEDI-0680, PDR001 (spartalizumab), REGN2810 (cemiplimab), BGB-108, prolgolimab, camrelizumab, sintilimab, tislelizumab, toripalimab, dostarlimab, retifanlimab, sasanlimab, penpulimab, CS1003, HLX10, SCT-I10A, zimberelimab, balstilimab, genolimzumab, Bl 754091, cetrelimab, YBL-006, BAT1306, HX008, budigalimab, AMG 404, CX-188, JTX-4014, 609A, Sym021 , LZM009, F520, SG001 , AM0001 , ENUM 244C8, ENUM 388D4, STI-11
  • the anti-PD-1 antibody is nivolumab (CAS Registry Number: 946414-94-4).
  • Nivolumab (Bristol-Myers Squibb/Ono), also known as MDX-1106-04, MDX-1106, ONO-4538, BMS- 936558, and OPDIVO®, is an anti-PD-1 antibody described in WO 2006/121168.
  • the anti-PD-1 antibody is pembrolizumab (CAS Registry Number: 1374853- 91-4).
  • Pembrolizumab (Merck), also known as MK-3475, Merck 3475, lambrolizumab, SCH-900475, and KEYTRUDA®, is an anti-PD-1 antibody described in WO 2009/114335.
  • the anti-PD-1 antibody is MEDI-0680 (AMP-514; AstraZeneca).
  • MEDI-0680 is a humanized lgG4 anti-PD-1 antibody.
  • the anti-PD-1 antibody is PDR001 (CAS Registry No. 1859072-53-9;
  • PDR001 is a humanized lgG4 anti-PD-1 antibody that blocks the binding of PD-L1 and PD-L2 to PD-1.
  • the anti-PD-1 antibody is REGN2810 (Regeneron).
  • REGN2810 is a human anti-PD-1 antibody.
  • the anti-PD-1 antibody is BGB-108 (BeiGene).
  • the anti-PD-1 antibody is BGB-A317 (BeiGene).
  • the anti-PD-1 antibody is JS-001 (Shanghai Junshi).
  • JS-001 is a humanized anti-PD-1 antibody.
  • the anti-PD-1 antibody is STI-A1110 (Sorrento).
  • STI-A1110 is a human anti- PD-1 antibody.
  • the anti-PD-1 antibody is INCSHR-1210 (Incyte).
  • INCSHR-1210 is a human lgG4 anti-PD-1 antibody.
  • the anti-PD-1 antibody is PF-06801591 (Pfizer).
  • the anti-PD-1 antibody is TSR-042 (also known as ANB011 ; Tesaro/AnaptysBio).
  • the anti-PD-1 antibody is AM0001 (ARMO Biosciences).
  • the anti-PD-1 antibody is ENUM 244C8 (Enumeral Biomedical Holdings).
  • ENUM 244C8 is an anti-PD-1 antibody that inhibits PD-1 function without blocking binding of PD-L1 to
  • the anti-PD-1 antibody is ENUM 388D4 (Enumeral Biomedical Holdings).
  • ENUM 388D4 is an anti-PD-1 antibody that competitively inhibits binding of PD-L1 to PD-1.
  • the anti-PD-1 antibody comprises the six HVR sequences (e.g., the three heavy chain HVRs and the three light chain HVRs) and/or the heavy chain variable domain and light chain variable domain from an anti-PD-1 antibody described in WO 2015/112800, WO 2015/112805, WO 2015/112900, US 20150210769 , WO2016/089873, WO 2015/035606, WO 2015/085847, WO 2014/206107, WO 2012/145493, US 9,205,148, WO 2015/119930, WO 2015/119923, WO 2016/032927, WO 2014/179664, WO 2016/106160, and WO 2014/194302.
  • the six HVR sequences e.g., the three heavy chain HVRs and the three light chain HVRs
  • the heavy chain variable domain and light chain variable domain from an anti-PD-1 antibody described in WO 2015/112800, WO 2015/112805, WO 2015/112900, US 20150210769 , WO2016/0898
  • the anti-PD-1 antibody has reduced or minimal effector function.
  • the minimal effector function results from an “effector-less Fc mutation” or aglycosylation mutation.
  • the effector-less Fc mutation is an N297A or D265A/N297A substitution in the constant region.
  • the isolated anti-PD-1 antibody is aglycosylated.
  • the PD-1 axis binding antagonist is a PD-L2 binding antagonist.
  • the PD-L2 binding antagonist is a molecule that inhibits the binding of PD-L2 to its ligand binding partners.
  • the PD-L2 binding ligand partner is PD-1.
  • the PD-L2 binding antagonist may be, without limitation, an antibody, an antigen-binding fragment thereof, an immunoadhesin, a fusion protein, an oligopeptide, or a small molecule.
  • the PD-L2 binding antagonist is an anti-PD-L2 antibody.
  • the anti-PD-L2 antibody can bind to a human PD-L2 or a variant thereof.
  • the anti-PD-L2 antibody is a monoclonal antibody.
  • the anti-PD-L2 antibody is an antibody fragment selected from the group consisting of Fab, Fab’, Fab’-SH, Fv, scFv, and (Fab’)2 fragments.
  • the anti-PD-L2 antibody is a humanized antibody.
  • the anti-PD-L2 antibody is a human antibody.
  • the anti-PD-L2 antibody has reduced or minimal effector function.
  • the minimal effector function results from an “effector-less Fc mutation” or aglycosylation mutation.
  • the effector-less Fc mutation is an N297A or D265A/N297A substitution in the constant region.
  • the isolated anti-PD-L2 antibody is aglycosylated.
  • compositions and formulations comprising a bispecific antibody targeting PD-1 and LAG3 and, optionally, a pharmaceutically acceptable carrier.
  • the disclosure also provides: (i) pharmaceutical compositions and formulations comprising a bispecific antibody targeting PD-1 and LAG3 and an anti-VEGF antibody (e.g., bevacizumab), and optionally, a pharmaceutically acceptable carrier; and (ii) pharmaceutical compositions and formulations comprising an anti-TIGIT antagonist antibody and a bispecific antibody targeting PD-1 and LAG3 and optionally, a pharmaceutically acceptable carrier.
  • compositions and formulations of a bispecific antibody targeting PD-1 and LAG3 and/or other agents described herein can be prepared by mixing the agent or agents having the desired degree of purity with one or more optional pharmaceutically acceptable carriers (Remington’s Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions.
  • mosunetuzumab is formulated for administration subcutaneously. In some embodiments, mosunetuzumab is formulated for administration intravenously.
  • compositions and formulations as described herein can be prepared by mixing the active ingredients (e.g., a bispecific antibody targeting PD-1 and LAG3, an anti-TIGIT antagonist antibody, and/or an anti-VEGF antibody) having the desired degree of purity with one or more optional pharmaceutically acceptable carriers (see, e.g., Remington’s Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), e.g., in the form of lyophilized formulations or aqueous solutions.
  • active ingredients e.g., a bispecific antibody targeting PD-1 and LAG3, an anti-TIGIT antagonist antibody, and/or an anti-VEGF antibody
  • one or more optional pharmaceutically acceptable carriers see, e.g., Remington’s Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)
  • An exemplary tiragolumab formulation comprises a histidine solution containing polysorbate 20, sucrose, L-methionine, and WFI.
  • Tiragolumab may be provided in a 15-mL vial containing 10 ml_ of tiragolumab drug product at an approximate concentration of tiragolumab antibody of 60 mg/mL.
  • Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arg
  • Exemplary pharmaceutically acceptable carriers herein further include interstitial drug dispersion agents such as soluble neutral-active hyaluronidase glycoproteins (sHASEGP), for example, human soluble PH-20 hyaluronidase glycoproteins, such as rHuPH20 (HYLENEX®, Baxter International, Inc.).
  • sHASEGP soluble neutral-active hyaluronidase glycoproteins
  • rHuPH20 HYLENEX®, Baxter International, Inc.
  • Certain exemplary sHASEGPs and methods of use, including rHuPH20 are described in U.S. Patent Publication Nos. 2005/0260186 and 2006/0104968.
  • a sHASEGP is combined with one or more additional glycosaminoglycanases such as chondroitinases.
  • Exemplary lyophilized antibody formulations are described in U.S. Patent No. 6,267,958.
  • Aqueous antibody formulations include those described in U.S. Patent No. 6,171 ,586 and W02006/044908, the latter formulations including a histidine-acetate buffer.
  • the formulation herein may also contain more than one active ingredient as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
  • an additional therapeutic agent e.g., a chemotherapeutic agent, a cytotoxic agent, a growth inhibitory agent, and/or an anti-hormonal agent, such as those recited herein above.
  • Such active ingredients are suitably present in combination in amounts that are effective for the purpose intended.
  • Active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methyl methacrylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
  • colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, for example, films, or microcapsules.
  • the formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes. XII. Articles of Manufacture or Kits
  • Kits comprising a bispecific antibody targeting PD- 1 and LAG3 and an anti-TIGIT antagonist antibody
  • an article of manufacture or a kit comprising a bispecific antibody targeting PD-1 and LAG3 and an anti-TIGIT antagonist antibody (e.g., tiragolumab).
  • the article of manufacture or kit further comprises a package insert comprising instructions for using the anti-TIGIT antagonist antibody in combination with the bispecific antibody targeting PD-1 and LAG3 to treat or delay progression of cancer in a subject.
  • a package insert comprising instructions for using the anti-TIGIT antagonist antibody in combination with the bispecific antibody targeting PD-1 and LAG3 to treat or delay progression of cancer in a subject.
  • Any of the bispecific antibody targeting PD-1 and LAG3 and/or anti-TIGIT antagonist antibodies described herein may be included in the article of manufacture or kits.
  • kits comprising a bispecific antibody targeting PD-1 and LAG3 for use in combination with an anti-TIGIT antagonist antibody for treating a subject having a cancer according to any of the methods described herein.
  • the kit further comprises the anti-TIGIT antagonist antibody.
  • the article of manufacture or kit further comprises a package insert comprising instructions for using the bispecific antibody targeting PD-1 and LAG3 in combination with the anti-TIGIT antagonist antibody (e.g., tiragolumab) to treat or delay progression of a cancer in a subject.
  • the bispecific antibody targeting PD-1 and LAG3 and the anti-TIGIT antagonist antibody are in the same container or separate containers.
  • Suitable containers include, for example, bottles, vials, bags and syringes.
  • the container may be formed from a variety of materials such as glass, plastic (such as polyvinyl chloride or polyolefin), or metal alloy (such as stainless steel or hastelloy).
  • the container holds the formulation and the label on, or associated with, the container may indicate directions for use.
  • the article of manufacture or kit may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.
  • the article of manufacture further includes one or more of another agent (e.g., an additional chemotherapeutic agent or anti neoplastic agent).
  • another agent e.g., an additional chemotherapeutic agent or anti neoplastic agent.
  • suitable containers for the one or more agents include, for example, bottles, vials, bags and syringes.
  • any of the bispecific antibodies targeting PD-1 and LAG3 and/or anti-TIGIT antagonist antibodies described herein may be included in the article of manufacture or kits. Any of the articles of manufacture or kits may include instructions to administer a bispecific antibody targeting PD-1 and LAG3 and/or an anti-TIGIT antagonist antibody to a subject in accordance with any of the methods described herein, e.g., any of the methods set forth in Section III above.
  • Kits comprising a bispecific antibody targeting PD- 1 and LAG3 and an anti- VEGF antibody
  • an article of manufacture or a kit comprising a bispecific antibody targeting PD-1 and LAG3 and an anti-VEGF antibody (e.g., bevacizumab).
  • the article of manufacture or kit further comprises a package insert comprising instructions for using the anti-VEGF antibody in combination with the bispecific antibody targeting PD-1 and LAG3 to treat or delay progression of cancer in a subject.
  • a package insert comprising instructions for using the anti-VEGF antibody in combination with the bispecific antibody targeting PD-1 and LAG3 to treat or delay progression of cancer in a subject.
  • Any of the bispecific antibody targeting PD-1 and LAG3 and/or anti- VEGF antibodies described herein may be included in the article of manufacture or kits.
  • a kit comprising a bispecific antibody targeting PD-1 and LAG3 for use in combination with an anti-VEGF antibody for treating a subject having a cancer according to any of the methods described herein.
  • the kit further comprises the anti-VEGF antibody.
  • the article of manufacture or kit further comprises a package insert comprising instructions for using the bispecific antibody targeting PD-1 and LAG3 in combination with the anti-VEGF antibody to treat or delay progression of a cancer in a subject.
  • the bispecific antibody targeting PD-1 and LAG3 and the anti-VEGF antibody are in the same container or separate containers.
  • Suitable containers include, for example, bottles, vials, bags and syringes.
  • the container may be formed from a variety of materials such as glass, plastic (such as polyvinyl chloride or polyolefin), or metal alloy (such as stainless steel or hastelloy).
  • the container holds the formulation and the label on, or associated with, the container may indicate directions for use.
  • the article of manufacture or kit may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.
  • the article of manufacture further includes one or more of another agent (e.g., an additional chemotherapeutic agent or anti-neoplastic agent).
  • another agent e.g., an additional chemotherapeutic agent or anti-neoplastic agent.
  • suitable containers for the one or more agents include, for example, bottles, vials, bags and syringes.
  • any of the bispecific antibodies targeting PD-1 and LAG3 and/or anti-VEGF antibodies described herein may be included in the article of manufacture or kits. Any of the articles of manufacture or kits may include instructions to administer a bispecific antibody targeting PD-1 and LAG3 and/or an anti-VEGF antibody to a subject in accordance with any of the methods described herein, e.g., any of the methods set forth in Section III above.
  • Example 1 A Phase Ib/ll, open-label, multicenter, randomized umbrella study evaluating the efficacy and safety of multiple treatment combinations in patients with melanoma
  • Melanoma is a potentially deadly form of skin cancer and is one of the fastest-growing malignancies (Algazi et al. Cancer Manag Res. 2: 197-211, 2010; Finn et al. BMC Med. 10: 23, 2012). More than 300,000 people worldwide are currently diagnosed with melanoma each year, and 57,000 people die of the disease. The clinical outcomes of patients with melanoma are highly dependent on the stage at presentation. Most people who present with more advanced melanoma have a poor prognosis (Finn et al. BMC Med. 10: 23, 2012).
  • B043328 is a Phase Ib/ll, open-label, multicenter, randomized, umbrella study in patients with resectable Stage III (Cohort 1) or Stage IV (Cohort 2) melanoma.
  • the study is designed with the flexibility to open new treatment arms as new treatments become available, close existing treatment arms that demonstrate minimal clinical activity or unacceptable toxicity, modify the patient population (e.g., with regard to prior anti-cancer treatment or biomarker status), or introduce additional cohorts of patients with other types of melanoma.
  • ADA anti-drug antibody
  • ASTCT American Society for Transplantation and Cellular Therapy
  • CLND completion lymph node dissection
  • CR complete response
  • CRS cytokine-release syndrome
  • EFS event-free survival
  • NCI CTCAE v5.0 National Cancer Institute Common Terminology Criteria for Adverse Events, Version 5.0
  • ORR objective response rate
  • OS overall survival
  • pCR pathologic complete response
  • PK pharmacokinetic
  • pnCR pathologic near complete response
  • pPR pathologic partial response
  • PR partial response
  • pRR pathologic response rate
  • RECIST v1 .1 Response Evaluation Criteria in Solid Tumors, Version 1 .1 ;
  • RFS relapse-free survival.
  • ADA anti-drug antibody
  • ASTCT American Society for Transplantation and Cellular Therapy
  • CR complete response
  • CRS cytokine-release syndrome
  • DOR duration of response
  • iRECIST modified RECIST v1 .1 for immune-based therapeutics
  • NCI CTCAE v5.0 National Cancer Institute Common Terminology Criteria for Adverse Events, Version 5.0
  • ORR objective response rate
  • OS overall survival
  • PFS progression-free survival
  • PK pharmacokinetic
  • PR partial response
  • RECIST v1 .1 Response Evaluation Criteria in Solid Tumors, Version 1 .1 .
  • Cohort 1 enrolls patients with resectable Stage III melanoma with measurable lymph node metastases according to Response Evaluation Criteria in Solid Tumors, Version 1 .1 (RECIST v1 .1) that can be biopsied, who have no history of in-transit metastases within the last 6 months, and who have not received systemic CIT for their disease, e.g., PD-1/PD-L1 and/or CTLA-4 blocking agents or other agents.
  • RECIST v1 .1 Solid Tumors
  • Cohort 2 enrolls patients with Stage IV melanoma who experienced disease progression during or after at least one but not more than two lines of treatment for metastatic disease. Up to two lines of checkpoint inhibition therapy (monotherapy or combination therapy) are allowed. Patients with BRAF- mutant disease may have received an additional line of targeted therapy (either before, intermittent with, or after the checkpoint inhibition therapy) or may have received targeted therapy and checkpoint inhibition therapy concurrently as one combination treatment.
  • patients are randomly assigned to a control arm (nivolumab plus ipilimumab (Nivo + Ipi)) or an experimental arm consisting of R07247669 (a bispecific antibody that binds to PD-1 and LAG3), atezolizumab in combination with tiragolumab (Atezo + Tira), or R07247669 in combination with tiragolumab (R07247669 + Tira).
  • Patients are stratified by geographic region (Australia vs. Rest of the World) and baseline LDH ( ⁇ the upper limit of normal (ULN) vs. > ULN). Details on the treatment regimens are provided in Table 7 and Fig. 1 .
  • the Sponsor may decide to delay or suspend enrollment within a given treatment arm. Experimental arms with insufficient clinical activity or unacceptable toxicity are not expanded. Additional patients may be enrolled to ensure balance among treatment arms with respect to demographic and baseline characteristics, including potential predictive biomarkers, in order to enable further subgroup analyses.
  • the randomization ratio depends on the number of experimental arms that are available (e.g., if an arm is added or enrollment in an arm is suspended, pending analysis of results from the preliminary phase), with the stipulation that the likelihood of being allocated to the control arm is no more than 35%. Randomization takes into account arm-specific exclusion criteria. Patients are ineligible for a specific arm if they meet any of the exclusion criteria outlined for that arm.
  • Treatment Regimens a The Sponsor may decide to delay or suspend enrollment within a given treatment arm. Thus, all experimental arms may not open for enrollment at the same time. b During the safety run-in phase, patients are assigned to available treatment arms. The treatment assignment ratio depends on the number of experimental arms that are open for enrollment. c The randomization ratio depends on the number of experimental arms that are open for randomization (e.g., if an arm is added or randomization into an arm is suspended pending analysis of results from the preliminary phase), with the stipulation that the likelihood of being allocated to the control arm is no more than 35%. d If clinical activity is observed in an experimental arm during the preliminary phase, approximately 20 additional patients are enrolled in that arm during the expansion phase.
  • suspected clinical or radiographic progression per RECIST v1.1 may not be indicative of true disease progression.
  • patients who meet the criteria for disease progression per RECIST v1.1 while receiving treatment with a CIT drug are permitted to continue study treatment until surgery.
  • progression is confirmed by biopsy or repeated radiographic assessment by an additional expert reviewer. All patients are expected to proceed with surgery, provided that there are no distant metastases and the surgeon considers the disease to be completely resectable.
  • Radiographic progression per RECIST v1.1 may not be indicative of true disease progression.
  • patients who meet criteria for disease progression per RECIST v1 .1 while receiving treatment with a CIT combination are permitted to continue treatment if they meet all of the following criteria:
  • Patients eligible for treatment beyond progression are informed by the investigator that they may be foregoing other treatment options known to confer clinical benefit while continuing to receive the study treatment. Patients have the right to voluntarily withdraw from the study at any time for any reason. In addition, the investigator has the right to withdraw a patient from the study for medical conditions that the investigator or Sponsor determines may jeopardize the patient’s safety if he/she continues in the study.
  • the safety evaluation is based on safety data from a minimum of 6 patients who have received at least one dose of treatment (i.e., one dose of each agent for a given combination) and who have completed safety follow-up assessments until surgery. Notably, timely conduct of surgery (CLND) is an indicator of treatment tolerability.
  • CLND timely conduct of surgery
