WO2022238505A1 - Anticorps à domaine unique spécifique de h2ax phosphorylé et ses utilisations - Google Patents
Anticorps à domaine unique spécifique de h2ax phosphorylé et ses utilisations Download PDFInfo
- Publication number
- WO2022238505A1 WO2022238505A1 PCT/EP2022/062831 EP2022062831W WO2022238505A1 WO 2022238505 A1 WO2022238505 A1 WO 2022238505A1 EP 2022062831 W EP2022062831 W EP 2022062831W WO 2022238505 A1 WO2022238505 A1 WO 2022238505A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acid
- single domain
- domain antibody
- h2ax
- Prior art date
Links
- 108010003723 Single-Domain Antibodies Proteins 0.000 title claims abstract description 122
- 101150044041 h2ax gene Proteins 0.000 title 1
- 230000026731 phosphorylation Effects 0.000 claims abstract description 10
- 238000006366 phosphorylation reaction Methods 0.000 claims abstract description 10
- 230000005778 DNA damage Effects 0.000 claims abstract description 9
- 231100000277 DNA damage Toxicity 0.000 claims abstract description 9
- 102100034533 Histone H2AX Human genes 0.000 claims abstract description 9
- 101001067891 Homo sapiens Histone H2AX Proteins 0.000 claims abstract description 7
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims abstract description 5
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 claims abstract description 5
- 210000004027 cell Anatomy 0.000 claims description 209
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 48
- 150000001413 amino acids Chemical class 0.000 claims description 47
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 46
- 238000000034 method Methods 0.000 claims description 35
- 238000006467 substitution reaction Methods 0.000 claims description 32
- 230000014509 gene expression Effects 0.000 claims description 26
- 238000012217 deletion Methods 0.000 claims description 21
- 230000037430 deletion Effects 0.000 claims description 21
- 238000007792 addition Methods 0.000 claims description 20
- 150000001875 compounds Chemical class 0.000 claims description 17
- 150000007523 nucleic acids Chemical class 0.000 claims description 15
- 239000013604 expression vector Substances 0.000 claims description 14
- 102000037865 fusion proteins Human genes 0.000 claims description 14
- 108020001507 fusion proteins Proteins 0.000 claims description 14
- 229910052717 sulfur Inorganic materials 0.000 claims description 14
- 238000010166 immunofluorescence Methods 0.000 claims description 13
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 12
- 206010028980 Neoplasm Diseases 0.000 claims description 12
- 229910052757 nitrogen Inorganic materials 0.000 claims description 11
- 108020004707 nucleic acids Proteins 0.000 claims description 11
- 102000039446 nucleic acids Human genes 0.000 claims description 11
- 238000002965 ELISA Methods 0.000 claims description 10
- 102000000070 Sodium-Glucose Transport Proteins Human genes 0.000 claims description 10
- 108010080361 Sodium-Glucose Transport Proteins Proteins 0.000 claims description 10
- 229910052700 potassium Inorganic materials 0.000 claims description 10
- 230000006229 amino acid addition Effects 0.000 claims description 8
- 238000003556 assay Methods 0.000 claims description 8
- 201000011510 cancer Diseases 0.000 claims description 8
- 108091006047 fluorescent proteins Proteins 0.000 claims description 8
- 102000034287 fluorescent proteins Human genes 0.000 claims description 8
- 230000010076 replication Effects 0.000 claims description 8
- 238000012360 testing method Methods 0.000 claims description 8
- 238000012216 screening Methods 0.000 claims description 7
- -1 mCitrine Proteins 0.000 claims description 6
- 238000001262 western blot Methods 0.000 claims description 6
- 102000004190 Enzymes Human genes 0.000 claims description 5
- 108090000790 Enzymes Proteins 0.000 claims description 5
- 239000005090 green fluorescent protein Substances 0.000 claims description 5
- 230000012743 protein tagging Effects 0.000 claims description 5
- 108010048367 enhanced green fluorescent protein Proteins 0.000 claims description 4
- 230000006698 induction Effects 0.000 claims description 4
- 238000001114 immunoprecipitation Methods 0.000 claims description 3
- 230000001225 therapeutic effect Effects 0.000 claims description 3
- YMHOBZXQZVXHBM-UHFFFAOYSA-N 2,5-dimethoxy-4-bromophenethylamine Chemical compound COC1=CC(CCN)=C(OC)C=C1Br YMHOBZXQZVXHBM-UHFFFAOYSA-N 0.000 claims description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 2
- 108091005944 Cerulean Proteins 0.000 claims description 2
- 108091005960 Citrine Proteins 0.000 claims description 2
- 108010043121 Green Fluorescent Proteins Proteins 0.000 claims description 2
- 102000004144 Green Fluorescent Proteins Human genes 0.000 claims description 2
- 241000545067 Venus Species 0.000 claims description 2
- 239000008186 active pharmaceutical agent Substances 0.000 claims description 2
- 238000002487 chromatin immunoprecipitation Methods 0.000 claims description 2
- 239000011035 citrine Substances 0.000 claims description 2
- 238000000684 flow cytometry Methods 0.000 claims description 2
- 108010021843 fluorescent protein 583 Proteins 0.000 claims description 2
- 238000010859 live-cell imaging Methods 0.000 claims description 2
- 229910052720 vanadium Inorganic materials 0.000 claims description 2
- 108091005957 yellow fluorescent proteins Proteins 0.000 claims description 2
- 101150098207 NAAA gene Proteins 0.000 claims 2
- 102000006830 Luminescent Proteins Human genes 0.000 claims 1
- 108010047357 Luminescent Proteins Proteins 0.000 claims 1
- 231100000696 potential genotoxic effect Toxicity 0.000 claims 1
- 230000004543 DNA replication Effects 0.000 abstract description 4
- 108090000623 proteins and genes Proteins 0.000 description 77
- 235000018102 proteins Nutrition 0.000 description 67
- 102000004169 proteins and genes Human genes 0.000 description 67
- 235000001014 amino acid Nutrition 0.000 description 39
- 230000027455 binding Effects 0.000 description 36
- 238000011282 treatment Methods 0.000 description 36
- 229940024606 amino acid Drugs 0.000 description 35
- 229940079593 drug Drugs 0.000 description 33
- 239000003814 drug Substances 0.000 description 33
- 210000004940 nucleus Anatomy 0.000 description 30
- 108010001441 Phosphopeptides Proteins 0.000 description 27
- 239000000427 antigen Substances 0.000 description 21
- 238000010361 transduction Methods 0.000 description 21
- 230000026683 transduction Effects 0.000 description 20
- 238000004458 analytical method Methods 0.000 description 19
- 102000036639 antigens Human genes 0.000 description 19
- 108091007433 antigens Proteins 0.000 description 19
- 238000011534 incubation Methods 0.000 description 18
- 238000001514 detection method Methods 0.000 description 17
- 108091026890 Coding region Proteins 0.000 description 16
- 239000013598 vector Substances 0.000 description 15
- 238000001890 transfection Methods 0.000 description 14
- 230000003436 cytoskeletal effect Effects 0.000 description 13
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 12
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 12
- 231100000024 genotoxic Toxicity 0.000 description 12
- 230000001738 genotoxic effect Effects 0.000 description 12
- 230000004048 modification Effects 0.000 description 12
- 238000012986 modification Methods 0.000 description 12
- 239000000872 buffer Substances 0.000 description 11
- 238000002474 experimental method Methods 0.000 description 11
- 238000012544 monitoring process Methods 0.000 description 11
- 102000004196 processed proteins & peptides Human genes 0.000 description 11
- 239000012634 fragment Substances 0.000 description 10
- 239000000463 material Substances 0.000 description 10
- 238000010186 staining Methods 0.000 description 10
- 229920001184 polypeptide Polymers 0.000 description 9
- 210000004899 c-terminal region Anatomy 0.000 description 8
- 239000003153 chemical reaction reagent Substances 0.000 description 8
- 239000000284 extract Substances 0.000 description 8
- 230000003053 immunization Effects 0.000 description 8
- 230000003993 interaction Effects 0.000 description 8
- 238000011002 quantification Methods 0.000 description 8
- 230000001105 regulatory effect Effects 0.000 description 8
- 108010033040 Histones Proteins 0.000 description 7
- 238000005516 engineering process Methods 0.000 description 7
- 238000002649 immunization Methods 0.000 description 7
- 239000013612 plasmid Substances 0.000 description 7
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 108060003951 Immunoglobulin Proteins 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 6
- 108091028043 Nucleic acid sequence Proteins 0.000 description 6
- 230000001580 bacterial effect Effects 0.000 description 6
- 230000015572 biosynthetic process Effects 0.000 description 6
- 239000013078 crystal Substances 0.000 description 6
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 6
- 238000004520 electroporation Methods 0.000 description 6
- 239000000499 gel Substances 0.000 description 6
- 102000018358 immunoglobulin Human genes 0.000 description 6
- 210000004962 mammalian cell Anatomy 0.000 description 6
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 6
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 6
- 230000004481 post-translational protein modification Effects 0.000 description 6
- 238000000746 purification Methods 0.000 description 6
- 230000028617 response to DNA damage stimulus Effects 0.000 description 6
- 239000011780 sodium chloride Substances 0.000 description 6
- 230000009870 specific binding Effects 0.000 description 6
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 6
- 102100033400 4F2 cell-surface antigen heavy chain Human genes 0.000 description 5
- 241000588724 Escherichia coli Species 0.000 description 5
- 102000006395 Globulins Human genes 0.000 description 5
- 108010044091 Globulins Proteins 0.000 description 5
- 101000800023 Homo sapiens 4F2 cell-surface antigen heavy chain Proteins 0.000 description 5
- 241001416177 Vicugna pacos Species 0.000 description 5
- 125000000539 amino acid group Chemical group 0.000 description 5
- 210000000805 cytoplasm Anatomy 0.000 description 5
- 239000007850 fluorescent dye Substances 0.000 description 5
- 238000003780 insertion Methods 0.000 description 5
- 230000037431 insertion Effects 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 5
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 4
- 108010077544 Chromatin Proteins 0.000 description 4
- 108020004414 DNA Proteins 0.000 description 4
- 102000006947 Histones Human genes 0.000 description 4
- 101000785063 Homo sapiens Serine-protein kinase ATM Proteins 0.000 description 4
- VSNHCAURESNICA-UHFFFAOYSA-N Hydroxyurea Chemical compound NC(=O)NO VSNHCAURESNICA-UHFFFAOYSA-N 0.000 description 4
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 4
- 102100020824 Serine-protein kinase ATM Human genes 0.000 description 4
- 239000000090 biomarker Substances 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- 210000003483 chromatin Anatomy 0.000 description 4
- 238000010276 construction Methods 0.000 description 4
- 229960001330 hydroxycarbamide Drugs 0.000 description 4
- 238000010820 immunofluorescence microscopy Methods 0.000 description 4
- 229940072221 immunoglobulins Drugs 0.000 description 4
- 238000001727 in vivo Methods 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 230000033001 locomotion Effects 0.000 description 4
- 238000002823 phage display Methods 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 102100022900 Actin, cytoplasmic 1 Human genes 0.000 description 3
- 108010085238 Actins Proteins 0.000 description 3
- 239000012099 Alexa Fluor family Substances 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- 102100021935 C-C motif chemokine 26 Human genes 0.000 description 3
- 241000251730 Chondrichthyes Species 0.000 description 3
- 108020004635 Complementary DNA Proteins 0.000 description 3
- 102000005768 DNA-Activated Protein Kinase Human genes 0.000 description 3
- 108010006124 DNA-Activated Protein Kinase Proteins 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- 101000897493 Homo sapiens C-C motif chemokine 26 Proteins 0.000 description 3
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 3
- 241000283973 Oryctolagus cuniculus Species 0.000 description 3
- KDLHZDBZIXYQEI-UHFFFAOYSA-N Palladium Chemical compound [Pd] KDLHZDBZIXYQEI-UHFFFAOYSA-N 0.000 description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 3
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 3
- 239000012505 Superdex™ Substances 0.000 description 3
- 229920004890 Triton X-100 Polymers 0.000 description 3
- XMYKNCNAZKMVQN-NYYWCZLTSA-N [(e)-(3-aminopyridin-2-yl)methylideneamino]thiourea Chemical compound NC(=S)N\N=C\C1=NC=CC=C1N XMYKNCNAZKMVQN-NYYWCZLTSA-N 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 238000010804 cDNA synthesis Methods 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- WDDPHFBMKLOVOX-AYQXTPAHSA-N clofarabine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1F WDDPHFBMKLOVOX-AYQXTPAHSA-N 0.000 description 3
- 229960000928 clofarabine Drugs 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 238000002425 crystallisation Methods 0.000 description 3
- 230000008025 crystallization Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000029087 digestion Effects 0.000 description 3
- 230000005782 double-strand break Effects 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 229940088598 enzyme Drugs 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 3
- 229960005277 gemcitabine Drugs 0.000 description 3
- 229910052739 hydrogen Inorganic materials 0.000 description 3
- 239000001257 hydrogen Substances 0.000 description 3
