WO2022232653A1 - Combination of anti-galectin-9 antibodies and chemotherapeutics for use in cancer therapy - Google Patents
Combination of anti-galectin-9 antibodies and chemotherapeutics for use in cancer therapy Download PDFInfo
- Publication number
- WO2022232653A1 WO2022232653A1 PCT/US2022/027142 US2022027142W WO2022232653A1 WO 2022232653 A1 WO2022232653 A1 WO 2022232653A1 US 2022027142 W US2022027142 W US 2022027142W WO 2022232653 A1 WO2022232653 A1 WO 2022232653A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- subject
- dose
- galectin
- administered
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/335—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
- A61K31/337—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having four-membered rings, e.g. taxol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7042—Compounds having saccharide radicals and heterocyclic rings
- A61K31/7052—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
- A61K31/706—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
- A61K31/7064—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
- A61K31/7068—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2851—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the lectin superfamily, e.g. CD23, CD72
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
Definitions
- Galectin-9 is a tandem-repeat lectin consisting of two carbohydrate recognition domains (CRDs) and was discovered and described for the first time in 1997 in patients suffering from Hodgkin’s lymphoma (HL) (Tureci et al., J. Biol. Chem. 1997, 272, 6416-6422). Three isoforms exist, and can be located within the cell or extracellularly. Elevated Galectin-9 levels have been in observed a wide range of cancers, including melanoma, Hodgkin’s lymphoma, hepatocellular, pancreatic, gastric, colon and clear cell renal cell cancers (Wdowiak et al. Int. J. Mol. Sci. 2018, 19, 210).
- Galectin-9 was expressed in 57% of tumors and was significantly increased in the plasma of patients with advanced melanoma compared to healthy controls (Enninga et al., Melanoma Res. 2016 Oct; 26(5): 429-441).
- a number of studies have shown utility for Galectin-9 as a prognostic marker, and more recently as a potential new drug target (Enninga et al., 2016; Kawashima et al. BJU Int 2014; 113: 320-332; Kageshita et al., Int J Cancer. 2002 Jun 20;99(6):809-16, and references therein).
- Galectin-9 has been described to play an important role in in a number of cellular processes such as adhesion, cancer cell aggregation, apoptosis, and chemotaxis. Recent studies have shown a role for Galectin-9 in immune modulation in support of the tumor, e.g., through negative regulation of Thl type responses, Th2 polarization and polarization of macrophages to the M2 phenotype.
- Galectin-9 has also been found to play a role in polarizing T cell differentiation into tumor suppressive phenotypes), as well as promoting tolerogenic macrophage programming and adaptive immune suppression (Daley et al., Nat Med., 2017, 23, 556-567).
- PD AC pancreatic ductal adenocarcinoma
- blockade of the checkpoint interaction between Galectin-9 and the receptor Dectin-1 found on innate immune cells in the tumor microenvironment (TME) has been shown to increase anti-tumor immune responses in the TME and to slow tumor progression (Daley et al., Nat Med., 2017, 23, 556-567).
- Galectin-9 also has been found to bind to CD206, a surface marker of M2 type macrophages, resulting in a reduced secretion of CVL22 (MDC), a macrophage derived chemokine which has been associated with longer survival and lower recurrence risk in lung cancer (Enninga et al, J Pathol. 2018 Aug;245(4):468-477).
- the present disclosure is based on the unexpected discovery that a synergistic effect is observed in combined therapies involving both an exemplary anti-galectin 9 antibody (e.g., G9.2-17(IgG4)) and chemotherapeutics such as gemcitabine and paclitaxel (e.g., nanoparticle albumin-bound paclitaxel or nab-paclitaxel) in an animal model.
- an exemplary anti-galectin 9 antibody e.g., G9.2-17(IgG4)
- chemotherapeutics such as gemcitabine and paclitaxel (e.g., nanoparticle albumin-bound paclitaxel or nab-paclitaxel) in an animal model.
- the present disclosure is based, at least in part, on the unexpectedly discovery that an anti- Galectin 9 antibody G9.2-17 (IgG4) has a quicker clearance rate in human subjects as compared with other antibody therapeutics.
- a treatment regimen comprising a dosing schedule of once every week was developed to ensure a suitable plasma concentration, e.g., a therapeutic systemic exposure level, of the anti-Galectin 9 antibody (anti-Gal-9 antibody) for achieving therapeutic effects.
- a suitable plasma concentration e.g., a therapeutic systemic exposure level
- anti-Galectin 9 antibody anti-Gal-9 antibody
- an anti-galectin-9 antibody e.g., G9.2-17 or a functional variant thereof
- one or more chemotherapeutics e.g., gemcitabine, paclitaxel such as paclitaxel protein-bound (e.g., nab-paclitaxel or Abraxane ® ), or a combination thereof.
- the anti-Gal-9 antibody disclosed herein such as G9.2-17(IgG4) may be administered at a once per week dosing schedule.
- the method for treating a solid tumor disclosed herein may comprise administering to a subject in need thereof an effective amount of an antibody that binds human galectin-9 (anti-Gal-9 antibody).
- the anti-Gal-9 antibody may have the same heavy chain complementarity determining regions (CDRs) and the same light chain CDRs as antibody G9.2-17.
- the subject may be undergoing an anti-cancer therapy comprising one or more chemotherapeutics.
- the method for treating a solid tumor disclosed herein may comprise administering to a subject in need thereof an effective amount of an antibody that binds human galectin-9 (anti-Gal-9 antibody) and an effective amount of one or more chemotherapeutics.
- the anti-Gal-9 antibody may have the same heavy chain complementarity determining regions (CDRs) and the same light chain CDRs as antibody G9.2-17.
- the method for treating a solid tumor disclosed herein may comprise administering to a subject in need thereof an effective amount of one or more chemotherapeutics.
- the subject may be undergoing a therapy comprising an antibody that binds human galectin-9 (anti-Gal-9 antibody), which has the same heavy chain complementarity determining regions (CDRs) and the same light chain CDRs as antibody G9.2-17.
- anti-Gal-9 antibody an antibody that binds human galectin-9
- CDRs heavy chain complementarity determining regions
- the solid tumor is pancreatic ductal adenocarcinoma (PDAC), for example, metastatic PDAC.
- PDAC pancreatic ductal adenocarcinoma
- the subject to be treated by any of the methods disclosed herein may have one or more of the following features: (i) has no resectable cancer; (ii) has no infection by SARS-CoV-2; and (iii) has no active brain or leptomeningeal metastasis.
- the solid tumor is pancreatic ductal adenocarcinoma (PDAC), and the subject has no locally advanced PDAC without distant organ metastatic deposits.
- PDAC pancreatic ductal adenocarcinoma
- the one or more chemotherapeutics involved in any of the methods disclosed herein may comprise an antimetabolite (e.g., a nucleoside analog), a microtubule inhibitor, or a combination thereof.
- an antimetabolite e.g., a nucleoside analog
- the nucleoside analog is gemcitabine and/or the tubulin inhibitor is paclitaxel, for example, nanoparticle albumin-bound paclitaxel (e.g., Abraxane ® ).
- the anti-Galectin-9 antibody is administered to the subject at a dose of about 0.2 mg/kg to about 32 mg/kg (e.g., about 0.2 mg/kg to about 16 mg/kg, 0.5 mg/kg to about 16 mg/kg, about 2 mg/kg to about 32 mg/kg or about 2 mg/kg to about 16 mg/kg, or about 0.2 mg/kg to about 15 mg/kg. or about 0.2 to about 16 mg/kg or higher).
- the anti-Gal-9 antibody is administered to the subject once a week.
- the anti-Gal-9 antibody may be administered to the subject at a dose of about 0.2 mg/kg to about 32 mg/kg once every week.
- the anti- Gal-9 antibody may be administered to the subject at a dose of about 10 mg/kg to about 16 mg/kg once every week.
- the anti-Gal-9 antibody disclosed herein, such as G9.2- 17 (IgG4) may be administered to the subject at a dose of about 650 mg to about 1120 mg once every week.
- the anti-Gal-9 antibody can be administered to the subject at a dose of 10 mg/kg once every week or at a flat dose of about 650-700 mg once every week.
- the anti-Galectin-9 antibody can be administered to the subject at a dose of 16 mg/kg once every week or at a flat dose of about 1040-1120 mg once every week.
- the anti-Gal-9 antibody is administered to the subject once every 2 or 3 weeks. In some embodiments, the anti-Galectin-9 antibody is administered to the subject at a dose selected from 0.2 mg/kg, 0.6 mg/kg, 0.63 mg/kg, 2 mg/kg, 4 mg/kg, 6 mg/kg, 6.3 mg/kg, 8 mg/kg, 10 mg/kg, 12 mg/kg, or 16 mg/kg or higher. In some embodiments, the anti- Galectin-9 antibody is administered to the subject at a dose selected from 2 mg/kg, 4 mg/kg, 8 mg/kg, 12 mg/kg, or 16 mg/kg or higher.
- the anti-Galectin-9 antibody is administered to the subject at a dose selected from 0.2 mg/kg, 0.6 mg/kg, 0.63 mg/kg, 2 mg/kg, 4 mg/kg, 6 mg/kg, 6.3 mg/kg, 10 mg/kg, or 16 mg/kg or higher. In some embodiments, the anti- Galectin-9 antibody is administered to the subject at a dose selected from 0.2 mg/kg, 0.63 mg/kg, 2 mg/kg, 4 mg/kg, 6 mg/kg, 6.3 mg/kg, 8 mg/kg, 10 mg/kg, 12 mg/kg, or 16 mg/kg once every 2 weeks. In some embodiments, the antibody is administered once every 2 weeks.
- the anti-Galectin-9 antibody is administered to the subject at a dose selected from 2 mg/kg, 4 mg/kg, 8 mg/kg, 12 mg/kg, or 16 mg/kg or higher once every 2 weeks. In some embodiments, the antibody is administered once every 2 weeks. In some embodiments, the anti-Galectin-9 antibody is administered to the subject at a dose selected from 0.2 mg/kg, 0.6 mg/kg, 0.63 mg/kg, 2 mg/kg , 4 mg/kg, 6 mg/kg, 6.3 mg/kg, 10 mg/kg, or 16 mg/kg or higher once every 2 weeks.
- the anti-Gal-9 antibody such as G9.2-17 (IgG4) may be administered to a subject at a dose of about 650 mg to about 1120 mg once every 2-6 weeks, for example, once every 2 weeks, once every 3 weeks, or once every 4 weeks.
- the anti-Gal-9 antibody is administered to a subject at a dose of about 650 mg to about 700 mg once every 2-6 weeks, for example, once every 2 weeks, once every 3 weeks, or once every 4 weeks.
- the anti-Gal-9 antibody is administered to a subject at a dose of about 1040 mg to about 1120 mg once every 2-6 weeks, for example, once every 2 weeks, once every 3 weeks, or once every 4 weeks.
- the anti-Gal-9 antibody is administered once every 2 weeks for one cycle, once every 2 weeks for two cycles, once every 2 weeks for 3 cycles, once every 2 weeks for 4 cycles, or once every 2 weeks for more than 4 cycles.
- the duration of treatment is 0-3 months, 0-6 months, 3-6 months, 6-12 months, 12-24 months or longer. In some embodiments, the duration of treatment is 12-24 months or longer.
- the cycles extend for a duration of 3 months to 6 months, or 6 months to 12 months or 12 months to 24 months or longer.
- the cycle length is modified, e.g., temporarily or permanently to a longer duration, e.g., 3 weeks or 4 weeks or 6 weeks.
- the anti-Gal-9 antibody is administered to the subject by intravenous infusion.
- the cancer is PDAC.
- the cancer is metastatic cancer.
- the subject can be administered multiple doses of the anti-Galectin 9 antibody and a later dose is higher than an earlier dose.
- the anti-Gal-9 antibody can be administered to the subject at a dose of about 0.5 mg/kg to about 32 mg/kg once every two weeks by intravenous infusion. In some embodiments, the anti-Gal-9 antibody can be administered to the subject at a dose of about 0.2 mg/kg to about 32 mg/kg once every two weeks by intravenous infusion. In some examples, the anti-Gal9 antibody is administered to the subject at a dose of about 0.5 mg/kg once every two weeks by intravenous infusion. In some embodiments, the anti-Gal-9 antibody can be administered to the subject at a dose of about 2 mg/kg to about 16 mg/kg once every two weeks by intravenous infusion.