  • a minimum of 6 patients in Cohort 2 must complete the initial safety run-in phase. If the R07247669 + Tira combination is determined to be tolerable, enrollment for the preliminary phase may be opened, and the R07247669 + Tira arm in Cohort 1 can be opened for enrollment. Patients in the safety run-in phase are enrolled and treated in a sequential manner, with at least one week between the first patient and the remaining patients.
  • the assessment is based on safety data from a minimum of 6 patients who have received at least one dose of treatment (i.e., one dose of each agent) and who have completed safety follow-up assessments for at least 28 days. If > 30% of patients experience one or more of the following events that is considered to be at least possibly related to study treatment, enrollment for that combination is put on hold while the Sponsor evaluates the benefit-risk profile of that treatment:
  • the end of this study is defined as the date when the last patient completes the last visit, including survival follow-up visits conducted by telephone or in the clinic.
  • the total length of the study, from screening of the first patient to the end of the study, is expected to be approximately 5 years.
  • Cohort 1 enrolls patients with resectable Stage III melanoma with measurable lymph node metastases (according to RECIST v1.1) that can be biopsied, and who have no history of in-transit metastases within the last 6 months. Enrolled patients must not have received prior immunotherapy for their disease.
  • Neoadjuvant therapy was found to have a statistically significant and clinically meaningful benefit as compared with adjuvant therapy (Rozeman et al. Lancet Oncol. 20: 948-960, 2019; Blank et al. J Clin Oncol. 38: 15S, 2020; Rozeman et al. Nat Med. 27: 256-263, 2021 ).
  • the safety profile of the treatment was found to be tolerable in an optimized treatment schedule.
  • Cohort 2 enrolls patients with Stage IV melanoma who experienced disease progression during or after at least one but not more than two lines of treatment for metastatic disease. Up to two lines of checkpoint inhibition therapy (monotherapy or combination therapy) are allowed. Patients with BRAF- mutant disease may have received an additional line of targeted therapy (either before, intermittent with, or after the checkpoint inhibition therapy) or may have received targeted therapy and checkpoint inhibition therapy concurrently as one combination treatment.
  • Baseline tumor tissue samples are collected from all patients (except patients in the Cohort 2 safety run-in phase) by biopsy of a metastatic lymph node (Cohort 1) or other metastatic lesion (Cohort 2) at screening.
  • archival primary tumor tissue is submitted from all patients if available. In case no archival primary tissue is available (e.g., for patients with unknown primary tumor), enrollment is permitted.
  • a formalin-fixed, paraffin-embedded (FFPE) tumor specimen in a paraffin block (preferred) with sufficient size and tumor content representation, preferably including the invasive margin, or at least 16 slides containing unstained, freshly cut, serial sections must be submitted along with an associated pathology report. If only 10-15 slides are available, the patient is still eligible for the study.
  • FFPE formalin-fixed, paraffin-embedded
  • stable anticoagulant regimen i.e. , no new thrombosis, thromboembolic event, or bleeding episode within 3 months prior to study treatment start.
  • Negative HIV test at screening Patients without a prior positive HIV test result undergo an HIV test at screening, unless not permitted per local regulations.
  • Negative hepatitis B surface antibody (HBsAb), and negative total hepatitis B core antibody (HBcAb) test at screening. If a patient has a negative hepatitis B surface antigen (HBsAg) test and a positive total HBcAb test at screening, an hepatitis B virus (HBV) DNA test must also be performed to rule out active HBV.
  • HBsAg negative hepatitis B surface antigen
  • HBV hepatitis B virus
  • Negative hepatitis C virus (HCV) antibody test at screening or positive HCV antibody test followed by a negative HCV RNA test at screening.
  • the HCV RNA test is performed only for patients who have a positive HCV antibody test.
  • Patients may present with primary melanoma with concurrent regional nodal metastasis, or a history of primary melanoma or unknown primary melanoma with clinically detected regional nodal recurrence, and may belong to any of the following groups: Primary cutaneous melanoma with concurrent clinically/radiologically apparent regional lymph node metastases; clinically/radiologically detected recurrent melanoma at the proximal regional lymph node(s) basin; or clinically/radiologically detected nodal melanoma (if single site) arising from an unknown primary.
  • Measurable disease at least one target lesion
  • At least one macroscopic lymph node metastasis measurable according to RECIST v1.1 to be biopsied.
  • Measurable disease at least one target lesion
  • RECIST v1.1 Measurable disease (at least one target lesion) according to RECIST v1.1.
  • At least one metastasis (measurable according to RECIST v1.1).
  • systemic immunosuppressive medication including, but not limited to, cyclophosphamide, azathioprine, methotrexate, thalidomide, and anti-tumor necrosis factor-a agents
  • systemic immunosuppressive medication including, but not limited to, cyclophosphamide, azathioprine, methotrexate, thalidomide, and anti-tumor necrosis factor-a agents
  • patients on replacement doses of corticosteroids to manage hypopituitary or adrenal insufficiency are eligible for the study; patients who received acute, low-dose, systemic immunosuppressant medications, or a one-time pulse dose of systemic immunosuppressant medication (e.g., 48 hours of corticosteroids for a contrast allergy) are eligible for the study after discussion with Medical Monitor; patients who received mineralocorticoids (e.g., fludrocortisone), corticosteroids for chronic obstructive pulmonary disease or asthma, or low-
  • autoimmune disease or immune deficiency including, but not limited to, myasthenia gravis, myositis, autoimmune hepatitis, systemic lupus erythematosus, rheumatoid arthritis, inflammatory bowel disease, antiphospholipid antibody syndrome, Wegener granulomatosis, Sjogren syndrome, Guillain-Barre syndrome, or multiple sclerosis, with the following exceptions:
  • rash must cover ⁇ 10% of body surface area; disease is well controlled at baseline and requires only low-potency topical corticosteroids; there is no occurrence of acute exacerbations of the underlying condition requiring psoralen plus ultraviolet A radiation, methotrexate, retinoids, biologic agents, oral calcineurin inhibitors, or high-potency or oral corticosteroids within the previous 12 months.
  • Severe infection within 4 weeks prior to initiation of study treatment including, but not limited to, hospitalization for complications of infection, bacteremia, or severe pneumonia, or any active infection that, in the opinion of the investigator, could impact patient safety.
  • Uncontrolled hypertension defined as resting systolic blood pressure > 150 mmHg and/or diastolic blood pressure > 100 mmHg in two or more serial measurements).
  • central venous access catheter e.g., port or similar
  • Prior immunotherapy including anti-CTLA-4, anti-PD-1 , and anti-PD-L1 therapeutic antibodies, and other systemic therapy for melanoma
  • Measurable disease per RECIST v1 .1 , must be present outside the CNS; the patient has no history of intracranial hemorrhage or spinal cord hemorrhage; CNS metastases are stable for > 4 weeks prior to initiation of study, or neurosurgical resection occurred > 28 days prior to initiation of study treatment; the patient has no requirement for corticosteroids as therapy for CNS disease for at least 14 days prior to initiation of study treatment; anti-convulsant therapy at a stable dose is permitted.
  • Uncontrolled tumor-related pain Patients requiring pain medication must be on a stable regimen at screening. Symptomatic lesions (e.g., bone metastases or metastases causing nerve impingement) amenable to palliative radiotherapy should be treated prior to enrollment. Patients should be recovered from the effects of radiation. There is no required minimum recovery period.
  • Symptomatic lesions e.g., bone metastases or metastases causing nerve impingement
  • Asymptomatic metastatic lesions that would likely cause functional deficits or intractable pain with further growth should be considered for loco-regional therapy, if appropriate, prior to enrollment.
  • Adverse events related to any prior radiotherapy, chemotherapy, targeted therapy, CPI therapy or surgical procedure must have resolved to Grade 1 or better, except alopecia (any grade), Grade 2 peripheral neuropathy, and hypothyroidism and/or hypopituitarism on a stable dosage of hormone replacement therapy (e.g., thyroxine, hydrocortisone, prednisolone, others).
  • hormone replacement therapy e.g., thyroxine, hydrocortisone, prednisolone, others.
  • LVEF Left ventricular ejection fraction
  • TTE transthoracic echocardiogram
  • MUGA multiple-gated acquisition
  • Troponin T TnT
  • Tnl troponin I
  • institutional ULN Patients with TnT or Tnl levels between > 1 and ⁇ 2 x ULN are eligible if repeat levels within 24 hours are ⁇ 1 c ULN. If repeat levels within 24 hours are between > 1 and ⁇ 2 c ULN, patients need to undergo a cardiac evaluation and may be considered for treatment if there are no clinically significant findings.
  • EBV Active Epstein-Barr virus
  • VCA EBV viral capsid antigen
  • An EBV PCR test should be performed as clinically indicated to screen for active infection or suspected chronic active infection. Patients with a positive EBV PCR test are excluded from the tiragolumab-containing arms.
  • the investigational medicinal products for this study are atezolizumab, tiragolumab, R07247669, nivolumab, and ipilimumab.
  • nivolumab plus ipilimumab (Nivo + Ipi) control arm receive treatment for 2 cycles (6 weeks) as outlined in Table 8 until surgery, or until unacceptable toxicity or loss of clinical benefit, whichever occurs first. It is recommended that treatment be initiated no later than 7 days after randomization.
  • Nivolumab is administered by IV infusion at a dose of 3 mg/kg on Day 1 of each 21 -day cycle (Q3W).
  • Ipilimumab is administered by IV infusion at a dose of 1 mg/kg on Day 1 of each 21 -day cycle (Q3W).
  • R07247669 is administered at a fixed dose of 2100 mg Q3W (2100 mg on Day 1 of each 21 -day cycle). Administration of R07247669 is performed in a monitored setting where there is immediate access to trained personnel and adequate equipment and medicine to manage potentially serious reactions. R07247669 infusions are administered per the instructions outlined in Table 10.
  • IRR infusion-related reaction.
  • premedication with paracetamol 500-1000 mg orally (PO) or IV and diphenhydramine 25-50 mg PO or IV (or an alternative histamine H1/2 antagonist at an adequate dose) is required prior to subsequent infusions.
  • PO paracetamol
  • diphenhydramine 25-50 mg PO or IV or an alternative histamine H1/2 antagonist at an adequate dose
  • the patient should be permanently discontinued from the study treatment.
  • Atezolizumab plus tiragolumab (Atezo + Tira) arm will receive treatment for 2 cycles (6 weeks) as outlined in Table 11 until surgery, or until unacceptable toxicity or loss of clinical benefit, whichever occurs first. It is recommended that treatment be initiated no later than 7 days after randomization.
  • Atezolizumab is administered at a fixed dose of 1200 mg every 3 weeks (Q3W) (1200 mg on Day 1 of each 21 -day cycle). Administration of atezolizumab is performed in a monitored setting where there is immediate access to trained personnel and adequate equipment and medicine to manage potentially serious reactions. Atezolizumab infusions are administered per the instructions outlined in Table 12.
  • Tiragolumab is administered at a fixed dose of 600 mg IV Q3W (600 mg on Day 1 of each 21 -day cycle). Administration of tiragolumab is performed in a monitored setting where there is immediate access to trained personnel and adequate equipment and medicine to manage potentially serious reactions. Tiragolumab infusions are administered per the instructions outlined in Table 13.
  • Atezolizumab and tiragolumab treatment may be temporarily suspended in patients experiencing toxicity considered to be related to study treatment. If corticosteroids are initiated for treatment of the toxicity, they must be tapered over > 1 month to the equivalent of ⁇ 10 mg/day oral prednisone before study treatment can be resumed, if warranted. In the neoadjuvant setting, the study treatment is limited to a pre-surgery window of 6 weeks. Treatment during this period should not be interrupted, unless a patient experiences toxicity. If toxicity meets criteria for interrupting/withholding atezolizumab and/or tiragolumab, atezolizumab and/or tiragolumab should be interrupted/withheld. After resolution of the toxicity, subsequent treatment cycles should only be considered if the benefit/risk profile is acceptable and if the surgery can be conducted within 2 weeks of the planned date. Otherwise, subsequent treatment cycles should be omitted to allow the patient to proceed directly to surgery without further delay.
  • tiragolumab may cause adverse events similar to, but independent of, atezolizumab. Tiragolumab may also exacerbate the frequency or severity of atezolizumab-related adverse events or may have non-overlapping toxicities with atezolizumab. Because these scenarios may not be distinguishable from each other in the clinical setting, adverse events should generally be attributed to both agents, and dose interruptions or treatment discontinuation in response to adverse events should be applied to both tiragolumab and atezolizumab. If atezolizumab is withheld or discontinued, tiragolumab should also be withheld or discontinued. If tiragolumab is withheld or discontinued, atezolizumab should also be withheld or discontinued. R07247669 + Tiragolumab (Cohorts 1 and 2)
  • Patients in the R07247669 plus tiragolumab (R07247669 + Tira) arm receive treatment as outlined in Table 14.
  • Patients in Cohort 1 receive treatment for 2 cycles (6 weeks) until surgery, or until unacceptable toxicity or loss of clinical benefit, whichever occurs first.
  • Patients in Cohort 2 receive treatment until unacceptable toxicity or loss of clinical benefit as determined by the investigator after an integrated assessment of radiographic and biochemical data, local biopsy results (if available), and clinical status (e.g., symptomatic deterioration such as pain secondary to disease).
  • R07247669 is administered by IV infusion at a fixed dose of 2100 mg on Day 1 of each 21 -day cycle.
  • Tiragolumab is administered by IV infusion at a fixed dose of 600 mg on Day 1 of each 21 -day cycle with a post-infusion observation period as described in Table 13.
  • R07247669 is administered in a monitored setting where there is immediate access to trained personnel and adequate equipment and medicine to manage potentially serious reactions.
  • R07247669 infusions are administered per the instructions outlined in Table 15. Table 15. Administration of First, Second, and Subsequent R07247669 Infusions
  • IRR infusion-related reaction.
  • R07247669 No dose modification for R07247669 is allowed. However, based on emerging safety and efficacy data, the Sponsor may explore lower doses (e.g., 1200 mg and 600 mg). R07247669 treatment may be interrupted for reasons other than toxicity (e.g., surgical procedures).
  • the investigator and the Medical Monitor will determine the acceptable length of treatment interruption.
  • Treatment with R07247669 and tiragolumab may be temporarily suspended in patients experiencing toxicity considered to be related to study treatment. If corticosteroids are initiated for treatment of the toxicity, they must be tapered over > 1 month to the equivalent of ⁇ 10 mg/day oral prednisone before study treatment can be resumed, if warranted.
  • R07247669 and tiragolumab are withheld for 12 weeks or longer due to toxicity, the patient should be discontinued from R07247669 and tiragolumab.
  • R07247669 and tiragolumab may be withheld for more than 12 weeks to allow for patients to taper off corticosteroids prior to resuming treatment.
  • R07247669 and tiragolumab may be resumed after being withheld for more than 12 weeks if the Medical Monitor agrees that the patient is likely to derive clinical benefit.
  • R07247669 and tiragolumab treatment may be suspended for reasons other than toxicity (e.g., surgical procedures). The acceptable length of the extended period of time must be agreed upon by the investigator and the Medical Monitor.
  • tiragolumab may cause adverse events similar to, but independent of, R07247669. Tiragolumab may also exacerbate the frequency or severity of R07247669-related adverse events or may have non-overlapping toxicities with R07247669. Because these scenarios may not be distinguishable from each other in the clinical setting, adverse events should generally be attributed to both agents, and dose interruptions or treatment discontinuation in response to adverse events should be applied to both tiragolumab and R07247669. If R07247669 is withheld or discontinued, tiragolumab should also be withheld or discontinued. If tiragolumab is withheld or discontinued, R07247669 should also be withheld or discontinued.
  • Concomitant therapy consists of any medication (e.g., prescription drugs, over-the-counter drugs, vaccines, herbal or homeopathic remedies, nutritional supplements) used by a patient in addition to protocol-mandated study treatment from 7 days prior to initiation of study treatment to the treatment discontinuation visit.
  • medication e.g., prescription drugs, over-the-counter drugs, vaccines, herbal or homeopathic remedies, nutritional supplements
  • patients who experience infusion-associated symptoms may be treated symptomatically with acetaminophen, ibuprofen, diphenhydramine, and/or H2-receptor antagonists (e.g., famotidine, cimetidine), or equivalent medications per local standard practice.
  • H2-receptor antagonists e.g., famotidine, cimetidine
  • Serious infusion- associated events manifested by dyspnea, hypotension, wheezing, bronchospasm, tachycardia, reduced oxygen saturation, or respiratory distress should be managed with supportive therapies as clinically indicated (e.g., supplemental oxygen and p2-adrenergic agonists).
  • Oral contraceptives with a failure rate of ⁇ 1% per year Oral contraceptives with a failure rate of ⁇ 1% per year.
  • Prophylactic or therapeutic anticoagulation therapy such as warfarin at a stable dose or low- molecular-weight heparin.
  • Inactivated vaccinations e.g., influenza.
  • Megestrol acetate administered as an appetite stimulant Mineralocorticoids e.g., fludrocortisone
  • COPD chronic obstructive pulmonary disease
  • premedication with antihistamines, antipyretics, and/or analgesics may be administered for the second R07247669 infusion only, at the discretion of the investigator.
  • premedication with antihistamines, antipyretics, and/or analgesics may be administered for the second atezolizumab and tiragolumab infusions only, at the discretion of the investigator.
  • Palliative radiotherapy e.g., treatment of known bony metastases or symptomatic relief of pain
  • Palliative radiotherapy is permitted, provided it does not interfere with the assessment of tumor target lesions (e.g., the lesion to be irradiated must not be the only site of measurable disease).
  • Treatment with tiragolumab may be continued during palliative radiotherapy.
  • Treatment with R07247669 may be continued during palliative radiotherapy with one exception: palliative radiotherapy is not permitted on days when R07247669 is administered.
  • Local therapy e.g., surgery, stereotactic radiosurgery, radiotherapy, radiofrequency ablation
  • Patients experiencing a mixed response requiring local therapy for control of three or fewer lesions may still be eligible to continue study treatment after Medical Monitor approval has been obtained.
  • Patients who receive local therapy directed at a target lesion will no longer be evaluable for radiographic response but will remain evaluable for progression.
  • Premedication with antihistamines, antipyretics, and/or analgesics may be administered for the second and subsequent R07247669 and tiragolumab infusions only, at the discretion of the investigator.
  • All measurable and/or evaluable lesions identified at baseline should be re-assessed at subsequent tumor evaluations for Cohorts 1 and 2.
  • the same radiographic procedures used to assess disease sites at screening should be used for subsequent tumor assessments (e.g., the same contrast protocol for CT scans).
  • Patients in Cohort 1 are assessed for pathologic and radiologic response to treatment. Patients undergo pathological tumor assessments at baseline, and after 6 weeks of treatment at surgery (CLND). The complete resection of Stage III lymph nodes (CLND) in Week 7 must be performed in compliance with the criteria for adequate surgical procedures for therapeutic lymph node dissection. CLND should be performed as planned if the patient is receiving corticosteroids or other anti-inflammatory drugs for the management of immune-mediated adverse events, provided these are being given at a stable or tapering dose and the severity of adverse events is Grade 2 or better. CLND may be delayed for up to 2 weeks if study treatment-related adverse events have not improved sufficiently at the time of planned surgery. Pathological response is determined by local and independent pathologic review according to INMC guidelines (Tetzlaff et al. Ann Oncol. 29: 1861 -1868, 2018).