- 238000010185 immunofluorescence analysis Methods 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 238000007431 microscopic evaluation Methods 0.000 description 3
- 239000000203 mixture Substances 0.000 description 3
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 3
- 238000001542 size-exclusion chromatography Methods 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 229960005526 triapine Drugs 0.000 description 3
- 238000012800 visualization Methods 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 2
- UFBJCMHMOXMLKC-UHFFFAOYSA-N 2,4-dinitrophenol Chemical compound OC1=CC=C([N+]([O-])=O)C=C1[N+]([O-])=O UFBJCMHMOXMLKC-UHFFFAOYSA-N 0.000 description 2
- 239000012103 Alexa Fluor 488 Substances 0.000 description 2
- 239000012109 Alexa Fluor 568 Substances 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 2
- 101150050673 CHK1 gene Proteins 0.000 description 2
- 241000282836 Camelus dromedarius Species 0.000 description 2
- 230000033616 DNA repair Effects 0.000 description 2
- 235000017274 Diospyros sandwicensis Nutrition 0.000 description 2
- 208000031448 Genomic Instability Diseases 0.000 description 2
- 239000007995 HEPES buffer Substances 0.000 description 2
- 101710195517 Histone H2AX Proteins 0.000 description 2
- 102100039869 Histone H2B type F-S Human genes 0.000 description 2
- 101001035372 Homo sapiens Histone H2B type F-S Proteins 0.000 description 2
- 108020004684 Internal Ribosome Entry Sites Proteins 0.000 description 2
- 241000282838 Lama Species 0.000 description 2
- 241000282842 Lama glama Species 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- GHAZCVNUKKZTLG-UHFFFAOYSA-N N-ethyl-succinimide Natural products CCN1C(=O)CCC1=O GHAZCVNUKKZTLG-UHFFFAOYSA-N 0.000 description 2
- HDFGOPSGAURCEO-UHFFFAOYSA-N N-ethylmaleimide Chemical compound CCN1C(=O)C=CC1=O HDFGOPSGAURCEO-UHFFFAOYSA-N 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 102000038030 PI3Ks Human genes 0.000 description 2
- 108091007960 PI3Ks Proteins 0.000 description 2
- 108090000526 Papain Proteins 0.000 description 2
- 108090000430 Phosphatidylinositol 3-kinases Proteins 0.000 description 2
- 229920002562 Polyethylene Glycol 3350 Polymers 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 2
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 2
- 108091081024 Start codon Proteins 0.000 description 2
- 238000000692 Student's t-test Methods 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- PZBFGYYEXUXCOF-UHFFFAOYSA-N TCEP Chemical compound OC(=O)CCP(CCC(O)=O)CCC(O)=O PZBFGYYEXUXCOF-UHFFFAOYSA-N 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 2
- 238000000137 annealing Methods 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 230000006399 behavior Effects 0.000 description 2
- 229940127093 camptothecin Drugs 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000036755 cellular response Effects 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 238000004624 confocal microscopy Methods 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 238000006471 dimerization reaction Methods 0.000 description 2
- 238000010494 dissociation reaction Methods 0.000 description 2
- 230000005593 dissociations Effects 0.000 description 2
- 239000000890 drug combination Substances 0.000 description 2
- 239000000975 dye Substances 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 239000012894 fetal calf serum Substances 0.000 description 2
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 2
- 238000002073 fluorescence micrograph Methods 0.000 description 2
- 238000000799 fluorescence microscopy Methods 0.000 description 2
- 239000012737 fresh medium Substances 0.000 description 2
- 238000003384 imaging method Methods 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 230000002427 irreversible effect Effects 0.000 description 2
- 238000002372 labelling Methods 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 230000014759 maintenance of location Effects 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 238000001000 micrograph Methods 0.000 description 2
- 238000000386 microscopy Methods 0.000 description 2
- 235000013336 milk Nutrition 0.000 description 2
- 239000008267 milk Substances 0.000 description 2
- 210000004080 milk Anatomy 0.000 description 2
- 238000010899 nucleation Methods 0.000 description 2
- 238000004091 panning Methods 0.000 description 2
- 229940055729 papain Drugs 0.000 description 2
- 235000019834 papain Nutrition 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- OXNIZHLAWKMVMX-UHFFFAOYSA-N picric acid Chemical compound OC1=C([N+]([O-])=O)C=C([N+]([O-])=O)C=C1[N+]([O-])=O OXNIZHLAWKMVMX-UHFFFAOYSA-N 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 230000009257 reactivity Effects 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- 235000017281 sodium acetate Nutrition 0.000 description 2
- 239000001632 sodium acetate Substances 0.000 description 2
- 238000007619 statistical method Methods 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 230000001052 transient effect Effects 0.000 description 2
- 238000003146 transient transfection Methods 0.000 description 2
- 230000014616 translation Effects 0.000 description 2
- 229950002929 trinitrophenol Drugs 0.000 description 2
- 230000007306 turnover Effects 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 1
- VGIRNWJSIRVFRT-UHFFFAOYSA-N 2',7'-difluorofluorescein Chemical compound OC(=O)C1=CC=CC=C1C1=C2C=C(F)C(=O)C=C2OC2=CC(O)=C(F)C=C21 VGIRNWJSIRVFRT-UHFFFAOYSA-N 0.000 description 1
- 150000003923 2,5-pyrrolediones Chemical class 0.000 description 1
- WFZBLOIXZRZEDG-YDALLXLXSA-N 3-(carbamoylamino)-5-(3-fluorophenyl)-n-[(3s)-piperidin-3-yl]thiophene-2-carboxamide;hydrochloride Chemical compound Cl.NC(=O)NC=1C=C(C=2C=C(F)C=CC=2)SC=1C(=O)N[C@H]1CCCNC1 WFZBLOIXZRZEDG-YDALLXLXSA-N 0.000 description 1
- AUDYZXNUHIIGRB-UHFFFAOYSA-N 3-thiophen-2-ylpyrrole-2,5-dione Chemical compound O=C1NC(=O)C(C=2SC=CC=2)=C1 AUDYZXNUHIIGRB-UHFFFAOYSA-N 0.000 description 1
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 1
- ILBKBRBXCXDCFB-UHFFFAOYSA-N 4-(1h-indol-2-yl)benzene-1,3-diamine Chemical compound NC1=CC(N)=CC=C1C1=CC2=CC=CC=C2N1 ILBKBRBXCXDCFB-UHFFFAOYSA-N 0.000 description 1
- ZBQCCTCQUCOXBO-UHFFFAOYSA-N 4-(4-aminophenyl)-2,2,6,6-tetramethylcyclohex-3-en-1-amine Chemical compound CC1(C)C(N)C(C)(C)CC(C=2C=CC(N)=CC=2)=C1 ZBQCCTCQUCOXBO-UHFFFAOYSA-N 0.000 description 1
- BZTDTCNHAFUJOG-UHFFFAOYSA-N 6-carboxyfluorescein Chemical compound C12=CC=C(O)C=C2OC2=CC(O)=CC=C2C11OC(=O)C2=CC=C(C(=O)O)C=C21 BZTDTCNHAFUJOG-UHFFFAOYSA-N 0.000 description 1
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 1
- WNDDWSAHNYBXKY-UHFFFAOYSA-N ATTO 425-2 Chemical compound CC1CC(C)(C)N(CCCC(O)=O)C2=C1C=C1C=C(C(=O)OCC)C(=O)OC1=C2 WNDDWSAHNYBXKY-UHFFFAOYSA-N 0.000 description 1
- YIXZUOWWYKISPQ-UHFFFAOYSA-N ATTO 565 para-isomer Chemical compound [O-]Cl(=O)(=O)=O.C=12C=C3CCC[N+](CC)=C3C=C2OC=2C=C3N(CC)CCCC3=CC=2C=1C1=CC(C(O)=O)=CC=C1C(O)=O YIXZUOWWYKISPQ-UHFFFAOYSA-N 0.000 description 1
- PWZJEXGKUHVUFP-UHFFFAOYSA-N ATTO 590 meta-isomer Chemical compound [O-]Cl(=O)(=O)=O.C1=2C=C3C(C)=CC(C)(C)N(CC)C3=CC=2OC2=CC3=[N+](CC)C(C)(C)C=C(C)C3=CC2=C1C1=CC=C(C(O)=O)C=C1C(O)=O PWZJEXGKUHVUFP-UHFFFAOYSA-N 0.000 description 1
- SLQQGEVQWLDVDF-UHFFFAOYSA-N ATTO 610-2 Chemical compound [O-]Cl(=O)(=O)=O.C1=C2CCC[N+](CCCC(O)=O)=C2C=C2C1=CC1=CC=C(N(C)C)C=C1C2(C)C SLQQGEVQWLDVDF-UHFFFAOYSA-N 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 235000002198 Annona diversifolia Nutrition 0.000 description 1
- 108010032595 Antibody Binding Sites Proteins 0.000 description 1
- 101100519158 Arabidopsis thaliana PCR2 gene Proteins 0.000 description 1
- 101800001415 Bri23 peptide Proteins 0.000 description 1
- 102400000107 C-terminal peptide Human genes 0.000 description 1
- 101800000655 C-terminal peptide Proteins 0.000 description 1
- 101100067721 Caenorhabditis elegans gly-3 gene Proteins 0.000 description 1
- 241000282832 Camelidae Species 0.000 description 1
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 1
- 101710132601 Capsid protein Proteins 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- VYZAMTAEIAYCRO-UHFFFAOYSA-N Chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 238000011537 Coomassie blue staining Methods 0.000 description 1
- 238000000116 DAPI staining Methods 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 230000007035 DNA breakage Effects 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- SHIBSTMRCDJXLN-UHFFFAOYSA-N Digoxigenin Natural products C1CC(C2C(C3(C)CCC(O)CC3CC2)CC2O)(O)C2(C)C1C1=CC(=O)OC1 SHIBSTMRCDJXLN-UHFFFAOYSA-N 0.000 description 1
- 108090000204 Dipeptidase 1 Proteins 0.000 description 1
- 241000255925 Diptera Species 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 1
- 241001198387 Escherichia coli BL21(DE3) Species 0.000 description 1
- 238000001134 F-test Methods 0.000 description 1
- 229920001917 Ficoll Polymers 0.000 description 1
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical compound FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 1
- 229910052688 Gadolinium Inorganic materials 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 102000053187 Glucuronidase Human genes 0.000 description 1
- 108010060309 Glucuronidase Proteins 0.000 description 1
- 229910052689 Holmium Inorganic materials 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000581326 Homo sapiens Mediator of DNA damage checkpoint protein 1 Proteins 0.000 description 1
- 101000742054 Homo sapiens Protein phosphatase 1D Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 102100034343 Integrase Human genes 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 239000007836 KH2PO4 Substances 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical group CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 239000006142 Luria-Bertani Agar Substances 0.000 description 1
- 229910052765 Lutetium Inorganic materials 0.000 description 1
- PWHULOQIROXLJO-UHFFFAOYSA-N Manganese Chemical compound [Mn] PWHULOQIROXLJO-UHFFFAOYSA-N 0.000 description 1
- ZOKXTWBITQBERF-AKLPVKDBSA-N Molybdenum Mo-99 Chemical compound [99Mo] ZOKXTWBITQBERF-AKLPVKDBSA-N 0.000 description 1
- 241000204031 Mycoplasma Species 0.000 description 1
- 229910020700 Na3VO4 Inorganic materials 0.000 description 1
- VEQPNABPJHWNSG-UHFFFAOYSA-N Nickel(2+) Chemical compound [Ni+2] VEQPNABPJHWNSG-UHFFFAOYSA-N 0.000 description 1
- 102000019040 Nuclear Antigens Human genes 0.000 description 1
- 108010051791 Nuclear Antigens Proteins 0.000 description 1
- 108010077850 Nuclear Localization Signals Proteins 0.000 description 1
- 102000007999 Nuclear Proteins Human genes 0.000 description 1
- 108010089610 Nuclear Proteins Proteins 0.000 description 1
- 108010047956 Nucleosomes Proteins 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 108010058846 Ovalbumin Proteins 0.000 description 1
- 101150102573 PCR1 gene Proteins 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 108700019535 Phosphoprotein Phosphatases Proteins 0.000 description 1
- 102000045595 Phosphoprotein Phosphatases Human genes 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 229910052777 Praseodymium Inorganic materials 0.000 description 1
- 229910052773 Promethium Inorganic materials 0.000 description 1
- 102100038675 Protein phosphatase 1D Human genes 0.000 description 1
- 239000012083 RIPA buffer Substances 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 229910052772 Samarium Inorganic materials 0.000 description 1
- BUGBHKTXTAQXES-UHFFFAOYSA-N Selenium Chemical compound [Se] BUGBHKTXTAQXES-UHFFFAOYSA-N 0.000 description 1
- 108091081021 Sense strand Proteins 0.000 description 1
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 208000007271 Substance Withdrawal Syndrome Diseases 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 239000005864 Sulphur Substances 0.000 description 1
- 102400001102 Tail peptide Human genes 0.000 description 1
- 101800000868 Tail peptide Proteins 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- ATJFFYVFTNAWJD-UHFFFAOYSA-N Tin Chemical compound [Sn] ATJFFYVFTNAWJD-UHFFFAOYSA-N 0.000 description 1
- 108700009124 Transcription Initiation Site Proteins 0.000 description 1
- YZCKVEUIGOORGS-NJFSPNSNSA-N Tritium Chemical compound [3H] YZCKVEUIGOORGS-NJFSPNSNSA-N 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 102000006275 Ubiquitin-Protein Ligases Human genes 0.000 description 1
- 108010083111 Ubiquitin-Protein Ligases Proteins 0.000 description 1
- 229910052769 Ytterbium Inorganic materials 0.000 description 1
- VWQVUPCCIRVNHF-OUBTZVSYSA-N Yttrium-90 Chemical compound [90Y] VWQVUPCCIRVNHF-OUBTZVSYSA-N 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O ammonium group Chemical group [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 239000012298 atmosphere Substances 0.000 description 1
- FOYVTVSSAMSORJ-UHFFFAOYSA-N atto 655 Chemical compound OC(=O)CCCN1C(C)(C)CC(CS([O-])(=O)=O)C2=C1C=C1OC3=CC4=[N+](CC)CCCC4=CC3=NC1=C2 FOYVTVSSAMSORJ-UHFFFAOYSA-N 0.000 description 1
- MHHMNDJIDRZZNT-UHFFFAOYSA-N atto 680 Chemical compound OC(=O)CCCN1C(C)(C)C=C(CS([O-])(=O)=O)C2=C1C=C1OC3=CC4=[N+](CC)CCCC4=CC3=NC1=C2 MHHMNDJIDRZZNT-UHFFFAOYSA-N 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 102000005936 beta-Galactosidase Human genes 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 102000006995 beta-Glucosidase Human genes 0.000 description 1
- 108010047754 beta-Glucosidase Proteins 0.000 description 1
- 102000006635 beta-lactamase Human genes 0.000 description 1
- 238000012742 biochemical analysis Methods 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 1