- the anti-Gal-9 antibody can be administered to the subject at a dose of about 0.2 mg/kg to about 16 mg/kg or higher once every two weeks by intravenous injection. In some examples, the anti-Gal9 antibody is administered to the subject at a dose of about 0.2 mg/kg once every two weeks by intravenous infusion. In some examples, the anti-Gal9 antibody is administered to the subject at a dose of about 0.6 mg/kg once every two weeks by intravenous infusion. In some examples, the anti- Gal-9 antibody is administered to the subject at a dose of about 0.63 mg/kg once every two weeks by intravenous infusion.
- the anti-Gal9 antibody is administered to the subject at a dose of about 2 mg/kg once every two weeks by intravenous infusion. In some examples, the anti-Gal-9 antibody is administered to the subject at a dose of about 4 mg/kg once every two weeks by intravenous infusion. In some examples, the anti-Gal9 antibody is administered to the subject at a dose of about 6 mg/kg once every two weeks by intravenous infusion. In some examples, the anti-Gal-9 antibody is administered to the subject at a dose of about 6.3 mg/kg once every two weeks by intravenous infusion. In some examples, the anti- Gal9 antibody is administered to the subject at a dose of about 8 mg/kg once every two weeks by intravenous infusion.
- the anti-Gal-9 antibody is administered to the subject at a dose of about 10 mg/kg once every two weeks by intravenous infusion. In some examples, the anti-Gal9 antibody is administered to the subject at a dose of about 12 mg/kg once every two weeks by intravenous infusion. In some examples, the anti-Gal-9 antibody is administered to the subject at a dose of about 16 mg/kg or higher once every two weeks by intravenous infusion. In some examples, the anti-Gal-9 antibody is administered to the subject at a dose of about 32 mg/kg once every two weeks by intravenous infusion. In some embodiments, the anti-Gal-9 antibody may be administered to the subject at a dose of about 10 mg/kg to about 16 mg/kg once every week.
- the one or more chemotherapeutics comprise an antimetabolite, a microtubule inhibitor, or a combination thereof.
- the antimetabolite may be gemcitabine.
- the microtubule inhibitor may be paclitaxel.
- the paclitaxel is a protein-bound paclitaxel, for example, a nanoparticle albumin-bound paclitaxel.
- the one or more chemotherapeutics comprise a combination of gemcitabine and paclitaxel.
- the method comprises a cycle of 28 days, in which the anti-Gal9 antibody is administered to the subject on day 1 and day 15 and gemcitabine and paclitaxel (e.g., nanoparticle albumin-bound paclitaxel) are administered to the subject on day 1, day 8, and day 15.
- the paclitaxel is administered to the subject at 125 mg/m 2 intravenously.
- the gemcitabine is administered to the subject at 1000 mg/m 2 .
- the method disclosed herein may comprise a cycle of 28 days, in which the anti-Gal-9 antibody is administered to the subject on day 1, day 8, day 15, and day 22 and the gemcitabine and paclitaxel are administered to the subject on day 1, day 8, and day 15.
- the paclitaxel is administered to the subject at 125 mg/m 2 intravenously.
- the gemcitabine is administered to the subject at 1000 mg/m 2 .
- the anti-Galectin-9 antibody comprises a light chain complementarity determining region 1 (CDR1) set forth as SEQ ID NO: 1, a light chain complementarity determining region 2 (CDR2) set forth as SEQ ID NO: 2, and a light chain complementarity determining region 3 (CDR3) set forth as SEQ ID NO: 3 and/or comprises a heavy chain complementarity determining region 1 (CDR1) set forth as SEQ ID NO: 4, a heavy chain complementarity determining region 2 (CDR2) set forth as SEQ ID NO: 5, and a heavy chain complementarity determining region 3 (CDR3) set forth as SEQ ID NO: 6.
- CDR1 light chain complementarity determining region 1
- CDR2 light chain complementarity determining region 2
- CDR3 light chain complementarity determining region 3
- the anti-Gal9 antibody may comprise a heavy chain variable region (VH) that comprises the amino acid sequence of SEQ ID NO: 7; and a light chain variable region (VL) that comprises the amino acid sequence of SEQ ID NO: 8.
- VH heavy chain variable region
- VL light chain variable region
- the anti-Gal9 antibody can be an IgG molecule, for example, an IgG4 molecule.
- the anti-Gal9 antibody may comprise a heavy chain that comprises the amino acid sequence of SEQ ID NO: 19 and a light chain that comprises the amino acid sequence of SEQ ID NO: 15.
- the one or more chemotherapeutics can be administered to the subject on a day when the subject receives the anti-Galectin 9 antibody.
- the administration of the one or more chemotherapeutics and the administration of the anti-Galectin 9 antibody can be performed on two consecutive days.
- the administration of the one or more chemotherapeutics can be performed prior to the administration of the anti- Gal- 9 antibody, e.g., on the first dosing day and the anti-Galectin 9 antibody is administered on the subsequent day.
- the subject may be a human patient.
- the subject may comprise galectin-9 positive cancer cells or immune cells.
- the subject may have an elevated level of galectin-9 relative to a control value.
- the subject may have an elevated serum or plasma level of galectin-9 relative to the control value.
- the subject may have received at least one line of systemic anticancer therapy.
- the subject may be free of prior therapy involving gemcitabine and/or paclitaxel or had a prior therapy involving gemcitabine and/or paclitaxel at least six months before administration of the anti-Gal-9 antibody.
- the subject is examined for one or more of the following features before, during, and/or after the treatment: (a) one or more tumor markers in tumor biopsy samples from the subject, optionally wherein the one or more tumor markers comprise CA15-3, CA-125, CEA, CA19-9, and/or alpha fetoprotein, and any other tumor -type specific tumor markers; (b) cytokine profile; and (c) galectin 9 serum/plasma levels, d) peripheral blood mononuclear cell immunophenotyping, e) tumor tissue biopsy/excisional specimen multiplex immunophenotyping, f) tumor tissue biopsy/excisional specimen galectin-9 expression levels and pattern, g) any other immune score test such as: PDL-1 immunohistochemistry, tumor mutational burden (TMB), tumor microsatellite instability status, as well as panels such as: Immunoscore ® - HalioDx, ImmunoSeq- Adaptive Biotechnologies, TIS, developed on the NanoString nCounter ®
- any of the methods disclosed herein may further comprise monitoring occurrence of one or more adverse effects in the subject.
- the one or more adverse effects comprise hepatic impairment, hematologic toxicity, neurologic toxicity, cutaneous toxicity, gastrointestinal toxicity, or a combination thereof.
- the method may further comprise reducing the dose of the anti- Gal9 antibody, the dose of the one or more chemotherapeutics, or both when an adverse effect is observed.
- the method may further comprise reducing the dose of the anti-Gal-9 antibody, the dose of gemcitabine, the dose of paclitaxel, or a combination thereof.
- an anti- Gal-9 antibody dose reduction as per clinician’s assessment or at least by 30% is implemented.
- a reduction level of 30 or 50% of the previous dose level is implemented.
- one more dose reduction by 30% of dose level -1 (the level at first dose reduction) is implemented (dose level -2, the level at second dose reduction).
- one more dose reduction by 50% of dose level -1 is implemented (dose level -2).
- one or more dose reductions by about 10% to about 80% of a previous dose level are implemented.
- one or more dose reductions by about 10% to about 20%, about 20% to about 30%, about 30% to about 40%, about 40% to about 50%, about 50% to about 60%, or about 70% to about 80% of previous levels are implemented.
- one or more dose reductions by 10% to 20%, 20% to 30%, 30% to 40%, 40% to 50%, 50% to 60%, or 70% to 80% of previous levels are implemented.
- one or more dose reductions by about 10%, by about 20%, by about 30%, by about 40%, by about 50%, by about 60%, by about 70%, or by about 80% of previous levels are implemented. In some embodiments, one or more dose reductions by 10%, by 20%, by 30%, by 40%, by 50%, by 60%, by 70%, or by 80% of previous levels are implemented. In some instances, administration of the paclitaxel is withheld when the subject has a level of aspartate transaminase (AST) greater than lOx upper limit of normal (ULN), a level of bilirubin greater than 5x ULN, or both.
- AST aspartate transaminase
- the method may further comprise reducing the dose of the anti-Gal-9 antibody, the dose of the gemcitabine, the dose of the paclitaxel, or a combination thereof, when moderate to severe hepatic impairment is observed. In other instances, the method may further comprise reducing the dose or terminating administration of the anti-Gal-9 antibody, the gemcitabine, the paclitaxel, or a combination thereof, when severe hematologic toxicity, neurologic toxicity, cutaneous toxicity, and/or gastrointestinal toxicity is observed. In some examples, the dose of the paclitaxel is reduced to 100 mg/m 2 - 75 mg/m 2 . In other examples, the dose of the gemcitabine is reduced to 800 mg/m 2 - 600 mg/m 2 .
- compositions for use in treating a solid tumor e.g., those described herein and including metastatic solid tumors
- uses of any of the anti-Galectin-9 antibodies for manufacturing a medicament for treating the solid tumor in combination with one or more chemotherapeutic agents as also disclosed herein.
- Figs. 1A-1D include graphs showing Kaplan-Meier survival curves and log rank tests for orthotopic mPA6115 pancreatic cancer xenograft mouse models grouped by treatment regimens.
- Group 1 untreated;
- Group 2 chemo vehicle control, saline;
- Group 3 Isotype IgGl mouse;
- Group 4 Anti-Gal9 mAh;
- Group 5 Gemcitabine/Abraxane;
- Group 6 Anti-Gal9 mAh and Gemcitabine/Abraxane.
- Fig. 1A shows survival curves for all six groups.
- Fig. IB shows survival curves for Groups 1, 5, and 6.
- Fig. 1C shows survival curves for Groups 1, 4, and 6.
- Fig. ID shows survival curves for Groups 1, 4, 5, and 6.
- Fig. 2 includes a graph showing hazard ratios (HR) and their 95% confidence interval (%95CI) of group 4-6 against group 1, group 2 and group 3 respectively calculated from cox- regression analysis
- group 1 untreated orthotopic mPA6115 mice
- group 2 chemo vehicle control, saline treated orthotopic mPA6115 mice
- group 3 Isotype IgGl mouse treated orthotopic mPA6115 mice
- group 4 Anti-Gal9 mAh treated orthotopic mPA6115 mice
- group 5 Gemcitabine/Abraxane treated ortho topic mPA6115 mice
- group 6 Anti-Gal9 mAh and Gemcitabine/Abraxane treated orthotopic mPA6115 mice.
- Fig. 3 includes a graph the mean body weight of each treatment group as measured twice a week for the study duration
- group 1 untreated orthotopic mPA6115 mice
- group 2 chemo vehicle control, saline treated orthotopic mPA6115 mice
- group 3 Isotype IgGl mouse treated orthotopic mPA6115 mice
- group 4 Anti-Gal9 mAh treated orthotopic mPA6115 mice
- group 5 Gemcitabine/Abraxane treated orthotopic mPA6115 mice
- group 6 Anti-Gal9 mAh and Gemcitabine/Abraxane treated orthotopic mPA6115 mice.
- Fig. 4 is a schematic depicting an exemplary study scheme.
- CRM reassessment method
- RP2D recommended Phase 2 dose
- PK pharmacokinetics
- PD pharmacodynamics
- PDAC pancreatic ductal adenocarcinoma
- CRC colorectal cancer
- CCA cholangiocarcinoma
- TBD to be decided.
- Fig. 5 includes a graph showing the effect of G2.9-17 on TGF-betal secretion measurements in whole blood of an exemplary healthy human donor. TGF-betal release from donor cryopreserved macrophages incubated in the presence of M2 polarization cocktails.
- IgG4 isotype is a negative control antibody. Data represent mean + SEM of triplicate measures. Significance was determined by two-way ANOVA with Dunnett’s multiple comparison test. * p ⁇ 0.05
- Fig. 6 includes a graph showing the effect of G2.9-17 on IL-10 secretion in whole blood of an exemplary healthy human donor.
- IgG4 isotype is a negative control antibody.
- Data represent the mean ( ⁇ SEM) of triplicate. Significance was determined by two-way ANOVA with Tukey’s multiple comparisons test, * P ⁇ 0.05.
- chemotherapeutics such as gemcitabine and paclitaxel (e.g., protein-bound paclitaxel such as nanoparticle albumin-conjugated paclitaxel, for example, Abraxane ® ) for treating solid tumors, for example, pancreatic ductal adenocarcinoma (PDAC).
- solid tumors for example, pancreatic ductal adenocarcinoma (PDAC).