  • neoadjuvant treatment diagnosis of disease progression should be confirmed by clinical, laboratory, radiological, and/or histological findings.
  • a tumor assessment is performed in Week 13 to conclude the neoadjuvant therapy-surgery intervention window.
  • disease status should be clinically evaluated and documented as per institutional guidelines (e.g., every 3 months for the first 2 years; every 6 months in the third year; once a year in the fourth and following years).
  • liver function tests, bone scans, chest X- ray/diagnostic CT scan, liver imaging, and/or other radiographic modalities may be considered when clinically indicated to exclude metastatic disease.
  • the diagnosis of a progression or recurrence should be confirmed histologically whenever clinically possible.
  • the earliest date of diagnosis of disease progression or recurrent disease should be used and recorded. This date should be based on objective clinical, radiological, histological, or cytological evidence.
  • Recurrent disease includes local, regional, or distant recurrence.
  • Liver Positive cytology or biopsy in the presence of a single new lesion or the appearance of multiple lesions consistent with metastatic disease
  • Central nervous system A positive brain CT or MRI scan or CSF cytology
  • Cutaneous, subcutaneous, and lymph node recurrence Positive cytology or biopsy in the presence of a single new lesion or the appearance of multiple lesions consistent with metastatic disease
  • Bone and other organs Positive cytology or biopsy in the presence of a single new lesion or the appearance of multiple lesions consistent with metastatic disease identified on two different radiologic studies (i.e., positive nuclear bone scan or PET scan and contrast Gl series or ultrasound, X-ray or CT of abdomen for abdominal disease).
  • tumor assessments every 9 ( ⁇ 1) weeks (from Day 1 of Cycle 1) for the first 54 weeks and then every 12 ( ⁇ 2) weeks thereafter, regardless of dose delays. The exception is patients who continue treatment after radiographic disease progression. Such patients undergo tumor assessments every 9 weeks until loss of clinical benefit as determined by the investigator. Thus, tumor assessments continue according to schedule in patients who discontinue treatment for reasons other than loss of clinical benefit, even if they start new, non-protocol-specified anti-cancer therapy. At the investigator’s discretion, tumor assessments may be repeated at any time if progressive disease is suspected.
  • Brain metastases treated with radiotherapy or surgery are not considered measurable or evaluable but are documented at screening as a site of metastatic disease. Brain metastases identified at baseline that have been treated with radiotherapy or surgery are not considered to be measurable or evaluable unless there is suspected disease progression in the brain (i.e., the patient becomes symptomatic). Thus, subsequent head scans are not required unless clinically indicated.
  • tumor assessments must be continued after disease progression per RECIST v1.1 for patients who receive treatment beyond progression. This includes continued measurement of target lesions, evaluation of non-target lesions
  • Baseline tumor tissue samples are collected from all patients (except patients in the Cohort 2 safety run-in phase) by biopsy of a metastatic lymph node (Cohort 1 ) or other metastatic lesion (Cohort 2) at screening.
  • Cohort 1 metastatic lymph node
  • Cohort 2 metastatic lesion
  • on-treatment tissue samples are collected by biopsy on Day 1 of Cycle 2, and at surgery (CLND).
  • CLND surgery
  • on-treatment tissue samples are collected by biopsy on Day 8 of Cycle 2.
  • Exploratory biomarker analyses are performed in an effort to understand the association of biomarkers with response to study drugs, taking into account efficacy and safety endpoints.
  • Exploratory biomarker research may include, but is not limited to, analysis of genes or gene signatures associated with tumor immunobiology, PD-L1 , lymphocyte subpopulations, T-cell receptor repertoire, or cytokines associated with T-cell activation. Research may involve DNA or RNA extraction, analysis of somatic mutations, and use of next-generation sequencing (NGS) (including whole exome sequencing (WES)).
  • NGS next-generation sequencing
  • WES whole exome sequencing
  • DNA extracted from blood may be compared with DNA extracted from tissue to identify somatic variants by distinguishing germline variants from somatic variants.
  • NGS methods may include whole genome sequencing (WGS) or WES of tissue and blood samples.
  • WGS whole genome sequencing
  • WES WES of tissue and blood samples.
  • blood samples are collected for DNA extraction to enable WGS or WES to identify variants that are predictive of response to study drug, are associated with progression to a more severe disease state, are associated with acquired resistance to study drug, are associated with susceptibility to develop adverse events, can lead to improved adverse event monitoring or investigation, or can increase the knowledge and understanding of disease biology and drug safety.
  • DNA extracted from blood may be compared with DNA extracted from tissue to identify somatic variants by distinguishing germline variants from somatic variants.
  • efficacy analyses are based on the efficacy-evaluable population, defined as all patients who receive at least one dose of each drug for their assigned treatment regimen
  • safety analyses are based on the safety-evaluable population, defined as all patients who receive any amount of study treatment.
  • Enrollment is summarized by region, country, and investigator by treatment arm.
  • Patient disposition is summarized by treatment arm.
  • Major protocol deviations, including major deviations with regard to the inclusion and exclusion criteria, are summarized by treatment arm.
  • study drug administration data are tabulated or listed by treatment arm, and any dose modifications are flagged. Means and standard deviations are used to summarize the total dose and dose intensity for each study drug. Reasons for discontinuation of study drugs are tabulated.
  • Demographic and baseline characteristics are summarized overall and by treatment arm.
  • Cohort 1 consists of patients with resectable Stage III melanoma who have not received prior systemic therapy for their disease.
  • Cohort 2 consists of patients with Stage IV melanoma who experienced disease progression during or after at least one but not more than two lines of treatment for metastatic disease.
  • Cohort 1 approximately 55-145 patients are randomly allocated to the control and experimental arms during the study. In Cohort 2, approximately 6-46 patients are assigned to an experimental arm.
  • the primary efficacy endpoint in Cohort 1 is pRR at time of surgery.
  • pRR is assessed after completion of neoadjuvant treatment (Week 7) at time of CLND.
  • the pRR is defined as the proportion of patients who achieve pCR (a complete absence of viable tumor in the treated tumor bed), pathologic near complete response (pnCR; ⁇ 10% of viable tumor in the treated tumor bed); and pathologic partial response (pPR; ⁇ 50% of the treated tumor bed is occupied by viable tumor cells) as determined by independent pathologic review.
  • pRR is calculated for each arm along with 90% Cls. The difference in the pRR between the experimental arms and the control arm is also calculated along with 90% Cls. Confidence intervals are estimated by the exact method or the Wald method, depending on the sample size.
  • the secondary efficacy endpoints in Cohort 1 are pRR at time of surgery as determined by local pathologic assessment, event-free survival (EFS), RFS, OS, and ORR prior to surgery.
  • pRR is defined in Table 5.
  • EFS is defined as the time from randomization to any of the following events (whichever occurs first): disease progression that precludes surgery, as assessed by the investigator according to RECIST v1.1 ; local, regional, or distant disease recurrence; or death from any cause. Patients who have not experienced such events are censored at the time of their last post-tumor tumor assessment.
  • RFS is defined as the time from surgery to the first documented recurrence of disease or death from any cause. For patients who do not have documented recurrence of disease or death, RFS is censored at the day of the last tumor assessment.
  • OS is defined as the time from randomization to death from any cause. Patients who are still alive at the time of OS analysis are censored at the last date they were known to be alive.
  • the Kaplan-Meier method is used to estimate the median for RFS, EFS, and OS, 90% Cls are constructed using the Brookmeyer and Crowley method.
  • the RFS, EFS, and OS rate at specific timepoints are also estimated using the Kaplan-Meier method, with 90% Cls calculated on the basis of Greenwood’s estimate for the variance.
  • ORR is assessed after completion of neoadjuvant treatment (Week 7) and is defined as the proportion of patients with a CR or PR, as determined by the investigator according to RECIST v1.1. Patients with missing or no response assessments are classified as non responders. Note that ORR is determined using unconfirmed pre-operative radiologic responses. Although RECIST v1.1 requires confirmatory imaging assessments to be completed at least 4 weeks after the initial response, due to the timing of CLND, these responses cannot be confirmed with subsequent imaging.
  • ORR is calculated for each arm, along with 90% Cls, using the Clopper-Pearson method. The difference in ORR between the experimental arms and the control arm is also calculated, along with 90% Cls. Cls are estimated by the exact method or the Wald method, depending on the sample size.
  • the exploratory efficacy endpoints in Cohort 1 are landmark EFS, landmark RFS, and landmark OS at specific timepoints (1 , 2, 3, and 5 years).
  • Landmark EFS rates, landmark RFS rates, and landmark OS rates are estimated for each study arm using the Kaplan-Meier method, with 90% Cls calculated through use of Greenwood’s formula.
  • ORR The primary efficacy endpoint in Cohort 2 is ORR, as defined in Table 6. ORR is determined by the investigator according to RECIST v1.1. Patients with missing or no response assessments are classified as non-responders.
  • ORR the proportion of patients with a complete or partial response, is calculated for each arm, along with 90% Cls (Clopper-Pearson method). Cls are estimated by the exact method or the Wald method, depending on the sample size.
  • the secondary efficacy endpoints in Cohort 2 are PFS, OS, OS at specific timepoints (e.g., 6 months), duration of response (DOR), and disease control, as defined in Table 6.
  • PFS, DOR, and disease control are determined by the investigator according to RECIST v1.1.
  • DOR is derived for efficacy-evaluable patients with a CR or PR.
  • PFS and DOR is censored at the day of the last tumor assessment.
  • the Kaplan-Meier method is used to estimate the median for PFS, OS, and DOR, with 90% Cls constructed through use of the Brookmeyer and Crowley method.
  • OS rate at specific timepoints is also estimated using the Kaplan-Meier method, with 90% Cls calculated on the basis of Greenwood’s estimate for the variance.
  • the exploratory efficacy endpoints are ORR, PFS, DOR, and disease control as determined by the investigator according to iRECIST.
  • ORR, PFS, DOR, and disease control are analyzed through use of the same methods described in the above sections, “Primary Efficacy Endpoint in Cohort 2” and “Secondary Efficacy Endpoints in Cohort 2.”
  • DOR is derived for efficacy-evaluable patients with a complete or partial response.
  • Adverse event severity is graded according to NCI CTCAE v5.0, and severity of CRS will also be graded by the investigator according to the ASTCT Consensus Grading (Lee et al. Biol Blood Marrow Transplant. 25: 625-638, 2019).
  • All adverse events, serious adverse events, adverse events leading to death, adverse events of special interest, and adverse events leading to study treatment discontinuation that occur on or after the first dose of study treatment i.e. , treatment-emergent adverse events
  • mapped term appropriate thesaurus level, and severity grade. For events of varying severity, the highest grade is used in the summaries. Deaths and causes of death are summarized.
  • vital sign pulse rate, respiratory rate, blood pressure, pulse oximetry, and temperature
  • ECG data will be displayed by time, with grades identified where appropriate. Additionally, a shift table of selected laboratory test results is used to summarize the baseline and maximum postbaseline severity grade. Changes in vital signs and ECGs are summarized.
  • Immunogenicity may be assessed for atezolizumab and other study treatments as appropriate.
  • the immunogenicity analyses include all patients with at least one anti-drug antibody (ADA) assessment. Patients are grouped according to treatment received or, if no treatment is received prior to study discontinuation, according to treatment assigned.
  • ADA anti-drug antibody
  • ADA-positive patients and ADA-negative patients at baseline baseline prevalence
  • postbaseline incidence the numbers and proportions of ADA-positive patients and ADA-negative patients at baseline (baseline prevalence) and after drug administration (postbaseline incidence) are summarized by treatment group.
  • patients are considered to be ADA positive if they are ADA negative or have missing data at baseline but develop an ADA response following study drug exposure (treatment-induced ADA response), or if they are ADA positive at baseline and the titer of one or more postbaseline samples is at least 0.60-titer unit greater than the titer of the baseline sample (treatment-enhanced ADA response).
  • Patients are considered to be ADA negative if they are ADA negative or have missing data at baseline and all postbaseline samples are negative, or if they are ADA positive at baseline but do not have any postbaseline samples with a titer that is at least 0.60-titer unit greater than the titer of the baseline sample (treatment unaffected).
  • ADA status and safety, efficacy, PK, and biomarker endpoints may be analyzed and reported via descriptive statistics.
  • a posterior probability may be used to guide further enrollment in a treatment arm based on an interim analysis of clinical activity in the experimental arm compared with a predefined ORR threshold, defined as an improvement over standard of care. For example, if available data suggest a standard of care ORR of 10%, and an ORR improvement of 10% is considered to be a clinical meaningful change, this would lead to an ORR threshold of 20% in the calculation of the posterior probability.
  • the ORR for standard of care treatment is based on emerging internal and external data for in- class immune-modulating investigational and other compounds for the patient population in Cohort 2 who have received at least two lines of prior treatment at the time of the analysis.
  • the Sponsor may make a decision to expand enrollment in an arm based on the totality of available data including, but not limited to, duration of the observed responses, PFS, and potentially early OS data. Safety and biomarker data (available at the time of making this decision) are also taken into consideration from the perspective of an adequate benefit-risk assessment.
  • R07247669 (PD1-LAG3) is a novel bispecific antibody being investigated for the treatment of inflamed solid tumor types. It aims to reinvigorate T-cells by blocking two co-inhibitory checkpoint receptors, PD-1 and LAG-3. R07247669 incorporates monovalent high-affinity binding to PD-1 and monovalent high-affinity binding to LAG-3 (20-fold lower than that to PD-1), allowing avidity-mediated selectivity gain. LAG-3 is expressed at higher levels on regulatory T-cells than other T-cells, and its blockade by monospecific anti-LAG3 antibodies has been reported to detrimentally enhance their suppressive activity.
  • Tregs express lower levels of PD-1 than dysfunctional T-cells and are, therefore, less likely to be targeted and “activated” in response to treatment with R07247669, wherein binding to PD-1 serves also as a handle.
  • LAG3 has recently been validated as a clinical target in first-line (1 L) treatment of melanoma with the recent approval of the anti-LAG3 antibody relatlimab in combination with the anti-PD-1 antibody nivolumab.
  • the pharmacological effect of an agent that blocks an inhibitory checkpoint receptor is driven by engaging the receptor on immune cells.
  • Saturation of target engagement (TE) can thus be used as a surrogate for pharmacology saturation, i.e., maximal effect on downstream signaling.
  • TE target engagement
  • additional drug is not expected to lead to additional pharmacological effect.
  • the dose required for target saturation in the tumor can thus be proposed as a recommended phase II dose.
  • R07247669 is currently being evaluated as a single agent in the Phase I Study NP41300.
  • Study NP41300 is an open-label, multicenter, dose escalation, Phase I study to evaluate the safety/tolerability, pharmacokinetics (PK), pharmacodynamics, and preliminary anti-tumor activity of R07247669 in patients with locally advanced and/or metastatic solid tumors.
  • the study consists of a dose escalation arm having two schedules (Part A) and a tumor-specific expansion arm (Part B).
  • Part A consists of Part A1 (dosing once every two weeks (Q2W)) and Part A2 (dosing once every three weeks (Q3W)) dose escalation design to determine the maximum tolerated dose (MTD) and/or recommended dose for expansion (RDE) of R07247669 in patients with solid tumors.
  • Part B consists of tumor-specific expansions of R07247669 administered at the MTD and/or RDE and at other doses of interest for future development in a subset of patients with selected solid tumor indications.
  • Adult patients with advanced and/or metastatic solid tumors were enrolled as per the protocol. //.
  • R07247669 serum concentrations were determined.
  • serum samples were collected at regular prespecified time points in patients in the NP41300 study. These included both peak (within 30 minutes after end of infusion) and trough (within 24 hours before the next dose) samples and rich sampling at Cycle 1 and 5.
  • the population PK analysis was performed using a nonlinear mixed effects modeling approach. One- and two-compartment models were evaluated, followed by testing different residual error structures. The model was then refined by testing interindividual variability for each PK parameter, followed by inspection of the correlations among the random effect values to guide the development of a parsimonious omega structure. Model selection was based on the log-likelihood criterion, goodness-of-fit plots, and scientific plausibility.
  • the pharmacological effect of PD1-LAG3 is driven by the engagement of PD1 and LAG3 on CD8+ T cells. Saturation of these receptors on the CD8 cells can thus be used as a surrogate for maximal effect on downstream signaling; additional PD1-LAG3 is not expected to lead to additional pharmacological effect.
  • Tumor receptor occupancy modeling was performed. The goal was to characterize intratumoral PD1 and LAG3 engagement as a function of R07247669 concentration and dose. For the purpose of estimating the dose required to saturate the target with PK data, a minimal physiologically-based pharmacokinetic (mPBPK) model was used. The model simplifies different tissues/organs into two distinct types of tissues sufficient to describe R07247669 systemic concentration, and includes a tumor compartment to describe intratumoral R07247669 concentration and PD1 and LAG3 engagement, providing a fit-for-purpose approach. The two tumor subcompartments, represented the vascular and interstitial space. PD1 -LAG3 enters and leaves tumor vascular space based on tumor blood flow rate.
  • mPBPK pharmacokinetic
  • PD1-LAG3 can bind to PD-1 and/or LAG3 on tumor-associated immune cells, be eliminated via target-mediated drug disposition (TMDD), or be eliminated by convective flow.
  • TMDD target-mediated drug disposition
  • a tumor compartment was also added to the model to describe the tumor uptake of R07247669.
  • a simpler model (with only one target) has been previously described by Li et al ., Clinical Pharmacology and Therapeutics,
  • CL clearance
  • V1 central volume
  • Q intercompartmental clearance
  • V2 peripheral volume
  • IIV interindividual variability
  • Part A1 Q2W
  • Part B a total of 83 patients have been treated.
  • Table 18 provides a summary of patients who received R07247669 in NP41300.
  • the maximum tolerated dose (MTD) was not reached, and no dose-limiting toxicities (DLTs) were observed during dose escalation from 50 mg to 2100 mg Q2W.
  • MTD maximum tolerated dose
  • DLTs dose-limiting toxicities
  • Greater than 90% occupancy of PD-1 and LAG3 receptors on peripheral CD8+ cells was observed following the first administration of 50 mg R07247669 and saturation was observed at all doses to 2100 mg.
  • formation of persistent ADAs against R07247669 was observed. Reduction of exposure occurred in some ADA positive patients receiving 300 mg or less.
  • clinical responses were observed at doses of 600 mg and above.
  • the disease control rate (DCR) in Part A of study NP41300 was 51.4% (18/35 patients) and the objective response rate (ORR) was 17.1% (6/35 patients).
  • DCR disease control rate
  • ORR objective response rate

