WO2022258805A1 - Treatment of obesity and obesity-related disorders - Google Patents
Treatment of obesity and obesity-related disorders Download PDFInfo
- Publication number
- WO2022258805A1 WO2022258805A1 PCT/EP2022/065826 EP2022065826W WO2022258805A1 WO 2022258805 A1 WO2022258805 A1 WO 2022258805A1 EP 2022065826 W EP2022065826 W EP 2022065826W WO 2022258805 A1 WO2022258805 A1 WO 2022258805A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- peptide
- gip
- a13aib
- use according
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/2235—Secretins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/2278—Vasoactive intestinal peptide [VIP]; Related peptides (e.g. Exendin)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/26—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/48—Drugs for disorders of the endocrine system of the pancreatic hormones
- A61P5/50—Drugs for disorders of the endocrine system of the pancreatic hormones for increasing or potentiating the activity of insulin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/57563—Vasoactive intestinal peptide [VIP]; Related peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/645—Secretins
Definitions
- the present disclosure relates to a glucose-dependent insulinotropic peptide (GIP) receptor (GIPR) antagonist GIP peptide in combination with a glucagon-like peptide-1 (GLP-1) agonist, such as a GLP-1 peptide, for use in the treatment of obesity and obesity-related disorders, as well as GIPR antagonist GIP peptides for treating a subset of obesity-related disorders.
- GIP glucose-dependent insulinotropic peptide
- GLP-1 glucagon-like peptide-1
- Gastrointestinal peptides and adipokines are critical signalling molecules involved in controlling whole-body energy homeostasis. These circulating hormones regulate a variety of biological responses such as hunger, satiety and glucose uptake. In vivo experiments have established that these hormones also regulate bone metabolism, while associations between these hormones and bone mass have been observed in human clinical studies.
- Incretins are gastrointestinal hormones that help to regulate carbohydrate metabolism in response to food intake.
- the two main incretins are glucose-dependent insulinotropic peptide (GIP) and glucagon-like peptide-1 (GLP-1), both secreted by intestinal epithelial cells.
- Intestinal glucagon-like peptide-2 (GLP-2) is co-secreted along with GLP-1 upon nutrient ingestion.
- GIP Glucose-dependent insulinotropic peptide
- GIP is a hormone secreted from the K cells of the gut following a meal 1 .
- GLP-1 glucagon-like peptide 1
- GIP is a potent insulin secretagogue 2 .
- GIP has been shown to display glucagon-releasing properties under certain conditions ( 3 ⁇ 5 13 ).
- the interest in understanding the biology of GIP was intensified by the association between rodent GIPR (GIP receptor) and adiposity 1421 .
- GLP-1 is a 31 -amino acid peptide derived from the proglucagon gene. It is secreted by intestinal L-cells and released in response to food ingestion to induce insulin secretion from pancreatic b-cells. In addition to the incretin effects, GLP-1 also decreases glucagon secretion, delays gastric emptying and reduces caloric intake. GLP-1 exerts its effects by activation of the GLP-1 receptor, which belongs to a class B G-protein- coupled receptor. The function of GLP-1 is limited by rapid degradation by the DPP-IV enzyme, resulting in a half-life of approximately 2 minutes.
- GLP-1 receptor agonists such as exenatide, liraglutide, dulaglutide and semaglutide have been developed and are used in the clinic to improve glycemic control in patients with type 2 diabetes. Furthermore, GLP-1 receptor agonists promote body weight reduction as well as reduction in blood pressure and plasma cholesterol levels in patients.
- Irwin et al. 2009 (Diabetes Obes Metab 2009 Jun;11 (6):603-10) discloses that daily intraperitoneal injections of the GLP-1 agonist (d-Ala8)GLP-1 or of the GIPR antagonist GIP peptide (Pro3)GIP restored glycaemic control to normal levels and significantly improved glucose tolerance compared with high-fat controls in mice. However, food intake and body weights were not affected. Moreover, Irwin et al. 2009 also discloses that combination therapy consisting of the GLP-1 agonist (d-Ala8)GLP-1 and the GIPR antagonist GIP peptide (Pro3)GIP seems to have little benefit over either treatment alone, and that body weight and food intake were not affected even when the two compounds were administered together.
- GIPA-1 mouse GIP(3-30)NH 2
- GIPA-2 NaAo-K10[gEgE- C16]-Arg18-hGIP(5-42)
- GIPA-2 NaAo-K10[gEgE- C16]-Arg18-hGIP(5-42)
- GIPA-2 was found to be a more potent antagonist than GIPA-1 in mice, and inhibited glucose stimulated insulin secretion.
- chronic administration of GIPA-1 or GIPA-2 alone had no effect on absolute body weight or cumulative food intake compared with vehicle control.
- liraglutide reduced both body weight and food intake, but no additive effect was observed by combining liraglutide with either of the GIPR antagonists on these parameters.
- acylated GIPR antagonist GIP peptides derived from native hGIP(3-30) comprising amino acid substitutions D9E, A13Aib, D15E, H18K, D21E and/or N24E and a C-terminal elongation, which have high solubility, physical stability and/or superior antagonistic properties, are surprisingly effective in reducing body weight, reducing food intake, reducing fasting blood levels of glucose, reducing fasting blood levels of insulin, reducing insulin resistance and improving insulin sensitivity, reducing fasting blood levels of triglycerides and reducing fasting blood levels of cholesterol, in a monkey model of obesity, alone and in particular when used in combination with the GLP-1 receptor agonist liraglutide.
- This implies that these carefully optimised GIPR antagonist GIP peptides are especially effective especially when administered in combination with GLP-1 receptor agonists in treating obesity and obesity-related disorders such as dyslipidemia.
- the in vivo data presented herein demonstrate for the first time that the herein disclosed therapy such as combination therapy results in improved reduction of body weight .
- improved reduction of food intake improved reduction of fasting blood levels of glucose, improved reduction of fasting blood levels of insulin, improved reduction of insulin resistance, improved reduction of fasting blood levels of triglycerides, improved reduction of fasting blood levels of cholesterol and improved reduction of fasting blood levels of low-density lipoprotein (LDL) cholesterol compared to any of the single therapies, and there is at least a clear additive effect on these parameters.
- LDL low-density lipoprotein
- the present disclosure provides a glucose-dependent insulinotropic peptide receptor (GIPR) antagonist GIP peptide consisting of amino acid sequence SEQ ID NO: 1 : 3 4 5 6 7 8 9 10 11 12 13 14 15 16
- GIPR glucose-dependent insulinotropic peptide receptor
- S - S - G - A - P - P - P - S ( SEQ ID NO : 1 ) wherein Xi is E, glutaric acid, adipic acid or succinic acid; wherein x 2 is M, L or Nle; or a functional variant thereof, wherein the amino acid sequence of said variant differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 1, 2 or 3 individual amino acid substitutions, wherein said peptide comprises a fatty acid molecule attached to the side chain amino group of the amino acid residue at position 18 of SEQ I D NO: 1 , or said functional variant thereof, for use in a method of treating obesity, obesity-related disorders and/or dyslipidemia, said method comprising one or more steps of co-administering a glucagon-like peptide- 1 (GLP-1) receptor agonist.
- GLP-1 glucagon-like peptide- 1
- the present disclosure provides a GIPR antagonist GIP peptide as disclosed herein, for use in a method of inhibiting or reducing one or more of i) food intake, ii) body weight, iii) fasting blood levels of glucose, iv) fasting blood levels of insulin, v) insulin resistance, vi) fasting blood levels of triglycerides, vii) fasting blood levels of cholesterol, viii) fasting blood levels of low-density lipoprotein (LDL) cholesterol, said method comprising one or more steps of co-administering a glucagon like peptide-1 (GLP-1) receptor agonist.
- GLP-1 glucagon like peptide-1
- the present disclosure provides a GIPR antagonist GIP peptide as disclosed herein, for use in a method of treating dyslipidemia, said method comprising one or more steps of co-administering a glucagon-like peptide-1 (GLP-1) receptor agonist.
- GLP-1 glucagon-like peptide-1
- a further aspect of the present disclosure provides a composition comprising, separately or together, a GIPR antagonist GIP peptide and a GLP-1 receptor agonist, wherein said GIPR antagonist GIP peptide consist of amino acid sequence SEQ ID NO: 1 :
- a further aspect of the present disclosure provides a kit of parts comprising a GIPR antagonist GIP peptide as defined herein and a GLP-1 receptor agonist as defined herein.
- composition comprising, separately or together, or said kit of parts comprising a GIPR antagonist GIP peptide and a GLP-1 receptor agonist, is for use in a method of treating one or more of obesity, obesity-related disorders and dyslipidemia; and/or for use in a method of inhibiting or reducing one or more of i) food intake, ii) body weight, iii) fasting blood levels of glucose, iv) fasting blood levels of insulin, v) insulin resistance, vi) fasting blood levels of triglycerides, vii) fasting blood levels of cholesterol, and viii) fasting blood levels of low-density lipoprotein (LDL) cholesterol.
- LDL low-density lipoprotein
- the optimised GIPR antagonist GIP peptides of the present disclosure are particularly effective in improving a number of parameters inclusive of reducing fasting blood levels of insulin, reducing insulin resistance and improving insulin sensitivity, reducing fasting blood levels of triglycerides and reducing fasting blood levels of low-density lipoprotein (LDL) cholesterol, which occur independently of the observed effects on weight loss and obesity.
- LDL low-density lipoprotein
- one aspect of the present disclosure relates to a GIPR antagonist GIP peptide consisting of amino acid sequence SEQ ID NO: 1 :
- Figure 1 GIPR antagonists alone and in combination with the GLP-1R agonist liraglutide markedly reduce energy intake and body weight in HFD induced obese male Cynomolgus monkeys, and improve insulin resistance and blood lipid profiles.
- Cynomolgus monkeys (Macaca fascicularis) were fed a HFD consisting of 50 g of KBI proprietary standard monkey formula feed in the morning 9:00 to 10:00 AM, 150 g apple in the afternoon 14:00 to 15:00 PM, and 100 g of KBI proprietary HFD in the evening 16:00 to 17:00 PM. Water was provided ad libitum.
- the monkeys were treated for 42 days with vehicle (placebo), liraglutide (in a dose escalation regimen over 7 days up to 0.03 mg/kg, once daily SC injection), Compound 1 (540 nmol/kg, once daily SC injection), Compound 1 in combination with liraglutide (same dosing and frequency), Compound 2 (1440 nmol/kg the first 3 days and 540 nmol/kg the remaining 39 study days, once daily SC injection), or Compound 2 in combination with liraglutide (same dosing and frequency).
- agonist in the present context refers to a peptide, or analogue thereof, capable of binding to and activating downstream signalling cascades from a receptor.
- Antagonist in the present context refers to a GIPR antagonist GIP peptide as defined herein, capable of binding to and blocking or reducing agonist-mediated responses of a receptor. Antagonists usually do not provoke a biological response themselves upon binding to a receptor. Antagonists have affinity but no efficacy for their cognate receptors, and binding of an antagonist to its receptor will inhibit the function of an agonist or inverse agonist at receptors. Antagonists mediate their effects by binding to the active (orthosteric) site or to allosteric sites on receptors, or they may interact at unique binding sites not normally involved in the biological regulation of the receptor's activity.