- the solid tumors are metastatic.
- the methods disclosed herein provide specific doses and/or dosing schedules.
- the methods disclosed herein target specific patient populations, for example, patients who have undergone prior treatment and show disease progression through the prior treatment, or patients who are resistant (de novo or acquired) to the prior treatment.
- the methods disclosed herein provide specific doses and/or dosing schedules of the anti-Gal-9 antibody disclosed herein (e.g., G9.2-17(IgG4)) in combination with the chemotherapeutic agents also disclosed herein (e.g., gemcitabine and paclitaxel), for example, 0.2 mg/kg to 16 mg/kg of the antibody once every week to once every 4 weeks (e.g., 0.2 mg/kg, 0.63 mg/kg, 2 mg/kg, 6.3 mg/kg, 10 mg/kg, or 16 mg/kg once every week or once every two weeks).
- the chemotherapeutic agents also disclosed herein
- gemcitabine and paclitaxel for example, 0.2 mg/kg to 16 mg/kg of the antibody once every week to once every 4 weeks (e.g., 0.2 mg/kg, 0.63 mg/kg, 2 mg/kg, 6.3 mg/kg, 10 mg/kg, or 16 mg/kg once every week or once every two weeks).
- the dosing schedule for the anti-Gal9 antibody such as G9.2-17(IgG4) may be 10 mg/kg or 16 mg/kg once every week.
- the anti-Gal9 antibody may be administered to the subject at a dose of about 10 mg/kg to about 16 mg/kg once every week.
- the anti-Gal-9 antibody disclosed herein such as G9.2-17(IgG4) may be administered to the subject at a flat dose, for example, about 650 mg to about 1120 mg (e.g., about 650-700 mg or about 1040-1120 mg) once every week to once every 4 weeks, e.g., once every week or once every two weeks.
- a treatment regimen comprising a dosing schedule of once very week was developed to ensure a systemic exposure level of the anti-Gal-9 antibody that achieves therapeutic effect.
- Galectin-9 a tandem-repeat lectin, is a beta-galactoside-binding protein, which has been shown to have a role in modulating cell-cell and cell-matrix interactions. It is found to be strongly overexpressed in Hodgkin’s disease tissue and in other pathologic states. It has in some instances also been found circulating in the tumor microenvironment (TME).
- TAE tumor microenvironment
- Galectin-9 interacts with Dectin-1, an innate immune receptor which is highly expressed on macrophages in PD AC, as well as on cancer cells (Daley, et al. Nat Med. 2017;23(5):556-6). Regardless of the source of Galectin-9, disruption of its interaction with Dectin-1 has been shown to lead to the reprogramming of CD4 + and CD8 + cells into indispensable mediators of anti-tumor immunity. Thus, Galectin-9 serves as a valuable therapeutic target for blocking the signaling mediated by Dectin-1. Accordingly, in some embodiments, the anti-Galectin-9 antibodies describe herein disrupt the interaction between Galectin-9 and Dectin-1.
- Galectin-9 also interacts with TIM-3, a type I cell surface glycoprotein expressed on the surface of leukemic stem cells in all varieties of acute myeloid leukemia (except for M3 (acute promyelocytic leukemia)), but not expressed in normal human hematopoietic stem cells (HSCs).
- TIM-3 a type I cell surface glycoprotein expressed on the surface of leukemic stem cells in all varieties of acute myeloid leukemia (except for M3 (acute promyelocytic leukemia)), but not expressed in normal human hematopoietic stem cells (HSCs).
- TIM-3 signaling resulting from Galectin-9 ligation has been found to have a pleiotropic effect on immune cells, inducing apoptosis in Thl cells (Zhu et al., Nat Immunol., 2005, 6:1245-1252) and stimulating the secretion of tumor necrosis factor-a (TNF-a), leading to the maturation of monocytes into dendritic cells, resulting in inflammation by innate immunity (Kuchroo et al., Nat Rev Immunol., 2008, 8:577-580).
- Galectin-9/TIM-3 signaling has been found to co-activate NF-KB and b-catenin signaling, two pathways that promote LSC self-renewal (Kikushige et al., Cell Stem Cell, 2015, 17(3):341-352).
- An anti- Galectin-9 antibody that interferes with Galectin-9/TIM-3 binding could have a therapeutic effect, especially with respect to leukemia and other hematological malignancies. Accordingly, in some embodiments, the anti-Galectin-9 antibodies described herein disrupt the interaction between Galectin-9 and TIM- 3.
- Galectin-9 interacts with CD206, a mannose receptor highly expressed on M2 polarized macrophages, thereby promoting tumor survival (Enninga et al., J Pathol. 2018 Aug;245(4):468-477).
- Tumor-associated macrophages expressing CD206 are mediators of tumor immunosuppression, angiogenesis, metastasis, and relapse (see, e.g., Scodeller et al., Sci Rep. 2017 Nov 7;7(1): 14655, and references therein).
- Ml also termed classically activated macrophages
- Thl -related cytokines and bacterial products express high levels of IL-12, and are tumoricidal.
- M2 macrophages
- Th2 -related factors express high level of anti-inflammatory cytokines, such as IL-10, and facilitate tumor progression (Biswas and Mantovani; Nat Immunol. 2010 Oct; 11 ( 10) : 889-96) .
- the pro-tumoral effects of M2 include the promotion of angiogenesis, advancement of invasion and metastasis, and the protection of the tumor cells from chemotherapy-induced apoptosis (Hu et al., Tumour Biol. 2015 Dec; 36(12): 9119-9126, and references therein).
- Tumor-associated macrophages are thought be of M2-like phenotype and have a protumor role.
- Galectin-9 has been shown to mediate myeloid cell differentiation toward an M2 phenotype (Enninga et al., Melanoma Res. 2016 Oct;26(5):429-41). It is possible that Galectin-9 binding CD206 may result in reprogramming TAMs towards the M2 phenotype, similar to what has been previously shown for Dectin. Without wishing to be bound by theory, blocking the interaction of Galectin-9 with CD206 may provide one mechanism by which an anti-Galectin-9 antibody, e.g., a G9.2-17 antibody, can be therapeutically beneficial. Accordingly, in some embodiments, the anti-Galectin-9 antibodies described herein disrupt the interaction between Galectin-9 and CD206.
- Galectin-9 has also been shown to interact with protein disulfide isomerase (PDI) and 4- 1BB (Bi S, et al. Proc Natl Acad Sci USA. 2011; 108(26): 10650-5; Madireddi et al. J Exp Med. 2014;211(7): 1433-48).
- PDI protein disulfide isomerase
- 4- 1BB Bi S, et al. Proc Natl Acad Sci USA. 2011; 108(26): 10650-5; Madireddi et al. J Exp Med. 2014;211(7): 1433-48).
- Anti-Galectin-9 antibodies can serve as therapeutic agents for treating diseases associated with Galectin-9 (e.g., those in which a Galectin-9 signaling plays a role).
- an anti-Galectin-9 antibody may block a signaling pathway mediated by Galectin-9.
- the antibody may interfere with the interaction between Galectin-9 and its binding partner (e.g., Dectin- 1, TIM-3 or CD206), thereby blocking the signaling triggered by the Galectin-9/Ligand interaction.
- an anti-Galectin-9 antibody may also exert its therapeutic effect by inducing blockade and/or cytotoxicity, for example, ADCC, CDC, or ADCP against pathologic cells that express Galectin-9.
- a pathologic cell refers to a cell that contributes to the initiation and/or development of a disease, either directly or indirectly. See, e.g., WO2019/084553, W02020/198390, W02020/0223702, and WO2021022256, the relevant disclosures of each of which are incorporated by reference for the subject matter and purpose referenced herein.
- the anti-Galectin-9 antibodies disclosed herein are capable of suppressing the signaling mediated by Galectin-9 (e.g., the signaling pathway mediated by Galectin-9/Dectin- 1 or Galectin-9/Tim-3) or eliminating pathologic cells expressing Galectin-9 via, e.g., ADCC. Accordingly, the anti-Galectin-9 antibodies described herein can be used for inhibiting any of the Galectin-9 signaling and/or eliminating Galectin-9 positive pathologic cells, thereby benefiting treatment of diseases associated with Galectin-9. See, e.g., WO2019/084553, PCT/US 2020/024767, and PCT/US2020/031181, the relevant disclosures of each of which are incorporated by reference for the purpose and subject matter referenced herein.
- anti-Galectin-9 antibodies and chemotherapeutics for treating certain solid tumors as disclosed herein.
- the present disclosure provides anti-Gal-9 antibody G9.2-17 and functional variants thereof for use in the treatment methods disclosed herein.
- An antibody is an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule.
- antibody e.g., anti-Galectin-9 antibody
- An antibody e.g., anti-Galectin-9 antibody
- an antibody of any class such as IgD, IgE, IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class.
- immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2.
- the heavy-chain constant domains that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively.
- the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
- a typical antibody molecule comprises a heavy chain variable region (VH) and a light chain variable region (VL), which are usually involved in antigen binding.
- VH and VL regions can be further subdivided into regions of hypervariability, also known as “complementarity determining regions” (“CDR”), interspersed with regions that are more conserved, which are known as “framework regions” (“FR”).
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the extent of the framework region and CDRs can be precisely identified using methodology known in the art, for example, by the Rabat definition, the Chothia definition, the AbM definition, the EU definition, the “Contact” numbering scheme, the IMGT” numbering scheme, the “AHo” numbering scheme, and/or the contact definition, all of which are well known in the art. See, e.g., Rabat, E.A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242, Chothia et al., (1989) Nature 342:877; Chothia, C. et al. (1987) J. Mol. Biol.
- the anti-Galectin-9 antibody described herein is a full-length antibody, which contains two heavy chains and two light chains, each including a variable domain and a constant domain.
- the anti-Galectin-9 antibody can be an antigenbinding fragment of a full-length antibody.
- binding fragments encompassed within the term “antigen-binding fragment” of a full length antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; (ii) a F(ab')2 fragment, a bivalent fragment including two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al, (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR) that retains functionality.
- a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CHI domains
- F(ab')2 fragment a bivalent fragment including two Fab fragments
- the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules known as single chain Fv (scFv).
- scFv single chain Fv
- any of the antibodies described herein can be either monoclonal or polyclonal.
- a “monoclonal antibody” refers to a homogenous antibody population and a “polyclonal antibody” refers to a heterogeneous antibody population. These two terms do not limit the source of an antibody or the manner in which it is made.
- Reference antibody G9.2-17 refers to an antibody capable of binding to human Galectin-9 and comprises a heavy chain variable region of SEQ ID NO:7 and a light chain variable domain of SEQ ID NO:8, both of which are provided below.
- the anti-Galectin-9 antibody for use in the methods disclosed herein is the G9.2-17 antibody.
- the anti-Galectin-9 antibody for use in the methods disclosed herein is an antibody having the same heavy chain complementarity determining regions (CDRs) as reference antibody G9.2-17 and/or the same light chain complementarity determining regions as reference antibody G9.2-17.
- Two antibodies having the same VH and/or VL CDRS means that their CDRs are identical when determined by the same approach (e.g., the Rabat approach, the Chothia approach, the AbM approach, the Contact approach, or the IMGT approach as known in the art. See, e.g. , bioinf.org.uk/abs/).
- the heavy and light chain CDRs of reference antibody G9.2-17 is provided in Table 1 below (determined using the Rabat methodology): Table 1. Heavy and Light Chain CDRs of G9.2-17
- the anti-Galectin-9 antibody for use in the methods disclosed herein may comprise (following the Kabat scheme) a heavy chain complementarity determining region 1 (CDR1) set forth as SEQ ID NO: 4, a heavy chain complementarity determining region 2 (CDR2) set forth as SEQ ID NO: 5, and a heavy chain complementarity determining region 3 (CDR3) set forth as SEQ ID NO: 6 and/or may comprise a light chain complementarity determining region 1 (CDR1) set forth as SEQ ID NO: 1, a light chain complementarity determining region 2 (CDR2) set forth as SEQ ID NO: 2, and a light chain complementarity determining region 3 (CDR3) set forth as SEQ ID NO: 3.
- CDR1 heavy chain complementarity determining region 1
- CDR2 light chain complementarity determining region 2
- CDR3 light chain complementarity determining region 3
- the anti- Galectin- 9 antibody can be in any format as disclosed herein, for example, a full-length antibody or a Fab.
- the term “G9.2-17(Ig4)” used herein refers to a G9.2-17 antibody which is an IgG4 molecule.