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Epidemiology (AREA)
  • Oncology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2022/074279 2021-07-28 2022-07-28 Methods and compositions for treating cancer Ceased WO2023010095A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
EP22764591.8A EP4377351A1 (en) 2021-07-28 2022-07-28 Methods and compositions for treating cancer
MX2024001214A MX2024001214A (es) 2021-07-28 2022-07-28 Metodos y composiciones para tratar cancer.
CA3224180A CA3224180A1 (en) 2021-07-28 2022-07-28 Methods and compositions for treating cancer
KR1020247005105A KR20240038008A (ko) 2021-07-28 2022-07-28 암 치료 방법 및 조성물
JP2024504960A JP2024529451A (ja) 2021-07-28 2022-07-28 がんを治療するための方法及び組成物
IL309120A IL309120A (en) 2021-07-28 2022-07-28 Methods and compositions for the treatment of cancer
AU2022317820A AU2022317820A1 (en) 2021-07-28 2022-07-28 Methods and compositions for treating cancer
CN202280052285.6A CN117715936A (zh) 2021-07-28 2022-07-28 用于治疗癌症的方法和组合物
US18/424,297 US20240327519A1 (en) 2021-07-28 2024-01-26 Methods and compositions for treating cancer

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202163226714P 2021-07-28 2021-07-28
US63/226,714 2021-07-28