- Antagonist activity may be reversible or irreversible depending on the longevity of the antagonist-receptor complex, which, in turn, depends on the nature of antagonist-receptor binding. The majority of drug antagonists typically achieve their potency by competing with endogenous ligands or substrates at structurally defined binding sites on receptors. Antagonists may be competitive, non-competitive, uncompetitive, silent antagonists, partial agonists or inverse agonists.
- GIP glucose-dependent insulinotropic polypeptide receptor
- GLP-1 receptor agonist refers to a compound, such as a peptide or a small molecule drug, capable of binding to and activating or enhancing agonist-mediated responses of GLP-1 R.
- the term “individual” refers to vertebrates, particular members of the mammalian species, preferably primates including humans. As used herein, ‘subject’ and ‘individual’ may be used interchangeably.
- amino acid residue can be a natural or non-natural amino acid residue linked by peptide bonds or bonds different from peptide bonds.
- the amino acid residues can be in D-configuration or L-configuration.
- An amino acid residue comprises an amino terminal part (NH2) and a carboxy terminal part (COOH) separated by a central part comprising a carbon atom, or a chain of carbon atoms, at least one of which comprises at least one side chain or functional group.
- NH2 refers to the amino group present at the amino terminal end of an amino acid or peptide
- COOH refers to the carboxy group present at the carboxy terminal end of an amino acid or peptide.
- the generic term amino acid comprises both natural and non-natural amino acids.
- Natural amino acids of standard nomenclature as listed in J. Biol. Chem., 243:3552-59 (1969) and adopted in 37 C.F.R., section 1.822(b)(2) belong to the group of amino acids listed herewith: Y,G,F,M,A,S,I,L,T,V,P,K,H,Q,E,W,R,D,N and C.
- Non-natural amino acids are those not listed immediately above.
- non-natural amino acid residues include, but are not limited to, modified amino acid residues, L-amino acid residues, and stereoisomers of D-amino acid residues.
- an “equivalent amino acid residue” refers to an amino acid residue capable of replacing another amino acid residue in a polypeptide without substantially altering the structure and/or functionality of the polypeptide. Equivalent amino acids thus have similar properties such as bulkiness of the side-chain, side chain polarity (polar or non-polar), hydrophobicity (hydrophobic or hydrophilic), pH (acidic, neutral or basic) and side chain organization of carbon molecules (aromatic/aliphatic). As such, “equivalent amino acid residues” can be regarded as “conservative amino acid substitutions”, and it is the substitution of amino acids whose side chains have similar biochemical properties and thus do not affect the function of the peptide.
- a “conservative amino acid substitution” can also be illustrated by a substitution among amino acids within each of the following groups: (1) glycine, alanine, valine, leucine, and isoleucine, (2) phenylalanine, tyrosine, and tryptophan, (3) serine and threonine, (4) aspartate and glutamate, (5) glutamine and asparagine, and (6) lysine, arginine and histidine.
- one amino acid may be substituted for another, in one embodiment, within the groups of amino acids indicated herein below: i) Amino acids having polar side chains (Asp, Glu, Lys, Arg, His, Asn, Gin, Ser, Thr, Tyr, and Cys,) ii) Amino acids having non-polar side chains (Gly, Ala, Val, Leu, lie, Phe, Trp, Pro, and Met) iii) Amino acids having aliphatic side chains (Gly, Ala Val, Leu, lie) iv) Amino acids having cyclic side chains (Phe, Tyr, Trp, His, Pro) v) Amino acids having aromatic side chains (Phe, Tyr, Trp) vi) Amino acids having acidic side chains (Asp, Glu) vii) Amino acids having basic side chains (Lys, Arg, His) viii) Amino acids having amide
- a serine residue of a peptide of the present disclosure may be substituted with an amino acid selected from the group consisting of Gin, Asn and Thr (all amino acids with polar uncharged side chains); and independently thereof, a glycine residue (Gly) is substituted with an amino acid selected from the group consisting of Ala, Val, Leu, and lie; and independently thereof, an arginine residue (Arg) is substituted with an amino acid selected from the group consisting of Lys and His (all have positively charged side chains); and independently thereof, a lysine residue (Lys) may be substituted with an amino acid selected from the group consisting of Arg and His; and independently thereof, a methionine residue (Met) may be substituted with an amino acid selected from the group consisting of Leu, Pro, lie, Val, Phe, Tyr and Trp (all have hydrophobic side chains); and independently thereof, a glutamine residue (Gin) may be substituted with an amino acid selected from the group consisting of Asp, Glu,
- L or D form optical isomers
- the amino acid in question has the natural L form, cf. Pure & Appl. Chem. Vol. (56(5) pp 595-624 (1984) or the D form, so that the peptides formed may be constituted of amino acids of L form, D form, or a sequence of mixed L forms and D forms.
- Glu Glutamic acid
- Examples are beta-Glu, gamma-Glu or glutaric acid.
- Glutaric acid is also known as Pentanedioic acid.
- a “functional variant” of a peptide is a peptide capable of performing essentially the same functions as the peptide it is a functional variant of.
- a functional variant can essentially bind the same molecules, such as receptors, or perform the same receptor mediated responses as the peptide it is a functional variant of.
- a functional variant of a “glucose-dependent insulinotropic peptide (GIP) antagonist GIP peptide” is a peptide, which can bind to the GIPR and inhibit GIPR downstream signalling, such as cAMP generation.
- a “bioactive agent” i.e. a biologically active substance/agent is any agent, drug, compound, composition of matter or mixture which provides some pharmacologic, often beneficial, effect that can be demonstrated in vivo or in vitro. It refers to the GIPR antagonist GIP peptide as defined herein and compounds or compositions comprising these, e.g. a composition comprising the GIPR antagonist GIP peptide as defined herein and the GLP-1 receptor agonist as defined herein, only the GIPR antagonist GIP peptide as defined herein, or only the GLP-1 receptor agonist as defined herein. As used herein, this term further includes any physiologically or pharmacologically active substance that produces a localized or systemic effect in an individual.
- drug and “medicament” as used herein include biologically, physiologically, or pharmacologically active substances that act locally or systemically in the human or animal body.
- treatment refers to the management and care of a patient for the purpose of combating a condition, disease or disorder.
- the term is intended to include the full spectrum of treatments for a given condition from which the patient is suffering, and refer equally to curative therapy, prophylactic or preventative therapy and ameliorating or palliative therapy, such as administration of the bioactive agents for the purpose of: alleviating or relieving symptoms or complications; delaying the progression of the condition, partially arresting the clinical manifestations, disease or disorder; curing or eliminating the condition, disease or disorder; amelioration or palliation of the condition or symptoms, and remission (whether partial or total), whether detectable or undetectable; and/or preventing or reducing the risk of acquiring the condition, disease or disorder, wherein “preventing” or “prevention” is to be understood to refer to the management and care of a patient for the purpose of hindering the development of the condition, disease or disorder, and includes the administration of the bioactive agents to prevent or reduce the risk of the onset of symptoms or complications.
- the individual to be treated is preferably a mammal, in particular a human being.
- Treatment of animals, such as mice, rats, dogs, cats, cows, horses, sheep and pigs, is, however, also encompassed herewith.
- An “individual in need thereof” refers to an individual who may benefit from the present disclosure. In one embodiment, said individual in need thereof is an obese or overweight individual.
- a treatment according to the invention can be prophylactic, ameliorating and/or curative.
- Bioactive agent in the present context refers to a GIPR antagonist GIP peptide as disclosed herein.
- Co-administering or “co-administration” as used herein refers to the administration of a GIPR antagonist GIP peptide of the present disclosure and a state-of-the-art pharmaceutical composition comprising a GLP-1 receptor agonist.
- the at least two components can be administered separately, sequentially or simultaneously.
- the present disclosure provides a glucose-dependent insulinotropic peptide receptor (GIPR) antagonist GIP peptide consisting of amino acid sequence SEQ ID NO: 1 :
- SEQ ID NO:1 SEQ ID NO:1
- Xi is E, glutaric acid, adipic acid or succinic acid
- x 2 is M, L or Nle
- amino acid sequence of said variant differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 1, 2 or 3 individual amino acid substitutions, wherein said peptide comprises a fatty acid molecule attached to the side chain amino group of the amino acid residue at position 18 of SEQ I D NO: 1 , or said functional variant thereof, for use in a method of treating obesity, obesity-related disorders and/or dyslipidemia, said method comprising one or more steps of co-administering a glucagon-like peptide- 1 (GLP-1) receptor agonist.
- GLP-1 glucagon-like peptide- 1
- GIP peptide consisting of amino acid sequence SEQ ID NO: 1 :
- SEQ ID NO:1 SEQ ID NO:1
- Xi is E, glutaric acid, adipic acid or succinic acid
- x 2 is M, L or Nle
- amino acid sequence of said variant differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 1, 2 or 3 individual amino acid substitutions, wherein said peptide comprises a fatty acid molecule attached to the side chain amino group of the amino acid residue at position 18 of SEQ I D NO: 1 , or said functional variant thereof, for use in a method of inhibiting or reducing one or more of i) food intake, ii) body weight, iii) fasting blood levels of glucose, iv) fasting blood levels of insulin, v) insulin resistance, vi) fasting blood levels of triglycerides, vii) fasting blood levels of cholesterol, and viii) fasting blood levels of low-density lip
- GIP peptide consisting of amino acid sequence SEQ ID NO: 1 :
- S - S - G - A - P - P - P - S ( SEQ ID NO : 1 ) wherein Xi is E, glutaric acid, adipic acid or succinic acid; wherein x 2 is M, L or Nle; or a functional variant thereof, wherein the amino acid sequence of said variant differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 1, 2 or 3 individual amino acid substitutions, wherein said peptide comprises a fatty acid molecule attached to the side chain amino group of the amino acid residue at position 18 of SEQ I D NO: 1 , or said functional variant thereof, for use in a method of treating dyslipidemia, said method comprising one or more steps of co-administering a glucagon-like peptide-1 (GLP-1) receptor agonist. Also disclosed is the use of a composition comprising a GLP-1 R agonist and a GIPR antagonist GIP peptide consisting of amino acid sequence SEQ ID NO: 1 :
- SEQ ID NO:1 SEQ ID NO:1
- Xi is E, glutaric acid, adipic acid or succinic acid
- x 2 is M, L or Nle
- amino acid sequence of said variant differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 1, 2 or 3 individual amino acid substitutions, wherein said peptide comprises a fatty acid molecule attached to the side chain amino group of the amino acid residue at position 18 of SEQ I D NO: 1 , or said functional variant thereof, in the manufacture of a medicament for treatment of obesity, obesity-related disorders and/or dyslipidemia.
- composition comprising a GLP-1 R agonist and a GIPR antagonist GIP peptide consisting of amino acid sequence SEQ ID NO:1:
- SEQ ID NO:1 SEQ ID NO:1
- Xi is E, glutaric acid, adipic acid or succinic acid
- x 2 is M, L or Nle
- amino acid sequence of said variant differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 1, 2 or 3 individual amino acid substitutions, wherein said peptide comprises a fatty acid molecule attached to the side chain amino group of the amino acid residue at position 18 of SEQ I D NO: 1 , or said functional variant thereof, in the manufacture of a medicament for inhibiting or reducing one or more of i) food intake, ii) body weight, iii) fasting blood levels of glucose, iv) fasting blood levels of insulin, v) insulin resistance, vi) fasting blood levels of triglycerides, vii) fasting blood levels of cholesterol, viii) fasting blood levels of low-density lip
- composition comprising a GLP-1R agonist and a GIPR antagonist GIP peptide consisting of amino acid sequence SEQ ID NO: 1 :
- S - S - G - A - P - P - P - S ( SEQ ID NO : 1 ) wherein Xi is E, glutaric acid, adipic acid or succinic acid; wherein x 2 is M, L or Nle; or a functional variant thereof, wherein the amino acid sequence of said variant differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 1, 2 or 3 individual amino acid substitutions, wherein said peptide comprises a fatty acid molecule attached to the side chain amino group of the amino acid residue at position 18 of SEQ I D NO: 1 , or said functional variant thereof, in the manufacture of a medicament for treating dyslipidemia.