- the term “G9.2-17 (Fab)” refers to a G9.2-17 antibody, which is a Fab molecule.
- the anti-Galectin-9 antibody or binding portion thereof comprises heavy and light chain variable regions, wherein the light chain variable region CDR1, CDR2, and CDR3 amino acid sequences have at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity to the light chain variable region CDR1, CDR2, and CDR3 amino acid sequences set forth in SEQ ID NOs: 1, 2, and 3, respectively.
- the anti-Galectin-9 antibody or binding portion thereof comprises heavy and light chain variable regions, wherein the heavy chain variable region CDR1, CDR2, and CDR3 amino acid sequences have at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity to the heavy chain variable region CDR1, CDR2, and CDR3 amino acid sequences set forth in SEQ ID NO: 4, 5, and 6, respectively.
- Galectin-9 antibodies e.g., which bind to the CRD1 and/or CRD2 region of Galectin-9 are described in co-owned, co-pending US Patent Application 16/173,970 and in co-owned, co-pending International Patent Applications PCT/US 18/58028 and PCT/US 2020/024767, the contents of each of which are herein incorporated by reference in their entireties.
- the anti-Galectin-9 antibody disclosed herein comprises light chain CDRs that have at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity, individually or collectively, as compared with the corresponding VL CDRS of reference antibody G9.2-17.
- the anti-Galectin-9 antibody comprises heavy chain CDRs that have at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity, individually or collectively, as compared with the corresponding VH CDRS of reference antibody G9.2-17.
- Gapped BLAST can be utilized as described in Altschul et al., Nucleic Acids Res. 25(17):3389-3402, 1997.
- the default parameters of the respective programs e.g., XBLAST and NBLAST.
- the anti-Galectin-9 antibody described herein comprises a VH that comprises the HC CDR1, HC CDR2, and HC CDR3, which collectively contain up to 8 amino acid residue variations (8, 7, 6, 5, 4, 3, 2, or 1 variations(s), including additions, deletions, and/or substitutions) relative to the HC CDR1, HC CDR2, and HC CDR3 of reference antibody G9.2-17.
- the anti- Galectin-9 antibody described herein comprises a VH that comprises the LC CDR1, LC CDR2, and LC CDR3, which collectively contain up to 8 amino acid residue variations (8, 7, 6, 5, 4, 3, 2, or 1 variations(s) including additions, deletions, and/or substitutions) relative to the LC CDR1, LC CDR2, and LC CDR3 of reference antibody G9.2-17.
- amino acid residue variations are conservative amino acid residue substitutions.
- a “conservative amino acid substitution” refers to an amino acid substitution that does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made.
- Variants can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references which compile such methods, e.g., Molecular Cloning: A Laboratory Manual, J. Sambrook, et al., eds., Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1989, or Current Protocols in Molecular Biology, F.M. Ausubel, et al., eds., John Wiley & Sons, Inc., New York.
- amino acids include substitutions made amongst amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D.
- the anti-Galectin-9 antibodies disclosed herein, having the heavy chain CDRs disclosed herein contains framework regions derived from a subclass of germline VH fragment.
- germline VH regions are well known in the art. See, e.g., the IMGT database (www.imgt.org) or at www.vbase2.org/vbstat.php.
- IGHV1 subfamily e.g., IGHV1-2, IGHV1-3, IGHV1-8, IGHV1-18, IGHV1-24, IGHV1-45, IGHV1-46, IGHV1-58, and IGHV1-69
- the IGHV2 subfamily e.g., IGHV2-5, IGHV2-26, and IGHV2-70
- the IGHV3 subfamily e.g., IGHV3-7, IGHV3-9, IGHV3-11, IGHV3-13, IGHV3-15, IGHV3-20, IGHV3-21, IGHV3-23, IGHV3-30, IGHV3-33, IGHV3-43, IGHV3- 48, IGHV3-49, IGHV3-53, IGHV3-64, IGHV3-66, IGHV3-72, and IGHV3-73, IGHV3-74), the IGHV4 subfamily (e.g., IGHV4-4, IGHV4-28, IGH
- the anti-Galectin-9 antibody having the light chain CDRs disclosed herein, contains framework regions derived from a germline VK fragment.
- framework regions derived from a germline VK fragment examples include an IGKV1 framework (e.g., IGKV1-05, IGKV1-12, IGKV1- 27, IGKV1-33, or IGKV1-39), an IGKV2 framework (e.g., IGKV2-28), an IGKV3 framework (e.g., IGKV3-11, IGKV3-15, or IGKV3-20), and an IGKV4 framework (e.g., IGKV4-1).
- IGKV1 framework e.g., IGKV1-05, IGKV1-12, IGKV1- 27, IGKV1-33, or IGKV1-39
- an IGKV2 framework e.g., IGKV2-28
- an IGKV3 framework e.g
- the anti-Galectin-9 antibody comprises a light chain variable region that contains a framework derived from a germline nl fragment.
- a framework derived from a germline nl fragment examples include an IGkl framework (e.g., IGkV l-36, IGkV 1 -40, IGkV 1 -44, IGkV l-47, IGkV l-S l ), an IOl2 framework (e.g., IGkV2-8, IGkV2- 1 1 , IGkV2- 14, IGkV2- 18, IGkV2-23j, an IGL3 framework (e.g., IGXV3-1, IGXV3-9, IGXV3-10, IGXV3-12, IGXV3-16, IGXV3-19, IGXV3-21, IGXV3- 25, IGXV3-27,), an IOl4 framework (e.g., IGkV4-3, IGkV
- the anti-Galectin-9 antibody for use in the method disclosed herein can be an antibody having the same heavy chain variable region (VH) and/or the same light chain variable region (VL) as reference antibody Q9-2- ⁇ 7, the VH and VL region amino acid sequences are provided below:
- the anti-Galectin-9 antibody has at least 80% sequence identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%identity) to the heavy chain variable region of SEQ ID NO: 7.
- the anti-Galectin-9 antibody has at least 80% sequence identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%,
- the anti-Galectin-9 antibody disclosed herein is a functional variant of reference antibody G9.2-17.
- a functional variant can be structurally similar as the reference antibody (e.g., comprising the limited number of amino acid residue variations in one or more of the heavy chain and/or light chain CDRs as G9.2-17 as disclosed herein, or the sequence identity relative to the heavy chain and/or light chain CDRs of G9.2-17, or the VH and/or VL of G9.2-17 as disclosed herein) with substantially similar binding affinity (e.g., having a KD value in the same order) to human Galectin-9.
- the anti-Galectin-9 antibody as described herein can bind and inhibit the activity of Galectin-9 by at least 20% (e.g., 31%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90%, 95% or greater, including any increment therein).
- the apparent inhibition constant (Ki aPP or Ki ,apP ) which provides a measure of inhibitor potency, is related to the concentration of inhibitor required to reduce enzyme activity and is not dependent on enzyme concentrations.
- the inhibitory activity of an anti-Galectin-9 antibody described herein can be determined by routine methods known in the art.
- the Ki , app value of an antibody may be determined by measuring the inhibitory effect of different concentrations of the antibody on the extent of the reaction (e.g., enzyme activity); fitting the change in pseudo-first order rate constant (v) as a function of inhibitor concentration to the modified Morrison equation (Equation 1) yields an estimate of the apparent Ki value.
- the Ki app can be obtained from the y-intercept extracted from a linear regression analysis of a plot of K i , app versus substrate concentration.
- the anti-Galectin-9 antibody described herein has a Ki app value of 1000, 900, 800, 700, 600,
- the anti-Galectin-9 antibody has a lower Ki app for a first target (e.g., the CRD2 of Galectin-9) relative to a second target (e.g., CRD1 of the Galectin-9). Differences in Ki app (e.g., for specificity or other comparisons) can be at least 1.5, 2, 3, 4, 5, 10, 15, 20, 37.5, 50, 70, 80, 91, 100, 500, 1000, 10,000 or 10 5 fold.
- the anti-Galectin-9 antibody inhibits a first antigen (e.g., a first protein in a first conformation or mimic thereof) greater relative to a second antigen (e.g., the same first protein in a second conformation or mimic thereof; or a second protein).
- a first antigen e.g., a first protein in a first conformation or mimic thereof
- a second antigen e.g., the same first protein in a second conformation or mimic thereof; or a second protein.
- any of the anti-Galectin-9 antibodies is further affinity matured to reduce the Ki app of the antibody to the target antigen or antigenic epitope thereof.
- the anti-Galectin-9 antibody suppresses Dectin-1 signaling, e.g., in tumor infiltrating immune cells, such as macrophages. In some embodiments, the anti- Galectin-9 antibody suppresses Dectin-1 signaling triggered by Galectin-9 by at least 30%
- inhibitory activity can be determined by conventional methods, such as routine assays.
- the anti-Galectin-9 antibody suppresses the T cell immunoglobulin mucin-3 (TIM-3) signaling initiated by Galectin-9.
- the anti-Galectin-9 antibody suppresses the T cell immunoglobulin mucin-3 (TIM-3) signaling, e.g., in tumor infiltrating immune cells, e.g., in some embodiments by at least 30% (e.g., 31%, 35%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or greater, including any increment therein).
- TIM-3 T cell immunoglobulin mucin-3
- Such inhibitory activity can be determined by conventional methods, such as routine assays.
- the anti-Galectin-9 antibody suppresses the CD206 signaling, e.g., in tumor infiltrating immune cells. In some embodiments, the anti-Galectin-9 antibody suppresses the CD206 signaling triggered by Galectin-9 by at least 30% (e.g., 31%, 35%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or greater, including any increment therein). Such inhibitory activity can be determined by conventional methods, such as routine assays. In some embodiments, the anti-Galectin-9 antibody blocks or prevents binding of Galectin-9 to CD206 by at least 30% (e.g., 31%, 35%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or greater, including any increment therein). Such inhibitory activity can be determined by conventional methods, such as routine assays.
- the anti-Galectin-9 antibody induces cell cytotoxicity, such as ADCC, in target cells expressing Galectin-9, e.g., wherein the target cells are cancer cells or immune suppressive immune cells.
- the anti-Galectin-9 antibody induces apoptosis in immune cells, such as T cells, or cancer cells by at least 30% (e.g., 31%, 35%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or greater, including any increment therein).
- Such inhibitory activity can be determined by conventional methods, such as routine assays.
- any of the anti-Galectin-9 antibodies described herein induce cell cytotoxicity such as complement-dependent cytotoxicity (CDC) against target cells expressing Galectin-9.
- CDC complement-dependent cytotoxicity
- ADCP Antibody-dependent cell-mediated phagocytosis
- Fc ⁇ RI, and Fc ⁇ RIIIa of which Fc ⁇ RIIa (CD32a) on macrophages represent the predominant pathway.
- the anti-Galectin-9 antibody induces cell phagocytosis of target cells, e.g., cancer cells or immune suppressive immune cells expressing Galectin-9 (ADCP).
- the anti-Galectin-9 antibody increases phagocytosis of target cells, e.g., cancer cells or immune suppressive immune cells, by at least 30% (e.g., 31%, 35%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or greater, including any increment therein).
- the anti-Galectin-9 antibody described herein induces cell cytotoxicity such as complement-dependent cytotoxicity (CDC) against target cells, e.g., cancer cells or immune suppressive immune cells.
- CDC complement-dependent cytotoxicity
- the anti-Galectin-9 antibody increases CDC against target cells by at least 30% (e.g., 31%, 35%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or greater, including any increment therein).
- the anti-Galectin-9 antibody induces T cell activation, e.g., in tumor infiltrating T cells, i.e., suppress Galectin-9 mediated inhibition of T cell activation, either directly or indirectly.
- the anti-Galectin-9 antibody promotes T cell activation by at least 30% (e.g., 31%, 35%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or greater, including any increment therein).
- T cell activation can be determined by conventional methods, such as assays (e.g., measurement of CD44, TNF alpha, IFNgamma, and/or PD-1).
- the anti-Galectin-9 antibody promotes CD4+ cell activation by at least 30% (e.g., 31%, 35%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or greater, including any increment therein).
- the anti-Galectin antibody induces CD44 expression in CD4+ cells.
- the anti-Galectin-9 antibody increases CD44 expression in CD4+ cells by at least 30% (e.g., 31%, 35%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or greater, including any increment therein).
- the anti-Galectin antibody induces IFNgamma expression in CD4+ cells.
- the anti- Galectin-9 antibody increases IFNgamma expression in CD4+ cells by at least 30% (e.g., 31%, 35%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or greater, including any increment therein).