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US18/424,297 Continuation US20240327519A1 (en) 2021-07-28 2024-01-26 Methods and compositions for treating cancer

Publications (2)

Publication Number Publication Date
WO2023010095A1 true WO2023010095A1 (en) 2023-02-02
WO2023010095A8 WO2023010095A8 (en) 2023-03-16

Family

ID=83188712

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/074279 Ceased WO2023010095A1 (en) 2021-07-28 2022-07-28 Methods and compositions for treating cancer

Country Status (10)

Country Link
US (1) US20240327519A1 (cg-RX-API-DMAC7.html)
EP (1) EP4377351A1 (cg-RX-API-DMAC7.html)
JP (1) JP2024529451A (cg-RX-API-DMAC7.html)
KR (1) KR20240038008A (cg-RX-API-DMAC7.html)
CN (1) CN117715936A (cg-RX-API-DMAC7.html)
AU (1) AU2022317820A1 (cg-RX-API-DMAC7.html)
CA (1) CA3224180A1 (cg-RX-API-DMAC7.html)
IL (1) IL309120A (cg-RX-API-DMAC7.html)
MX (1) MX2024001214A (cg-RX-API-DMAC7.html)
WO (1) WO2023010095A1 (cg-RX-API-DMAC7.html)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024163009A1 (en) * 2023-01-31 2024-08-08 Genentech, Inc. Methods and compositions for treating urothelial bladder cancer
WO2024263904A1 (en) * 2023-06-23 2024-12-26 Genentech, Inc. Methods for treatment of liver cancer