- Also disclosed herein is a method for treatment of obesity, obesity-related disorders and/or dyslipidemia comprising administration to an individual in need thereof a GIPR antagonist GIP peptide consisting of amino acid sequence SEQ ID NO:1:
- SEQ ID NO:1 SEQ ID NO:1
- Xi is E, glutaric acid, adipic acid or succinic acid
- x 2 is M, L or Nle
- amino acid sequence of said variant differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 1, 2 or 3 individual amino acid substitutions, wherein said peptide comprises a fatty acid molecule attached to the side chain amino group of the amino acid residue at position 18 of SEQ I D NO: 1 , or said functional variant thereof, said method comprising one or more steps of co-administering a GLP-1R agonist.
- Also disclosed herein is a method for inhibiting or reducing one or more of i) food intake, ii) body weight, iii) fasting blood levels of glucose, iv) fasting blood levels of insulin, v) insulin resistance, vi) fasting blood levels of triglycerides, vii) fasting blood levels of cholesterol and viii) fasting blood levels of low-density lipoprotein (LDL) cholesterol in an individual in need thereof, said method comprising administration of a GIPR antagonist GIP peptide consisting of amino acid sequence SEQ ID NO: 1 :
- SEQ ID NO:1 SEQ ID NO:1
- Xi is E, glutaric acid, adipic acid or succinic acid
- x 2 is M, L or Nle
- amino acid sequence of said variant differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 1, 2 or 3 individual amino acid substitutions, wherein said peptide comprises a fatty acid molecule attached to the side chain amino group of the amino acid residue at position 18 of SEQ I D NO: 1 , or said functional variant thereof, said method comprising one or more steps of co-administering a GLP-1R agonist.
- the present disclosure provides a composition comprising, separately or together, or a kit of parts comprising, a GIPR antagonist GIP peptide and a GLP-1 receptor agonist, wherein said GIPR antagonist GIP peptide consist of amino acid sequence SEQ ID NO: 1 :
- SEQ ID NO : 1 SEQ ID NO : 1
- Xi is E, glutaric acid, adipic acid or succinic acid
- x 2 is M, L or Nle
- amino acid sequence of said variant differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 1, 2 or 3 individual amino acid substitutions, wherein said peptide comprises a fatty acid molecule attached to the side chain amino group of the amino acid residue at position 18 of SEQ I D NO: 1 , or said functional variant thereof.
- composition comprising, separately or together, or a kit of parts comprising, a GIPR antagonist GIP peptide and a GLP-1 receptor agonist, wherein said GIPR antagonist GIP peptide consist of amino acid sequence SEQ ID NO:1:
- SEQ ID NO:1 SEQ ID NO:1
- Xi is E, glutaric acid, adipic acid or succinic acid
- x 2 is M, L or Nle
- amino acid sequence of said variant differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 1, 2 or 3 individual amino acid substitutions, wherein said peptide comprises a fatty acid molecule attached to the side chain amino group of the amino acid residue at position 18 of SEQ I D NO: 1 , or said functional variant thereof, for use in a method for treatment of obesity, obesity-related disorders and/or dyslipidemia.
- composition comprising, separately or together, or a kit of parts comprising, a GIPR antagonist GIP peptide and a GLP-1 receptor agonist, wherein said GIPR antagonist GIP peptide consist of amino acid sequence SEQ ID NO: 1 :
- SEQ ID NO:1 SEQ ID NO:1
- Xi is E, glutaric acid, adipic acid or succinic acid
- x 2 is M, L or Nle
- amino acid sequence of said variant differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 1, 2 or 3 individual amino acid substitutions, wherein said peptide comprises a fatty acid molecule attached to the side chain amino group of the amino acid residue at position 18 of SEQ I D NO: 1 , or said functional variant thereof, for use in a method for inhibiting or reducing one or more of i) food intake, ii) body weight, iii) fasting blood levels of glucose, iv) fasting blood levels of insulin, v) insulin resistance, vi) fasting blood levels of triglycerides, vii) fasting blood levels of cholesterol and viii) fasting blood levels of low-density lipo
- a combination drug comprising i) a glucagon-like peptide-1 (GLP-1) receptor agonist, and ii) a glucose-dependent insulinotropic peptide receptor (GIPR) antagonist GIP peptide consisting of amino acid sequence SEQ ID NO: 1 :
- SEQ ID NO : 1 SEQ ID NO : 1
- Xi is E, glutaric acid, adipic acid or succinic acid
- x 2 is M, L or Nle
- amino acid sequence of said variant differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 1, 2 or 3 individual amino acid substitutions, wherein said peptide comprises a fatty acid molecule attached to the side chain amino group of the amino acid residue at position 18 of SEQ I D NO: 1 , or said functional variant thereof.
- a combination drug comprising i) a glucagon-like peptide-1 (GLP-1) receptor agonist, and ii) a glucose-dependent insulinotropic peptide receptor (GIPR) antagonist GIP peptide consisting of amino acid sequence SEQ ID NO:1:
- a combination drug comprising i) a glucagon-like peptide-1 (GLP-1) receptor agonist, and ii) a glucose-dependent insulinotropic peptide receptor (GIPR) antagonist GIP peptide consisting of amino acid sequence SEQ ID NO: 1 :
- the GIPR antagonist GIP peptide and the GLP-1 receptor agonist of the present disclosure are contained together in the same composition or pharmaceutical formulation.
- the GIPR antagonist GIP peptide and the GLP-1 receptor agonist of the present disclosure are each contained in separate compositions or pharmaceutical formulations.
- the GIPR antagonist GIP peptide and the GLP-1 receptor agonist are administered simultaneously.
- the GIPR antagonist GIP peptide and the GLP-1 receptor agonist are administered separately.
- the GIPR antagonist GIP peptide and the GLP-1 receptor agonist are administered sequentially.
- one aspect of the present disclosure relates to a GIPR antagonist GIP peptide consisting of amino acid sequence SEQ ID NO: 1 :
- Another aspect of the present disclosure relates to a GIPR antagonist GIP peptide consisting of amino acid sequence SEQ ID NO: 1 :
- the peptide for use in a method of inhibiting or reducing any one of i) food intake, ii) body weight, iii) fasting blood levels of glucose, iv) fasting blood levels of insulin, v) insulin resistance, vi) fasting blood levels of triglycerides, vii) fasting blood levels of cholesterol and viii) fasting blood levels of low-density lipoprotein (LDL) cholesterol, and/or for use in a method of treating dyslipidemia is EGTFISEYSIAibl_EKIKQQEFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO:6; GIP(3-30)+Cex(31-39) [D9E;A13Aib;M14L;D15E;H18K;D21E;N24E], or a functional variant thereof comprising 1 , 2 or 3 individual amino acid substitutions.
- the peptide for use in a method of inhibiting or reducing any one of i) food intake, ii) body weight, iii) fasting blood levels of glucose, iv) fasting blood levels of insulin, v) insulin resistance, vi) fasting blood levels of triglycerides, vii) fasting blood levels of cholesterol and viii) fasting blood levels of low-density lipoprotein (LDL) cholesterol, and/or for use in a method of treating dyslipidemia is XGTFISEYSIAibNleEKIKQQEFVEWLLAQKPSSGAPPPS-2xAEEAc+yGlu-C18- diacid/18K; SEQ ID NO:12; GIP(3-30)+Cex(31-39) [E3Glutaric acid(X);D9E;A13Aib; M14Nle;D15E;H18K;D21E;N24E], or a functional variant thereof comprising 1, 2 or 3 individual amino acid substitutions.
- the peptide for use in a method of inhibiting or reducing any one of i) food intake, ii) body weight, iii) fasting blood levels of glucose, iv) fasting blood levels of insulin, v) insulin resistance, vi) fasting blood levels of triglycerides, vii) fasting blood levels of cholesterol and viii) fasting blood levels of low-density lipoprotein (LDL) cholesterol, and/or for use in a method of treating obesity, obesity-related disorders and/or dyslipidemia is XGTFISEYSIAibl_EKIKQQEFVEWLLAQKPSSGAPPPS-C16- diacid/18K; SEQ ID NO:11 ; GIP(3-30)+Cex(31-39) [E3Glutaric acid(X);D9E;A13Aib;M14L;D15E;H18K; D21 E;N24E], or a functional variant thereof comprising 1, 2 or 3 individual amino acid substitutions.
- Overweight and obesity are defined as abnormal or excessive fat accumulation that presents a risk to health.
- a body mass index (BMI) over 25 is considered overweight, and over 30 is obese.
- Obesity is a complex disease involving an excessive amount of body fat. Obesity increases the risk of other diseases and health problems, such as heart disease, diabetes, high blood pressure and certain cancers.
- An individual is usually considered to be obese if they have a body mass index (BMI) of 30 kg/m 2 or more, for example 35 kg/m 2 or more, such as 40 kg/m 2 or more.
- BMI body mass index
- An individual is usually considered to be overweight if they have an BMI of 25 to ⁇ 30.
- an individual is obese if they have a BMI of 25 kg/m 2 or more, such as 30 kg/m 2 or more, for example 35 kg/m 2 or more, such as 40 kg/m 2 or more.
- an individual is considered Class 1 obese if they have an BMI of 30 to ⁇ 35. In some embodiments of the present disclosure an individual is considered Class 2 obese if they have an BMI of 35 to ⁇ 40.
- an individual is considered Class 3 obese if they have an BMI of >40.
- Class 3 obesity is sometimes categorized as “severe” obesity.
- an individual is considered obese if they have a BMI of >25 and having one or more obesity-related disorders (co-morbidities).
- an individual is considered to be obese if they have a waist circumference of 380 cm for women or of 394 cm for men.
- the obesity-related disorder of the present disclosure is binge eating.
- the obesity-related disorder of the present disclosure is selected from the group consisting of heart disease, stroke, high blood pressure, high blood cholesterol, high blood low-density lipoprotein (LDL) cholesterol, high blood triglycerides, dyslipidemia, gallbladder disease and gallstones, NAFLD (non-alcoholic fatty liver disease) and NASH (non-alcoholic steatohepatitis), osteoarthritis, gout, breathing problems such as sleep apnea and asthma, insulin resistance and diabetes mellitus.
- LDL blood low-density lipoprotein
- the obesity-related disorder of the present disclosure is diabetes mellitus, Type II.
- the obesity-related disorder of the present disclosure is dyslipidemia.
- the present disclosure provides a treatment for an obesity-related disorder in an individual who has normal body weight, in an individual who is overweight or in an individual who is obese.