- the anti-Galectin antibody induces TNFalpha expression in CD4+ cells.
- the anti-Galectin-9 antibody increases TNFalpha expression in CD4+ cells by at least 30% (e.g., 31%, 35%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or greater, including any increment therein).
- the anti-Galectin-9 antibody promotes CD8+ cell activation by at least 30% (e.g., 31%, 35%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or greater), including any increment therein).
- the anti-Galectin antibody induces CD44 expression in CD8+ cells.
- the anti-Galectin-9 antibody increases CD44 expression in CD8+ cells by at least 30% (e.g., 31%, 35%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or greater, including any increment therein).
- the anti-Galectin antibody induces IFNgamma expression in CD8+ cells.
- the anti- Galectin-9 antibody increases IFNgamma expression in CD8+ cells by at least 30% (e.g., 31%, 35%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or greater, including any increment therein).
- the anti-Galectin antibody induces TNFalpha expression in CD8+ cells.
- the anti-Galectin-9 antibody increases TNFalpha expression in CD8+ cells by at least 30% (e.g., 31%, 35%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or greater, including any increment therein).
- an anti-Galectin-9 antibody as described herein has a suitable binding affinity for the target antigen (e.g. , Galectin-9) or antigenic epitopes thereof.
- binding affinity refers to the apparent association constant or KA.
- the KA is the reciprocal of the dissociation constant (KD).
- the anti-Galectin-9 antibody described herein may have a binding affinity (KD) of at least 10 -5 , 10 -6 , 10 -7 , 10 -8 , 10 -9 , 10 -10 M, or lower for the target antigen or antigenic epitope.
- KD binding affinity
- An increased binding affinity corresponds to a decreased KD.
- Binding affinity can be determined by a variety of methods including equilibrium dialysis, equilibrium binding, gel filtration, ELISA, surface plasmon resonance, or spectroscopy (e.g., using a fluorescence assay). Exemplary conditions for evaluating binding affinity are in HBS-P buffer (10 mM HEPES pH7.4, 150 mM NaCl, 0.005% (v/v) Surfactant P20).
- KA affinity-binding affinity
- a quantitative measurement of affinity e.g., determined using a method such as ELISA or FACS analysis
- KA proportional to KA, and thus can be used for comparisons, such as determining whether a higher affinity is, e.g., 2-fold higher, to obtain a qualitative measurement of affinity, or to obtain an inference of affinity, e.g., by activity in a functional assay, e.g., an in vitro or in vivo assay.
- the in vitro binding assay is indicative of in vivo activity.
- the in vitro binding assay is not necessarily indicative of in vivo activity.
- tight binding is beneficial, but in other cases tight binding is not as desirable in vivo, and an antibody with lower binding affinity is more desirable.
- the heavy chain of any of any of the anti-Galectin-9 antibodies as described herein further comprise a heavy chain constant region (CH) or a portion thereof (e.g., CH1, CH2, CH3, or a combination thereof).
- the heavy chain constant region can be of any suitable origin, e.g., human, mouse, rat, or rabbit.
- the heavy chain constant region is from a human IgG (a gamma heavy chain) of any IgG subfamily as described herein.
- the heavy chain constant region of the antibodies described herein comprise a single domain (e.g., CH1, CH2, or CH3) or a combination of any of the single domains, of a constant region (e.g., SEQ ID NOs: 10, 12-14, and 21).
- the light chain constant region of the antibodies described herein comprise a single domain (e.g., CL), of a constant region. Exemplary light and heavy chain sequences are listed below. Exemplary light and heavy chain sequences are listed below.
- the hlgGl LALA sequence includes two mutations, L234A and L235A (EU numbering), which suppress FcgR binding as well as a P329G mutation (EU numbering) to abolish complement Clq binding, thus abolishing all immune effector functions.
- the hIgG4 Fab Arm Exchange Mutant sequence includes a mutation to suppress Fab Arm Exchange (S228P; EU numbering).
- An IL2 signal sequence (MYRMQLLSCIALSLALVTNS; SEQ ID NO: 9) can be located N-terminally of the variable region. It is used in expression vectors, which is cleaved during secretion and thus not in the mature antibody molecule.
- hlgGl Heavy Chain Constant Region SEQ ID NO: 10.
- the heavy chain constant region in an anti-Galectin-9 antibody disclosed herein may have the C-terminal Lysine (K) residue removed for, e.g., manufacturing purposes.
- K C-terminal Lysine
- the corresponding amino acid sequences of those having no terminal K residue are provided below: hlgGl Heavy Chain Constant Region with No C-Terminal Lysine (SEQ ID NO: 24)
- VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSPG* hIgG4 mut Heavy Chain Constant Region with No C-Terminal Lysine SEQ ID NO: 29
- anti-Galectin-9 antibodies having any of the above heavy chain constant regions are paired with a light chain having the following light chain constant region:
- the anti-Galectin-9 antibody comprises a heavy chain IgGl constant region that has at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity to SEQ ID NO: 10.
- the constant region of the anti-Galectin-9 antibody comprises a heavy chain IgGl constant region comprising SEQ ID NO: 13.
- the constant region of the anti-Galectin-9 antibody comprises a heavy chain IgG4 constant region consisting of SEQ ID NO: 10.
- the anti-Galectin-9 antibody comprises a heavy chain IgG4 constant region that has at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity to SEQ ID NO: 13.
- the anti-Galectin-9 antibody comprises a heavy chain IgG4 constant region comprising SEQ ID NO: 13.
- the anti-Galectin-9 antibody comprises a heavy chain IgG4 constant region consisting of SEQ ID NO: 13.
- the constant region is from human IgG4.
- the anti-Galectin-9 antibody comprises a heavy chain IgG4 constant region that has at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity to SEQ ID NO: 20.
- the anti-Galectin- 9 antibody comprises a heavy chain IgG4 constant region comprising SEQ ID NO: 20.
- the anti-Galectin-9 antibody comprises a heavy chain IgG4 constant region consisting of SEQ ID NO: 20.
- the anti-Galectin-9 antibody comprises a light chain constant region that has at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity to SEQ ID NO: 11.
- the anti-Galectin-9 antibody comprises a light chain constant region comprising SEQ ID NO: 11.
- the anti-Galectin-9 antibody comprises a light chain constant region consisting of SEQ ID NO: 11.
- the IgG is a mutant with minimal Fc receptor engagement.
- the constant region is from a human IgGl LALA.
- the anti- Galectin-9 antibody comprises a heavy chain IgGl constant region that has at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity to SEQ ID NO: 12.
- the anti-Galectin-9 antibody comprises a heavy chain IgGl constant region comprising SEQ ID NO: 12.
- the anti-Galectin-9 antibody comprises a heavy chain IgGl constant region consisting of SEQ ID NO: 12.
- the anti-Galectin-9 antibody comprises a modified constant region.
- the anti-Galectin-9 antibody comprise a modified constant region that is immunologically inert, e.g., does not trigger complement mediated lysis, or does not stimulate antibody-dependent cell mediated cytotoxicity (ADCC). ADCC activity can be assessed using methods disclosed in U.S. Pat. No. 5,500,362.
- the constant region is modified as described in Eur. J. Immunol. (1999) 29:2613-2624; PCT Application No. PCT/GB99/01441; and/or UK Patent Application No. 9809951.8.
- the IgG4 constant region is a mutant with reduced heavy chain exchange.
- the constant region is from a human IgG4 Fab Arm Exchange mutant S228P.
- the constant region of the anti-Galectin-9 antibody comprises a heavy chain IgG4 constant region that has at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity to SEQ ID NO: 14.
- the constant region of the anti-Galectin-9 antibody comprises a heavy chain IgG4 constant region comprising SEQ ID NO: 14.
- the constant region of the anti-Galectin-9 antibody comprises a heavy chain IgG4 constant region consisting of SEQ ID NO: 14.
- the anti-Galectin-9 antibody comprises a heavy chain IgG4 constant region that has at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity to SEQ ID NO: 21.
- the anti-Galectin-9 antibody comprises a heavy chain IgG4 constant region comprising SEQ ID NO: 21.
- the anti-Galectin-9 antibody comprises a heavy chain IgG4 constant region consisting of SEQ ID NO: 21.
- the anti-Galectin -9 antibody has chains corresponding to SEQ ID NO: 15 for the light chains; and the amino acid sequences of exemplary heavy chains correspond to SEQ ID NOs: 10 (hlgGl); 12 (hlgGl LALA); 13 (MgG4); 20 (MgG4); 14 (hIgG4 mut); and 21 (hIgG4 mut).
- the anti-Galectin-9 antibody has a light chain comprising, consisting essentially of, or consisting of SEQ ID NO: 15. In some embodiments, the anti- Galectin-9 antibody has a heavy chain comprising, consisting essentially of, or consisting of any one of the sequences selected from the group consisting of SEQ ID NO: 16-19, 22 and 23. In some embodiments, the anti-Galectin-9 antibody has a light chain comprising, consisting essentially of, or consisting of SEQ ID NO: 15 and a heavy chain comprising, consisting essentially of, or consisting of any one of the sequences selected from the group consisting of SEQ ID NO: 16-19.
- the anti-Galectin-9 antibody has a light chain comprising SEQ ID NO: 15 and a heavy chain comprising any one of the sequences selected from the group consisting of SEQ ID NO: 16-19, 22 and 23. In some embodiments, the anti- Galectin-9 antibody has a light chain consisting essentially of SEQ ID NO: 15 and a heavy chain consisting essentially of any one of the sequences selected from the group consisting of SEQ ID NO: 16-19, 22 and 23. In some embodiments, the anti-Galectin-9 antibody has a light chain consisting of SEQ ID NO: 15 and a heavy chain consisting of any one of the sequences selected from the group consisting of SEQ ID NO: 16-19, 22 and 23.
- the anti-Galectin-9 antibody has a light chain consisting essentially of SEQ ID NO: 15 and a heavy chain consisting essentially of SEQ ID NO: 19. In another specific embodiment, the anti-Galectin-9 antibody has a light chain consisting essentially of SEQ ID NO: 15 and a heavy chain consisting essentially of SEQ ID NO: 20.
- the anti-Galectin-9 antibody comprises a heavy chain sequence having at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity to SEQ ID NO: 16.
- the anti-Galectin-9 antibody comprises a heavy chain sequence comprising SEQ ID NO: 16.
- the anti-Galectin-9 antibody comprises a heavy chain sequence consisting of SEQ ID NO: 16.
- the anti-Galectin-9 antibody comprises a heavy chain sequence having at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity to SEQ ID NO: 17.
- the anti-Galectin-9 antibody comprises a heavy chain sequence comprising SEQ ID NO: 17.
- the anti-Galectin-9 antibody comprises a heavy chain sequence consisting of SEQ ID NO: 17.
- the anti-Galectin-9 antibody comprises a heavy chain sequence having at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity to SEQ ID NO: 18.
- the anti-Galectin-9 antibody comprises a heavy chain sequence comprising SEQ ID NO: 18.
- the anti-Galectin-9 antibody comprises a heavy chain sequence consisting of SEQ ID NO: 18.
- the anti-Galectin-9 antibody comprises a heavy chain sequence having at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity to SEQ ID NO: 22.
- the anti-Galectin-9 antibody comprises a heavy chain sequence comprising SEQ ID NO: 22.
- the anti-Galectin-9 antibody comprises a heavy chain sequence consisting of SEQ ID NO: 22.
- the anti-Galectin-9 antibody comprises a heavy chain sequence having at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity to SEQ ID NO: 19.
- the anti-Galectin-9 antibody comprises a heavy chain sequence comprising SEQ ID NO: 19.
- the anti-Galectin-9 antibody comprises a heavy chain sequence consisting of SEQ ID NO: 19.
- the anti-Galectin-9 antibody comprises a heavy chain sequence having at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity to SEQ ID NO: 23.
- the anti-Galectin-9 antibody comprises a heavy chain sequence comprising SEQ ID NO: 23.
- the anti-Galectin-9 antibody comprises a heavy chain sequence consisting of SEQ ID NO: 23.
- the anti-Galectin-9 antibody comprises a light chain sequence having at least 80% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% and any increment therein) sequence identity to SEQ ID NO: 15.
- the anti-Galectin-9 antibody comprises a light chain sequence comprising SEQ ID NO: 15.
- the anti-Galectin-9 antibody comprises a light chain sequence consisting of SEQ ID NO: 15.