Citations (95)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1989006692A1 (en) 1988-01-12 1989-07-27 Genentech, Inc. Method of treating tumor cells by inhibiting growth factor receptor function
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
WO1993001161A1 (en) 1991-07-11 1993-01-21 Pfizer Limited Process for preparing sertraline intermediates
WO1993016185A2 (en) 1992-02-06 1993-08-19 Creative Biomolecules, Inc. Biosynthetic binding protein for cancer marker
WO1994010202A1 (en) 1992-10-28 1994-05-11 Genentech, Inc. Vascular endothelial cell growth factor antagonists
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
WO1994029350A2 (en) 1993-06-14 1994-12-22 The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services Recombinant disulfide-stabilized polypeptide fragments having binding specificity
WO1995027062A1 (en) 1994-04-04 1995-10-12 Genentech, Inc. Agonist antibodies against the flk2/flt3 receptor and uses thereof
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
WO1996027011A1 (en) 1995-03-01 1996-09-06 Genentech, Inc. A method for making heteromultimeric polypeptides
WO1996030046A1 (en) 1995-03-30 1996-10-03 Genentech, Inc. Vascular endothelial cell growth factor antagonists
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
US5587458A (en) 1991-10-07 1996-12-24 Aronex Pharmaceuticals, Inc. Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5804396A (en) 1994-10-12 1998-09-08 Sugen, Inc. Assay for agents active in proliferative disorders
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
WO1998045332A2 (en) 1997-04-07 1998-10-15 Genentech, Inc. Humanized antibodies and methods for forming humanized antibodies
WO1998050431A2 (en) 1997-05-02 1998-11-12 Genentech, Inc. A method for making multispecific antibodies having heteromultimeric and common components
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US6054297A (en) 1991-06-14 2000-04-25 Genentech, Inc. Humanized antibodies and methods for making them
US6171586B1 (en) 1997-06-13 2001-01-09 Genentech, Inc. Antibody formulation
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
US6267958B1 (en) 1995-07-27 2001-07-31 Genentech, Inc. Protein formulation
US6582959B2 (en) 1991-03-29 2003-06-24 Genentech, Inc. Antibodies to vascular endothelial cell growth factor
US20030190317A1 (en) 1997-04-07 2003-10-09 Genentech, Inc. Anti-VEGF antibodies
US20030206899A1 (en) 1991-03-29 2003-11-06 Genentech, Inc. Vascular endothelial cell growth factor antagonists
US6703020B1 (en) 1999-04-28 2004-03-09 Board Of Regents, The University Of Texas System Antibody conjugate methods for selectively inhibiting VEGF
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
WO2004056312A2 (en) 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
US6818418B1 (en) 1998-12-10 2004-11-16 Compound Therapeutics, Inc. Protein scaffolds for antibody mimics and other binding proteins
US20050014934A1 (en) 2002-10-15 2005-01-20 Hinton Paul R. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
WO2005012359A2 (en) 2003-08-01 2005-02-10 Genentech, Inc. Anti-vegf antibodies
US6884879B1 (en) 1997-04-07 2005-04-26 Genentech, Inc. Anti-VEGF antibodies
US20050112126A1 (en) 1997-04-07 2005-05-26 Genentech, Inc. Anti-VEGF antibodies
WO2005056764A2 (en) 2003-12-05 2005-06-23 Compound Therapeutics, Inc. Inhibitors of type 2 vascular endothelial growth factor receptors
US20050186208A1 (en) 2003-05-30 2005-08-25 Genentech, Inc. Treatment with anti-VEGF antibodies
US20050260186A1 (en) 2003-03-05 2005-11-24 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases
US20060009360A1 (en) 2004-06-25 2006-01-12 Robert Pifer New adjuvant composition
WO2006044908A2 (en) 2004-10-20 2006-04-27 Genentech, Inc. Antibody formulation in histidine-acetate buffer
WO2006121168A1 (en) 2005-05-09 2006-11-16 Ono Pharmaceutical Co., Ltd. Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics
WO2007005874A2 (en) 2005-07-01 2007-01-11 Medarex, Inc. Human monoclonal antibodies to programmed death ligand 1 (pd-l1)
WO2007110205A2 (en) 2006-03-24 2007-10-04 Merck Patent Gmbh Engineered heterodimeric protein domains
EP1870459A1 (en) 2005-03-31 2007-12-26 Chugai Seiyaku Kabushiki Kaisha Methods for producing polypeptides by regulating polypeptide association
WO2007147901A1 (en) 2006-06-22 2007-12-27 Novo Nordisk A/S Production of bispecific antibodies
US7371826B2 (en) 1999-01-15 2008-05-13 Genentech, Inc. Polypeptide variants with altered effector function
US20080139791A1 (en) 1998-12-10 2008-06-12 Adnexus Therapeutics, Inc. Pharmaceutically acceptable Fn3 Polypeptides for human treatments
WO2008098796A1 (en) 2007-02-16 2008-08-21 Nascacell Technologies Ag Polypeptide comprising a knottin protein moiety
WO2009080252A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009080253A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
WO2009114335A2 (en) 2008-03-12 2009-09-17 Merck & Co., Inc. Pd-1 binding proteins
WO2009126688A2 (en) 2008-04-09 2009-10-15 Genentech, Inc. Novel compositions and methods for the treatment of immune related diseases
WO2010027827A2 (en) 2008-08-25 2010-03-11 Amplimmune, Inc. Targeted costimulatory polypeptides and methods of use to treat cancer
WO2010077634A1 (en) 2008-12-09 2010-07-08 Genentech, Inc. Anti-pd-l1 antibodies and their use to enhance t-cell function
WO2010129304A2 (en) 2009-04-27 2010-11-11 Oncomed Pharmaceuticals, Inc. Method for making heteromultimeric molecules
WO2011066389A1 (en) 2009-11-24 2011-06-03 Medimmmune, Limited Targeted binding agents against b7-h1
WO2011066342A2 (en) 2009-11-24 2011-06-03 Amplimmune, Inc. Simultaneous inhibition of pd-l1/pd-l2
WO2011090762A1 (en) 2009-12-29 2011-07-28 Emergent Product Development Seattle, Llc Heterodimer binding proteins and uses thereof
WO2011143545A1 (en) 2010-05-14 2011-11-17 Rinat Neuroscience Corporation Heterodimeric proteins and methods for producing and purifying them
WO2011161699A2 (en) 2010-06-25 2011-12-29 Aurigene Discovery Technologies Limited Immunosuppression modulating compounds
WO2012058768A1 (en) 2010-11-05 2012-05-10 Zymeworks Inc. Stable heterodimeric antibody design with mutations in the fc domain
WO2012130831A1 (en) 2011-03-29 2012-10-04 Roche Glycart Ag Antibody fc variants
WO2012145493A1 (en) 2011-04-20 2012-10-26 Amplimmune, Inc. Antibodies and other molecules that bind b7-h1 and pd-1
WO2012168944A1 (en) 2011-06-08 2012-12-13 Aurigene Discovery Technologies Limited Therapeutic compounds for immunomodulation
WO2013096291A2 (en) 2011-12-20 2013-06-27 Medimmune, Llc Modified polypeptides for bispecific antibody scaffolds
WO2013132317A1 (en) 2012-03-07 2013-09-12 Aurigene Discovery Technologies Limited Peptidomimetic compounds as immunomodulators
WO2013144704A1 (en) 2012-03-29 2013-10-03 Aurigene Discovery Technologies Limited Immunomodulating cyclic compounds from the bc loop of human pd1
WO2013157954A1 (en) 2012-04-20 2013-10-24 Merus B.V. Methods and means for the production of ig-like molecules
WO2013181634A2 (en) 2012-05-31 2013-12-05 Sorrento Therapeutics Inc. Antigen binding proteins that bind pd-l1
WO2014179664A2 (en) 2013-05-02 2014-11-06 Anaptysbio, Inc. Antibodies directed against programmed death-1 (pd-1)
WO2014194302A2 (en) 2013-05-31 2014-12-04 Sorrento Therapeutics, Inc. Antigen binding proteins that bind pd-1
WO2014206107A1 (zh) 2013-06-26 2014-12-31 上海君实生物医药科技有限公司 抗pd-1抗体及其应用
WO2015033303A1 (en) 2013-09-06 2015-03-12 Aurigene Discovery Technologies Limited Cyclic peptidomimetic compounds as immunomodulators
WO2015033299A1 (en) 2013-09-06 2015-03-12 Aurigene Discovery Technologies Limited 1,2,4-oxadiazole derivatives as immunomodulators
WO2015033301A1 (en) 2013-09-06 2015-03-12 Aurigene Discovery Technologies Limited 1,3,4-oxadiazole and 1,3,4-thiadiazole derivatives as immunomodulators
WO2015035606A1 (en) 2013-09-13 2015-03-19 Beigene, Ltd. Anti-pd1 antibodies and their use as therapeutics and diagnostics
WO2015036927A1 (en) 2013-09-10 2015-03-19 Aurigene Discovery Technologies Limited Immunomodulating peptidomimetic derivatives
WO2015044900A1 (en) 2013-09-27 2015-04-02 Aurigene Discovery Technologies Limited Therapeutic immunomodulating compounds
WO2015085847A1 (zh) 2013-12-12 2015-06-18 上海恒瑞医药有限公司 Pd-1抗体、其抗原结合片段及其医药用途
WO2015112800A1 (en) 2014-01-23 2015-07-30 Regeneron Pharmaceuticals, Inc. Human antibodies to pd-1
US20150210769A1 (en) 2014-01-24 2015-07-30 Novartis Ag Antibody molecules to pd-1 and uses thereof
WO2015112805A1 (en) 2014-01-23 2015-07-30 Regeneron Pharmaceuticals, Inc. Human antibodies to pd-l1
WO2015119923A1 (en) 2014-02-04 2015-08-13 Pfizer Inc. Combination of a pd-1 antagonist and a 4-abb agonist for treating cancer
WO2015119930A1 (en) 2014-02-04 2015-08-13 Pfizer Inc. Combination of a pd-1 antagonist and a vegfr inhibitor for treating cancer
WO2015150447A1 (en) 2014-04-02 2015-10-08 F. Hoffmann-La Roche Ag Multispecific antibodies
WO2016000619A1 (en) 2014-07-03 2016-01-07 Beigene, Ltd. Anti-pd-l1 antibodies and their use as therapeutics and diagnostics
WO2016020309A1 (en) 2014-08-04 2016-02-11 F. Hoffmann-La Roche Ag Bispecific t cell activating antigen binding molecules
WO2016032927A1 (en) 2014-08-25 2016-03-03 Pfizer Inc. Combination of a pd-1 antagonist and an alk inhibitor for treating cancer
US20160108123A1 (en) 2014-10-14 2016-04-21 Novartis Ag Antibody molecules to pd-l1 and uses thereof
WO2016089873A1 (en) 2014-12-02 2016-06-09 Celgene Corporation Combination therapies
WO2016106160A1 (en) 2014-12-22 2016-06-30 Enumeral Biomedical Holdings, Inc. Methods for screening therapeutic compounds
WO2018185043A1 (en) * 2017-04-05 2018-10-11 F. Hoffmann-La Roche Ag Bispecific antibodies specifically binding to pd1 and lag3
EP3392276A1 (en) * 2015-12-16 2018-10-24 Jiangsu Alphamab Biopharmaceuticals Co., Ltd. Heterodimer molecule based on ch3 structural domain, and preparation method therefor and use thereof
WO2020232019A1 (en) * 2019-05-13 2020-11-19 Regeneron Pharmaceuticals, Inc. Combination of pd-1 inhibitors and lag-3 inhibitors for enhanced efficacy in treating cancer
WO2021133653A1 (en) * 2019-12-23 2021-07-01 Macrogenics, Inc. Therapy for the treatment of cancer