- Individuals who are not obese or overweight may for other reasons be suffering from an obesity-related disorder such as those referred to herein including any one of heart disease, stroke, high blood pressure, high blood cholesterol, high blood low-density lipoprotein (LDL) cholesterol, high blood triglycerides, dyslipidemia, gallbladder disease and gallstones, NAFLD (non alcoholic fatty liver disease) and NASH (non-alcoholic steatohepatitis), osteoarthritis, gout, breathing problems such as sleep apnea and asthma, insulin resistance and diabetes mellitus.
- an obesity-related disorder such as those referred to herein including any one of heart disease, stroke, high blood pressure, high blood cholesterol, high blood low-density lipoprotein (LDL) cholesterol, high blood triglycerides, dyslipidemia, gallbladder disease and gallstones
- the present disclosure provides a treatment, such as an optimized GIPR antagonist GIP peptide as defined herein alone or in combination with a GLP-1 R agonist for use in treating one or more of heart disease, stroke, high blood pressure, high blood cholesterol, high blood low-density lipoprotein (LDL) cholesterol, high blood triglycerides, dyslipidemia, gallbladder disease and gallstones, NAFLD (non-alcoholic fatty liver disease) and NASH (non-alcoholic steatohepatitis), osteoarthritis, gout, breathing problems such as sleep apnea and asthma, insulin resistance and diabetes mellitus.
- a treatment such as an optimized GIPR antagonist GIP peptide as defined herein alone or in combination with a GLP-1 R agonist for use in treating one or more of heart disease, stroke, high blood pressure, high blood cholesterol, high blood low-density lipoprotein (LDL) cholesterol, high blood triglycerides, dyslipidemia, gallbladder disease and gallstones
- the peptide(s) or composition for use according to the present disclosure is for treatment of an obesity-related disorder in an overweight individual.
- the peptide(s) or composition for use according to the present disclosure is for treatment of an obesity-related disorder in an obese individual.
- the peptide(s) or composition for use according to the present disclosure is for treatment of an obesity-related disorder in an individual with a BMI of 18 to 25.
- the peptide(s) or composition for use according to the present disclosure is for treatment of an obesity-related disorder in an individual with a BMI of >25.
- the peptide(s) or composition for use according to the present disclosure is for treatment of an obesity-related disorder in an individual with a BMI of 30 to ⁇ 35.
- the peptide(s) or composition for use according to the present disclosure is for treatment of an obesity-related disorder in an individual with a BMI of 35 to ⁇ 40.
- the peptide(s) or composition for use according to the present disclosure is for treatment of an obesity-related disorder in an individual with a BMI of >40.
- the peptide(s) or composition for use according to the present disclosure is for treatment of an obesity-related disorder in an individual with a waist circumference of 380 cm for women or of 394 cm for men.
- the present disclosure in one embodiment concerns a GIPR antagonist GIP peptide consisting of amino acid sequence SEQ ID NO: 1 :
- the GIPR antagonist GIP peptides of the present disclosure have a sequence based on native human GIP3-30, and the numbering of the amino acid residues of the native hGIP has been kept for the GIPR antagonist GIP peptide.
- the residue at position 3 is actually the first residue of the GIPR antagonist GIP peptides of the present disclosure (residue at position 1 in the official sequence listing).
- the Lysine at position 18, which is used for attachment of a fatty acid is actually the residue at position 16 in the official sequence listing.
- the GIPR antagonist GIP peptide according to present disclosure are characterized by having higher solubility, higher physical stability and/or improved antagonistic properties compared to native hGIP, and as compared to hGIP3-30.
- the GIP peptide according to the present disclosure is such that Xi of SEQ ID NO:1 is E. In some embodiments, the GIP peptide according to the present disclosure is such that Xi of SEQ ID NC is glutaric acid.
- the GIP peptide according to the present disclosure, or the variant thereof is such that x 2 of SEQ ID NO:1 is L.
- the GIP peptide according to the present disclosure, or the variant thereof is such that x 2 of SEQ ID NO:1 is Nle.
- the GIP peptide according to the present disclosure, or the variant thereof is such that Xi of SEQ ID NO:1 is E and x 2 of SEQ ID NO:1 is L.
- the GIP peptide according to the present disclosure is such that Xi of SEQ ID NO:1 is glutaric acid and x 2 of SEQ ID NO:1 is L
- the GIP peptide according to the present disclosure, or the variant thereof is such that Xi of SEQ ID NO:1 is glutaric acid and x 2 of SEQ ID NO:1 is Nle.
- the amino acid sequence of said functional variant of the GIP peptide according to the present disclosure differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 3 individual amino acid substitutions.
- the amino acid sequence of said functional variant of the GIP peptide according to the present disclosure differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 2 individual amino acid substitutions.
- the amino acid sequence of said functional variant of the GIP peptide according to the present disclosure differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 1 amino acid substitution.
- the amino acid sequence of said functional variant of the GIP peptide according to the present disclosure differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 1 , 2 or 3 individual conservative amino acid substitutions.
- the amino acid sequence of said functional variant of the GIP peptide according to the present disclosure differs from SEQ ID NO:1 in that the amino acid sequence of the variant comprises 1 , 2 or 3 individual amino acid substitutions at any one of positions 4 to 8, 10 to 13, 16, 17, 19, 20, 22, 23, 25 to 39 of SEQ ID NO:1.
- the GIPR antagonist GIP peptide according to the present disclosure is selected from the group consisting of:
- EGTFISEYSIAibMEKIKQQDFVEWLLAQKPSSGAPPPS SEQ ID NO:2; GIP(3-30) [D9E;A13Aib;D15E;H18K;N24E],
- EGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS SEQ ID NO:6; GIP(3-30) [D9E;A13Aib;M14L;D15E;H18K;D21 E;N24E],
- EGTFISEYSIAibNIeEKIKQQEFVEWLLAQKPSSGAPPPS SEQ ID NO:7; GIP(3-30) [D9E;A13Aib;M14Nle;D15E;H18K; D21E;N24E],
- EGTFISEYSIALEKIKQQEFVEWLLAQKPSSGAPPPS SEQ ID NO:8; GIP(3-30) [D9E;M14L;D15E;H18K; D21E;N24E],
- EGTFISEYSIANIeEKIKQQEFVEWLLAQKPSSGAPPPS SEQ ID NO:9; GIP(3-30) [D9E;M14Nle;D15E;H18K;D21E;N24E],
- EGTFISEYSIAibLEKIKQQDFVEWLLAQKPSSGAPPPS SEQ ID NO:10; GIP(3-30) [D9E;A13Aib;M14L;D15E;H18K;N24E]
- XGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS SEQ ID NO:11 ; GIP(3-30) [E3Glutaric acid(X);D9E;A13Aib; M14L;D15E;H18K;D21E;N24E], XGTFISEYSIAibNIeEKIKQQEFVEWLLAQKPSSGAPPPS; SEQ ID NO:12; GIP(3-30) [E3Glutaric acid(X);D9E;A13Aib; M14Nle;D15E;H18K;D21E;N24E], XGTFISEYSIALEKIKQQEFVEWLLAQKPSSGAPPPS; SEQ ID NO: 13; GIP(3-30) [E3Glutaric acid(X);D9E; M14L;D15E;H18K;D21E;N24E], XGTFISEYSIAibMEKIKQQEFVEWLLAQKPSSGAPPPS;
- EGTFISEYSIAibMEKIKQQDFVEWLLAQKPSSGAPPPS SEQ ID NO:2; GIP(3-30) [D9E,A13Aib;D15E;H18K;N24E],
- XGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS SEQ ID NO:20; GIP(3-30) [E3Succinic acid(X);D9E;A13Aib; M14L;D15E;H18K;D21E;N24E], and XGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS; SEQ ID NO:21; GIP(3-30) [E3Adipic acid(X);D9E;A13Aib; M14L;D15E;H18K;D21E;N24E], or a functional variant thereof comprising 1, 2 or 3 individual amino acid substitutions.
- the GIPR antagonist GIP peptide according to the present disclosure is selected from the group consisting of:
- EGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS SEQ ID NO:6; GIP(3-30) [D9E;A13Aib;M14L;D15E;H18K; D21E;N24E],
- XGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS SEQ ID NO:11; GIP(3-30) [E3Glutaric acid(X);D9E;A13Aib;M14L;D15E;H18K;D21E;N24E], XGTFISEYSIAibNIeEKIKQQEFVEWLLAQKPSSGAPPPS; SEQ ID NO:12; GIP(3-30) [E3Glutaric acid(X);D9E;A13Aib;M14Nle;D15E;H18K;D21E;N24E], or a functional variant thereof comprising 1, 2 or 3 individual amino acid substitutions.
- the GIPR antagonist GIP peptide according to the present disclosure is C-terminally carboxylated (-COOH).
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein the fatty acid molecule is a straight-chain fatty acid. In some embodiments, the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein the fatty acid molecule is a branched fatty acid. In some embodiments, the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein the fatty acid molecule is a diacyl fatty acid molecule.
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein said fatty acid molecule comprises an acyl group of the formula CH 3 (CH 2 ) n CO-, wherein n is in an integer from 4 to 24.
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein said fatty acid molecule comprises one or more acyl groups selected from the group consisting of CH 3 (CH 2 ) 6 CO-, CH 3 (CH 2 ) 8 CO-, CH 3 (CH 2 ) 10 CO-, CH 3 (CH 2 ) 12 CO-, CH 3 (CH 2 ) 14 CO-, CH 3 (CH 2 ) 16 CO-, CH 3 (CH 2 ) 18 CO-, CH 3 (CH 2 ) 20 CO- and CH 3 (CH 2 ) 22 CO-.
- acyl groups selected from the group consisting of CH 3 (CH 2 ) 6 CO-, CH 3 (CH 2 ) 8 CO-, CH 3 (CH 2 ) 10 CO-, CH 3 (CH 2 ) 12 CO-, CH 3 (CH 2 ) 14 CO-, CH 3 (CH 2 ) 16 CO-, CH 3 (CH 2 ) 18 CO-, CH 3 (CH 2 ) 20 CO- and CH 3 (CH 2 ) 22 CO
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein said fatty acid molecule comprises an acyl group selected from the group consisting of CH3(CH2) IO CO- (lauryl, C12), CH 3 (CH 2 )i2CO- (myristoyl, C14), CH 3 (CH 2 ) I CO- (palmitoyl, C16), CH 3 (CH 2 ) 16 CO- (stearyl, C18), CH 3 (CH 2 ) 18 CO- (arachidyl, C20) and CH 3 (CH 2 ) 20 CO- (behenyl, C22).
- acyl group selected from the group consisting of CH3(CH2) IO CO- (lauryl, C12), CH 3 (CH 2 )i2CO- (myristoyl, C14), CH 3 (CH 2 ) I CO- (palmitoyl, C16), CH 3 (CH 2 ) 16 CO- (stearyl, C18), CH 3 (CH 2 ) 18
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein said fatty acid molecule comprises two acyl groups individually selected from the group consisting of HOOC-CH 3 (CH 2 ) IO CO- (dodecanoyl, C12), HOOC-CH 3 (CH 2 ) 12 CO- (1-tetradecanoyl, C14), HOOC- CH 3 (CH 2 ) 14 CO- (hexadecanoyl, C16), HOOC-CH 3 (CH 2 ) 15 CO- (15-carboxy- pentadecanoyl, C17), HOOC-CH 3 (CH 2 )i 6 CO- (octadecanoyl, C18), HOOC-
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein said fatty acid molecule comprises an acyl group of the formula COOH(CH2)nCO- (dicarboxylic acid), wherein n is an integer from 4 to 24.