- the anti-Galectin-9 antibody used in the treatment methods disclosed herein has a heavy chain of SEQ ID NO: 19 and a light chain of SEQ ID NO: 15.
- the anti-Galectin-9 antibody used in the treatment methods disclosed herein is G9.2-17 IgG4. In some examples, such an anti-Galectin-9 antibody does not have the C-terminal lysine residue in its heavy chain.
- Antibodies capable of binding Galectin-9 as described herein can be made by any method known in the art, including but not limited to, recombinant technology. One example is provided below.
- Nucleic acids encoding the heavy and light chain of an anti-Galectin-9 antibody as described herein can be cloned into one expression vector, each nucleotide sequence being in operable linkage to a suitable promoter.
- each of the nucleotide sequences encoding the heavy chain and light chain is in operable linkage to a distinct promoter.
- the nucleotide sequences encoding the heavy chain and the light chain can be in operable linkage with a single promoter, such that both heavy and light chains are expressed from the same promoter.
- an internal ribosomal entry site IRS
- the nucleotide sequences encoding the two chains of the antibody are cloned into two vectors, which can be introduced into the same or different cells.
- the two chains are expressed in different cells, each of them can be isolated from the host cells expressing such and the isolated heavy chains and light chains can be mixed and incubated under suitable conditions allowing for the formation of the antibody.
- a nucleic acid sequence encoding one or all chains of an antibody can be cloned into a suitable expression vector in operable linkage with a suitable promoter using methods known in the art.
- the nucleotide sequence and vector can be contacted, under suitable conditions, with a restriction enzyme to create complementary ends on each molecule that can pair with each other and be joined together with a ligase.
- synthetic nucleic acid linkers can be ligated to the termini of a gene. These synthetic linkers contain nucleic acid sequences that correspond to a particular restriction site in the vector. The selection of expression vectors/promoter would depend on the type of host cells for use in producing the antibodies.
- promoters can be used for expression of the antibodies described herein, including, but not limited to, cytomegalovirus (CMV) intermediate early promoter, a viral LTR such as the Rous sarcoma vims LTR, HIV-LTR, HTLV-1 LTR, the simian virus 40 (SV40) early promoter, E. coli lac UV5 promoter, and the herpes simplex tk vims promoter.
- CMV cytomegalovirus
- a viral LTR such as the Rous sarcoma vims LTR, HIV-LTR, HTLV-1 LTR
- SV40 simian virus 40
- E. coli lac UV5 promoter E. coli lac UV5 promoter
- herpes simplex tk vims promoter the herpes simplex tk vims promoter.
- Regulatable promoters can also be used.
- Such regulatable promoters include those using the lac repressor from E. coli as a transcription modulator to regulate transcription from lac operator-bearing mammalian cell promoters [Brown, M. et al., Cell, 49:603-612 (1987)], those using the tetracycline repressor (tetR) [Gossen, M., and Bujard, H., Proc. Natl. Acad. Sci. USA 89:5547-5551 (1992); Yao, F. et al., Human Gene Therapy, 9:1939-1950 (1998); Shockelt, P., et al., Proc. Natl. Acad. Sci.
- Regulatable promoters that include a repressor with the operon can be used.
- the lac repressor from E. coli can function as a transcriptional modulator to regulate transcription from lac operator-bearing mammalian cell promoters (M. Brown et al., Cell, 49:603-612 (1987); Gossen and Bujard (1992); M. Gossen et al., Natl. Acad. Sci.
- tetracycline repressor tetR
- VP 16 transcription activator
- tetO-bearing minimal promoter derived from the human cytomegalovirus (hCMV) major immediate-early promoter to create a tetR-tet operator system to control gene expression in mammalian cells.
- hCMV human cytomegalovirus
- a tetracycline inducible switch is used.
- tetracycline repressor alone, rather than the tetR-mammalian cell transcription factor fusion derivatives can function as potent trans-modulator to regulate gene expression in mammalian cells when the tetracycline operator is properly positioned downstream for the TATA element of the CMVIE promoter (Yao et al., Human Gene Therapy, 10(16): 1392-1399 (2003)).
- tetracycline inducible switch is that it does not require the use of a tetracycline repressor-mammalian cells trans activator or repressor fusion protein, which in some instances can be toxic to cells (Gossen et al., Natl.
- the vector can contain, for example, some or all of the following: a selectable marker gene, such as the neomycin gene for selection of stable or transient transfectants in mammalian cells; enhancer/promoter sequences from the immediate early gene of human CMV for high levels of transcription; transcription termination and RNA processing signals from SV40 for mRNA stability; SV40 polyoma origins of replication and ColEl for proper episomal replication; internal ribosome binding sites (IRESes), versatile multiple cloning sites; and T7 and SP6 RNA promoters for in vitro transcription of sense and antisense RNA.
- a selectable marker gene such as the neomycin gene for selection of stable or transient transfectants in mammalian cells
- enhancer/promoter sequences from the immediate early gene of human CMV for high levels of transcription
- transcription termination and RNA processing signals from SV40 for mRNA stability
- SV40 polyoma origins of replication and ColEl for proper episomal replication
- polyadenylation signals useful to practice the methods described herein include, but are not limited to, human collagen I polyadenylation signal, human collagen II polyadenylation signal, and SV40 polyadenylation signal.
- One or more vectors comprising nucleic acids encoding any of the antibodies may be introduced into suitable host cells for producing the antibodies.
- the host cells can be cultured under suitable conditions for expression of the antibody or any polypeptide chain thereof.
- Such antibodies or polypeptide chains thereof can be recovered by the cultured cells (e.g., from the cells or the culture supernatant) via a conventional method, e.g., affinity purification.
- polypeptide chains of the antibody can be incubated under suitable conditions for a suitable period of time allowing for production of the antibody.
- methods for preparing an antibody described herein involve a recombinant expression vector that encodes both the heavy chain and the light chain of an anti- Galectin-9 antibody, as also described herein.
- the recombinant expression vector can be introduced into a suitable host cell (e.g., a dhfr- CHO cell) by a conventional method, e.g., calcium phosphate-mediated transfection.
- a suitable host cell e.g., a dhfr- CHO cell
- Positive transformant host cells can be selected and cultured under suitable conditions allowing for the expression of the two polypeptide chains that form the antibody, which can be recovered from the cells or from the culture medium.
- the two chains recovered from the host cells can be incubated under suitable conditions allowing for the formation of the antibody.
- two recombinant expression vectors are provided, one encoding the heavy chain of the anti-Galectin-9 antibody and the other encoding the light chain of the anti- Galectin-9 antibody.
- Both of the two recombinant expression vectors can be introduced into a suitable host cell (e.g., dhfr- CHO cell) by a conventional method, e.g., calcium phosphate- mediated transfection.
- each of the expression vectors can be introduced into a suitable host cells. Positive transformants can be selected and cultured under suitable conditions allowing for the expression of the polypeptide chains of the antibody.
- the antibody produced therein can be recovered from the host cells or from the culture medium.
- the polypeptide chains can be recovered from the host cells or from the culture medium and then incubated under suitable conditions allowing for formation of the antibody.
- the two expression vectors are introduced into different host cells, each of them can be recovered from the corresponding host cells or from the corresponding culture media. The two polypeptide chains can then be incubated under suitable conditions for formation of the antibody.
- Standard molecular biology techniques are used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recovery of the antibodies from the culture medium.
- some antibodies can be isolated by affinity chromatography with a Protein A or Protein G coupled matrix.
- nucleic acids encoding the heavy chain, the light chain, or both of an anti- Galectin-9 antibody as described herein vectors (e.g., expression vectors) containing such; and host cells comprising the vectors are within the scope of the present disclosure.
- Anti-Galectin-9 antibodies thus prepared can be characterized using methods known in the art, whereby reduction, amelioration, or neutralization of Galectin-9 biological activity is detected and/or measured.
- an ELISA-type assay is suitable for qualitative or quantitative measurement of Galectin-9 inhibition of Dectin- 1 or TIM-3 signaling.
- the bioactivity of an anti-Galectin-9 antibody can verified by incubating a candidate antibody with Dectin- 1 and Galectin-9, and monitoring any one or more of the following characteristics: (a) binding between Dectin- 1 and Galectin-9 and inhibition of the signaling transduction mediated by the binding; (b) preventing, ameliorating, or treating any aspect of a solid tumor; (c) blocking or decreasing Dectin-1 activation; (d) inhibiting (reducing) synthesis, production or release of Galectin-9.
- TIM-3 can be used to verify the bioactivity of an anti-Galectin-9 antibody using the protocol described above.
- CD206 can be used to verify the bioactivity of an anti-Galectin-9 antibody using the protocol described above.
- bioactivity or efficacy is assessed in a subject, e.g., by measuring peripheral and intra- tumoral T cell ratios, T cell activation, or by macrophage phenotyping.
- Additional assays to determine bioactivity of an anti-Galectin-9 antibody include measurement of CD8+ and CD4+ (conventional) T-cell activation (in an in vitro or in vivo assay, e.g., by measuring inflammatory cytokine levels, e.g., IFNgamma, TNFalpha, CD44, ICOS granzymeB, Perforin, IL2 (upregulation); CD26L and IL-10 (downregulation)); measurement of reprogramming of macrophages (in vitro or in vivo), e.g., from the M2 to the Ml phenotype (e.g., increased MHCII, reduced CD206, increased TNF-alpha and iNOS), Alternatively, levels of ADCC can be assessed, e.g., in an in vitro assay, as described herein.
- inflammatory cytokine levels e.g., IFNgamma, TNFalpha, CD44, ICOS granzymeB
- the present disclosure provides methods for treating solid tumors, such as pancreatic ductal adenocarcinoma (PDAC), colorectal cancer (CRC), hepatocellular carcinoma (HCC), cholangiocarcinoma (CAA), renal cell carcinoma (RCC), urothelial, head and neck, breast cancer, lung cancer, or other GI solid tumors, using any of the anti-Galectin antibodies, for example G9.2-17 (e.g., G9.2-17(IgG4)), in combination with one or more chemotherapeutics such as gemcitabine and/or paclitaxel (e.g., Abraxane ® ).
- PDAC pancreatic ductal adenocarcinoma
- CRC colorectal cancer
- HCC hepatocellular carcinoma
- CAA cholangiocarcinoma
- RRCC renal cell carcinoma
- urothelial head and neck, breast cancer, lung cancer, or other GI solid tumors
- anti-Galectin-9 antibodies through their inhibition of Dectin-1, can reprogram immune responses against tumor cells via, e.g., inhibiting the activity of gd T cells infiltrated into tumor microenvironment, and/or enhancing immune surveillance against tumor cells by, e.g., activating CD4+ and/or CD8+ T cells.
- combined use of an anti-Galectin-9 antibody and one or more chemotherapeutics such as those described herein would be expected to significantly enhance anti-tumor efficacy.
- the present disclosure provides methods of treating a solid tumor, for example, PDAC, CRC, HCC, cholangiocarcinoma, renal cell carcinoma (RCC), urothelial cancer, head and neck cancer, breast cancer, lung cancer, or other GI solid tumors.
- the treatment methods disclosed herein involve the combined therapy of an anti-Gal9 antibody such as G9.2-17(IgG4) and one or more chemotherapeutics (e.g., gemcitabine and paclitaxel as disclosed herein).
- Pancreatic ductal adenocarcinoma is a devastating disease with few long-term survivors (Yadav et al., Gastroenterology, 2013, 144, 1252-1261). Inflammation is paramount in PD AC progression as oncogenic mutations alone, in the absence of concomitant inflammation, are insufficient for tumorigenesis (Guerra et al., Cancer Cell, 2007, 11, 291- 302). Innate and adaptive immunity cooperate to promote tumor progression in PD AC. In particular, specific innate immune subsets within the tumor microenvironment (TME) are apt at educating adaptive immune effector cells towards a tumor-permissive phenotype.
- TAE tumor microenvironment
- Antigen presenting cell (APC) populations including M2-polarized tumor-associated macrophages (TAMs) and myeloid dendritic cells (DC), induce the generation of immune suppressive Th2 cells in favor of tumor-protective Thl cells (Ochi et al., J of Exp Med., 2012, 209, 1671-1687; Zhu et al., Cancer Res., 2014, 74, 5057-5069) .
- TAMs tumor-associated macrophages
- DC myeloid dendritic cells
- CRC Colorectal cancer
- bowel cancer also known as bowel cancer, colon cancer, or rectal cancer
- CRC is any cancer affecting the colon and the rectum.