- 230000000711 cancerogenic effect Effects 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 230000007248 cellular mechanism Effects 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 229910052804 chromium Inorganic materials 0.000 description 1
- 239000011651 chromium Substances 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 230000008045 co-localization Effects 0.000 description 1
- 229910017052 cobalt Inorganic materials 0.000 description 1
- 239000010941 cobalt Substances 0.000 description 1
- GUTLYIVDDKVIGB-UHFFFAOYSA-N cobalt atom Chemical compound [Co] GUTLYIVDDKVIGB-UHFFFAOYSA-N 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 238000000942 confocal micrograph Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 239000004121 copper complexes of chlorophylls and chlorophyllins Substances 0.000 description 1
- 238000010219 correlation analysis Methods 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- QONQRTHLHBTMGP-UHFFFAOYSA-N digitoxigenin Natural products CC12CCC(C3(CCC(O)CC3CC3)C)C3C11OC1CC2C1=CC(=O)OC1 QONQRTHLHBTMGP-UHFFFAOYSA-N 0.000 description 1
- SHIBSTMRCDJXLN-KCZCNTNESA-N digoxigenin Chemical compound C1([C@@H]2[C@@]3([C@@](CC2)(O)[C@H]2[C@@H]([C@@]4(C)CC[C@H](O)C[C@H]4CC2)C[C@H]3O)C)=CC(=O)OC1 SHIBSTMRCDJXLN-KCZCNTNESA-N 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- RDYMFSUJUZBWLH-UHFFFAOYSA-N endosulfan Chemical compound C12COS(=O)OCC2C2(Cl)C(Cl)=C(Cl)C1(Cl)C2(Cl)Cl RDYMFSUJUZBWLH-UHFFFAOYSA-N 0.000 description 1
- 230000001973 epigenetic effect Effects 0.000 description 1
- 229960001904 epirubicin Drugs 0.000 description 1
- DEFVIWRASFVYLL-UHFFFAOYSA-N ethylene glycol bis(2-aminoethyl)tetraacetic acid Chemical compound OC(=O)CN(CC(O)=O)CCOCCOCCN(CC(O)=O)CC(O)=O DEFVIWRASFVYLL-UHFFFAOYSA-N 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 238000001125 extrusion Methods 0.000 description 1
- 235000013861 fat-free Nutrition 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 239000011737 fluorine Substances 0.000 description 1
- 229910052731 fluorine Inorganic materials 0.000 description 1
- UIWYJDYFSGRHKR-UHFFFAOYSA-N gadolinium atom Chemical compound [Gd] UIWYJDYFSGRHKR-UHFFFAOYSA-N 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- 238000009650 gentamicin protection assay Methods 0.000 description 1
- 229910052732 germanium Inorganic materials 0.000 description 1
- GNPVGFCGXDBREM-UHFFFAOYSA-N germanium atom Chemical compound [Ge] GNPVGFCGXDBREM-UHFFFAOYSA-N 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 230000003862 health status Effects 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- KJZYNXUDTRRSPN-UHFFFAOYSA-N holmium atom Chemical compound [Ho] KJZYNXUDTRRSPN-UHFFFAOYSA-N 0.000 description 1
- BHEPBYXIRTUNPN-UHFFFAOYSA-N hydridophosphorus(.) (triplet) Chemical compound [PH] BHEPBYXIRTUNPN-UHFFFAOYSA-N 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 229910052738 indium Inorganic materials 0.000 description 1
- APFVFJFRJDLVQX-UHFFFAOYSA-N indium atom Chemical compound [In] APFVFJFRJDLVQX-UHFFFAOYSA-N 0.000 description 1
- 239000012212 insulator Substances 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 210000003923 intranuclear space Anatomy 0.000 description 1
- 239000011630 iodine Substances 0.000 description 1
- 229910052740 iodine Inorganic materials 0.000 description 1
- 230000005865 ionizing radiation Effects 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Chemical group CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 238000011551 log transformation method Methods 0.000 description 1
- OHSVLFRHMCKCQY-UHFFFAOYSA-N lutetium atom Chemical compound [Lu] OHSVLFRHMCKCQY-UHFFFAOYSA-N 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 239000006249 magnetic particle Substances 0.000 description 1
- 229910052748 manganese Inorganic materials 0.000 description 1
- 239000011572 manganese Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- ZTLGJPIZUOVDMT-UHFFFAOYSA-N n,n-dichlorotriazin-4-amine Chemical compound ClN(Cl)C1=CC=NN=N1 ZTLGJPIZUOVDMT-UHFFFAOYSA-N 0.000 description 1
- 229910052754 neon Inorganic materials 0.000 description 1
- GKAOGPIIYCISHV-UHFFFAOYSA-N neon atom Chemical compound [Ne] GKAOGPIIYCISHV-UHFFFAOYSA-N 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 229910001453 nickel ion Inorganic materials 0.000 description 1
- 210000000633 nuclear envelope Anatomy 0.000 description 1
- 238000012758 nuclear staining Methods 0.000 description 1
- 230000025308 nuclear transport Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 210000001623 nucleosome Anatomy 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 230000030648 nucleus localization Effects 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 230000010355 oscillation Effects 0.000 description 1
- 229940092253 ovalbumin Drugs 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 229960001756 oxaliplatin Drugs 0.000 description 1
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 1
- 229910052763 palladium Inorganic materials 0.000 description 1
- 229920002866 paraformaldehyde Polymers 0.000 description 1
- 230000008823 permeabilization Effects 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 238000007747 plating Methods 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- GNSKLFRGEWLPPA-UHFFFAOYSA-M potassium dihydrogen phosphate Chemical compound [K+].OP(O)([O-])=O GNSKLFRGEWLPPA-UHFFFAOYSA-M 0.000 description 1
- PUDIUYLPXJFUGB-UHFFFAOYSA-N praseodymium atom Chemical compound [Pr] PUDIUYLPXJFUGB-UHFFFAOYSA-N 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- VQMWBBYLQSCNPO-UHFFFAOYSA-N promethium atom Chemical compound [Pm] VQMWBBYLQSCNPO-UHFFFAOYSA-N 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 239000012521 purified sample Substances 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 238000010223 real-time analysis Methods 0.000 description 1
- 238000001454 recorded image Methods 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000019725 replication fork arrest Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 229910052702 rhenium Inorganic materials 0.000 description 1
- WUAPFZMCVAUBPE-UHFFFAOYSA-N rhenium atom Chemical compound [Re] WUAPFZMCVAUBPE-UHFFFAOYSA-N 0.000 description 1
- 229910052703 rhodium Inorganic materials 0.000 description 1
- 239000010948 rhodium Substances 0.000 description 1
- MHOVAHRLVXNVSD-UHFFFAOYSA-N rhodium atom Chemical compound [Rh] MHOVAHRLVXNVSD-UHFFFAOYSA-N 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 239000012146 running buffer Substances 0.000 description 1
- KZUNJOHGWZRPMI-UHFFFAOYSA-N samarium atom Chemical compound [Sm] KZUNJOHGWZRPMI-UHFFFAOYSA-N 0.000 description 1
- 238000009738 saturating Methods 0.000 description 1
- 229910052706 scandium Inorganic materials 0.000 description 1
- SIXSYDAISGFNSX-UHFFFAOYSA-N scandium atom Chemical compound [Sc] SIXSYDAISGFNSX-UHFFFAOYSA-N 0.000 description 1
- 229910052711 selenium Inorganic materials 0.000 description 1
- 239000011669 selenium Substances 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 229910052709 silver Inorganic materials 0.000 description 1
- 239000004332 silver Substances 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 238000011895 specific detection Methods 0.000 description 1
- 238000002798 spectrophotometry method Methods 0.000 description 1
- 230000010473 stable expression Effects 0.000 description 1
- 125000003638 stannyl group Chemical group [H][Sn]([H])([H])* 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 229910052713 technetium Inorganic materials 0.000 description 1
- GKLVYJBZJHMRIY-UHFFFAOYSA-N technetium atom Chemical compound [Tc] GKLVYJBZJHMRIY-UHFFFAOYSA-N 0.000 description 1
- MPLHNVLQVRSVEE-UHFFFAOYSA-N texas red Chemical compound [O-]S(=O)(=O)C1=CC(S(Cl)(=O)=O)=CC=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 MPLHNVLQVRSVEE-UHFFFAOYSA-N 0.000 description 1
- 229910052716 thallium Inorganic materials 0.000 description 1
- BKVIYDNLLOSFOA-UHFFFAOYSA-N thallium Chemical compound [Tl] BKVIYDNLLOSFOA-UHFFFAOYSA-N 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 239000003104 tissue culture media Substances 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000010474 transient expression Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- IHIXIJGXTJIKRB-UHFFFAOYSA-N trisodium vanadate Chemical compound [Na+].[Na+].[Na+].[O-][V]([O-])([O-])=O IHIXIJGXTJIKRB-UHFFFAOYSA-N 0.000 description 1
- 229910052722 tritium Inorganic materials 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 238000002424 x-ray crystallography Methods 0.000 description 1
- 229910052724 xenon Inorganic materials 0.000 description 1
- FHNFHKCVQCLJFQ-UHFFFAOYSA-N xenon atom Chemical compound [Xe] FHNFHKCVQCLJFQ-UHFFFAOYSA-N 0.000 description 1
- NAWDYIZEMPQZHO-UHFFFAOYSA-N ytterbium Chemical compound [Yb] NAWDYIZEMPQZHO-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6875—Nucleoproteins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/60—Fusion polypeptide containing spectroscopic/fluorescent detection, e.g. green fluorescent protein [GFP]
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2440/00—Post-translational modifications [PTMs] in chemical analysis of biological material
- G01N2440/14—Post-translational modifications [PTMs] in chemical analysis of biological material phosphorylation
Definitions
- the present invention relates to an antibody specific for ⁇ -H2AX and its uses as a laboratory tool.
- Histones constitute the core proteins of chromatin and their post-translational modifications (PTMs) contribute to the molecular basis of epigenetic gene regulation and cellular memory. In humans, several variant forms of histones have been described and this is particularly relevant for the H2A histone.
- the H2A variants represent the largest and most diverse family of histones; there is overwhelming evidence that their unstructured N- and C-termini, which protrude out of the core structure of the nucleosome, harbor several sites for PTMs in response to varying stimuli.
- the H2AX variant shares high amino acid similarity with H2A and is characterized by an extended C-terminus, which is phosphorylated when the cells become injured by agents that provoke DNA replication stress (RS) and genome instability.
- RS DNA replication stress
- S139 serine at position 139
- PI3K phosphatidylinositol 3 kinase
- ATM ataxia-telangiectasia mutated
- ATR ATM and Rad3-related
- DNA-PK DNA-dependent protein kinase
- H2AX can be phosphorylated at the threonine residue at position 136 (T136) and at the C-terminal tyrosine residue at position 142 (Y142) to facilitate DNA repair, whereas the persistency of the latter PTM may also trigger apoptosis.
- S139 phosphorylation is regarded as the main PTM of H2AX since it is specifically recognized by the adaptor protein MDC1, which further recruits several E3 ubiquitin ligases to favor DNA repair and/or restart of the halted forks during RS. Because ⁇ -H2AX is involved in the DDR, it is generally considered a biomarker of DNA double-strand breaks (DSBs) and its relevance as read-out of sustained RS is well accepted.
- H2AX is also phosphorylated in the absence of DNA breakage, likely during replication fork arrest and subsequent single-stranded DNA accumulation, and this early event upon insult induces the formation of discrete nuclear foci of ⁇ -H2AX, which can be visualized with specific antibodies under the microscope.
- ⁇ -H2AX which can spread progressively over the whole nucleus (pan-nuclear ⁇ -H2AX) following chromatin modification by loop extrusion, gives in fact an estimate of the severity of the RS.
- ⁇ - H2AX is considered nowadays a universal bio-indicator of the severity of genotoxic compounds that interfere with DNA replication in vitro and in vivo.
- ⁇ -H2AX is also an early biomarker in clinics to check for tissue health status after radiotherapy, chemotherapy or radiation treatment. Indeed, almost all studies aiming at selecting small molecules triggering irreversible genome instability refer to ⁇ -H2AX formation and retention to assess their potency. In particular, tracking ⁇ -H2AX is of high interest for validating chemotherapeutics and for controlling the carcinogenic properties of chemicals present in biological samples. From a drug discovery point of view, this biomarker is of great interest to screen for efficacy and toxicity of therapeutic treatments.
- Nanobodies correspond to the variable domain (VHH) of the heavy chain-only antibodies (HcAb) expressed in these animals.
- VHH repertoires can be cloned as VHH repertoires with minimal modification from total RNA of peripheral blood mononuclear cells (PBMCs) obtained after immunization, thus presenting an authentic picture of the in vivo-maturated heavy chain repertoire diversity.
- PBMCs peripheral blood mononuclear cells
- their small size ( ⁇ 15 kDa) compared to conventional antibodies ( ⁇ 150 kDa) and, especially, their capacity to fold stably in a reducing environment make them excellent binding molecules in cells.
- alpaca-derived nanobodies against ⁇ -H2AX have already been generated (Rajan et al, 2015, FEBS Open Bio. 5:779–788.
- Histone H2AX phosphorylated at serine 139 is a hallmark of DNA damage, signaling the presence of DNA double-strand breaks and global replication stress in mammalian cells. While ⁇ -H2AX can be visualized with antibodies in fixed cells, its detection in living cells was so far not possible. Therefore, there is still a need for tools specific for ⁇ -H2AX suitable for in vivo use in living cells for detecting DNA Damage and replication stress.
- ⁇ -H2AX levels vary from one cell to another, a reagent that would consent monitoring in individual cells both ⁇ -H2AX levels and their fate after treatment with varying doses of genotoxic agents would be useful.