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein said fatty acid molecule comprises an acyl group selected from the group consisting of COOH(CH 2 )i 4 CO-, COOH(CH 2 )i 6 CO-, COOH(CH 2 ) I8 CO- and COOH(CH 2 ) 2 oCO-.
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein said fatty acid molecule comprises or consists of COOH(CH2)i4CO-.
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein said fatty acid molecule comprises or consists of COOH(CH2)i6CO-.
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein said fatty acid molecule comprises or consists of COOH(CH2)i8CO-.
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein said fatty acid molecule is attached to the side chain amino group of a lysine residue at position 18 of SEQ ID NO: 1 , or a variant of SEQ ID NO:1.
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein said fatty acid molecule is attached to the side chain amino group of an ornithine residue at position 18 of SEQ ID NO: 1 , or a variant of SEQ I D NO: 1.
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein said fatty acid molecule is attached to the side chain amino group of the amino acid residue at position 18 of SEQ I D NO: 1 , or a variant of SEQ I D NO: 1 , via a linker.
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein the fatty acid molecule is attached to an amino acid residue of SEQ ID NO:1, or a variant thereof, via a linker in such a way that a carboxyl group of the fatty acid molecule forms an amide bond with an amino group of the linker.
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid molecule attached to an amino acid residue of SEQ ID NO:1 , or a variant thereof, via a linker, wherein said linker comprises one or more moieties individually selected from the group consisting of: a. a-amino acid, y-amino acid or w-amino acid, b. one or more amino acids selected from the group consisting of succinic acid, Lys, Glu, Asp, c. one or more amino acids selected from the group consisting of Gly and Ser, d. one or more amino acids selected from the group consisting of Ala, Glu, Lys and Leu, e.
- a linker comprises one or more moieties individually selected from the group consisting of: a. a-amino acid, y-amino acid or w-amino acid, b. one or more amino acids selected from the group consisting of succinic acid, Lys, Glu, Asp
- y-aminobutanoyl y-aminobutyric acid
- g-Glu g-glutamic acid
- b-Asp b-asparagyl
- b-Ala b-alanyl
- 2-aminoisobutyric acid Aib and Gly
- n is an integer between 1 and 50, such as an integer between 1-4, 1-3 or 1-2.
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid molecule attached to an amino acid residue of SEQ ID NO:1, or a variant thereof, via a linker, wherein said linker comprises a g-Glu, one or more 8-amino-3,6-dioxaoctanoic acid (AEEAc), or combinations thereof, for example wherein said linker comprises or consists of a [8-amino-3,6-dioxaoctanoic acid] n (AEEAc) n , wherein n is an integer between 1 and 50, such as an integer between 1-2, 2-3, 3-4, 4-5, 5-6, 6-7, 7-8, 8-9, 9-10, 10-11, 11-12, 12-13, 13-14, 14-15, 15-20, 20-25, 25-30, 30-35, 35-40, 40-45, 45-50, preferably wherein n is 1, 2 or 3.
- AEEAc 8-amino-3,6-dioxa
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid molecule attached to an amino acid residue of SEQ ID NO:1 , or a variant thereof, via a linker, wherein said linker comprises or consists of a g-Glu and two AEEAc.
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid molecule attached to an amino acid residue of SEQ ID NO:1, or a variant thereof, via a linker, wherein said linker comprises or consists of Y-Glu-AEEAc-AEEAc.
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein the fatty acid molecule is attached to the side chain amino group of the amino acid residue at position 18 of SEQ ID NO: 1 , or said functional variant thereof, via a linker, and wherein the combination of linker and fatty acid molecule is selected from the group consisting of: i. Hexadecanoyl-y-Glu- ii. Hexadecanoyl-Y-Glu-y-Glu- iii. Hexadecanoyl-y-Glu-AEEAc- iv. Hexadecanoyl-y-Glu-AEEAc-AEEAc- v.
- Octadecanoyl-Y-Glu- xii Octadecanoyl-Y-Glu-Y-Glu- xiii. Octadecanoyl-Y-Glu-AEEAc- xiv. Octadecanoyl-Y-Glu-AEEAc-AEEAc- xv. Octadecanoyl-Y-Glu-AEEAc-AEEAc- xvi. [17-carboxy-heptadecanoyl]-Y-Glu- xvii. [17-carboxy-heptadecanoyl]-Y-Glu-Y-Glu- xviii.
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein the fatty acid molecule is attached to the side chain amino group of the amino acid residue at position 18 of SEQ I D NO: 1 , or said functional variant thereof, via a linker, and wherein the combination of linker and fatty acid molecule is [17-carboxy-heptadecanoyl]-Y-Glu-AEEAc-AEEAc-.
- the GIPR antagonist GIP peptide according to the present disclosure comprises a fatty acid, wherein the fatty acid molecule is attached to the side chain amino group of the amino acid residue at position 18 of SEQ I D NO: 1 , or said functional variant thereof, directly, that is without a linker or spacer, and wherein the fatty acid is selected from the group consisting of: i. [15-Carboxy pentadecanoyl], and ii. [17-carboxy-heptadecanoyl]
- the GIPR antagonist GIP peptide according to the present disclosure is selected from the group consisting of:
- the GIPR antagonist GIP peptide according to the present disclosure is selected from the group consisting of: i. EGTFISEYSIAibl_EKIKQQEFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO:6; GIP(3-30)+Cex(31-39) [D9E;A13Aib;M14L;D15E;H18K;D21E;N24E], ii.
- the GIPR antagonist GIP peptide according to the present disclosure is: EGTFISEYSIAibl_EKIKQQEFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO:6; GIP(3-30)+Cex(31-39) [D9E;A13Aib;M14L;D15E;H18K;D21E;N24E], or a functional variant thereof comprising 1, 2 or 3 individual amino acid substitutions.
- the GIPR antagonist GIP peptide according to the present disclosure is: XGTFISEYSIAibNIeEKIKQQEFVEWLLAQKPSSGAPPPS- 2xAEEAc+yGlu-C18-diacid/18K; SEQ ID NO:12; GIP(3-30)+Cex(31-39) [E3Glutaric acid(X);D9E;A13Aib; M14Nle;D15E;H18K;D21E;N24E], or a functional variant thereof comprising 1, 2 or 3 individual amino acid substitutions.
- the GIPR antagonist GIP peptide according to the present disclosure is: XGTFISEYSIAibl_EKIKQQEFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: 11 ; GIP(3-30)+Cex(31-39) [E3Glutaric acid(X);D9E;A13Aib;M14L;D15E; H18K;D21E;N24E], or a functional variant thereof comprising 1, 2 or 3 individual amino acid substitutions.
- GLP-1 receptor agonists In some embodiments the GIPR antagonist GIP peptide according to the present disclosure is co-administered with a GLP-1 receptor (GLP-1 R) agonist.
- GLP-1 R GLP-1 receptor
- said GLP-1 receptor agonist is a non peptide GLP-1 receptor agonist.
- said GLP-1 receptor agonist is a small molecule GLP-1 R agonist.
- cyclobutane-derivative-based non-peptidic agonists for GLP-1 R including Boc5 and its newly discovered analogue WB4-24.
- said small molecule GLP-1 receptor agonist is selected from the group consisting of Boc5, WB4-24, OWL833, TT-OAD2, LY3502970 and PF 06882961.
- said GLP-1 receptor agonist is a GLP- 1 receptor activating antibody.
- said GLP-1 R agonist is an agonist of the GLP-1 receptor. In some embodiments said GLP-1 R agonist is an agonist of only the GLP-1 receptor. some embodiments said GLP-1 R agonist is an agonist of mainly the GLP-1 receptor some embodiments said GLP-1 R agonist is an agonist of the GLP-1 receptor, and one or more additional receptors. In some embodiments of the present disclosure, said GLP-1 receptor agonist is a dual acting GLP-1 receptor agonist. In some embodiments of the present disclosure, said GLP-1 receptor agonist is a dual agonist of the GLP-1 receptor and an additional receptor. These may be peptide-based or non-peptide based. In some embodiments of the present disclosure, said GLP-1 receptor agonist is a triple acting GLP-1 receptor agonist. In some embodiments of the present disclosure, said GLP-1 receptor agonist is a triple agonist of the GLP-1 receptor and two additional receptors.
- said GLP-1 receptor agonist is a GLP- 1 R/glucagon dual agonist.
- said GLP-1 receptor agonist is a peptide GLP-1 receptor agonist.
- said GLP-1 receptor agonist is a GLP- 1 peptide.
- said GLP-1 peptide is a protease- resistant analogue of hGLP-1 (human GLP-1 ; SEQ ID NO:32).
- said GLP-1 peptide is selected from the group consisting of exenatide (SEQ ID NO:22), Lixisenatide (SEQ ID NO:23), albiglutide (SEQ ID NO:24), liraglutide (SEQ ID NO:25), taspoglutide (SEQ ID NO:26), dulaglutide (SEQ ID NO:27), semaglutide (SEQ ID NO:19), efpeglenatide, exendin-4 (Ex4; SEQ ID NO:22), Ex4(1-30) (SEQ ID NO:29), Ex4(9-39) (SEQ ID NO:30), Ex(9- 30) (SEQ ID NO:28), hGLP-1 (1-37) (SEQ ID NO:32), hGLP-1 (7-36) (SEQ ID NO:33), hGLP-1 (7-37) (SEQ ID NO:34), hGLP-1 (1-36) (SEQ ID NO:35), hGLP-1 (9-36),
- said GLP-1 peptide is hGLP-1 (7-37), or a variant thereof, such as a variant having one or two individual amino acid substitutions, such as a variant having two individual amino acid substitutions, and optionally comprising a fatty acid molecule.
- said variant has one or two individual amino acid substitutions at positions 8 and 34.
- said GLP-1 peptide is (Arg34)hGLP- 1(7-37): 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22
- said GLP-1 peptide is (Arg34)hGLP- 1(7-37) comprising a fatty acid molecule attached to the lysine at position 26, or a variant thereof, such as a variant having one amino acid substitution. In one embodiment said variant has an amino acid substitution at position 8.
- said GLP-1 peptide is (Arg34)hGLP-1(7- 37) comprising a fatty acid molecule attached to the lysine at position 26.
- said GLP-1 peptide is liraglutide.
- Liraglutide is a GLP-1 receptor agonist and its chemical structure is N26- (Hexadecanoyl-gamma-glutamyle)-(Arg34)GLP-1-(7-37)-peptide.
- said GLP-1 peptide is (Aib8)(Arg34)hGLP-1(7-37) comprising a fatty acid molecule attached to the lysine at position 26.
- said GLP-1 peptide is semaglutide.
- said GLP-1 peptide is a liquid formulation of semaglutide.
- said GLP-1 peptide is a solid oral dosage form composition of semaglutide.
- Semaglutide is a GLP-1 receptor agonist and its chemical structure is N-epsilon26-[2- (2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butyrylamino]ethoxy ⁇ ethoxy)acetylamino]ethoxy ⁇ ethoxy)a cetyl][A/Jb8,Arg34]GLP-1 (7-37) as disclosed in e.g. US 8,129,343.