Patent Citations (110)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5648260A (en) 1987-03-18 1997-07-15 Scotgen Biopharmaceuticals Incorporated DNA encoding antibodies with altered effector functions
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
WO1989006692A1 (en) 1988-01-12 1989-07-27 Genentech, Inc. Method of treating tumor cells by inhibiting growth factor receptor function
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
US6582959B2 (en) 1991-03-29 2003-06-24 Genentech, Inc. Antibodies to vascular endothelial cell growth factor
US20030203409A1 (en) 1991-03-29 2003-10-30 Genentech, Inc. Antibodies to vascular endothelial cell growth factor
US20030206899A1 (en) 1991-03-29 2003-11-06 Genentech, Inc. Vascular endothelial cell growth factor antagonists
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
US6054297A (en) 1991-06-14 2000-04-25 Genentech, Inc. Humanized antibodies and methods for making them
WO1993001161A1 (en) 1991-07-11 1993-01-21 Pfizer Limited Process for preparing sertraline intermediates
US5587458A (en) 1991-10-07 1996-12-24 Aronex Pharmaceuticals, Inc. Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof
WO1993016185A2 (en) 1992-02-06 1993-08-19 Creative Biomolecules, Inc. Biosynthetic binding protein for cancer marker
EP0666868B1 (en) 1992-10-28 2002-04-03 Genentech, Inc. Use of anti-VEGF antibodies for the treatment of cancer
WO1994010202A1 (en) 1992-10-28 1994-05-11 Genentech, Inc. Vascular endothelial cell growth factor antagonists
WO1994029350A2 (en) 1993-06-14 1994-12-22 The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services Recombinant disulfide-stabilized polypeptide fragments having binding specificity
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
WO1995027062A1 (en) 1994-04-04 1995-10-12 Genentech, Inc. Agonist antibodies against the flk2/flt3 receptor and uses thereof
US5804396A (en) 1994-10-12 1998-09-08 Sugen, Inc. Assay for agents active in proliferative disorders
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US7695936B2 (en) 1995-03-01 2010-04-13 Genentech, Inc. Knobs and holes heteromeric polypeptides
WO1996027011A1 (en) 1995-03-01 1996-09-06 Genentech, Inc. A method for making heteromultimeric polypeptides
WO1996030046A1 (en) 1995-03-30 1996-10-03 Genentech, Inc. Vascular endothelial cell growth factor antagonists
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US6267958B1 (en) 1995-07-27 2001-07-31 Genentech, Inc. Protein formulation
US7060269B1 (en) 1997-04-07 2006-06-13 Genentech, Inc. Anti-VEGF antibodies
US6884879B1 (en) 1997-04-07 2005-04-26 Genentech, Inc. Anti-VEGF antibodies
US20030190317A1 (en) 1997-04-07 2003-10-09 Genentech, Inc. Anti-VEGF antibodies
US20050112126A1 (en) 1997-04-07 2005-05-26 Genentech, Inc. Anti-VEGF antibodies
WO1998045332A2 (en) 1997-04-07 1998-10-15 Genentech, Inc. Humanized antibodies and methods for forming humanized antibodies
WO1998050431A2 (en) 1997-05-02 1998-11-12 Genentech, Inc. A method for making multispecific antibodies having heteromultimeric and common components
US6171586B1 (en) 1997-06-13 2001-01-09 Genentech, Inc. Antibody formulation
US20080139791A1 (en) 1998-12-10 2008-06-12 Adnexus Therapeutics, Inc. Pharmaceutically acceptable Fn3 Polypeptides for human treatments
US6818418B1 (en) 1998-12-10 2004-11-16 Compound Therapeutics, Inc. Protein scaffolds for antibody mimics and other binding proteins
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US7371826B2 (en) 1999-01-15 2008-05-13 Genentech, Inc. Polypeptide variants with altered effector function
US7332581B2 (en) 1999-01-15 2008-02-19 Genentech, Inc. Polypeptide variants with altered effector function
US6703020B1 (en) 1999-04-28 2004-03-09 Board Of Regents, The University Of Texas System Antibody conjugate methods for selectively inhibiting VEGF
US20050014934A1 (en) 2002-10-15 2005-01-20 Hinton Paul R. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
WO2004056312A2 (en) 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
US20050260186A1 (en) 2003-03-05 2005-11-24 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases
US20050186208A1 (en) 2003-05-30 2005-08-25 Genentech, Inc. Treatment with anti-VEGF antibodies
WO2005012359A2 (en) 2003-08-01 2005-02-10 Genentech, Inc. Anti-vegf antibodies
WO2005056764A2 (en) 2003-12-05 2005-06-23 Compound Therapeutics, Inc. Inhibitors of type 2 vascular endothelial growth factor receptors
US20060009360A1 (en) 2004-06-25 2006-01-12 Robert Pifer New adjuvant composition
WO2006044908A2 (en) 2004-10-20 2006-04-27 Genentech, Inc. Antibody formulation in histidine-acetate buffer
EP1870459A1 (en) 2005-03-31 2007-12-26 Chugai Seiyaku Kabushiki Kaisha Methods for producing polypeptides by regulating polypeptide association
WO2006121168A1 (en) 2005-05-09 2006-11-16 Ono Pharmaceutical Co., Ltd. Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics
WO2007005874A2 (en) 2005-07-01 2007-01-11 Medarex, Inc. Human monoclonal antibodies to programmed death ligand 1 (pd-l1)
WO2007110205A2 (en) 2006-03-24 2007-10-04 Merck Patent Gmbh Engineered heterodimeric protein domains
WO2007147901A1 (en) 2006-06-22 2007-12-27 Novo Nordisk A/S Production of bispecific antibodies
WO2008098796A1 (en) 2007-02-16 2008-08-21 Nascacell Technologies Ag Polypeptide comprising a knottin protein moiety
WO2009080253A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009080252A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
WO2009114335A2 (en) 2008-03-12 2009-09-17 Merck & Co., Inc. Pd-1 binding proteins
WO2009126688A2 (en) 2008-04-09 2009-10-15 Genentech, Inc. Novel compositions and methods for the treatment of immune related diseases
US9499596B2 (en) 2008-04-09 2016-11-22 Genentech, Inc. Compositions and methods for the treatment of immune related diseases
WO2010027827A2 (en) 2008-08-25 2010-03-11 Amplimmune, Inc. Targeted costimulatory polypeptides and methods of use to treat cancer
US8217149B2 (en) 2008-12-09 2012-07-10 Genentech, Inc. Anti-PD-L1 antibodies, compositions and articles of manufacture
WO2010077634A1 (en) 2008-12-09 2010-07-08 Genentech, Inc. Anti-pd-l1 antibodies and their use to enhance t-cell function
WO2010129304A2 (en) 2009-04-27 2010-11-11 Oncomed Pharmaceuticals, Inc. Method for making heteromultimeric molecules
WO2011066389A1 (en) 2009-11-24 2011-06-03 Medimmmune, Limited Targeted binding agents against b7-h1
US20130034559A1 (en) 2009-11-24 2013-02-07 Medlmmune Limited Targeted Binding Agents Against B7-H1
WO2011066342A2 (en) 2009-11-24 2011-06-03 Amplimmune, Inc. Simultaneous inhibition of pd-l1/pd-l2
WO2011090762A1 (en) 2009-12-29 2011-07-28 Emergent Product Development Seattle, Llc Heterodimer binding proteins and uses thereof
WO2011090754A1 (en) 2009-12-29 2011-07-28 Emergent Product Development Seattle, Llc Polypeptide heterodimers and uses thereof
WO2011143545A1 (en) 2010-05-14 2011-11-17 Rinat Neuroscience Corporation Heterodimeric proteins and methods for producing and purifying them
WO2011161699A2 (en) 2010-06-25 2011-12-29 Aurigene Discovery Technologies Limited Immunosuppression modulating compounds
WO2012058768A1 (en) 2010-11-05 2012-05-10 Zymeworks Inc. Stable heterodimeric antibody design with mutations in the fc domain
WO2012130831A1 (en) 2011-03-29 2012-10-04 Roche Glycart Ag Antibody fc variants
WO2012145493A1 (en) 2011-04-20 2012-10-26 Amplimmune, Inc. Antibodies and other molecules that bind b7-h1 and pd-1
US9205148B2 (en) 2011-04-20 2015-12-08 Medimmune, Llc Antibodies and other molecules that bind B7-H1 and PD-1
WO2012168944A1 (en) 2011-06-08 2012-12-13 Aurigene Discovery Technologies Limited Therapeutic compounds for immunomodulation
WO2013096291A2 (en) 2011-12-20 2013-06-27 Medimmune, Llc Modified polypeptides for bispecific antibody scaffolds
WO2013132317A1 (en) 2012-03-07 2013-09-12 Aurigene Discovery Technologies Limited Peptidomimetic compounds as immunomodulators
WO2013144704A1 (en) 2012-03-29 2013-10-03 Aurigene Discovery Technologies Limited Immunomodulating cyclic compounds from the bc loop of human pd1
WO2013157954A1 (en) 2012-04-20 2013-10-24 Merus B.V. Methods and means for the production of ig-like molecules
WO2013157953A1 (en) 2012-04-20 2013-10-24 Merus B.V. Methods and means for the production of ig-like molecules
WO2013181634A2 (en) 2012-05-31 2013-12-05 Sorrento Therapeutics Inc. Antigen binding proteins that bind pd-l1
WO2014179664A2 (en) 2013-05-02 2014-11-06 Anaptysbio, Inc. Antibodies directed against programmed death-1 (pd-1)
WO2014194302A2 (en) 2013-05-31 2014-12-04 Sorrento Therapeutics, Inc. Antigen binding proteins that bind pd-1
WO2014206107A1 (zh) 2013-06-26 2014-12-31 上海君实生物医药科技有限公司 抗pd-1抗体及其应用
WO2015033299A1 (en) 2013-09-06 2015-03-12 Aurigene Discovery Technologies Limited 1,2,4-oxadiazole derivatives as immunomodulators
WO2015033301A1 (en) 2013-09-06 2015-03-12 Aurigene Discovery Technologies Limited 1,3,4-oxadiazole and 1,3,4-thiadiazole derivatives as immunomodulators
WO2015033303A1 (en) 2013-09-06 2015-03-12 Aurigene Discovery Technologies Limited Cyclic peptidomimetic compounds as immunomodulators
WO2015036927A1 (en) 2013-09-10 2015-03-19 Aurigene Discovery Technologies Limited Immunomodulating peptidomimetic derivatives
WO2015035606A1 (en) 2013-09-13 2015-03-19 Beigene, Ltd. Anti-pd1 antibodies and their use as therapeutics and diagnostics
WO2015044900A1 (en) 2013-09-27 2015-04-02 Aurigene Discovery Technologies Limited Therapeutic immunomodulating compounds
WO2015085847A1 (zh) 2013-12-12 2015-06-18 上海恒瑞医药有限公司 Pd-1抗体、其抗原结合片段及其医药用途
WO2015112800A1 (en) 2014-01-23 2015-07-30 Regeneron Pharmaceuticals, Inc. Human antibodies to pd-1
WO2015112805A1 (en) 2014-01-23 2015-07-30 Regeneron Pharmaceuticals, Inc. Human antibodies to pd-l1
WO2015112900A1 (en) 2014-01-24 2015-07-30 Dana-Farber Cancer Institue, Inc. Antibody molecules to pd-1 and uses thereof
US20150210769A1 (en) 2014-01-24 2015-07-30 Novartis Ag Antibody molecules to pd-1 and uses thereof
WO2015119923A1 (en) 2014-02-04 2015-08-13 Pfizer Inc. Combination of a pd-1 antagonist and a 4-abb agonist for treating cancer
WO2015119930A1 (en) 2014-02-04 2015-08-13 Pfizer Inc. Combination of a pd-1 antagonist and a vegfr inhibitor for treating cancer
WO2015150447A1 (en) 2014-04-02 2015-10-08 F. Hoffmann-La Roche Ag Multispecific antibodies
WO2016000619A1 (en) 2014-07-03 2016-01-07 Beigene, Ltd. Anti-pd-l1 antibodies and their use as therapeutics and diagnostics
WO2016020309A1 (en) 2014-08-04 2016-02-11 F. Hoffmann-La Roche Ag Bispecific t cell activating antigen binding molecules
WO2016032927A1 (en) 2014-08-25 2016-03-03 Pfizer Inc. Combination of a pd-1 antagonist and an alk inhibitor for treating cancer
US20160108123A1 (en) 2014-10-14 2016-04-21 Novartis Ag Antibody molecules to pd-l1 and uses thereof
WO2016061142A1 (en) 2014-10-14 2016-04-21 Novartis Ag Antibody molecules to pd-l1 and uses thereof
WO2016089873A1 (en) 2014-12-02 2016-06-09 Celgene Corporation Combination therapies
WO2016106160A1 (en) 2014-12-22 2016-06-30 Enumeral Biomedical Holdings, Inc. Methods for screening therapeutic compounds
EP3392276A1 (en) * 2015-12-16 2018-10-24 Jiangsu Alphamab Biopharmaceuticals Co., Ltd. Heterodimer molecule based on ch3 structural domain, and preparation method therefor and use thereof
WO2018185043A1 (en) * 2017-04-05 2018-10-11 F. Hoffmann-La Roche Ag Bispecific antibodies specifically binding to pd1 and lag3
WO2020232019A1 (en) * 2019-05-13 2020-11-19 Regeneron Pharmaceuticals, Inc. Combination of pd-1 inhibitors and lag-3 inhibitors for enhanced efficacy in treating cancer
WO2021133653A1 (en) * 2019-12-23 2021-07-01 Macrogenics, Inc. Therapy for the treatment of cancer

Non-Patent Citations (112)