- classical antibodies i.e., IgG
- IgG monovalent Fab format of IgG, that can be obtained following digestion with papain, diffuses freely into the nucleus upon delivery.
- detection of ⁇ -H2AX with complete antibodies can only be carried out in fixed cells (end-point experiments) and thus does not allow to study transient dynamic states of the chromatin following damage.
- nanobodies single domain antibodies that are easily expressed as functional recombinant proteins and report the extensive characterization of a novel nanobody that specifically recognizes ⁇ -H2AX.
- the interaction of this nanobody with the C-terminal end of ⁇ -H2AX was solved by X-ray crystallography.
- the inventors engineered a bivalent version of this nanobody and showed that bivalency is essential to quantitatively visualize ⁇ -H2AX in fixed drug-treated cells.
- the inventors After labelling with a chemical fluorophore, the inventors were able to detect ⁇ -H2AX in a single-step assay with the same sensitivity as with validated antibodies that are used with an assay having several steps. Then, the use of the nanobodies identified by the inventors allows an improved assay which is more cost-effective. Moreover, the inventors produced fluorescent nanobody fusion proteins and applied a transduction strategy to visualize with precision ⁇ -H2AX foci present in intact living cells following drug treatment. Together, this novel tool allows performing fast screenings of genotoxic drugs and enables to study the dynamics of this particular chromatin modification in individual cells under a variety of conditions.
- the present invention relates to a single domain antibody directed against H2AX with a phosphorylation of serine at position 139 ( ⁇ -H2AX) comprising a variable domain comprising three CDRs (complementarity determining regions), namely CDR1, CDR2 and CDR3, consisting in the amino acid sequence of SEQ ID NO: 1 : GLT(L/F)SRYA for CDR1, the amino acid sequence of SEQ ID NO: 2 : ITASGRTT for CDR2, and the amino acid sequence of SEQ ID NO: 3 : AADYGX 1 X 2 X 3 YTRRQSEYX 4 Y for CDR3, wherein X 1 and X 2 are any amino acid, X 3 is K or R, and X 4 is D or E.
- CDRs complementarity determining regions
- CDR1 is GLTLSRYA.
- CDR1 is GLTFSRYA.
- X 1 and X 2 are independently selected in the group consisting of A, V, S, N, K, R, T and G, especially of S, N, K, R, T and G.
- X 1 is selected in the group consisting of S, N, T and G.
- X2 is selected in the group consisting of G, K and S.
- X 1 is selected in the group consisting of S, N, T and G;
- X 2 is selected in the group consisting of G, K and S;
- X 3 is K or R; and
- X 4 is D or E.
- X 3 is R.
- X 4 is E.
- X 3 is R and X 4 is E.
- X 3 is K and X 4 is D.
- the amino acid sequence of CDR3 can be selected in the following group: AADYGSGKYTRRQSEYDY (SEQ ID NO: 4); AADYGNKRYTRRQSEYEY (SEQ ID NO: 5); AADYGTSRYTRRQSEYEY (SEQ ID NO: 6); AADYGGGRYTRRQSEYEY (SEQ ID NO: 7); AADYGSGRYTRRQSEYDY (SEQ ID NO: 8); AADYGSGKYTRRQSEYEY (SEQ ID NO: 9); AADYGSGRYTRRQSEYEY (SEQ ID NO: 10); AADYGNKKYTRRQSEYEY (SEQ ID NO: 11); AADYGNKRYTRRQSEYDY (SEQ ID NO: 12); AADYGNKKYTRR
- the amino acid sequence of CDR3 is selected from the group consisting of AADYGNKRYTRRQSEYEY (SEQ ID NO: 5); AADYGTSRYTRRQSEYEY (SEQ ID NO: 6); AADYGNKKYTRRQSEYEY (SEQ ID NO: 11); AADYGNKRYTRRQSEYDY (SEQ ID NO: 12); AADYGNKKYTRRQSEYDY (SEQ ID NO: 13); AADYGTSKYTRRQSEYEY (SEQ ID NO: 14); AADYGTSRYTRRQSEYDY (SEQ ID NO: 15); and AADYGTSKYTRRQSEYDY (SEQ ID NO: 16).
- the amino acid sequence of CDR3 is selected from the group consisting of AADYGSGKYTRRQSEYDY (SEQ ID NO: 4); AADYGNKRYTRRQSEYEY (SEQ ID NO: 5); AADYGTSRYTRRQSEYEY (SEQ ID NO: 6); and AADYGGGRYTRRQSEYEY (SEQ ID NO: 7). and more particularly of AADYGNKRYTRRQSEYEY (SEQ ID NO: 5); and AADYGTSRYTRRQSEYEY (SEQ ID NO: 6).
- the amino acid sequence of CDR3 is AADYGTSRYTRRQSEYEY (SEQ ID NO: 6).
- the single domain antibody is a VHH, preferably from Camelidae, more preferably from Llama species, or camelized framework regions of a human VH.
- the single domain antibody is an antibody that comprises, consists in, or consists essentially in, the amino acid sequence of SEQ ID NO: 20 or a variant amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid additions, deletions, substitutions, or combinations thereof within the sequence of SEQ ID NO: 20, said addition, deletion, or substitution being outside of CDR1, CDR2 and CDR3 (underlined in the sequence for convenience), wherein the amino acid sequence of SEQ ID NO: 20 is MA(E/D)VQLXXSGGGXVQXG(G/D)SLRLSC(S/A)(A/T)SGLT(F/L)SRYAMGWFRQAPGNEREFVAVITASGRTTLYA DS(V/L)KGRFTISRDNAKNTVALQMQSLK
- the single domain antibody is an antibody that comprises, consists in, or consists essentially in, the amino acid sequence of SEQ ID NO: 21 or a variant amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid additions, deletions, substitutions, or combinations thereof within the sequence of SEQ ID NO: 21, said addition, deletion, or substitution being outside of CDR1, CDR2 and CDR3 (underlined in the sequence for convenience), wherein the amino acid sequence of SEQ ID NO: 21 is MA(E/D)VQLVESGGGLVQAGDSLRLSCA(A/T)SGLTFSRYAMGWFRQAPGNEREFVAVITASGRTTLYADSVKGRFTI SRDNAKNTVALQMQSLKPEDTAVYYCAADYGX 1 X 2 RYTRRQSEYX 4 YWGQGTQVTVSSAAA (
- X 1 and X 2 can be as defined in any particular aspect as described above.
- the present invention relates to a bivalent molecule comprising two single domain antibodies directed against ⁇ -H2AX as described herein.
- the two single domain antibodies can be the same or different.
- the bivalent molecule is a bivalent protein in which the two single domain antibodies are connected as a protein fusion.
- the two single domain antibodies are connected via a peptide linker.
- the linker is usually 3-44 amino acid residues in length.
- the linker has 3-30 amino acid residues in length.
- linker sequences are Gly/Ser linkers of different length including (Gly 4 Ser) 4 , (Gly 4 Ser) 3 , (Gly 4 Ser) 2 , Gly 4 Ser, Gly 3 Ser, Gly3, Gly 2 Ser and (Gly 3 Ser 2 ) 3 .
- the linker is (Gly 4 Ser) 3 .
- the bivalent protein can comprise, essentially consist in or consist in an amino acid sequence selected from the group consisting of - MA(E/D)VQLXXSGGGXVQXG(G/D)SLRLSC(S/A)(A/T)SGLT(F/L)SRYAMGWFRQAPGNEREFVAVITASG RTTLYADS(V/L)KGRFTISRDNAKNTVALQMQSLKPEDTAVYYCAADYGX 1 X 2 X 3 YTRRQSEYX 4 YWGQGTQV TVSS(X) n AA (A/-) – linker - MA(E/D)VQLXXSGGGXVQXG(G/D)SLRLSC(S/A)(A/T)SGLT(F/L)SRYAMGWFRQAPGNEREFVAVITASG RTTLYADS(V/L)KGRFTISRDNAKNTVALQMQSLKPEDTAVYYCAADYGX 1 X 2 X
- the (A/-) is no amino acid.
- a protein with higher valance than a bivalent protein may relate to a protein (monomeric or polymeric) comprising 2, 3, 4, 5 or 6 single domain antibody as described herein.
- the single domain antibody or the bivalent molecule is labelled with a detectable entity (“label”).
- label refers to any atom or molecule that can be used to provide a quantifiable signal and that can be attached to a single domain antibody or bivalent molecule as disclosed herein via a covalent bond or a noncovalent interaction (e.g., through ionic or hydrogen bonding, or via immobilization, adsorption, or the like).
- a label may be selected from the group consisting in a radiolabel, an enzyme label, afluorescent label, a bioluminescent molecule, a biotin-avidin label, a chemiluminescent label, and a detectable entity.
- the detectable entity can be a tag that can be detected by an antibody specific for the tag.
- the detectable label is selected from the group consisting of: a hapten, a fluorescent dye, a fluorescent protein, a chromophore, a metal ion, a gold particle, a silver particle, a magnetic particle, a polypeptide, an enzyme, a luminescent compound, or an oligonucleotide.
- the detectable label is a fluorescent protein.
- the fluorescent protein can be selected in the non-exhaustive list comprising Green Fluorescent Protein, Enhanced Green Fluorescent Protein (EGFP), Enhanced Yellow Fluorescent Protein (EYFP), Venus, mVenus, Citrine, mCitrine, Cerulean, mCerulean, Orange Fluorescent Protein (OFP), mNeonGreen, moxNeonGreen, mCherry, mTagBFP, mTurquoise, mScarlet, mWasabi, mOrange, mStrawberry and dTomato.
- Green Fluorescent Protein Enhanced Green Fluorescent Protein (EGFP), Enhanced Yellow Fluorescent Protein (EYFP), Venus, mVenus, Citrine, mCitrine, Cerulean, mCerulean, Orange Fluorescent Protein (OFP), mNeonGreen, moxNeonGreen, mCherry, mTagBFP, mTurquoise, mS
- the fluorescent protein is dTomato and has the following sequence: MVSKGEEVIKEFMRFKVRMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHP ADIPDYKKLSFPEGFKWERVMNFEDGGLVTVTQDSSLQDGTLIYKVKMRGTNFPPDGPVMQKKTMGWEASTERLYP RDGVLKGEIHQALKLKDGGHYLVEFKTIYMAKKPVQLPGYYYVDTKLDITSHNEDYTIVEQYERSEGRHHLFL (SEQ ID NO: 38).
- the detectable label can be a fluorescent dye, for instance selected in the non-exhaustive list including Oregon Green(R), Pacific BlueTM, Pacific OrangeTM, Pacific GreenTM, Cascade BlueTM, Cascade YellowTM, Lucifer YellowTM, Marina BlueTM, and Texas Red(R) (TxRed); an AlexaFluor(R)(AF) dye such as AF350, AF405, AF488,AF500, AF514, AF532, AF546, AF555, AF568, AF594, AF610, AF633, AF635, AF647, AF680, AF700, AF710, AF750, AF790, and AF800; a Cy dye such as Cy2, Cy3, Cy3.5, Cy5, Cy5.5, Cy7, and Cy 7.5; Atto 390, Atto 425, Atto 465, Atto 488, Atto 495, Atto 5l4Atto 520, Atto 532, Atto 550, Atto 565, Atto 590
- the detectable label can be a hapten such as a fluorescein or a derivative thereof, fluorescein isothiocyanate, carboxyfluorescein, dichlorotriazinylamine fluorescein, digoxigenin, dinitrophenol (DNP), trinitrophenol (TNP), and biotin.
- the detectable molecule can be a detectable tag, preferably a peptide detectable tag.
- tag includes E6 tag (for instance of sequence TSMFQDPQERPRASA).
- the detectable label can be a bioluminescent molecule or an enzyme such as luciferase, ⁇ - galactosidase, ⁇ -lactamase, peroxidase, alkaline phosphatase, ⁇ - glucuronidase, and ⁇ -glucosidase.
- an enzyme such as luciferase, ⁇ - galactosidase, ⁇ -lactamase, peroxidase, alkaline phosphatase, ⁇ - glucuronidase, and ⁇ -glucosidase.
- the detectable label can be a radiolabel, such as a radionuclide selected from the group consisting of: carbon (14C), chromium (5lCr), cobalt (57Co), fluorine (18F), gadolinium (l53Gd, l59Gd), germanium (68Ge), holmium (I66H0), indium (1151h, 1131h, 1121h, min), iodine (1251, 1231, 1211), lanthanium (l40La), lutetium (l77Lu), manganese (54Mn), molybdenum (99 Mo), palladium (103 Pd), phosphorous (32 P), praseodymium (142 Pr), promethium (l49Pm), rhenium (l86Re, l88Re), rhodium (l05Rh), rutheroium (97Ru), samarium (l53Sm), scandium (47Sc), selenium (75Se), (85Sr
- the present disclosure relates to a single domain antibody or bivalent protein as disclosed herein conjugated to a detectable label.
- the methods for preparing such a conjugate are well-known in the art.
- the sequence of the single domain antibody or the bivalent protein can be modified by a substitution or addition of a residue suitable for the conjugation of the detectable label.
- the amino acid sequence of the single domain antibody or bivalent protein includes a substitution or addition of a residue, preferably a cysteine, preferably near to the C-terminal end, for instance within the 2-10 most C-terminal amino acids of the single domain antibody or bivalent protein as described herein, more preferably within the 3-5 most C-terminal amino acids.
- the additional residue preferably a cysteine residue
- the additional residue is added before the stretch of three A (i.e., AAA replaced by CAAA).
- This additional residue preferably a cysteine residue
- the label is a protein and is fused or linked to the single domain antibody or the bivalent molecule, thereby forming a protein fusion.
- the label can be fused or linked at the N-terminal end of the single domain antibody or the bivalent molecule, or at the C-terminal end of the single domain antibody or the bivalent molecule or, in the context of the bivalent molecule, between the two single domain antibodies.
- the label is fused or linked at the C-terminal end of the single domain antibody or the bivalent molecule.