- the amino acid sequence of semaglutide differs from that of human GLP-1 because it is a truncated analogue, and has two amino acid substitutions at positions 8 and 34, and the lysine at position 26 is acylated with stearic diacid (C-18 fatty diacid chain) via a spacer, corresponding to modified residue: N-epsilon26-[2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4- carboxy-4-(17- carboxyheptadecanoylamino)butyrylamino]ethoxy ⁇ ethoxy)acetylamino]ethoxy ⁇ ethoxy)a cetyl].
- the GIPR antagonist GIP peptide of the present disclosure is selected from the group consisting of:
- the GIPR antagonist GIP peptide is selected from the group consisting of:
- the GIPR antagonist GIP peptide is selected from the group consisting of:
- the GIPR antagonist GIP peptide is selected from the group consisting of:
- the GIPR antagonist GIP peptide is selected from the group consisting of: EGTFISEYSIAibl_EKIKQQEFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: EGTFISEYSIAibl_EKIKQQEFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: EGTFISEYSIAibl_EKIKQQEFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID
- GIP(3-30)+Cex(31-39) [E3Glutaric acid(X);D9E;A13Aib;M14L;D15E;H18K; D21E;N24E], or a functional variant thereof comprising 1, 2 or 3 individual amino acid substitutions; and wherein the GLP-1 receptor agonist is (Arg34)hGLP-1(7-37) (SEQ ID NO:25), or a variant thereof, such as variant having one individual amino acid substitution, and optionally comprising a fatty acid molecule; or such as a variant comprising a fatty acid molecule.
- the GIPR antagonist GIP peptide is selected from the group consisting of:
- GIP GIP(3-30)+Cex(31-39) [E3Glutaric acid(X);D9E;A13Aib;M14L;D15E;H18K; D21E;N24E], or a functional variant thereof comprising 1, 2 or 3 individual amino acid substitutions; and wherein the GLP-1 receptor agonist is (Arg34)hGLP-1(7-37) (SEQ ID NO:25) comprising a fatty acid molecule attached to the lysine at position 26 of said (SEQ ID NO:25), or a variant thereof, such as a variant having one individual amino acid substitution. In one embodiment said variant has an amino acid substitution at position 8.
- the GIPR antagonist GIP peptide is selected from the group consisting of:
- the GIPR antagonist GIP peptide is selected from the group consisting of:
- the GIPR antagonist GIP peptide is EGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO:6; GIP(3-30)+Cex(31-39) [D9E;A13Aib;M14L;D15E;H18K;D21E;N24E] or a functional variant thereof comprising 1 , 2 or 3 individual amino acid substitutions, and wherein the GLP-1 receptor agonist is semaglutide.
- the GIPR antagonist GIP peptide is XGTFISEYSIAibNleEKIKQQEFVEWLLAQKPSSGAPPPS-2xAEEAc+yGlu-C18- diacid/18K; SEQ ID NO:12; GIP(3-30)+Cex(31-39) [E3Glutaric acid(X);D9E;A13Aib; M14Nle;D15E;H18K;D21E;N24E] or a functional variant thereof comprising 1, 2 or 3 individual amino acid substitutions, and wherein the GLP-1 receptor agonist is semaglutide.
- the GIPR antagonist GIP peptide is XGTFISEYSIAibl_EKIKQQEFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: 11 ; GIP(3-30)+Cex(31-39)
- bioactive agents of the present disclosure Whilst it is possible for the bioactive agents of the present disclosure to be administered as the raw chemicals (e.g. peptides), it is sometimes preferred to present them in the form of a pharmaceutical formulation.
- a pharmaceutical formulation may be referred to as a pharmaceutical composition, pharmaceutically acceptable composition or pharmaceutically safe composition.
- a pharmaceutical formulation which comprises one or more bioactive agents of the present disclosure, or a pharmaceutically acceptable salt or ester thereof, and a pharmaceutically acceptable carrier, excipient and/or diluent.
- the pharmaceutical formulations may be prepared by conventional techniques, e.g. as described in Remington: The Science and Practice of Pharmacy 2005, Lippincott, Williams & Wilkins.
- salts of the instant peptide compounds are also intended to be covered by this disclosure. These salts will be ones which are acceptable in their application to a pharmaceutical use. By that it is meant that the salt will retain the biological activity of the parent compound and the salt will not have untoward or deleterious effects in its application and use in treating diseases.
- compositions are prepared in a standard manner. If the parent compound is a base it may for example be treated with an excess of an organic or inorganic acid in a suitable solvent. If the parent compound is an acid, it may for example be treated with an inorganic or organic base in a suitable solvent.
- a pharmaceutical formulation or a pharmaceutical composition according to the present disclosure comprises a GIPR antagonist GIP peptide, a GLP-1 receptor agonist, or both a GIPR antagonist GIP peptide and a GLP-1 receptor agonist according to the present disclosure.
- the present disclosure relates to combination therapy of a GIPR antagonist GIP peptide and a GLP-1 receptor agonist.
- the GIPR antagonist GIP peptide and the GLP-1 receptor agonist are present in the same pharmaceutical formulation.
- the GIPR antagonist GIP peptide and the GLP-1 receptor agonist are present in two different pharmaceutical formulations, which may administered simultaneously, sequentially or separately to an individual in need thereof.
- a GIP peptide, a GLP-1 receptor agonist, or a composition comprising a GIP peptide and/or a GLP-1 receptor agonist as defined herein is administered to an individual in need of treatment in pharmaceutically effective doses or a therapeutically effective amount.
- the dosage requirements will vary with the particular drug composition employed, the route of administration and the particular subject being treated, which depend on the severity and the sort of the disorder as well as on the weight and general state of the subject. It will also be recognized by one skilled in the art that the optimal quantity and spacing of individual dosages of a peptide compound will be determined by the nature and extent of the condition being treated, the form, route and site of administration, and the particular patient being treated, and that such optima can be determined by conventional techniques.
- each of the bioactive agents are administered at least once daily, such as once daily.
- each of the bioactive agents are administered in intermittent intervals, or intervals, whereby a dose is not administered every day.
- one or more doses are administered once every second day, every third day, every fourth day, every fifth day, every sixth day, every week, every second week, every third week, every fourth week, every month, every fifth week, every sixth week, or intervals within those ranges (such as every 2 to 4 weeks, or 4 to 6 weeks).
- a dose is administered once every week, such as once weekly, such as in one dose per week.
- a dose of the GIPR antagonist GIP peptide of the present disclosure is administered at least once daily, such as once daily, such as once each second day, such as once each third day, such as once each fourth day, such as once each fifth day, such as once each sixth day, such as once weekly, such as once each second week (biweekly), such as once monthly.
- a dose of the GIPR antagonist GIP peptide of the present disclosure is administered once daily.
- a dose of the GIPR antagonist GIP peptide of the present disclosure is administered once weekly.
- a dose of the GIPR antagonist GIP peptide of the present disclosure is administered once each second week.
- a dose of the GIPR antagonist GIP peptide of the present disclosure is administered once monthly.
- a dose of the GLP-1 receptor agonist of the present disclosure is administered continuously, such as at least once daily, such as once daily, such as once each second day, such as once each third day, such as once each fourth day, such as once each fifth day, such as once each sixth day, such as once weekly, such as once each second week, such as once monthly.
- a dose of the GLP-1 receptor agonist of the present disclosure is administered once daily.
- a dose of the GLP-1 receptor agonist of the present disclosure is administered once weekly.
- a dose of the GLP-1 receptor agonist of the present disclosure is administered once each second week (biweekly dosage).
- the GIPR antagonist GIP peptide according to the present disclosure is administered at a dosage of about 15 nmol/kg, such as about 20 nmol/kg, such as about 25 nmol/kg, such as about 30 nmol/kg, such as about 35 nmol/kg, such as about 40 nmol/kg, such as about 45 nmol/kg, such as about 50 nmol/kg, such as about 55 nmol/kg, such as about 60 nmol/kg, such as about 65 nmol/kg, such as about 70 nmol/kg, such as about 75 nmol/kg, such as about 80 nmol/kg, such as about 85 nmol/kg, such as about 90 nmol/kg, such as about 95 nmol/kg, such as about 100 nmol/kg, such as about 110 nmol/kg, such as about 120 nmol/kg, such as about 125 nmol/kg, such as about 150 nmol/kg, such as about 175 nmol/kg
- said dose of the GIPR antagonist GIP peptide according to the present disclosure is administered at a daily dosage, at a weekly dosage, at a biweekly dosage or at a monthly dosage.
- the GIPR antagonist GIP peptide according to the present disclosure is administered at a once weekly dosage of about 15 nmol/kg, such as about 20 nmol/kg, such as about 25 nmol/kg, such as about 30 nmol/kg, such as about 35 nmol/kg, such as about 40 nmol/kg, such as about 45 nmol/kg, such as about 50 nmol/kg, such as about 55 nmol/kg, such as about 60 nmol/kg, such as about 65 nmol/kg, such as about 70 nmol/kg, such as about 75 nmol/kg, such as about 80 nmol/kg, such as about 85 nmol/kg, such as about 90 nmol/kg, such as about 95 nmol/kg, such as about 100 nmol/kg
- the GIPR antagonist GIP peptide according to the present disclosure is administered at a dosage of 15 to 20 nmol/kg, such as 20 to 25 nmol/kg, such as 25 to 30 nmol/kg, such as 30 to 35 nmol/kg, such as 35 to 40 nmol/kg, such as 40 to 45 nmol/kg, such as 45 to 50 nmol/kg, such as 50 to 60 nmol/kg, such as 60 to 70 nmol/kg, such as 70 to 80 nmol/kg, such as 80 to 90 nmol/kg, such as 90 to 100 nmol/kg, such as 100 to 125 nmol/kg, such as 125 to 150 nmol/kg, such as 150 to 175 nmol/kg, such as 175 to 200 nmol/kg, such as 200 to 250 nmol/kg, such as 250 to 300 nmol/kg, such as 300 to 350 nmol/kg, such as 350 to 400 nmol/kg, such as 400 to 450
- the GLP-1 receptor agonist of the present disclosure is administered at a dosage of about 5 pg/kg, such as about 10 pg/kg, such as about 15 pg/kg, such as about 20 pg/kg, such as about 25 pg/kg, such as about 30 pg/kg, such as about 40 pg/kg, such as about 50 pg/kg, such as about 75 pg/kg, such as about 100 pg/kg, such as about 200 pg/kg, such as about 300 pg/kg, such as about 400 pg/kg, such as about 500 pg/kg, such as about 600 pg/kg, such as about 700 pg/kg, such as about 800 pg/kg, such as about 900 pg/kg, such as about 1 mg/kg, such as about 5 mg/kg, such as about 10 mg/kg, such as about 25 mg/kg, such as about 50 mg/kg, such as about 100 mg/kg.
- said dose such as about 5
- the GLP-1 receptor agonist of the present disclosure is administered at a dosage of 5 to 10 pg/kg, such as 10 to 15 pg/kg, such as 15 to 20 pg/kg, such as 20 to 25 pg/kg, such as 25 to 30 pg/kg, such as 30 to 40 pg/kg, such as 40 to 50 pg/kg, such as 50 to 75 pg/kg, such as 75 to 100 pg/kg, such as 100 to 200 pg/kg, such as 200 to 300 pg/kg, such as 300 to 400 pg/kg, such as 400 to 500 pg/kg, such as 500 to 600 pg/kg, such as 600 to 700 pg/kg, such as 700 to 800 pg/kg, such as 800 to 900 pg/kg, such as 900 to 1 mg/kg, such as 1 to 5 mg/kg, such as 5 to 10 mg/kg, such as 10 to 25 mg/kg, such as 25 to 50 mg/kg, such
- said dose of the GLP-1 receptor agonist according to the present disclosure is administered at a daily dosage, at a weekly dosage, at a biweekly dosage or at a monthly dosage.