* Cited by examiner, † Cited by third party
Title
"Remington's Pharmaceutical Sciences", 1980
"UniProt", Database accession no. P08637
"Uniprot", Database accession no. Q9NZQ7-3
ABBAS ET AL.: "Cellular and Mol. Immunology", 2000, W.B. SAUNDERS, CO.
AGATA ET AL., INT. IMMUNOLOGY, vol. 8, 1996, pages 765 - 772
AHAMADI ET AL., CPT PHARMACOMETRICS SYST PHARMACOL, vol. 6, no. 1, 2017, pages 58 - 66
ALGAZI ET AL., CANCER MANAG RES., vol. 2, 2010, pages 197 - 211
ARLAUCKAS ET AL., SCI TRANSL MED, vol. 9, no. 389, 2017, pages eaal3604
ASCIERTO ET AL., ANN ONCO, vol. 28, 2017, pages c611 - 612
ASCIERTO ET AL., ANN ONCOL, vol. v611-v612, 2017, pages v295 - v329
BAITSCH ET AL., J CLIN INVEST, vol. 121, 2011, pages 2350 - 2360
BATAILLE, EXPERT REV DERMATOL, vol. 4, 2009, pages 533 - 539
BOIGE ET AL., ONCOLOGIST, vol. 17, 2012, pages 1063 - 1072
BOUZIN ET AL., J IMMUNOL, vol. 178, 2007, pages 1505 - 1511
BRUGGEMANN ET AL., J EXP MED, vol. 166, 1987, pages 1351 - 1361
BUTTE ET AL., IMMUNITY, vol. 27, 2007, pages 111 - 122
CAINAP ET AL., J CLIN ONCOL, vol. 33, 2015, pages 172 - 179
CAMISASCHI ET AL., J IMMUNOL, vol. 184, 2010, pages 6545 - 6551
CARTER, J IMMUNOL METH, vol. 248, 2001, pages 7 - 15
CARTER, J IMMUNOL METHODS, vol. 248, 2001, pages 7 - 15
CAS , no. 1859072-53-9
CHEN ET AL., CLIN CANCER RES, vol. 18, 2012, pages 6580 - 6587
CHENG ET AL., EUR J CANCER, vol. 48, 2009, pages 1452 - 1465
CHENG ET AL., LANCET ONCOL, vol. 10, 2012, pages 25 - 34
CHENMELLMAN, IMMUNITY, vol. 39, 2013, pages 1 - 10
CHINAI ET AL., TRENDS IN PHARMACOLOGICAL SCIENCES, vol. 36, 2015, pages 587 - 595
CHOTHIALESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CLYNES ET AL., PROC NATL ACAD SCI USA, vol. 95, 1998, pages 652 - 656
DUDEK ET AL., J CLIN ONCOL, vol. 38, 2020, pages 10013 - 1145
DUNCAN, A.R.WINTER, G., NATURE, vol. 322, 1988, pages 738 - 740
EXPERT OPIN. BIOL. THER., vol. 5, 2005, pages 783 - 797
FINN ET AL., BMC MED, vol. 10, 2012, pages 23
FINN ET AL., N ENGL J MED, vol. 382, 2020, pages 1894 - 1905
FLAHERTY ET AL., N ENGL J MED, vol. 367, 2012, pages 107 - 114
GABRILOVICH ET AL., NAT MED, vol. 2, 1996, pages 1096 - 1103
GERSHENWALD ET AL., CA CANCER J CLIN, vol. 67, 2017, pages 472 - 492
GOLDBERGDRAKE, CURR TOP MICROBIOL IMMUNOL, vol. 344, 2011, pages 269 - 278
GUO ET AL., J TRANSL MED, vol. 18, 2020, pages 306
GUYER, R.L. ET AL., J. IMMUNOL., vol. 117, 1976, pages 587 - 593
HALES ET AL., ANN ONCOL, vol. 21, 2010, pages 1944 - 1951
HAUSCHILD ET AL., LANCET, vol. 380, 2012, pages 358 - 365
HE ET AL., CANCER SCI, vol. 107, 2016, pages 1193 - 1197
HE, ONCOL, vol. 12, 2017, pages 814 - 823
HELLSTROM ET AL., PROC NATL ACAD SCI USA, vol. 82, 1985, pages 1499 - 1502
HELLSTROM ET AL., PROC NATL ACAD SCI USA, vol. 83, 1986, pages 7059 - 7063
HOLLINGER ET AL., PROC NATL ACAD SCI USA, vol. 90, 1993, pages 6444 - 6448
HONG ET AL., J CLIN ONCOL, vol. 36, 2018, pages 3012
HOUSTON, J.S., METHODS IN ENZYMOL., vol. 203, 1991, pages 46 - 96
HUANG ET AL., BLOOD, vol. 110, 2007, pages 624 - 631
HUANG ET AL., ONCOTARGET, vol. 6, 2015, pages 27359 - 27377
HUARD ET AL., IMMUNOGENETICS, vol. 39, 1994, pages 213 - 217
HUDSON ET AL., NAT MED, vol. 9, 2003, pages 129 - 134
ISHIDA ET AL., EMBO J., vol. 11, 1992, pages 3887 - 3895
JAIN, NAT MED, vol. 7, 2001, pages 987 - 989
JIANG HAIPING ET AL: "PD-L1/LAG-3 bispecific antibody enhances tumor-specific immunity", vol. 10, no. 1, 1 January 2021 (2021-01-01), XP055974043, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8237984/pdf/KONI_10_1943180.pdf> DOI: 10.1080/2162402X.2021.1943180 *
JOHNSON ET AL., J CLIN ONCOL, vol. 31, 2013, pages 3517 - 3524
KABAT: "Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH
KAMANGAR ET AL., J CLIN ONCOL, vol. 24, 2006, pages 2137 - 2150
KANTOFF ET AL., N ENGL J MED, vol. 363, no. 26, 2010, pages 2521 - 2532
KEILHOLZ ET AL., ANN ONCOL, vol. 31, no. 11, 2020, pages 1435 - 1448
KIM, J.K. ET AL., J. IMMUNOL., vol. 113, 1994, pages 2429 - 2434
KOBAYASHI, H. ET AL., NUCL. MED. BIOL., vol. 25, 1998, pages 387 - 393
LARKIN ET AL., N ENGL J MED, vol. 373, 2015, pages 23 - 34
LARKIN ET AL., N ENGL J MED, vol. 380, 2019, pages 1450 - 1462
LEE ET AL., BIOL BLOOD MARROW TRANSPLANT, vol. 25, 2019, pages 625 - 638
LENCIONI ET AL., J HEPATOL, vol. 66, 2017, pages 1166 - 1172
LENCIONILLOVET, SEMIN LIVER DES, vol. 30, 2010, pages 52 - 60
LI ET AL., CLINICAL PHARMACOLOGY AND THERAPEUTICS, vol. 110, no. 1, 2021, pages 200 - 209
LI ET AL., IMMUNOL LETT, vol. 150, 2013, pages 1116 - 1122
LIU ET AL., CLIN CANCER RES, vol. 20, 2014, pages 1623 - 1631
LIU ET AL., JAMA ONCOL, vol. 5, 2019, pages 1731 - 1738
LLOVET ET AL., J NATL CANCER INST, vol. 100, 2008, pages 698 - 711
LLOVET ET AL., N ENGL J MED, vol. 359, 2008, pages 378 - 380
LONG ET AL., ASCO ANNUAL MEETING ABSTRACTS, vol. 32, 2014, pages 9011
LONG ET AL., GENES CANCER, vol. 9, no. 5-6, 2018, pages 176 - 189
MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745
MAKKER ET AL., J CLIN ONCOL, vol. 35, 2017, pages 5598
MATSUZAKI ET AL., PROC NATL ACAD SCI USA, vol. 107, 2010, pages 7875 - 7880
MOTZ ET AL., NAT MED, vol. 20, 2014, pages 607 - 615
NORSTROM ET AL., ONCOTARGET, vol. 7, 2016, pages 23581 - 23593
OELKRUGRAMAGE, CLIN EXP IMMUNOL, vol. 178, 2014, pages 1 - 8
PAZDUR ET AL., ONCOLOGIST, vol. 13, 2008, pages 19 - 21
POPKOV ET AL., JOURNAL OF IMMUNOLOGICAL METHODS, vol. 288, 2004, pages 149 - 164
PRESTA ET AL., CANCER RES., vol. 57, 1997, pages 4593 - 4599
PROTEIN ENG. DES. SEL., vol. 18, 2005, pages 435 - 444
RAJAGOPAL, V. ET AL., PROT. ENG., 1997, pages 1453 - 1459
RIDGWAY ET AL., PROT ENG, vol. 9, 1996, pages 617 - 621
RINI ET AL., LANCET, vol. 393, 2019, pages 2404 - 2415
ROLAND ET AL., PLOS ONE, vol. 4, 2009, pages e7669
ROZEMAN ET AL., LANCET ONCOL, vol. 20, 2019, pages 1239 - 1251
ROZEMAN ET AL., NAT MED, vol. 27, 2021, pages 256 - 263
SCHAEFER, W. ET AL., PNAS, vol. 108, 2011, pages 11187 - 1191
SCHMIDT, M. ET AL., ONCOGENE, vol. 18, 1999, pages 1711 - 1721
SHIELDS, R.L. ET AL., J. BIOL. CHEM., vol. 276, 2001, pages 6591 - 6604
SIEGEL ET AL., CA CANCER J CLIN, vol. 66, 2016, pages 115 - 132
SIEGEL ET AL., J CLIN ONCOL, vol. 26, 2008, pages 2992 - 2998
SOCINSKI ET AL., N ENGL J MED, vol. 378, 2018, pages 2288 - 2301
STRATTON ET AL., SOCIETY FOR IMMUNOTHERAPY OF CANCER (SITC) ABSTRACT P325, 2018
STUBENRAUCH ET AL., DRUG METABOLISM AND DISPOSITION, vol. 38, 2010, pages 84 - 91
TAKADA ET AL., BMC RES NOTES, vol. 8, 2015, pages 609
TAWBI ET AL., N ENGL J MED, vol. 386, no. 1, 2022, pages 24 - 34
TETZLAFF ET AL., ANN ONCOL, vol. 29, 2018, pages 1861 - 1868
THOMMEN ET AL., CANCER IMMUNOL RES, 2015, pages 31344 - 55
VORON ET AL., J EXP MED, vol. 212, 2015, pages 139 - 148
WALLIN ET AL., NAT COMMUN, vol. 7, 2016, pages 12624
WEBER ET AL., LANCET ONCOL, vol. 16, no. 4, 2015, pages 375 - 384
WOLCHOK ET AL., ABSTRACT 9506 ASCO ANNUAL MEETING, 2021
WOLCHOK ET AL., N ENGL J MED, vol. 377, 2017, pages 1345 - 1356
WOO ET AL., CANCER RES, vol. 72, 2012, pages 917 - 927
YANG ET AL., J IMMUNOL, vol. 187, 2011, pages 1113 - 1119
YARCHOAN ET AL., CLIN CANCER RES, vol. 23, 2017, pages 7333 - 7339
ZHANG ET AL., SCI IMMUNOL, 2017, pages 2eaah4569

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024163009A1 (en) * 2023-01-31 2024-08-08 Genentech, Inc. Methods and compositions for treating urothelial bladder cancer
WO2024263904A1 (en) * 2023-06-23 2024-12-26 Genentech, Inc. Methods for treatment of liver cancer

Also Published As

Publication number Publication date
WO2023010095A8 (en) 2023-03-16
JP2024529451A (ja) 2024-08-06
US20240327519A1 (en) 2024-10-03
EP4377351A1 (en) 2024-06-05
AU2022317820A9 (en) 2024-01-04
IL309120A (en) 2024-02-01
MX2024001214A (es) 2024-02-12
CA3224180A1 (en) 2023-02-02
KR20240038008A (ko) 2024-03-22
AU2022317820A1 (en) 2023-12-14
CN117715936A (zh) 2024-03-15

Similar Documents

Publication Publication Date Title
KR20220133243A (ko) 항 tigit 길항제 항체를 이용한 암의 치료 방법
US20240424092A1 (en) Methods for treatment of cancer with an anti-tigit antagonist antibody
US20240327519A1 (en) Methods and compositions for treating cancer
US20230131598A1 (en) Combination treatment for cancer
US20240287182A1 (en) Methods and compositions for treating cancer
JP2023521228A (ja) 癌の併用療法
CA3175490A1 (en) Combination treatment for cancer based upon an icos antibody and a pd-l1 antibody tgf-beta-receptor fusion protein
US20240317854A1 (en) Methods for treating cancer with anti-ilt3 antibodies
US20240207398A1 (en) Methods and compositions for treating cancer
WO2025036445A1 (en) Treatment of lung cancer with anti-pd-1 and chemotherapy
HK40109234A (zh) 用於治疗癌症的方法和组合物
WO2024163494A1 (en) Methods and compositions for treating non-small cell lung cancer and triple-negative breast cancer
WO2024163009A1 (en) Methods and compositions for treating urothelial bladder cancer
CN117940452A (zh) 用于治疗癌症的方法和组合物
KR20260054704A (ko) 항-pd-1 및 화학요법을 이용한 폐암 치료
HK40110052A (zh) 用於治疗癌症的方法和组合物
WO2026019990A1 (en) Methods of treating cancer with anti-ccr8/anti-cd3 bispecific antibodies
WO2024263904A1 (en) Methods for treatment of liver cancer
WO2024263195A1 (en) Methods for treatment of liver cancer
HK40119150A (zh) 用於治疗癌症的方法和组合物

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22764591

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2022317820

Country of ref document: AU

Ref document number: AU2022317820

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 309120

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2022317820

Country of ref document: AU

Date of ref document: 20220728

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 3224180

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 202280052285.6

Country of ref document: CN

Ref document number: MX/A/2024/001214

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2024504960

Country of ref document: JP

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112024001692

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20247005105

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 1020247005105

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 2024104437

Country of ref document: RU

Ref document number: 2022764591

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022764591

Country of ref document: EP

Effective date: 20240228

ENP Entry into the national phase

Ref document number: 112024001692

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20240126