- the single domain antibody or the bivalent protein can further comprise tag sequence, such as a histidine tag, useful for the purification of the recombinant protein.
- the single domain antibody or the bivalent protein can further comprise a NLS sequence (nuclear localization signal).
- the present invention further relates to a nucleic acid sequence encoding the single domain antibody or the bivalent protein as disclosed above, an expression cassette comprising such a nucleic acid sequence, a vector comprising such a nucleic acid sequence or expression cassette, and a host cell comprising such a nucleic acid sequence, expression cassette or vector.
- the promoter used to control the expression of the single domain antibody or the bivalent protein is a weak promoter.
- the expression vector is a low copy number vector.
- the expression vector may comprise a restriction site allowing the insertion of a detectable label so as to obtain a protein fusion comprising the single domain antibody or the bivalent protein and the detectable protein.
- the present disclosure also relates to a method for producing the single domain antibody or the bivalent protein as described herein comprising expressing the single domain antibody or the bivalent protein in a host cell and recovering the produced single domain antibody or bivalent protein.
- the present disclosure relates to the single domain antibody or the bivalent protein or a nucleic acid, expression cassette or vector encoding it as a research tool.
- the single domain antibody or the bivalent protein as described herein or an expression vector encoding the single domain antibody or the bivalent protein and a leaflet for the use of this reagent.
- the single domain antibody or the bivalent protein comprises a detectable label as detailed above.
- the present disclosure relates to the use of the single domain antibody or the bivalent protein as described herein or a nucleic acid, expression cassette or vector encoding it for detecting and/or quantifying and/or monitoring ⁇ -H2AX in a cell or a cellular extract thereof, especially ⁇ -H2AX foci.
- the single domain antibody or the bivalent protein as described herein or a nucleic acid, expression cassette or vector encoding it for detecting or monitoring DNA damage or Replication stress in a cell or a cellular extract thereof.
- the use is a non-therapeutic use.
- the use can be an in vitro use, an in cellulo use or an ex vivo use (on isolated cells). In particular, the in vivo use can be excluded.
- the single domain antibody or bivalent protein is used in one of the following assays: ELISA, flow cytometry, immunofluorescence, live cell imaging (non fixed), immunoprecipitation, in particular Chromatin immunoprecipitation, and Western blot.
- the present disclosure further relates to a method for detecting and/or quantifying and/or monitoring ⁇ - H2AX in a cell, comprising contacting the cell with a single domain antibody or a bivalent protein as described herein or with a nucleic acid, expression cassette or vector encoding said single domain antibody or bivalent protein, and detecting and/or quantifying and/or monitoring the single domain antibody or bivalent protein in the cell or a cellular extract thereof.
- the method can be for detecting or quantifying or monitoring DNA damage or Replication stress in a cell.
- the method is a non-therapeutic method.
- the method can be an in vitro method, an in cellulo method or an ex vivo method (on isolated cells). In particular, the in vivo method can be excluded.
- the cell is a cancer cell.
- the cell is a living cell.
- the cell is a fixed cell.
- the cell is an eukaryotic cell, more preferably a mammalian cell.
- the cell is contacted or has been contacted or will be contacted with a test compound or molecule simultaneously or before the contacting step with the single domain antibody or bivalent protein.
- the test compound or molecule can be any compound or molecule, especially can be a compound or molecule known or suspected to be a genotoxic agent.
- the use and method as disclosed above is preferable after induction of DNA damage or replication stress.
- the present disclosure may relate to the use of the single domain antibody or the bivalent protein as described herein or a nucleic acid, expression cassette or vector encoding it for screening or identifying a compound or a molecule having a genotoxic effect; or to a method for screening or identifying a compound or a molecule having a genotoxic effect, the method comprising contacting a eukaryotic cell with a compound or a molecule, the cell expressing the single domain antibody or the bivalent protein as described herein or the cell being contacted with the single domain antibody or the bivalent protein as described herein, and detecting and/or quantifying and/or monitoring the single domain antibody or the bivalent protein in the cell, thereby determining the effect of the compound or molecule on DNA damage or replication stress or determining the genotoxic effect of the compound or molecule.
- the compound or molecule is selected if no genotoxic effect is detected. In an alternative aspect, the compound or molecule is selected if a genotoxic effect is detected.
- the effect observed for the compound or molecule can be compared with one or several compounds or molecules of reference for which the genotoxic effect or the absence of genotoxic effect is well-documented.
- the single domain antibody or the bivalent protein is detected, quantified or monitored in the nucleus of the cell.
- the single domain antibody or the bivalent protein is use for detecting, quantifying or monitoring the ⁇ -H2AX foci.
- the single domain antibody or the bivalent protein is linked to a fluorescent label as detailed above and the single domain antibody or the bivalent protein is detected, quantified or monitored by the fluorescence of the fluorescent label.
- the advantage is that the detection, quantification or monitoring can be carried in a one-step process.
- the single domain antibody or the bivalent protein is monitored for a period of time, for instance by video recording, to follow the event occurring in the living cell after induction of DNA damage or replication stress.
- other kind of detectable label can be used and the method may comprise the detection of the detectable label through the addition or the use of a mean specific for the detectable label. For instance, if the detectable label is a tag, an antibody specific for this tag can be used to detect the detectable label.
- H2AX refers to H2A histone family member X (H2AX). It is described in UniProtKB under reference P16104 for human and P27661 for mouse. Human sequence of H2AX is the following MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRI IPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY.
- H2AX Mouse sequence of H2AX is the following MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRI IPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKSSATVGPKAPAVGKKASQASQEY.
- the protein is called gammaH2AX or ⁇ H2AX.
- antibody refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen-binding site that specifically binds an antigen.
- the term antibody encompasses not only whole antibody molecules, but also antigen-binding antibody fragments as well as variants (including derivatives) of antibodies and antibody fragments.
- the term antibody refers to heavy-chain only antibodies, VHH, fragments and derivatives thereof such (VHH)2 fragments and single domain antibodies.
- VHH variable-chain only antibody
- HCAbs refer to immunoglobulins which are devoid of light chains and consist in two heavy chains. These antibodies do not rely upon the association of heavy and light chain variable domains for the formation of the antigen-binding site but instead the variable domain of the heavy polypeptide chains alone naturally forms the complete antigen binding site.
- Each heavy chain comprises a constant region and a variable domain which enables the binding to a specific antigen, epitope or ligand.
- HCAbs encompass heavy chain antibodies of the camelid-type in which each heavy chain comprises a variable domain called VHH and two constant domains. Such heavy-chain antibodies directed against a specific antigen can be obtained from immunized camelids. Camelids encompass dromedary, camel, lama and alpaca. Camelid HCAbs have been described by Hamers-Casterman et al., Nature, 1993, 363:446. Other examples of HCAb are immunoglobulin-like structures (Ig-NAR) from cartilaginous fishes.
- Ig-NAR immunoglobulin-like structures
- Heavy-chain antibodies can be humanized using well-known methods.
- the terms “single domain antibody”, “sdAb” and “nanobody” are used interchangeably and have the same meaning.
- the term single domain antibody refers to a single variable domain derived from a heavy chain antibody, which is able to bind an antigen, an epitope or a ligand alone, that is to say, without the requirement of another binding domain.
- a single domain antibody may be or may derive from VHH and V-NAR.
- V-NAR refers to the variable domain found in immunoglobulin-like structures (Ig-NAR) discovered in cartilaginous fishes such as sharks.
- the single domain antibody according to the present disclosure is a synthetic single domain antibody.
- synthetic means that such antibody has not been obtained from fragments of naturally occurring antibodies but produced from recombinant nucleic acids comprising artificial coding sequences (cf. WO 2015/063331).
- VHH refers to an antibody fragment consisting of the VH domain of camelid heavy-chain antibody.
- VHH fragments can be produced through recombinant DNA technology in a number of microbial hosts (bacterial, yeast, mould), as described in WO 94/29457.
- binding domains can be obtained by modification of the VH fragments of classical antibodies by a procedure termed "camelization", described by Davies et al, 1995.
- Dimers of VHH fragments, i.e. (VHH) 2 can be generated by fusing two sequences encoding VHH fragments, end to end, e.g., by PCR.
- the (VHH) 2 fragment is monospecific.
- the variable domain of an antibody of the present disclosure comprises at least three complementarity determining region (CDR) which determine its binding specificity.
- the CDRs are distributed between framework regions (FRs).
- the variable domain thus contains at least 4 framework regions interspaced by 3 CDR regions, resulting in the following typical antibody variable domain structure: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4.
- CDRs and/or FRs of the single domain antibody of the present disclosure may be fragments or derivatives from a naturally-occurring antibody variable domain or may be synthetic.
- amino acid modification amino acid change
- mutation are used interchangeably and refer to a change in an amino acid sequence such as a substitution, an insertion, and/or a deletion.
- amino acid substitution or “substitution” herein is meant the replacement of an amino acid at a particular position in a parent amino acid sequence with another amino acid.
- amino acid insertion or “insertion” is meant the addition of an amino acid at a particular position in a parent amino acid sequence.
- amino acid deletion or “deletion” is meant the removal of an amino acid at a particular position in a parent amino acid sequence.
- the amino acid substitutions may be conservative. A conservative substitution is the replacement of a given amino acid residue by another residue having a side chain (“R-group”) with similar chemical properties (e.g., charge, bulk and/or hydrophobicity). In general, a conservative amino acid substitution will not substantially change the functional properties of a protein.
- fusion protein or “protein fusion” are equivalent and refers to protein created through the joining of two or more genes that originally coded for separate proteins. Translation of this fusion gene results in a single polypeptide with functional properties derived from each of the original proteins.
- the fusion protein of the invention is a recombinant fusion protein created artificially by recombinant DNA technology. Table A – Amino Acid Residue
- (AA1/AA2) refers to the choice between the residue AA1 or the residue AA2.
- E/D means E or D
- A/T means A or T
- G/D means G or D
- S/A means S or A
- F/L means F or L
- V/L means V or L
- A/- means A or no amino acid.
- a variant is a variant of a variable domain, a CDR or a FR.
- a variant comprises from 1 to 40 amino acid modifications, preferably from 1 to 30 amino acid modifications, more preferably 1 to 20 amino acid modifications.
- the variant may have from 1 to 15 amino acid changes, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 amino acid changes as compared to its parent amino acid sequence.
- the variant may have from 1 to 3 amino acid changes, e.g., 1, 2, or 3 amino acid changes as compared to its parent amino acid sequence.
- the variants may comprise one or several amino acid substitutions, and/or, one or several amino acid insertions, and/or one or several amino acid deletions.
- the variant may comprise one or several conservative substitutions, e.g., as shown here above.
- the variant comprises one or several amino acid modifications in the framework domains.
- expression cassette refers to a nucleic acid construction comprising a coding region and regulatory regions necessary for expression, operably linked to the coding region.
- the expression “operably linked” indicates that the elements are combined in such a way that the expression of the coding region is under the control of the regulatory regions.
- a regulatory region is located upstream of the coding region at a distance compatible with the control of its expression.
- the regulatory region can include promoters, enhancers, silencers, attenuators, and internal ribosome entry sites (IRES). Spacer sequences may also be present between regulatory elements and the coding region, as long as they don’t prevent its expression.
- An expression cassette may also include a start codon in front of a protein-encoding gene, splicing signals for introns, and stop codons, transcription terminators, polyadenylation sequences.
- promoter and “transcriptional promoter” are equivalent and refer to a region of DNA that is part of the regulatory region of an expression cassette. The promoter is the regulatory element that initiates the transcription of a particular gene. Promoters are located near the transcription start site of genes, on the same strand and upstream on the DNA (towards the 5' region of the sense strand).
- expression vector refers to a vector designed for gene expression in cells.
- An expression vector allows to introduce a specific gene into a target cell, and can commandeer the cell's mechanism for protein synthesis to produce the protein encoded by the gene.
- An expression vector comprises expression elements including, for example, a promoter, the correct translation initiation sequence such as a ribosomal binding site and a start codon, a termination codon, and a transcription termination sequence.
- An expression vector may also comprise other regulatory regions such as enhancers, silencers and boundary elements/insulators to direct the level of transcription of a given gene.
- the expression vector can be a vector for stable or transient expression of a gene. BRIEF DESCRIPTION OF THE FIGURES Figure 1: Development and selection of specific anti- ⁇ -H2AX nanobodies.
- FIG 1A is a schematic representation of a phage display selection round (left). The histogram on the right shows the number of phages retained on plate after 2 rounds of selection with 3 different libraries issued from peripheral blood mononuclear cells (PBMCs) of individual animals.
- Figure 1B shows the specific binding capacity of the phages selected from the library 2 were assayed by phage-ELISA with either peptides as indicated (left) or histones extracted from H-treated (treatment with hydroxyurea) or untreated (NT) cells (right), both immobilized on plate.
- Figure 1C shows four individual VHH-phages (VHH: variable domain) identified by sequencing (A4, A9, C6 and G2) subjected to phage-ELISA.
- Figure 2 Biochemical and structural analysis of the selected nanobodies.
- Figure 2A is an SDS-PAGE analysis of the purified nanobodies A9 and C6.
- Figure 2B shows the binding capacity of the purified samples shown in Fig.2A which was tested by ELISA with either phosphorylated (phospho-peptide; 1 ⁇ g/mL) or non-phosphorylated (peptide; 1 ⁇ g/mL) C- terminal H2AX peptide coated on plate.
- Figure 2C is an immunofluorescence assay with the C6 nanobody. H1299 cells were treated for 24 hours with the indicated drugs (hydroxyurea, (H); or a combination of gemcitabine and a Chk-1 inhibitor (G+A)) and incubated after fixation with nanobody C6.
- Figure 2D is a quantification of the ⁇ -H2AX fluorescence signal recorded following incubation of the cells treated as in Fig.2C with either A9 or C6 nanobody.