- a dose of the GLP-1 receptor agonist is administered at a daily dosage of about 300 pg/kg, such as about 400 pg/kg.
- a dose of the GLP-1 receptor agonist is administered separately from a dose of the GIP peptide.
- a dose of the GLP-1 receptor agonist may be administered on the same day, but at a different point in time of the dose of the GIP peptide.
- a dose of the GLP-1 receptor agonist may be administered on a different day than a dose of the GIP peptide.
- a dose of the GLP-1 receptor agonist is administered separately from a dose of the GIP peptide, such that the GLP-1 receptor agonist and the GIP peptide are contained in separate compositions.
- a dose of the GLP-1 receptor agonist is administered simultaneously with a dose of the GIP peptide. Simultaneously encompass at essentially the same time and exactly at the same time. Simultaneous administration encompass wherein the two components are comprised in the same composition.
- a dose of the GLP-1 receptor agonist and the GIP peptide are administered sequentially, such as administering the GLP-1 R agonist prior to or after administration of a dose of the GIP peptide.
- the preferred route of administration will depend on the general condition and age of the subject to be treated, the nature of the condition to be treated, the location of the tissue to be treated in the body and the active ingredient chosen, but may for example be subcutaneous.
- the route of administration is capable of introducing the bioactive agents into the blood stream to ultimately target the sites of desired action.
- Such routes of administration are any suitable routes, such as an enteral route (including the oral, rectal, nasal, pulmonary, buccal, sublingual, transdermal, intracisternal and intraperitoneal administration), and/or a parenteral route (including subcutaneous, intramuscular, intrathecal, intracerebral, intravenous and intradermal administration).
- enteral route including the oral, rectal, nasal, pulmonary, buccal, sublingual, transdermal, intracisternal and intraperitoneal administration
- parenteral route including subcutaneous, intramuscular, intrathecal, intracerebral, intravenous and intradermal administration.
- Parenteral administration is any administration route not being the oral/enteral route whereby the medicament avoids first-pass degradation in the liver. Accordingly, parenteral administration includes any injections and infusions, for example bolus injection or continuous infusion, such as intravenous administration, intramuscular administration or subcutaneous administration. Furthermore, parenteral administration includes inhalations and topical administration.
- the bioactive agents may be administered topically to cross any mucosal membrane of an animal to which the biologically active substance is to be given, e.g. in the nose, vagina, eye, mouth, genital tract, lungs, gastrointestinal tract, or rectum, preferably the mucosa of the nose, or mouth, and accordingly, parenteral administration may also include buccal, sublingual, nasal, rectal, vaginal and intraperitoneal administration as well as pulmonal and bronchial administration by inhalation or installation. Also, the agents may be administered topically to cross the skin.
- the GIP peptide and/or the GLP-1 receptor agonist are administered subcutaneously.
- the GIP peptide and/or the GLP-1 receptor agonist are administered systemically.
- the GIP peptide and/or the GLP-1 receptor agonists are administered by infusion.
- the GIP peptide and/or the GLP-1 receptor agonists are administered by injection.
- the GIP peptide and/or the GLP-1 receptor agonists are administered parenterally, including subcutaneous, intramuscular, intrathecal, intracerebral, intravenous and intradermal administration. Local treatment
- the bioactive agent according to the invention may in one embodiment be used as a local treatment, i.e. be introduced directly to the site(s) of action. Accordingly, the bioactive agent may be applied to the skin or mucosa directly, or the bioactive agent may be injected into the site of action, for example into the diseased tissue or to an end artery leading directly to the diseased tissue. These administration forms preferably avoid the blood brain barrier. Examples
- GIP peptides GIPR antagonist GIP peptides:
- Compound 1 EGTFISEYSIAibl_EKIKQQEFVEWLLAQKPSSGAPPPS-C16-diacid/18K (GIP(3-30)+Cex(31-39) [D9E;A13Aib;M14L;D15E;H18K;D21E;N24E]), which corresponds to SEQ ID NO:6 with a C 16-diacid attached at the side chain of the Lysine at position 16 (18K if the numbering of native human GIP is considered).
- GLP-1 agonist liraglutide
- the cynomolgus monkey efficacy study was performed by Kunming Biomed International (KBI) in China. The study was approved by KBI’s Institutional Animal Care and Use Committee.
- High fat diet (HFD) induced obese cynomolgus monkeys Macaca fascicularis, male, >7.5 kg, fasting glucose ⁇ 90 mg/dL, fasting insulin ⁇ 60 pU/mL, >8 years of age) were obtained from KBI’s stock colony. Lighting in animal holding rooms was maintained on 12:12 hour lighLdark cycle, and the ambient temperature and humidity range was set at 18-29 degrees C and 30 to 90%, respectively.
- the monkeys were individually housed in cages arranged to allow visual and auditory contacts with conspecifics. The monkeys were provided with cage toys for environmental enrichment to ensure adequate welfare and psychological well-being.
- the cynomolgus monkeys were acclimated/trained to experimental procedures for three weeks followed by one week with continued training and introduction of ad libitum HFD prior to start of treatment.
- the monkeys were randomly sorted into six separate dose groups with 10 animals each based on acclimation data sets.
- Body weights were measured every third to fourth day during the study period.
- the monkeys were non-sedated and were transferred into small transfer cages and transported to a weighing scale.
- the tare weights of the transfer cages were determined prior to weighing the monkeys inside the transfer cages.
- the monkeys were weighed twice inside the transfer cages and recordings were made to the nearest 0.1 kg.
- Serum was separated by centrifugation at 2500 x g for 10 min at 4 °C.
- Insulin, CTX and PTH levels were analyzed using the Cobas e411 Immunology analyzer. Other parameters were analyzed using the Roche C311 or C501 biochemical analyzer.
- the placebo group had a total average weight gain of 9% on the last treatment day (day 42) whereas mono-treatments with Compound 1 or Compound 2 maintained body weight during the study period, demonstrating clear efficacy of both mono-treatments.
- Treatment with liraglutide resulted in a total average weight loss of 4% and treatment with Compound 1 + liraglutide and Compound 2 + liraglutide resulted in average total weight losses of 8% and 9% (17% and 18% vs placebo), respectively.
- Weight-loss is well known to cause improvements in insulin sensitivity and lipid profiles, and it is therefore often difficult to assess whether a drug directly affects these parameters in the presence of weight-loss.
- the obese NHPs treated with monotherapy of Compound 1 or Compound 2 were protected against the weight-gain observed in the placebo-treated animals and importantly, resulted in no change in weight throughout the study period. This is important for the interpretation of the following data.
- HOMA-IR Homeostatic Model Assessment for Insulin Resistance
- EGTFISEYSIAibMEKIKQQDFVEWLLAQKPSSGAPPPS SEQ ID NO:2; GIP(3-30) [D9E;A13Aib;D15E;H18K;N24E],
- EGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS SEQ ID NO:6; GIP(3-30) [D9E;A13Aib;M14L;D15E;H18K; D21E;N24E],
- EGTFISEYSIAibLEKIKQQDFVEWLLAQKPSSGAPPPS SEQ ID NO:10; GIP(3-30) [D9E;A13Aib;M14L;D15E;H18K;N24E],
- XGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS SEQ ID NO:11 ; GIP(3-30) [E3Glutaric acid(X);D9E;A13Aib; M14L;D15E;H18K;D21E;N24E], XGTFISEYSIAibNIeEKIKQQEFVEWLLAQKPSSGAPPPS; SEQ ID NO:12; GIP(3-30) [E3Glutaric acid(X);D9E;A13Aib; M14Nle;D15E;H18K;D21E;N24E], XGTFISEYSIALEKIKQQEFVEWLLAQKPSSGAPPPS; SEQ ID NO: 13; GIP(3-30) [E3Glutaric acid(X);D9E; M14L;D15E;H18K;D21 E;N24E],
- XGTFISEYSIAibMEKIKQQEFVEWLLAQKPSSGAPPPS SEQ ID NO:14; GIP(3-30) [E3Glutaric acid(X);D9E;A13Aib;D15E;H18K;D21E;N24E], EGTFISEYSIAibMEKIKQQEFVEWLLAQKPSSGAPPPS; SEQ ID NO:15; GIP(3- 30)[D9E;A13Aib;D15E;H18K; D21E;N24E],
- EGTFISEYSIAMEKIKQQEFVEWLLAQKPSSGAPPPS SEQ ID NO: 16; GIP(3-30) [D9E;D15E;H18K; D21E;N24E],
- EGTFISEYSIAibLDKIKQQDFVEWLLAQKPSSGAPPPS SEQ ID NO:17; GIP(3-30) [D9E;A13Aib; M14L;H18K;N24E], XGTFISDYSIAibMDKIKQQDFVEWLLAQKPSSGAPPPS; SEQ ID NO:18; GIP(3-30) [E3Glutaric acid(X);A13Aib;H18K;N24E],
- HA/JbEGTFTSDVSSYLEGQAAKEFIAWLVRGRG SEQ ID NO: 19; semaglutide, XGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS; SEQ ID NO:20; GIP(3-30) [E3Succinic acid(X);D9E;A13Aib; M14L;D15E;H18K;D21E;N24E], XGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS; SEQ ID NO:21; GIP(3-30) [E3Adipic acid(X);D9E;A13Aib; M14L;D15E;H18K;D21E;N24E], HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS; SEQ ID NO:22; exenatide,
- HGEGX1FX2SDVSSYLEGQAAKEFX3DAWLVKGR SEQ ID NO:24; albiglutide [X ! is allo-threonine; X2 is allo-threonine; X3IS alle (allo-isoleucine)], HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG; SEQ ID NO:25; liraglutide; HX ! EGTFTSDVSSYLEGQAAKEFIAWLV ⁇ R; SEQ ID NO:26; taspoglutide [X ! is Aib; X 2 is Aib],
- HAEATFTSDVSSYLEGQAAKEFIAWLVKGR SEQ ID NO:28; A10-hGLP-1(7-36), HGEGTFTSDLSKQMEEEAVRLFIEWLKNGG; SEQ ID NO:29; Ex4(1-30),
- DLSKQM EEEAVRLFI EWLKNGGPSSGAPPPS SEQ ID NO:30; Ex4(9-39), DLSKQMEEEAVRLFIEWLKNGG; SEQ ID NO:31; Ex4(9-30), HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG; SEQ ID NO:32; hGLP-1 (same as hGLP-1 (1-37)),
- HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR SEQ ID NO:33; hGLP-1 (7-36), HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG; SEQ ID NO:34; hGLP-1 (7-37), HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR; SEQ ID NO:35; hGLP-1(1-36), EGTFTSDVSSYLEGQAAKEFIAWLVKGR; SEQ ID NO:36; hGLP-1(9-36), AAEGTFTSDVSSYLEGQAAKEFIAWLVKGR; SEQ ID NO:37; A7-hGLP- 1(7-36), EGTFISEYSIAMEKIKQQDFVEWLLAQKPSSGAPPPS; SEQ ID NO:38; GIP(3- 30)+Cex(31 -39) [D9E;D15E; H 18K; N24E]
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Endocrinology (AREA)