- CRC is known to be driven by genetic alterations of tumor cells and is also influenced by tumor-host interactions. Recent reports have demonstrated a direct correlation between the densities of certain T lymphocyte subpopulations and a favorable clinical outcome in CRC, supporting a major role of T-cell-mediated immunity in repressing tumor progression of CRC.
- Hepatocellular carcinoma is the most common type of primary liver cancer. Hepatocellular carcinoma occurs most often in people with chronic liver diseases, such as cirrhosis caused by hepatitis B or hepatitis C infection. HCC is usually accompanied by cirrhotic liver with extensive lymphocyte infiltration due to chronic viral infection. Many studies have demonstrated that tumor-infiltrating effector CD8+ T cells and T helper 17 (Thl7) cells correlate with improved survival after surgical resection of tumors. However, tumor- infiltrating effector T cells fail to control tumor growth and metastasis (Pang et al., Cancer Immunol Immunother 2009;58:877-886).
- Cholangiocarcinoma is a group of cancers that begin in the bile ducts. Cholangiocarcinoma is commonly classified by its location in relation to the liver. For example, intrahepatic cholangiocarcinoma, accounting for less than 10% of all cholangiocarcinoma cases, begins in the small bile ducts within the liver. In another example, perihilar cholangiocarcinoma (also known as a Klatskin tumor), accounting for more than half of the cholangiocarcinoma cases, begins in hilum, where two major bile ducts join and leave the liver. Others are classified as distal cholangiocarcinomas, which begin in bile ducts outside the liver.
- the methods of the present disclosure increase anti-tumor activity (e.g., reduce cell proliferation, tumor growth, tumor volume, and/or tumor burden or load or reduce the number of metastatic lesions over time) by at least about 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or more as compared to levels prior to treatment or in a control subject.
- reduction is measured by comparing cell proliferation, tumor growth, and/or tumor volume in a subject before and after administration of the pharmaceutical composition.
- the method of treating or ameliorating a cancer in a subject allows one or more symptoms of the cancer to improve by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or more.
- cancerous cells and/or biomarkers in a subject are measured in a biological sample, such as blood, serum, plasma, urine, peritoneal fluid, and/or a biopsy from a tissue or organ.
- the methods include administration of the compositions of the invention to reduce tumor volume, size, load or burden in a subject to an undetectable size, or to less than about 1%, 2%, 5%, 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, or 90% of the subject's tumor volume, size, load or burden prior to treatment.
- the methods include administration of the compositions of the invention to reduce the cell proliferation rate or tumor growth rate in a subject to an undetectable rate, or to less than about 1%, 2%, 5%, 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, or 90% of the rate prior to treatment.
- the methods include administration of the compositions of the invention to reduce the development of or the number or size of metastatic lesions in a subject to an undetectable rate, or to less than about 1%, 2%, 5%, 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, or 90% of the rate prior to treatment.
- the term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which are depend in part on how the value is measured or determined, /. ⁇ ? ., the limitations of the measurement system.
- “about” can mean within an acceptable standard deviation, per the practice in the art.
- “about” can mean a range of up to ⁇ 20 %, preferably up to ⁇ 10 %, more preferably up to ⁇ 5 %, and more preferably still up to ⁇ 1 % of a given value.
- the term can mean within an order of magnitude, preferably within 2-fold, of a value.
- treating refers to the application or administration of a composition including one or more active agents to a subject, who has a target disease or disorder, a symptom of the disease/disorder, or a predisposition toward the disease/disorder, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disorder, a symptom of the disease or disorder, or the predisposition toward the disease or disorder.
- Alleviating a target disease/disorder includes delaying the development or progression of the disease, or reducing disease severity or prolonging survival. Alleviating the disease or prolonging survival does not necessarily require curative results.
- "delaying" the development of a target disease or disorder means to defer, hinder, slow, retard, stabilize, and/or postpone progression of the disease. This delay can be of varying lengths of time, depending on the history of the disease and/or individuals being treated.
- a method that “delays” or alleviates the development of a disease, or delays the onset of the disease is a method that reduces probability of developing one or more symptoms of the disease in a given time frame and/or reduces extent of the symptoms in a given time frame, when compared to not using the method. Such comparisons are typically based on clinical studies, using a number of subjects sufficient to give a statistically significant result.
- “Development” or “progression” of a disease means initial manifestations and/or ensuing progression of the disease. Development of the disease can be detectable and assessed using standard clinical techniques as well known in the art. However, development also refers to progression that may be undetectable. For purpose of this disclosure, development or progression refers to the biological course of the symptoms. “Development” includes occurrence, recurrence, and onset. As used herein “onset” or “occurrence” of a target disease or disorder includes initial onset and/or recurrence.
- a subject having a target solid tumor as disclosed herein, for example, PD AC can be identified by routine medical examination, e.g., laboratory tests, organ functional tests, genetic tests, interventional procedure (biopsy, surgery) any and all relevant imaging modalities,.
- the subject to be treated by the method described herein is a human cancer patient who has undergone or is subjecting to an anti-cancer therapy, for example, chemotherapy, radiotherapy, immunotherapy, tumor-treating fields (TTFields), or surgery.
- an anti-cancer therapy for example, chemotherapy, radiotherapy, immunotherapy, tumor-treating fields (TTFields), or surgery.
- subjects have received prior immune-modulatory anti-tumor agents.
- immune-modulatory agents include, but are not limited to as anti-PDl, anti-PD-Ll, anti-CTLA-4, anti-OX40, anti-CD137, anti-TIGIT, anti-PVRIG, platinum -based agent, etc.
- platinum-based agents include cisplatin, carboplatin, oxaliplatin, nedaplatin, and lobaplatin.
- the subject shows disease progression through the treatment. In other embodiments, the subject is resistant to the treatment (either de novo or acquired).
- such a subject is demonstrated as having advanced malignancies (e.g., inoperable or metastatic).
- advanced malignancies e.g., inoperable or metastatic.
- the subject has no standard therapeutic options available or ineligible for standard treatment options, which refer to therapies commonly used in clinical settings for treating the corresponding solid tumor.
- Tumor-treating fields are a cancer treatment modality that uses alternating electric fields of intermediate frequency ( ⁇ 100-500 kHz) and low intensity (1-3 V/cm) to disrupt cell division.
- the anti-Galectin-9 antibody in combination with a chemotherapeutic agent described herein may be administered prior to, concurrent with, or after a tumor-treating fields (TTFields) regimen.
- the anti-Galectin-9 antibody, in combination with a chemotherapeutic agent described herein may be administered prior to, concurrent with, or after a reverse-thermal hydrogel technology-based therapy, e.g., reverse-thermal hydrogel chemotherapy.
- the subject may be a human patient having a refractory disease, for example, a refractory PD AC.
- refractory refers to the tumor that does not respond to or becomes resistant to a treatment.
- the subject may be a human patient having a relapsed disease, for example, a relapsed PDAC.
- relapsed or “relapses” refers to the tumor that returns or progresses following a period of improvement (e.g., a partial or complete response) with treatment.
- the human patient to be treated by the methods disclosed herein may meet one or more of the inclusion and exclusion criteria disclosed in Example 2 below.
- the human patient may be older than 18 and have histologically confirmed unresectable metastatic cancer (e.g., adenocarcinomas and squamous cell carcinomas).
- the patient may have measurable disease, according to RECIST v. 1.1.
- the human patient may have recent archival tumor sample (e.g., obtained within 5 years) available for biomarker analyses (e.g., galectin-9 tumor tissue expression, which may be assessed by IHC).
- the human patient is a PDAC patient who has received at least one line of systemic therapy in the metastatic cancer setting.
- Such a patient may either be gemcitabine-containing regimen naive or at least 6 months out of having been treated using a gemcitabine-containing regimen.
- the patient may have Eastern Cooperative Oncology Group (ECOG) performance status 0-1 and/or Karnofsky score > 70.
- the patient may also have adequate hematologic and end organ function, e.g., neutrophil count > 1 x 10 9 /L, platelet count > 100 x 10 9 /L, for HCC in Part 1 > 50 x 10 9 /L; hemoglobin > 9.0 g/dL without transfusion in the previous week, Creatinine ⁇ 1.5 x ULN, AST (SGOT) ⁇ 3 x ULN ( ⁇ 5 x ULN when HCC or hepatic metastases are present), ALT (SGPT) ⁇ 3 x ULN ( ⁇ 5 x ULN when HCC or hepatic metastases present), Bilirubin ⁇ 1.5 x ULN (patients with known Gilbert's disease may have a bilirubin ⁇ 3.0 x ULN), Albumin > 3.0 g/dL, INR and P
- the human patient shows no evidence of active infection or infections requiring parenteral antibiotics, and no serious infection within 4 weeks before the treatment starts.
- Pancreatic, biliary, or enteric fistulae allowed, provided they are controlled with an appropriate non-infected and patent drain.
- the human patient subject to any treatment disclosed herein may be free of: (i) metastatic cancer of an unknown primary, (ii) clinically significant, active uncontrolled bleeding, any bleeding diathesis (e.g., active peptic ulcer disease); (iii) radiation therapy within 4 weeks of the first dose of the treatment, (iv) with fungating tumor masses or locally advanced PDAC; (v) > CTCAE grade 3 toxicity (except alopecia and vitiligo) due to prior cancer therapy; (v) history of second malignancy, (vi) evidence of severe or uncontrolled systemic diseases, congestive cardiac failure > New York Heart Association (NYHA) class 2, or myocardial infarction (MI) within 6 months, (vii) serious non-healing wound, active ulcer, or untreated bone fracture; (viii) uncontrolled pleural effusion, pericardial effusion, or ascites requiring recurrent drainage procedures; (ix) history of severe allergic, anaphylactic, or other hypersensitivity reactions to chimeric or
- the subject is a human patient having an elevated level of Galectin-9 as relative to a control level.
- the level of Galectin-9 can be a plasma or serum level of Galectin-9 in the human patient.
- the level of Galectin-9 can be the level of cell-surface Galectin-9, for example the level of Galectin-9 on cancer cells.
- the level of Galectin-9 can be the level of surface Galectin-9 expressed on cancer cells in patient- derived organotypic tumor spheroids (PDOT), which can be prepared by, e.g., the method disclosed in Examples below.
- a control level may refer to the level of Galectin-9 in a matched sample of a subject of the same species (e.g., human) who are free of the solid tumor.
- the control level represents the level of Galectin-9 in healthy subjects.
- a suitable biological sample can be obtained from a subject who is suspected of having the solid tumor and the biological sample can be analyzed to determine the level of Galectin-9 contained therein (e.g., free, cell-surface expressed, or total) using conventional methods, e.g., ELISA or FACS.
- organoid cultures are prepared, e.g., as described herein, and used to assess Galectin-9 levels in a subject. Single cells derived from certain fractions obtained as part of the organoid preparation process are also suitable for assessment of Galectin-9 levels in a subject.
- an assay for measuring the level of Galectin-9 involves the use of an antibody that specifically binds the Galectin-9 (e.g., specifically binds human Galectin-9).
- an antibody that specifically binds the Galectin-9 e.g., specifically binds human Galectin-9.
- Any of the anti-Galectin-9 antibodies known in the art can be tested for suitability in any of the assays described above and then used in such assays in a routine manner.
- an antibody described herein e.g., a G9.2-17 antibody
- the anti-Galectin-9 antibody is a Fab molecule. Assay methods for determining Galectin-9 levels as disclosed herein are also within the scope of the present disclosure.
- the antibodies described herein are administered to a subject in need of the treatment at an amount sufficient to inhibit the activity of Galectin-9 (and/or Dectin-1 or TIM-3 or CD206) in immune suppressive immune cells in a tumor by at least 20% (e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater) in vivo.
- the antibodies described herein, e.g., G9.2-17 are administered in an amount effective in reducing the activity level of Galectin-9 (and/or Dectin- 1 or TIM-3 or CD206) in immune suppressive immune cells in a tumor by at least 20% (e.g.
- the antibodies described herein, e.g., G9.2-17 are administered to a subject in need of the treatment at an amount sufficient to promote Ml-like programming in TAMs by at least 20% (e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater) in vivo (as compared to levels prior to treatment or in a control subject).
- the anti- Galectin-9 antibody can be administered to a subject by intravenous infusion.
- Injectable compositions may contain various carriers such as vegetable oils, dimethylactamide, dimethyformamide, ethyl lactate, ethyl carbonate, isopropyl myristate, ethanol, and polyols (glycerol, propylene glycol, liquid polyethylene glycol, and the like).