- Figure 2E is a crystallographic 3D-structure of the C6 nanobody in complex with the phosphorylated peptide corresponding to ⁇ -H2AX C-terminal tail (ApSQEY). The CDR1, CDR2 and CDR3 loops are respectively shown with arrows.
- FIG. 2F and 2G are close-up view of the ⁇ -H2AX tail peptide in the nanobody binding site. Residues are labelled as in Fig. 2E. Water molecules in the interface between the ⁇ -H2AX tail and the nanobody are represented as spheres and hydrogen bonds are represented as dotted lines.
- Figure 3 C6 nanobody localization to the nucleus in drug-treated H1299 cells.
- Figure 3A is an immunofluorescence analysis of H1299 cells after transfection with the plasmid encoding the C6-mCherry chromobody. 24 hours post-transfection, the indicated drugs were added.
- Bound nanobody or Fab were revealed with anti-E6T antibodies and secondary Alexa 568-labelled anti-mouse globulins. Scale bar: 20 ⁇ m. The quantification of the ⁇ -H2AX mean fluorescence intensity (FI) of the monitored cells is shown on the right. The numbers indicated in brackets correspond to the number of cells analyzed in each condition.
- Figure 4 Binding performance of the bivalent C6 nanobody.
- Figure 4A is a schematic representation of the constructs used to produce bivalent nanobodies in E. coli cells. The four R residues of bivalent C6 nanobody (C6B) that have been altered to generate the mutant bivalent C6 nanobody (C6BM) are indicated.
- Figure 4B is an analysis by surface plasmon resonance (SPR) of the interaction of monovalent (C6; 180 nM) or bivalent (C6B; 80 nM) C6 nanobody with the phospho-peptide immobilized on chip.
- SPR surface plasmon resonance
- the curves show typical normalized profiles of the fractional occupancy calculated with the signals recorded for each nanobody (Materials and Methods). Injection of nanobody was stopped at the 120 seconds time-point and dissociation was analyzed during 700 seconds.
- Figure 4C is a representative immunofluorescence images of H- or G+A-treated H1299 cells following fixation and incubation with bivalent C6 nanobody (left). Bound material was revealed as described in the legend of Figure 3. The nuclei were counterstained with DAPI.
- FIG. 4D shows the detection of ⁇ -H2AX in drug-treated H1299 cells with the fluorescently-labelled C6B. A depiction of the bivalent nanobody chemically conjugated to Alexa 568 is shown on the left. An immunofluorescence analysis of drug-treated H1299 cells after incubation with the labelled conjugate is shown on the right. Nuclei were counterstained with DAPI. Scale bar: 20 ⁇ m.
- Figure 4E is a box plot representation as in figure 4C of the normalized ⁇ -H2AX fluorescence intensity detected with the C6B-Alexa 568 conjugate of H1299 cells after treatment with the indicated drugs or drug combinations.
- the data shown correspond to those recorded after log transformation.
- the full name and the concentration of the drugs used is indicated in the Materials and Methods section.
- the numbers indicated in the x axis correspond to the number of cells analyzed in each condition. NT, non-treated cells.
- Figure 4F shows a comparison of the C6B-Alexa 568 conjugate with the mAb 3F4 for detecting ⁇ -H2AX in drug-treated H1299 cells.
- FIG. 5A Typical immunofluorescence images of C6B-transduced cells taken with a confocal microscope after DAPI counterstaining are shown (lower images). Scale bar: 10 ⁇ m.
- Figure 5B the quantification of the mean FI of cells transduced as in Figure 5A with either C6B or C6BM are represented. The number of analyzed cells in each condition is indicated (bottom).
- Figure 5C schematic representation of the C6B-mCherry (C6B-mCh) and the C6B-dTomato (C6B-dTo) fusion proteins used in the study.
- Figure 5D analysis by SDS-PAGE of the purified C6B-mCherry (1) and the C6B-dTomato (2) fusion proteins.
- FIG. 5E analysis by immunofluorescence microscopy of the C6B-dTomato (C6B-dTo) and C6BM- dTomato (C6BM-dTo) fusion proteins following transduction in H1299 cells.24 hours post-transduction, the cells were treated with H or left untreated (NT). The images show typical fields observed in each case under the microscope after fixation and DAPI counterstaining (lower images). Scale bar: 20 ⁇ m. An enlargement of one cell present in the field of the C6B-dTo samples following overlay of the red and blue channels with Fiji is shown below the original images.
- Figure 5F the quantification of the nuclear mean FI of C6B-dTo-transduced H1299 cells after treatment with the indicated drugs is shown. The numbers at the bottom correspond to the number of cells analyzed in each case.
- Figure 6 Visualization of the binding of the bivalent nanobody in live H1299 cells and analysis of its effect after pulse treatment with hydroxyurea.
- Figure 6A representative wide-field fluorescence microscopy images of H1299 cells transduced with the C6B-dTomato fusion protein and subsequently treated with the indicated drugs or left untreated (NT). Images with an identical exposure time were taken 24 hours after treatment. The amount of protein used for the transduction in each case is also indicated. Scale bar: 10 ⁇ m.
- FIG. 6B analysis of the movement of the foci formed in C6B-dTo-transduced H1299 cells treated with H.24 hours post-treatment, the cells were analyzed as in Figure 6A and pictures were taken every minute (total time: 10 minutes). The recorded images were processed as indicated in Materials and Methods section and show the trajectories of the foci present in two typical cells after 0, 1, 5 and 10 minutes of incubation. Scale bar: 10 ⁇ m.
- Figure 6C growth rate of the transduced H1299 following pulse-treatment with H. After transduction with the indicated proteins, the cells were seeded on plate and pulse-treated during 24 hours with H.
- the curves correspond the number of cells after counting at 24, 48, 72 and 96 hours after seeding.
- the data correspond to the calculated ratios (number of cells in each case/number of cells at seeding time (0 h)).
- Figure 6D variation of ⁇ -H2AX levels in H1299 cells transduced with either PBS or the C6B or C6B-dTo proteins and treated for 24 hours (pulse treatment) with H as probed by Western blotting with mAb 3F4. Following treatment, the transduced cells (5 ⁇ 10 5 ) were incubated in fresh medium and extracts (50 ⁇ g) were prepared at the indicated time points. ⁇ -actin was used as a loading control.
- Figure 7 Characterization of the A9 nanobody.
- Figure 7A analysis by SDS-PAGE of the bacterially-expressed nanobodies.
- the gel shows the protein content of similar amounts of total (E), soluble (S) and insoluble (I) fractions of extracts obtained after lysis of the induced bacteria.
- the bands corresponding to the nanobody polypeptides are indicated with arrows.
- Figures 7B and 7C representative immunofluorescence images of drug-treated H1299 cells recorded after incubation with either A9 nanobody (Fig.7B) or mAb 3F4 (Fig.7C). Scale bar: 20 ⁇ m.
- Figure 7D quantification of the signal obtained with the cells shown in Figure 7C. The number of analyzed cells is indicated in brackets.
- Figure 8 Microscopic analysis of C6 and A9 nanobodies upon transfection.
- Figure 8A representative confocal microscopy images of H1299 cells after transfection of the C6 nanobody-mCherry construct. The cells were treated as indicated in the legend of Fig.2C. Scale bar: 20 ⁇ m.
- Figures 8B and 8C immunofluorescence analysis of H1299 cells after transfection with chromobody A9- GFP. The cells were treated as indicated in the legend of Fig.3A. Representative images recorded under the microscope (Fig.8B) and the corresponding percentage of fluorescent cells observed in each condition (Fig.8C) are shown. Cut-off for negative cells was set on non-transfected cells using the maximal recorded value. Scale bar: 50 ⁇ m.
- Figure 9 Biochemical and fluorescence microscopic analyses of C6B an C6BM nanobodies.
- Figure 9A purification and analysis on SDS gel of the C6B and C6BM nanobodies. Aliquots of affinity- purified protein samples (1 to 5 ⁇ g) were subjected to SDS-PAGE and subsequent Coomassie blue staining.
- Figure 9B varying concentrations of C6B and C6BM nanobodies were probed by ELISA with fixed phospho- peptide on plate (0.1 ⁇ g/mL).
- Figure 9C typical binding profiles of the C6 nanobody to the phospho-peptide as probed by SPR (Materials and Methods). The experimental values of each experiment are indicated.
- Figure 9D immunofluorescence assay with the C6B nanobody in U2OS cells. Bound nanobodies were revealed with anti-E6 tag antibodies and Alexa Fluor 488 anti-mouse immunoglobulins. The nuclei were counterstained with DAPI (lower images). Scale bar: 20 ⁇ m.
- Figure 9E representative immunofluorescence images of H- or G+A-treated H1299 cells following fixation and incubation with 2ng/ml or 5 ng/ml of bivalent C6B nanobody bound material was revealed with anti- E6T antibody and Alexa 568-labelled anti-mouse globulins. The nuclei were counterstained with DAPI (lower images). Scale bar: 20 ⁇ m.
- Figure 10 Expression of the bivalent chromobodies in transfected cells.
- Figure 10A representative immunofluorescence images of H1299 cells transfected with the p ⁇ A-C6B-E6T- mCherry construct. The transfected cells were treated with the indicated drugs during 24 hours and after cell fixation, expressed nanobody-mCherry fusions were monitored under a confocal microscope. Scale bar: 20 ⁇ m.
- Figure 10B evaluation of the binding stability of the C6B-mCherry or the C6BM-mCherry fusions expressed in H1299 cells treated with the indicated drugs after transfection.
- FIG. 10C representative immunofluorescence images of the transfected H1299 cells used in Fig.10B. Scale bar: 50 ⁇ m.
- Figure 11 Transduction of the C6B or C6BM nanobodies in cancer cells.
- Figure 11A transduction of C6B and C6BM in H1299 cells. Representative images recorded by fluorescence microscopy after treatment of the cells with H or left untreated (NT). The nanobodies were revealed as indicated in the legend of Figure 4. Scale bar: 20 ⁇ m.
- Figure 11B transduction of C6B nanobodies in U2OS cells treated as in Fig.11A. Representative images taken with a confocal microscope after DAPI counterstaining (lower images) are shown. The C6B molecules were revealed as indicated in Fig.9D. Scale bar: 10 ⁇ m.
- Figure 12 Specific detection of foci with the C6B-dTo chromobody upon transduction
- Figure 12A comparison of the binding performance of C6-dTo and the C6B-dTo chromobodies. Equivalent amounts of monovalent or divalent chromobodies were delivered in H1299 cells and images were taken after treatment of the transduced cells for 24 hours with H.
- FIG. 12B H1299 cells were transduced with the C6B-dTo chromobody and treated as indicated in Fig.12A. Prior to analysis by immunofluorescence microscopy, they were incubated with mAb 3F4 and Alexa 468-labelled secondary anti-mouse globulins. The pictures show the foci pattern of a typical cell following analysis with red (left) or the green (middle) filters. Stronger lightness shows the colocalization of the chromobody and the mAb at foci (right). Scale bar: 10 ⁇ m.
- Figure 12C transduction of C6B-dTo chromobodies in U2OS cells treated as in Fi.12A. Scale bar: 20 ⁇ m.
- Figure 12D detection of foci in H1299 cells transduced with C6B-dTo chromobody and subsequent treatment with either clofarabine (C) or triapine (T). Typical nuclei after analysis as in Fig.12A are shown. Scale bar: 10 ⁇ m.
- Figure 13 Visualization of the movement of the C6B-dTomato molecules in live H1299 cells and schematic representation of their binding in drug-injured cells.
- Figure 13A two representative wide-field fluorescence microscopy images of H1299 cells transduced with the C6B-dTomato fusion protein and subsequently treated with G+A during 4 hours (left) were analyzed as indicated in the legend of Figure 6. The trajectories of the ⁇ -H2AX foci over a period of 10 minutes are shown. Scale bar: 10 ⁇ m.
- Figure 13B the left panel represents the internalization and nuclear transport of the C6B-dTo molecules. Upon delivery in the cytoplasm by electroporation they bind to newly-synthesized nuclear proteins (square) and are piggybacked in the nucleus (right lower corner compartment).
- Example 1 Development and selection of specific anti- ⁇ -H2AX nanobodies by phage display
- RS DNA replication stress
- the inventors immunized alpacas with the phosphorylated peptide CKATQA(p)SQEY corresponding to the C-terminal end of ⁇ -H2AX (residues 134-142).
- This peptide has been used in a previous study to generate monoclonal antibodies that are suitable for detecting ⁇ -H2AX in various immunoassays (Moeglin, E. et al.; Cancers 2019, 11, 355, doi:10.3390/cancers11030355).
- the PBMCs were collected and VHH libraries of approximately 10 7 independent clones were constructed.
- the phage display technology which consist in displaying the VHH molecules on the tip of M13-based phages, allows selecting those that bind to the phospho-peptide immobilized on plate. This method of antigen display was preferred to other methods such as immobilization on magnetic beads since it previously allowed successful screening of cell culture supernatants containing monoclonal antibodies. Colony counting following the first round of panning (R1) showed that phages expressing a VHH against the phospho-peptide were only present in the repertoire of one animal (alpaca 2) ( Figure 1A).
- Example 2 The selected nanobodies are soluble in the bacterial cytoplasm To test whether the four identified VHH variants could be used as nanobodies in immunoassays and cells, the inventors first sub-cloned their coding regions into a bacterial vector equipped with the relevant tags for detection and purification, then expressed them as single polypeptides in the cytoplasm of E. coli cells.
- Example 3 3D-structure determination of the C6 nanobody
- the inventors solved the crystal structure of the complex at 1.8 ⁇ resolution.
- the inventors selected the C6 nanobody due to its higher stability upon storage and overall better performance compared to A9.
- the crystals belonged to space group P3 1 , with 6 equivalent copies of the complex in the asymmetric unit where significant electron density is observed for the last five residues of the peptide ( Figure 2E).
- the other residues are highly flexible or disordered, implying that they are not involved in specific interactions.
- the nanobody adopts a canonical IgG fold with a scaffold of nine antiparallel ⁇ -strands forming two sandwiching ⁇ –sheets.