- Diabetes (AREA)
- Zoology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Hematology (AREA)
- Obesity (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Biochemistry (AREA)
- Toxicology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Vascular Medicine (AREA)
- Child & Adolescent Psychology (AREA)
- Emergency Medicine (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Dermatology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Plant Substances (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US18/565,984 US20240277813A1 (en) | 2021-06-10 | 2022-06-10 | Treatment of obesity and obesity-related disorders |
| JP2023575695A JP2024521398A (ja) | 2021-06-10 | 2022-06-10 | 肥満及び肥満関連障害の治療 |
| IL309128A IL309128A (en) | 2021-06-10 | 2022-06-10 | Treatment of obesity and obesity-related disorders |
| CA3221661A CA3221661A1 (en) | 2021-06-10 | 2022-06-10 | Treatment of obesity and obesity-related disorders |
| KR1020247000556A KR20240021212A (ko) | 2021-06-10 | 2022-06-10 | 비만 및 비만-관련 장애의 치료 |
| AU2022289247A AU2022289247A1 (en) | 2021-06-10 | 2022-06-10 | Treatment of obesity and obesity-related disorders |
| EP22733387.9A EP4351630A1 (en) | 2021-06-10 | 2022-06-10 | Treatment of obesity and obesity-related disorders |
| CN202280040922.8A CN117881415A (zh) | 2021-06-10 | 2022-06-10 | 肥胖症和肥胖症相关障碍的治疗 |
| MX2023014740A MX2023014740A (es) | 2021-06-10 | 2022-06-10 | Tratamiento de la obesidad y trastornos relacionados con la obesidad. |
| BR112023024968A BR112023024968A2 (pt) | 2021-06-10 | 2022-06-10 | Tratamento da obesidade e distúrbios relacionados à obesidade |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP21178712.2 | 2021-06-10 | ||
| EP21178712 | 2021-06-10 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022258805A1 true WO2022258805A1 (en) | 2022-12-15 |
Family
ID=76502668
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2022/065826 Ceased WO2022258805A1 (en) | 2021-06-10 | 2022-06-10 | Treatment of obesity and obesity-related disorders |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US20240277813A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4351630A1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2024521398A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20240021212A (cg-RX-API-DMAC7.html) |
| CN (1) | CN117881415A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2022289247A1 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112023024968A2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3221661A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL309128A (cg-RX-API-DMAC7.html) |
| MX (1) | MX2023014740A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2022258805A1 (cg-RX-API-DMAC7.html) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025136071A1 (ko) * | 2023-12-19 | 2025-06-26 | 한미약품 주식회사 | 에페글레나타이드를 유효성분으로 포함하는 약학 조성물 및 이의 투여 요법 |
| US12378237B2 (en) | 2021-09-27 | 2025-08-05 | Terns Pharmaceuticals, Inc. | Compounds as GLP-1R agonists |
| US12410163B2 (en) | 2022-02-23 | 2025-09-09 | Terns Pharmaceuticals, Inc. | Compounds as GLP-IR agonists |
| WO2025189141A1 (en) | 2024-03-08 | 2025-09-12 | Annapurna Bio, Inc. | Methods for treating obesity and increasing weight loss |
| US12486261B2 (en) | 2021-10-25 | 2025-12-02 | Terns Pharmaceuticals, Inc. | Compounds as GLP-1R agonists |
| US12485118B2 (en) | 2023-04-07 | 2025-12-02 | Terns Pharmaceuticals, Inc. | Combinations of GLP-1R and THRβ agonists and methods of use thereof |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2026046202A1 (zh) * | 2024-08-26 | 2026-03-05 | 博瑞生物医药(苏州)股份有限公司 | Glp-1/gip肽或含有其的药物组合物的用途 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006086769A2 (en) * | 2005-02-11 | 2006-08-17 | Amylin Pharmaceuticals, Inc. | Gip analog and hybrid polypeptides with selectable properties |
| US8129343B2 (en) | 2005-03-18 | 2012-03-06 | Novo Nordisk A/S | Acylated GLP-1 compounds |
| WO2020115048A1 (en) * | 2018-12-03 | 2020-06-11 | Antag Therapeutics Aps | Modified gip peptide analogues |
| WO2021110845A1 (en) * | 2019-12-03 | 2021-06-10 | Antag Therapeutics Aps | Optimized gip peptide analogues |
-
2022
- 2022-06-10 CA CA3221661A patent/CA3221661A1/en active Pending
- 2022-06-10 WO PCT/EP2022/065826 patent/WO2022258805A1/en not_active Ceased
- 2022-06-10 KR KR1020247000556A patent/KR20240021212A/ko active Pending
- 2022-06-10 AU AU2022289247A patent/AU2022289247A1/en active Pending
- 2022-06-10 US US18/565,984 patent/US20240277813A1/en active Pending
- 2022-06-10 IL IL309128A patent/IL309128A/en unknown
- 2022-06-10 CN CN202280040922.8A patent/CN117881415A/zh active Pending
- 2022-06-10 JP JP2023575695A patent/JP2024521398A/ja active Pending
- 2022-06-10 BR BR112023024968A patent/BR112023024968A2/pt unknown
- 2022-06-10 MX MX2023014740A patent/MX2023014740A/es unknown
- 2022-06-10 EP EP22733387.9A patent/EP4351630A1/en active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006086769A2 (en) * | 2005-02-11 | 2006-08-17 | Amylin Pharmaceuticals, Inc. | Gip analog and hybrid polypeptides with selectable properties |
| US8129343B2 (en) | 2005-03-18 | 2012-03-06 | Novo Nordisk A/S | Acylated GLP-1 compounds |
| WO2020115048A1 (en) * | 2018-12-03 | 2020-06-11 | Antag Therapeutics Aps | Modified gip peptide analogues |
| WO2021110845A1 (en) * | 2019-12-03 | 2021-06-10 | Antag Therapeutics Aps | Optimized gip peptide analogues |
Non-Patent Citations (4)
| Title |
|---|
| "Remington: The Science and Practice of Pharmacy", 2005, LIPPINCOTT, WILLIAMS & WILKINS |
| IRWIN ET AL., DIABETES OBES METAB, vol. 11, no. 6, June 2009 (2009-06-01), pages 603 - 10 |
| J. BIOL. CHEM., vol. 243, 1969, pages 3552 - 59 |
| WEST ET AL., PLOS ONE, vol. 16, no. 3, 31 March 2021 (2021-03-31) |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12378237B2 (en) | 2021-09-27 | 2025-08-05 | Terns Pharmaceuticals, Inc. | Compounds as GLP-1R agonists |
| US12378238B2 (en) | 2021-09-27 | 2025-08-05 | Terns Pharmaceuticals, Inc. | Compounds as GLP-1R agonists |
| US12378236B2 (en) | 2021-09-27 | 2025-08-05 | Terns Pharmaceuticals, Inc. | Compounds as GLP-1R agonists |
| US12378239B2 (en) | 2021-09-27 | 2025-08-05 | Terns Pharmaceuticals, Inc. | Compounds as GLP-1R agonists |
| US12522596B2 (en) | 2021-09-27 | 2026-01-13 | Terns Pharmaceuticals, Inc. | Compounds as GLP-1R agonists |
| US12486261B2 (en) | 2021-10-25 | 2025-12-02 | Terns Pharmaceuticals, Inc. | Compounds as GLP-1R agonists |
| US12410163B2 (en) | 2022-02-23 | 2025-09-09 | Terns Pharmaceuticals, Inc. | Compounds as GLP-IR agonists |
| US12485118B2 (en) | 2023-04-07 | 2025-12-02 | Terns Pharmaceuticals, Inc. | Combinations of GLP-1R and THRβ agonists and methods of use thereof |
| WO2025136071A1 (ko) * | 2023-12-19 | 2025-06-26 | 한미약품 주식회사 | 에페글레나타이드를 유효성분으로 포함하는 약학 조성물 및 이의 투여 요법 |
| WO2025189141A1 (en) | 2024-03-08 | 2025-09-12 | Annapurna Bio, Inc. | Methods for treating obesity and increasing weight loss |
Also Published As
| Publication number | Publication date |
|---|---|
| MX2023014740A (es) | 2024-03-13 |
| JP2024521398A (ja) | 2024-05-31 |
| IL309128A (en) | 2024-02-01 |
| BR112023024968A2 (pt) | 2024-02-20 |
| US20240277813A1 (en) | 2024-08-22 |
| AU2022289247A1 (en) | 2023-12-21 |
| CN117881415A (zh) | 2024-04-12 |
| CA3221661A1 (en) | 2022-12-15 |
| KR20240021212A (ko) | 2024-02-16 |
| EP4351630A1 (en) | 2024-04-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240277813A1 (en) | Treatment of obesity and obesity-related disorders | |
| TWI700291B (zh) | 升糖素及glp-1共激動劑化合物 | |
| AU2017322277B2 (en) | Amylin analogues | |
| JP5645339B2 (ja) | 摂食行動の修正 | |
| AU2014345570B2 (en) | Glucagon-GLP-1-GIP triple agonist compounds | |
| EP4549454A2 (en) | Gip/glp1 co-agonist compounds | |
| JP2023071869A (ja) | グルカゴンおよびglp-1受容体の長時間作用型コアゴニスト | |
| JP2017537894A (ja) | Glp−1rおよびglp−2r二重アゴニスト活性を有する組成物及びペプチド | |
| EP3065767A2 (en) | Gip-glp-1 dual agonist compounds and methods | |
| AU2014345569A1 (en) | GIP-GLP-1 dual agonist compounds and methods | |
| CA2979950A1 (en) | Amylin analogues | |
| JP2025000663A (ja) | ヒトアミリンアナログペプチド及び使用方法 | |
| CN117603337A (zh) | 酰化胃泌酸调节素肽类似物 | |
| CA3230915A1 (en) | New peptides as potent and selective gip receptor agonists | |
| WO2024149820A1 (en) | Nmu receptor 2 agonists | |
| WO2021133644A1 (en) | Stapled triazole co-agonists of the glucagon and glp-1 receptors | |
| Kurkin et al. | Physiology and pharmacology of glucagon-like peptide-1 receptor | |
| HK40101394A (zh) | 酰化胃泌酸调节素肽类似物 | |
| HK40106360A (zh) | 酰化胃泌酸调节素肽类似物 | |
| US20230285514A1 (en) | Stapled lactam co-agonists of the glucagon and glp-1 receptors | |
| EP3842449A1 (en) | Stapled olefin co-agonists of the glucagon and glp-1 receptors | |
| HK40046538B (en) | Gip/glp1 co-agonist compounds | |
| WO2014027049A1 (en) | Therapeutic uses of dogfish glucagon and analogues thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22733387 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 806101 Country of ref document: NZ Ref document number: 2022289247 Country of ref document: AU Ref document number: AU2022289247 Country of ref document: AU |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112023024968 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3221661 Country of ref document: CA Ref document number: 309128 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2023575695 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280040922.8 Country of ref document: CN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2023/014740 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2022289247 Country of ref document: AU Date of ref document: 20220610 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202309107T Country of ref document: SG |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202417000428 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 20247000556 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020247000556 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024100299 Country of ref document: RU Ref document number: 2022733387 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022733387 Country of ref document: EP Effective date: 20240110 |
|
| ENP | Entry into the national phase |
Ref document number: 112023024968 Country of ref document: BR Kind code of ref document: A2 Effective date: 20231128 |