- the paratope accepting the phospho-peptide is mainly built from CDR2 and CDR3 resulting in a solvent accessible surface area buried in the interface of approximately 385 ⁇ 2 .
- Detailed analysis of the complex showed that the phosphate group of phospho-S139 makes direct water-mediated interactions with side chains from CDR2 and CDR3 (Figure 2F).
- Key residues (single letter code) that belong to CDR2 are the hydrogen bond donors T52, S53 and T56 as well as R55, which also provides an electrostatic contribution.
- the nanobody interacts also with the two last residues of the peptide (Figure 2G).
- This second binding pocket involves side chains from CDR3 with key roles of R100, R100C and R100D: the ammonium group of R100 is stacked against the aromatic ring of the Y142 tail, while those of R100C and R100D recognize the side chain of E141 and the carboxy-terminal group of the phospho-peptide, respectively.
- the phosphate group of the phospho-peptide is a crucial determinant of the recognition of the antigen by the C6 nanobody, explaining its extraordinar specificity for the modified peptide.
- Example 4 The C6 and A9 nanobodies are solubly expressed in mammalian cells The inventors examined the behavior of the C6 nanobody when expressed in mammalian cells.
- the inventors cloned the coding region of C6 fused in frame to mCherry to generate a chromobody (Panza, P. et al.; Development 2015, 142, 1879–1884, doi:10.1242/dev.118943) expressed under the control of the ⁇ -actin promoter and transiently transfected it into H1299 cells.
- the C6 chromobody was located in the nucleus of the treated cells as well as the untreated cells after analysis with either a widefield ( Figure 3A) or a confocal microscope ( Figure 8A). The inventors speculated that unspecific binding to a nuclear antigen was caused by the overexpression of the chromobody.
- Example 5 Behavior of the C6 nanobody following transduction
- the inventors have shown that antibodies and fragments thereof can be efficiently transduced into cultured cells by electroporation (Muyldermans, S.; Annu. Rev. Biochem.2013, 82, 775– 797, doi:10.1146/annurev-biochem-063011-092449; Conic, S. et al.; J. Cell Biol. 2018, 217, 1537–1552, doi:10.1083/jcb.201709153).
- nanobodies can theoretically easily diffuse into the nucleus after delivery in the cytoplasm. Therefore, the inventors transduced the purified C6 nanobody in H1299 cells subsequently treated with H and imaged them after 24 or 48 hours of incubation. As shown in Figure 3B, the fluorescent signal resembled that typically observed for ⁇ -H2AX, albeit background staining (without treatment) was also significant. Since a similar staining was observed with the transduced Fab prepared by papain digestion of mAb 3F4 (Moeglin, E.
- Example 6 The bivalent C6 nanobody allows highly accurate detection of ⁇ -H2AX in fixed drug-treated cells
- C6B bivalent C6 nanobody
- C6BM a mutated version of it
- Figure 4A Both constructs were expressed in E. coli cells and, after purification and validation on gel ( Figure 9A), their capacity to bind to the phospho-peptide immobilized on plate was tested by ELISA ( Figure 9B).
- the responses were normalized to the peptide density and to the nanobody molecular weight, which allows calculating the fractional occupancy (FO) of the peptide sites (Zeder-Lutz, G. et al.; Anal. Biochem.2012, 421, 417–427, doi:10.1016/j.ab.2011.09.015).
- FO fractional occupancy
- an FO of one is expected for a 1:1 antibody-antigen molar ratio
- an FO of 0.5 is expected for a homogenous bivalent binding (i.e., 1:2 antibody-antigen molar ratio).
- Example 7 Single-step detection of ⁇ -H2AX in fixed drug-treated H1299 cells
- the inventors added a cysteine residue in the coding region of C6B between the C-terminus of the second VHH and the E6 tag.
- the purified protein (C6BC) was labelled with Alexa-Fluor 568-maleimide and used in IF ( Figure 4D).
- ⁇ -H2AX foci could be distinctly detected and quantified with the fluorescently-labelled C6BC molecules when using different combinations of RS-inducing drugs used in the clinic ( Figure 4E).
- Figure 4F Pearson correlation coefficient of 0.966
- Example 8 The transduced bivalent C6 nanobody allows monitoring ⁇ -H2AX in drug-treated live cells
- C6B could be used in cells
- the inventors modified the previously constructed chromobody C6-mCherry to add a second VHH copy thus creating C6B-mCherry.
- a strong nuclear mCherry signal was observed ( Figure 10A).
- nuclear staining was also observed in the absence of drug treatment, indicating a certain degree of unspecific binding. Nonetheless, CSK treatment showed that a large fraction of the fluorescent signal remained in the nucleus ( Figure 10B).
- the inventors stained the C6B-dTo-transduced cells with mAb 3F4 before microscopic analysis. Notably, the foci detected with C6B-dTo strictly co-localized with those visualized with the antibody and secondary Alexa fluor 488-labelled globulins ( Figure 12B).
- Example 9 Real-time analysis of ⁇ -H2AX in drug-treated H1299 cells
- the inventors took advantage of the strong fluorescence signal emitted by the dTomato protein and the fact that precise low amounts of C6B-dTo molecules can be delivered in cells via our electroporation method.
- Preliminary experiments showed that almost all of the internalized molecules accumulated in the nucleus when 0.5 to 2 ⁇ g of purified fusion protein were used.
- Figure 6A shows typical nuclei of C6B-dTo-transduced H1299 cells monitored by wide-field microscopy following treatment of the cells with H or G+A for 24 hours.
- the foci do not move into the nucleoli and, in some cells, the inventors found that their speed was not homogenous over the whole nucleus (see Figure 6B, lower panel).
- the inventors have also checked whether ⁇ -H2AX foci can be observed when lowering the time of incubation of the cells following treatment with G+A ( Figure 13A). Whereas most ⁇ -H2AX-positive nuclei displayed individual foci as observed with H, some of them showed the typical pattern of mid-S phase nuclei (figure 13A, lower panel) that has been observed after transfection of cells with a PCNA-GFP construct (Leonhardt, H. et al.; J. Cell Biol.
- Example 10 Impact of the delivered C6B nanobody on cell survival To assess if the delivered C6B nanobody interferes with the cell response to genotoxic drugs, the inventors performed cell survival assays with transduced H1299 cells and monitored the ⁇ -H2AX levels following pulse-treatment with H for 24 hours. Cells transduced with either PBS, C6B or C6B-dTo grew similarly at day 1, 2 and 3 post-treatment with H ( Figure 6C).
- RNA samples 200 ml of the immunized animals were collected under strict veterinary control and the PBMCs were isolated by Ficoll gradient centrifugation (GE Healthcare, Vélizy-Villacoublay, France).
- TRIzol reagent ThermoFisher Scientific, Grand Island, NY, USA.
- Complementary DNA cDNA was amplified using either SuperScript IV reverse transcriptase (ThermoFischer Scientific) or the BD Smart RACE kit (BD Biosciences).
- VHH repertoires were amplified from the cDNA by two successive PCR reactions using 3 different primer pairs (PCR1, PCR2; Table D) and the VHH fragments were cloned into the SfiI/NotI restriction sites of the pHEN1 phagemid vector.
- the bacterial colonies (approximately 4 x 10 7 independent transformants per library) were infected with M13KO7 helper phage to produce the phage libraries.
- the recombinant phages of each library were purified by PEG 8,000/NaCl precipitation and aliquots were stored at -80°C after addition of 15% glycerol.
- Biopanning was performed with the phospho-peptide (0.5-5 ⁇ g/ml) coated on microtiter wells (ThermoFisher Scientific). Briefly, approximately 10 11 phages in PBS containing 5% nonfat-dried milk were added to uncoated wells for 1 h and subsequently transferred to the peptide-coated wells. After incubation at 20°C for 1 hour, the wells were extensively washed with PBS containing 0.05% Tween 20. Bound phages were eluted with trypsin and amplified in growing TG1 cells for the next round of selection. The amount of phospho-peptide coated on plate was lowered to 0.5 ⁇ g/ml in the second round of selection.
- Phage titers and enrichment after each panning round were determined by infecting TG1 cells with 10-fold serial dilutions of the collected phages and plating on LB agar plates containing 100 ⁇ g/mL ampicillin and 1% glucose. Where indicated, binding of the phages to antigen on plate was revealed with an anti-M13 monoclonal antibody conjugated to horse radish peroxidase (HRP; Abcam, Cambridge, UK). The VHH nucleotide sequences were determined using the M13-RP primer (GATC-Eurofins, Ebersberg, Germany).
- the coding region of the VHH was amplified by SOE-PCR with the primer pairs pETOM-For/G4S-Rev and G4S-For/ E6T-Rev.
- the G4S-Rev and G4S-For are the annealing primers to add the (G4S) 3 linker region.
- the recombinant fragment was cloned into the NcoI-digested pET- C6-E6T-6H plasmid after digestion with NcoI restriction enzyme, thus generating pET-C6B-E6T-6H.
- the inventors amplified by SOE-PCR the coding region of the C6 with primers pETOM-For and pETOM-Rev, in combination with C6-Mut-Rev and C6-Mut- For as annealing primers.
- the resulting PCR fragment was sub-cloned into the NcoI/NotI-digested pET-C6- E6T-6H to obtain pET-C6M-E6T-6H.
- the plasmid pET-C6BM-E6T-6H, which encodes the bivalent form of the mutated C6 coding region was constructed as described above.
- the additional Cys residue in the coding region of the bivalent C6 was obtained by amplification of the C6 coding region with primers VHH- BspHI-For and C6-Cys-Rev and sub-cloned into the pET-C6B-E6T-6H.
- the pET-C6B-mCherry and pET-C6B-dTomato plasmids were constructed by inserting in frame the coding regions of mCherry protein or dTomato protein in the unique BamHI located in the E6 tag region.
- the dTomato coding region was subcloned from the ptdTomato-N1 vector (Clontech, Mountain View, USA). All primers used to generate the above-described plasmids are listed in Table D.
- the VHH variants were expressed in E. coli BL21(DE3) plysS cells by addition of IPTG (1 mM) and incubation overnight at 20°C. The expressed polypeptides were purified as previously described (Desplancq, D.
- the eluted samples were further purified by size exclusion chromatography on a Superdex 7510/300 GL column equilibrated in 20 mM Hepes buffer pH 7.2 containing 50 mM NaCl, 1 mM EDTA, 0.1 mM PMSF and 2 mM TCEP (optional).
- the C6B-mCherry and C6B-dTomato fusion proteins were purified by IMAC chromatography on HITRAP TM columns as above and subsequently polished by size exclusion chromatography on a HILOAD 16/600 Superdex 200 PG column (GE Healthcare) equilibrated in PBS. All purified proteins were stored at -80°C after addition of 10% glycerol.
- microtiter wells (ThermoFisher Scientific) were coated with 1 ⁇ g/mL of phosphorylated or non-phosphorylated peptide CKATQASQEY in PBS overnight at 4°C.
- the purified VHH preparations were diluted in PBS containing 0.2 % non-fat died milk and following incubation at RT for 1 hour they were revealed with mAb 4C6 and subsequent addition of HRP- conjugated rabbit anti-mouse IgG (GE Healthcare).
- the phospho-peptide CKATQA(p)SQEY was immobilized on the biosensor surface (BR-1005-30; GE healthcare) through the SH group of the N-terminal cysteine using thiol coupling chemistry.
- the reference surface was treated similarly except that peptide injection was omitted.
- the purified VHH samples were serially injected in duplicate for 120 seconds over reference and peptide surfaces. Each sample injection was followed by a wash with HBS-P buffer during 600 sec. Sensorgrams were corrected for signals from the reference flow cell as well as after running buffer injections.
- the Kd was determined by fitting the equilibrium response (Req) versus the concentration curve to a 1:1 interaction model with the Biacore 2.0.2 evaluation software (GE Healthcare).
- the peak fractions were concentrated to 5.1 mg/ml with a Amicon Ultra 3K filter (Merck-Millipore).
- the crystallization experiments were carried out by the sitting-drop vapor diffusion method at 20°C using a Mosquito Crystal dispensing robot (TTP Labtech) for mixing equal volumes (200 nL) of the C6-peptide sample and reservoir solutions in 96-well 2-drop MRC crystallization plates (Molecular Dimensions). Crystallization conditions were tested using commercially available screens (Qiagen, Molecular Dimensions). Several wells were found positive after about 1 week of incubation and crystals obtained with 25% PEG 3350, 0.2M sodium acetate.
- the crystals were transferred to 35% PEG 3350, 0.2M sodium acetate before being flash cooled in liquid nitrogen.
- the data were collected at the Proxima 2A beamline of the synchrotron Soleil at a wavelength 0.98 ⁇ (12.65 keV) on an EIGER X 9M detector (Dectris) with 20% transmission. 360° of data were collected using 0.1° oscillation and 0.025 s exposure per image, with a crystal to detector distance of 134.25 mm.
- the data were indexed, integrated, and scaled using XDS (Kabsch, W.; Acta Crystallogr. D Biol. Crystallogr. 2010, 66, 125–132, doi:10.1107/S0907444909047337).
- the 3D structure of the C6/phosphopeptide complex was solved by molecular replacement using the PHASER module of PHENIX (Liebschner, D. et al.; Acta Crystallogr. D Struct. Biol. 2019, 75, 861–877, doi:10.1107/S2059798319011471) with the structure of VHH PorM_01 (PDB ID: 5LZ0) edited to remove water molecules and the CDR loops, being used as a search model.
- refinement was performed using the refine module of PHENIX followed by iterative model building in COOT (Emsley, P. et al.; Acta Crystallogr. D Biol. Crystallogr.
- the cells were treated with either hydroxyurea (H; 2 mM), gemcitabine (G; 0.1 ⁇ M), AZD-7762 (A; 0.1 ⁇ M), clofarabine (C; 0.3 ⁇ M), triapine (T; 2 ⁇ M), camptothecin (CPT, 1 ⁇ M), epirubicin (EPI, 0.5 ⁇ M), etoposide (ETO, 10 ⁇ M), cisplatin (CIS, 10 ⁇ M), oxaliplatin (OXA, 10 ⁇ M) or combinations of two drugs at the same concentration as indicated. All drugs were purchased from Sigma-Aldrich.
- the harvested cells (approximately 10 7 /ml) were lysed for 10 minutes at 4°C in PBS supplemented with 0.5 % Triton X100, 2 mM PMSF, 0.02 % NaN 3 and 1 mM Na 3 VO 4 . After centrifugation for 10 minutes at 6500 g at 4°C, the recovered nuclei were acid extracted overnight at 4°C in 0.2 M HCl. The histone proteins present in the clarified lysate were stored at -20°C. For the analysis of the H1299 proteins by Western blotting, soluble extracts (60 ⁇ g/lane) in RIPA buffer were used.
- ⁇ -H2AX and ⁇ -actin were revealed with monoclonal antibody 3F4 (0.1 ⁇ g/mL) and rabbit polyclonal serum A2066 (Sigma-Aldrich), respectively. Bound secondary HRP-labeled antibodies were revealed with ECL reagent (GE Healthcare) and analyzed with the Image QuantLAS 4000 imager (GE Healthcare). Construction of the p ⁇ -actin plasmids and transient transfection The p ⁇ A-scFv-eGFP, a derivative of pDRIVE-h ⁇ -actin (Rinaldi, A.-S. et al.; Exp. Cell Res.
- This vector which carries unique NcoI and SpeI restriction sites was used to sub-clone the VHH variants as described above, thereby generating p ⁇ A-C6-E6T-mCherry, p ⁇ A-C6M-E6T-mCherry, p ⁇ A- C6B-E6T-mCherry and p ⁇ A-C6BM-E6T-mCherry. All oligonucleotides used to construct these expression vectors are listed in Table D. The day before transfection, 8 x 10 4 cells were plated in 12-well culture plates containing glass coverslips. Transient DNA transfection was performed using jetPRIME (Polyplus Transfection, Illkirch, France) according to manufacturer’s instructions.
- the culture medium was replaced with fresh medium after 4- 24 hours of incubation with the polymer/plasmid mixtures.
- Cells were incubated (37°C, 5% CO2) for 40 hours (H-treated cells) or 24 hours (G+A-treated cells), followed by microscopic analysis.
- Immunofluorescence microscopies For the analysis by classical immunofluorescence microscopy, the transfected or transduced cells were fixed with 4% paraformaldehyde for 20 minutes and, after permeabilization with 0.2% Triton X100 for 5 min, they were incubated with mAb 3F4 or VHH preparations diluted in PBS containing either 10% fetal calf serum or 2% BSA.
- the cells were treated with CSK-100 modified buffer (100 mM NaCl, 300 mM sucrose, 3 mM MgCl 2 , 10 mM HEPES pH 6.8, 1 mM EGTA, and 0.2% Triton X-100) for 5 minutes prior to fixation.
- CSK-100 modified buffer 100 mM NaCl, 300 mM sucrose, 3 mM MgCl 2 , 10 mM HEPES pH 6.8, 1 mM EGTA, and 0.2% Triton X-100
- the VHH molecules were revealed by addition of mAb 4C6 which binds to the E6 tag and bound antibodies were detected with Alexa Fluor 488 or 568 labelled-anti-mouse immunoglobulins (Life Technologies). Where indicated, Alexa 568 labelled-C6B molecules were used.
- Alexa 568 labelled-C6B molecules were used.
- the amount of fluorophore per bivalent C6 in the flow-through was calculated by spectrophotometry with a Nanodrop 2000 device (ThermoFisher Scientific). After incubation of the cells with the different reagents and several washes with PBS, the coverslips were mounted with 4’,6’-diamino- 2phenyl-indole (DAPI) Fluoromount-G (Southern Biotech, Birmingham, USA) and imaged with a Leica DM5500 microscope (Leica, Wetzlar, Germany) equipped with 20X and 63X objectives. The signal was recorded with a Leica DFC350FX camera. Confocal microscopy was performed as previously described (Conic, S. et al.; J.
- Live-sample were illuminated with a laser diode at 561 nm (10 W/cm 2 , Oxxius) at 37°C.
- Real- time imaging was performed by introducing a single edge dichroic mirror and a bandpass filter in the emission path of the microscope (Semrock, 560 nm edge BrightLine single-edge imaging-flat dichroic beamsplitter, 593/40 nm BrightLine single-band bandpass filter) and by using an EM-CCD camera (ImagEM, Hamamatsu, 0.106 ⁇ m pixel size) with a typical integration time of 100 ms.
- the videos were recorded using the perfect focus system of the microscope to avoid z-drift during the acquisition (1 image recorded every minute during 10 minutes). Images were processed using Fiji.
- the improved stack was obtained by computing the difference between A and B.
- the Mosaic plugin was then used on the final stack to reconstruct the single foci trajectories over the whole acquisition.
- Statistical analysis was performed using R software version 3.6.1. Averages are represented as means +/- SD and the number of replicates is indicated in the figure legends. In the boxplots ( Figures 2-5), the bars indicate the median and interquartile range of the recorded fluorescence after processing with R software.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Hematology (AREA)
- Medicinal Chemistry (AREA)
- Urology & Nephrology (AREA)
- Organic Chemistry (AREA)
- Biochemistry (AREA)
- Biomedical Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Genetics & Genomics (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Peptides Or Proteins (AREA)
Abstract
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US18/290,158 US20240272176A1 (en) | 2021-05-12 | 2022-05-11 | Single domain antibody specific for phosphorylated h2ax and its uses |
EP22728599.6A EP4337691A1 (fr) | 2021-05-12 | 2022-05-11 | Anticorps à domaine unique spécifique de h2ax phosphorylé et ses utilisations |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP21305627.8 | 2021-05-12 | ||
EP21305627 | 2021-05-12 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2022238505A1 true WO2022238505A1 (fr) | 2022-11-17 |
Family
ID=76217778
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2022/062831 WO2022238505A1 (fr) | 2021-05-12 | 2022-05-11 | Anticorps à domaine unique spécifique de h2ax phosphorylé et ses utilisations |
Country Status (3)
Country | Link |
---|---|
US (1) | US20240272176A1 (fr) |
EP (1) | EP4337691A1 (fr) |
WO (1) | WO2022238505A1 (fr) |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1994029457A2 (fr) | 1993-06-09 | 1994-12-22 | Unilever N.V. | Procede de production de proteines de fusion comprenant des fragments de scfv a l'aide d'un moule transforme |
WO2015063331A1 (fr) | 2013-11-04 | 2015-05-07 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Anticorps synthétique à domaine unique |
US20160145352A1 (en) * | 2013-06-21 | 2016-05-26 | Institut National De La Recherche Agronomique | Camelid single heavy-chain antibody directed against chromatin and uses of same |
US20190038762A1 (en) * | 2016-02-05 | 2019-02-07 | Millennium Pharmaceuticals, Inc. | Gcc-targeted antibody-drug conjugates |
-
2022
- 2022-05-11 EP EP22728599.6A patent/EP4337691A1/fr active Pending
- 2022-05-11 US US18/290,158 patent/US20240272176A1/en active Pending
- 2022-05-11 WO PCT/EP2022/062831 patent/WO2022238505A1/fr active Application Filing
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1994029457A2 (fr) | 1993-06-09 | 1994-12-22 | Unilever N.V. | Procede de production de proteines de fusion comprenant des fragments de scfv a l'aide d'un moule transforme |
US20160145352A1 (en) * | 2013-06-21 | 2016-05-26 | Institut National De La Recherche Agronomique | Camelid single heavy-chain antibody directed against chromatin and uses of same |
WO2015063331A1 (fr) | 2013-11-04 | 2015-05-07 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Anticorps synthétique à domaine unique |
US20190038762A1 (en) * | 2016-02-05 | 2019-02-07 | Millennium Pharmaceuticals, Inc. | Gcc-targeted antibody-drug conjugates |
Non-Patent Citations (21)
Title |
---|
CONIC, S. ET AL., J. CELL BIOL., vol. 217, 2018, pages 1537 - 1552 |
DESPLANCQ, D. ET AL., J. IMMUNOL. METHODS, vol. 369, 2011, pages 42 - 50 |
EMSLEY, P. ET AL., ACTA CRYSTALLOGR. D BIOL. CRYSTALLOGR., vol. 66, 2010, pages 486 - 501 |
FREUND, G. ET AL., MABS, vol. 5, 2013, pages 518 - 522 |
HAMERS-CASTERMAN ET AL., NATURE, vol. 363, 1993, pages 446 |
JULLIEN ET AL., J. CELL SCI., vol. 129, 2016, pages 2673 - 2683 |
LAFAYE, P. ET AL., MOL. IMMUNOL., vol. 46, 2009, pages 695 - 704 |
LEONHARDT, H. ET AL., J. CELL BIOL., vol. 149, 2000, pages 271 - 280 |
LIEBSCHNER, D. ET AL., ACTA CRYSTALLOGR. D STRUCT. BIOL., vol. 75, 2019, pages 861 - 877 |
MOEGLIN ERIC ET AL: "A Novel Nanobody Precisely Visualizes Phosphorylated Histone H2AX in Living Cancer Cells under Drug-Induced Replication Stress", CANCERS, vol. 13, no. 13, 1 July 2021 (2021-07-01), pages 3317, XP055958055, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8267817/pdf/cancers-13-03317.pdf> DOI: 10.3390/cancers13133317 * |
MOEGLIN ERIC ET AL: "Uniform Widespread Nuclear Phosphorylation of Histone H2AX Is an Indicator of Lethal DNA Replication Stress", CANCERS, vol. 11, no. 3, 13 March 2019 (2019-03-13), pages 355, XP055958072, DOI: 10.3390/cancers11030355 * |
MOEGLIN, E. ET AL., CANCERS, vol. 11, 2019, pages 355 |
MUYLDERMANS, S., ANNU. REV. BIOCHEM., vol. 82, 2013, pages 775 - 797 |
PANZA, P. ET AL., DEVELOPMENT, vol. 142, 2015, pages 1879 - 1884 |
RAJAN ET AL., FEBS OPEN BIO, vol. 5, 2015, pages 779 - 788 |
RAJAN MALINI ET AL: "Generation of an alpaca-derived nanobody recognizing [gamma]-H2AX", FEBS OPEN BIO, vol. 5, no. 1, 1 January 2015 (2015-01-01), US, pages 779 - 788, XP055958281, ISSN: 2211-5463, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4588710/pdf/main.pdf> DOI: 10.1016/j.fob.2015.09.005 * |
RINALDI, A.-S. ET AL., EXP. CELL RES., vol. 319, 2013, pages 838 - 849 |
RITZ, C. ET AL., PLOS ONE, vol. 10, 2015, pages e0146021 |
SAERENS ET AL., CURRENT OPINION IN PHARMACOLOGY, vol. 8, 2008, pages 600 - 608 |
SHANER, N.C. ET AL., NAT. BIOTECHNOL., vol. 22, 2004, pages 1567 - 1572 |
ZEDER-LUTZ, G. ET AL., ANAL. BIOCHEM., vol. 421, 2012, pages 417 - 427 |
Also Published As
Publication number | Publication date |
---|---|
EP4337691A1 (fr) | 2024-03-20 |
US20240272176A1 (en) | 2024-08-15 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Moutel et al. | NaLi-H1: A universal synthetic library of humanized nanobodies providing highly functional antibodies and intrabodies | |
Gonzalez-Sapienza et al. | Single-domain antibodies as versatile affinity reagents for analytical and diagnostic applications | |
KR102425339B1 (ko) | 비타민 d 의 측정을 위한 방법 | |
KR20130048242A (ko) | 항-종양 항원 항체 및 이용 방법 | |
US11372001B2 (en) | Anti-human IgG4 monoclonal antibody and methods of making and using same | |
US11390686B2 (en) | HER3 binding agents and uses thereof | |
Moeglin et al. | A novel nanobody precisely visualizes phosphorylated histone H2AX in living cancer cells under drug-induced replication stress | |
AU2015322658C1 (en) | Method for measuring reactivity of FVlll | |
JP2023527937A (ja) | 抗cldn18.2抗体及びその診断用途 | |
Wagner et al. | Nanobodies–Little helpers unravelling intracellular signaling | |
Rinaldi et al. | The use of fluorescent intrabodies to detect endogenous gankyrin in living cancer cells | |
CA3174692A1 (fr) | Anticorps specifiques de kras et leurs utilisations | |
AU2016378819A1 (en) | Antibodies against immunocomplexes comprising cyanobacterial cyclic peptide hepatotoxins | |
US20220073611A1 (en) | Anti-nmda receptor antibodies and methods of use | |
Frecot et al. | 30 years of nanobodies–an ongoing success story of small binders in biological research | |
US20240272176A1 (en) | Single domain antibody specific for phosphorylated h2ax and its uses | |
AU2018241286A1 (en) | Improved immunogenicity assays | |
JP2021515210A (ja) | 免疫療法のためのバイオマーカーとしてのプロガストリン | |
TW201840588A (zh) | 抗gpr20抗體 | |
Gelová et al. | Protein binder toolbox for studies of solute carrier transporters | |
JP2019532291A (ja) | 多重特異性分子の機能分析のためのsprに基づく二重結合アッセイ | |
JP2023514654A (ja) | ロイシンリッチリピートキナーゼ2のアロステリック調節因子 | |
KR20230018478A (ko) | 인간 면역글로불린 g에 대한 토끼 항체 | |
US20230406919A1 (en) | Nanobodies with specific affinity for voltage gated sodium channels | |
CN117264072B (zh) | 一种抗sn38单抗及其应用 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22728599 Country of ref document: EP Kind code of ref document: A1 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 18290158 Country of ref document: US |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2022728599 Country of ref document: EP |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 2022728599 Country of ref document: EP Effective date: 20231212 |