- water soluble antibodies can be administered by the drip method, whereby a pharmaceutical formulation containing the antibody and a physiologically acceptable excipient is infused.
- Physiologically acceptable excipients may include, for example, 5% dextrose, 0.9% saline, Ringer’s solution or other suitable excipients.
- Intramuscular preparations e.g. , a sterile formulation of a suitable soluble salt form of the antibody, can be dissolved and administered in a pharmaceutical excipient such as Water- for- Injection, 0.9% saline, or 5% glucose solution.
- a pharmaceutical excipient such as Water- for- Injection, 0.9% saline, or 5% glucose solution.
- the methods are provided, the anti-Galectin-9 antibody is administered concurrently with the one or more chemotherapeutics. In some embodiments, the anti-Galectin-9 antibody is administered before or after the one or more chemotherapeutics. In some embodiments, the one or more chemotherapeutics are administered systemically. In some embodiments, the one or more chemotherapeutics is administered locally.
- the one or more chemotherapeutics is administered by intravenous administration, e.g., as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerebrospinal, subcutaneous, intra-arterial, intra-articular, intravesical, intrasynovial, intrathecal, intratumoral, sub-urothelial, oral, inhalation or topical routes.
- the one or more chemotherapeutics is administered to the subject by intravenous infusion.
- the anti-Galectin-9 antibody described herein is administered to a patient who is currently on or has been previously on an anti-cancer therapy, e.g., a chemotherapy.
- an effective amount of the pharmaceutical composition described herein can be administered to a subject (e.g., a human) in need of the treatment via a suitable route, systemically or locally.
- the anti-galectin-9 antibodies are administered by intravenous administration, e.g. , as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerebrospinal, subcutaneous, intra-arterial, intra- articular, intrasynovial, intrathecal, intravesical, intratumoral, sub-urothelial, oral, inhalation or topical routes.
- the anti-galectin-9 antibody is administered to the subject by intravenous infusion.
- the anti-galectin-9 antibody is administered to the subject intraperitoneally.
- an effective amount refers to the amount of each active agent required to confer therapeutic effect on the subject, either alone or in combination with one or more other active agents.
- the therapeutic effect is reduced Galectin-9 activity and/or amount/expression, reduced Dectin-1 signaling, reduced TIM- 3 signaling, reduced CD206 signaling, or increased anti-tumor immune responses in the tumor microenvironment.
- increased anti-tumor responses include increased activation levels of effector T cells, or switching of the TAMs from the M2 to the Ml phenotype.
- the anti-tumor response includes increased ADCC responses.
- Effective amounts vary, as recognized by those skilled in the art, depending on the particular condition being treated, the severity of the condition, the individual patient parameters including age, physical condition, size, gender and weight, the duration of the treatment, the nature of concurrent therapy (if any), the specific route of administration and like factors within the knowledge and expertise of the health practitioner. These factors are well known to those of ordinary skill in the art and can be addressed with no more than routine experimentation. It is generally preferred that a maximum dose of the individual components or combinations thereof be used, that is, the highest safe dose according to sound medical judgment.
- Empirical considerations such as the half-life, generally contribute to the determination of the dosage.
- antibodies that are compatible with the human immune system such as humanized antibodies or fully human antibodies, are in some instances used to prolong half-life of the antibody and to prevent the antibody being attacked by the host's immune system.
- Frequency of administration may be determined and adjusted over the course of therapy, and is generally, but not necessarily, based on treatment and/or suppression and/or amelioration and/or delay of a target disease/disorder.
- sustained continuous release formulations of an antibody may be appropriate.
- formulations and devices for achieving sustained release are known in the art.
- dosages for an antibody as described herein are determined empirically in individuals who have been given one or more administration(s) of the antibody. Individuals are given incremental dosages of the antagonist. To assess efficacy of the antagonist, an indicator of the disease/disorder can be followed.
- the anti-Galectin-9 antibody is G9.2-17.
- the G9.2-17 antibody may be an IgG4 molecule (G9.2-17(IgG4) as disclosed herein.
- the anti-Galectin-9 antibody (G9.2-17) used herein has a heavy chain of SEQ ID NO: 19 and a light chain of SEQ ID NO: 15.
- the anti-Gal9 antibody may be formulated as disclosed herein and given to a subject in need of the treatment via a suitable route, for example, intravenous infusion.
- the anti-Galectin-9 antibody as disclosed herein can be administered to a subject at a suitable dose, for example, about 0.2 to about 32 mg/kg.
- Examples include 0.2 mg/kg to 0.5 mg/kg ,0.5 mg/kg to 1 mg/kg, lmg/kg to 2 mg/kg, 2 mg/kg to 3 mg/kg, 3 mg/kg to 4 mg/kg, 4 mg/kg to 6 mg/kg, 4 mg/kg to 6.3 mg/kg, 6 mg/kg to 8 mg/kg, 6.3mg/kg to 8 mg/kg, 4 mg/kg to 8 mg/kg, 8 mg/kg to 12 mg/kg, 8 mg/kg to 10 mg/kg, 10 mg/kg to 12 mg/kg 12 mg/kg to 16 mg/kg, 16 mg/kg to 20 mg/kg, 20 mg/kg to 24 mg/kg, 24 mg/kg to 28 mg/kg, or 28 mg/kg to 32 mg/kg (e.g., 0.2 mg/kg, 0.5 mg/kg, 1 mg/kg, lmg/kg to 2 mg/kg, 2 mg/kg to 3 mg/kg, 3 mg/kg to 4 mg/kg, 4 mg/kg to 6 mg/kg,
- the antibody is administered at a dose of about 0.2 mg/kg to 0.5 mg/kg, 0.5 mg/kg to 1 mg/kg, about 1 mg/kg to 2 mg/kg, about 2 mg/kg to 4 mg/kg, about 4 mg/kg to 8 mg/kg, 4 mg/kg to 6 mg/kg, 4 mg/kg to 6.3 mg/kg, 6 mg/kg to 8 mg/kg, 6.3mg/kg to 8 mg/kg, about 8 mg/kg to 12 mg/kg, about 12 mg/kg to 16 mg/kg, about 16 mg/kg to 20 mg/kg, about 20 mg/kg to 24 mg/kg, about 24 mg/kg to 28 mg/kg, or about 28 mg/kg to 32 mg/kg (e.g., about 0.2 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.63 mg/kg, about 1 mg/kg, about 2mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 6.3 mg
- the anti-Gal-9 antibody such as G9.2-17(IgG4) is administered at 0.2 mg/kg. In some embodiments, the anti-Gal-9 antibody is administered at 0.6 mg/kg. In some embodiments, the anti-Gal-9 antibody is administered at 0.63 mg/kg. In some embodiments, the anti-Gal-9 antibody is administered at 2 mg/kg. In some embodiments, the anti-Gal-9 antibody is administered at 4 mg/kg. In some embodiments, the anti-Gal-9 antibody is administered at 6 mg/kg. In some embodiments, the anti-Gal-9 antibody is administered at 6.3 mg/kg. In some embodiments, the anti-Gal-9 antibody is administered at 8 mg/kg.
- the anti-Gal-9 antibody is administered at 10 mg/kg. In some embodiments, the anti-Gal-9 antibody is administered at 12 mg/kg. In some embodiments, the anti-Gal-9 antibody is administered at 16 mg/kg. In some instances, multiple doses of the anti-Galectin-9 antibody can be administered to a subject at a suitable interval or cycle, for example, once every week, once every two to four weeks (e.g. , every two, three, or four weeks). The treatment may last for a suitable period, for example, up to 3 months, up to 6 months, or up to 12 months or up to 24 months or longer. In some embodiments, the anti-Gal9 antibody may be administered to the subject at a dose of about 10 mg/kg to about 16 mg/kg once every week.
- the anti-Gal-9 antibody is administered to the subject at a dose of 10 mg/kg once every week.
- the anti-Gal-9 antibody is administered to the subject at a dose of 16 mg/kg once every week.
- the anti-Gal-9 antibody such as G9.2-17(IgG4) disclosed herein may be administered to a subject at a flat dose, e ⁇ g ⁇ , about 650 mg to about 1120 mg, once every week to once every 4 weeks.
- the anti-Gal-9 antibody is administered to a subject at a about 650 mg to about 700 mg once every week.
- the anti-Gal-9 antibody is administered to a subject at a about 650 mg to about 700 mg once every two weeks.
- the anti-Gal-9 antibody is administered to a subject at a about 1040 mg to about 1120 mg once every week.
- the anti-Gal-9 antibody is administered to a subject at a about 1040 mg to about 1120 mg once every two weeks.
- the anti-Gal-9 antibody such as G9.2-17(IgG4) antibody is administered to a human patient having a solid tumor as disclosed herein (e.g., PD AC) at a dose of about 3 mg/kg once every two weeks via intravenous infusion.
- the anti-Galectin-9 antibody is administered to the human patient having the target solid tumor at a dose of about 15 mg/kg once every two weeks via intravenous infusion.
- the anti-Galectin-9 antibody is administered to the human patient having the target solid tumor at a dose of about 0.2 mg/kg once every two weeks via intravenous infusion.
- the anti-Galectin-9 antibody is administered to the human patient having the target solid tumor at a dose of about 0.6 mg/kg once every two weeks via intravenous infusion. In other examples, the anti-Galectin-9 antibody is administered to the human patient having the target solid tumor at a dose of about 0.63 mg/kg once every two weeks via intravenous infusion. In other examples, the anti-Galectin-9 antibody is administered to the human patient having the target solid tumor at a dose of about 2 mg/kg once every two weeks via intravenous infusion. In other examples, the anti-Galectin-9 antibody is administered to the human patient having the target solid tumor at a dose of about 4 mg/kg once every two weeks via intravenous infusion.
- the anti-Galectin-9 antibody is administered to the human patient having the target solid tumor at a dose of about 6 mg/kg once every two weeks via intravenous infusion. In other examples, the anti-Galectin-9 antibody is administered to the human patient having the target solid tumor at a dose of about 6.3 mg/kg once every two weeks via intravenous infusion. In other examples, the anti-Galectin-9 antibody is administered to the human patient having the target solid tumor at a dose of about 8 mg/kg once every two weeks via intravenous infusion. In other examples, the anti-Galectin-9 antibody is administered to the human patient having the target solid tumor at a dose of about 10 mg/kg once every two weeks via intravenous infusion.
- the anti-Galectin-9 antibody is administered to the human patient having the target solid tumor at a dose of about 12 mg/kg once every two weeks via intravenous infusion. In other examples, the anti-Galectin-9 antibody is administered to the human patient having the target solid tumor at a dose of about 16 mg/kg or higher dose level once every two weeks via intravenous infusion.
- the anti-Galectin-9 antibody is administered to the human patient having the target solid tumor at a dose at a dose selected from 0.2 mg/kg, 0.63 mg/kg, 2 mg/kg, 4 mg/kg, 6 mg/kg, 6.3 mg/kg, 8 mg/kg, 10 mg/kg, 12 mg/kg, and 16 mg/kg or higher dose level once every two weeks via intravenous infusion.
- the anti-Gal9 antibody may be administered to the subject at a dose of about 10 mg/kg to about 16 mg/kg once every week.
- the anti-Galectin-9 antibody is administered to the subject at a dose of 10 mg/kg once every week or at a flat dose of 650-700 mg once every week.
- the anti-Galectin-9 antibody is administered to the subject at a dose of 16 mg/kg once every week or at a flat dose of 1040-1120 mg once every week.
- about 2 mg/kg to 16 mg/kg anti-Gal9 antibody (e.g., G9.2-17 in IgG4 form) may be given to a subject in need of the treatment once every two weeks.
- about 0.2 mg/kg to 16 mg/kg anti-Gal9 antibody (e.g., G9.2-17 in IgG4 form) may be given to a subject in need of the treatment once every two weeks.
- the anti-Gal9 antibody (e.g., G9.2-17 in IgG4 form as disclosed herein, having a heavy chain of SEQ ID NO: 19 and a light chain of SEQ ID NO: 15) is administered to the subject at a dose of about 0.5 mg/kg, 0.6 mg/kg, 0.63 mg/kg, 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, 6.3 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, about 10 mg/kg, about 11 mg/kg, about 12 mg/kg, about 13 mg/kg, about 14 mg/kg, about 15 mg/kg, about 16 mg/kg, about 17 mg/kg, about 18 mg/kg, about 19 mg/kg, or about 20 mg/kg or any increment therein, once every two weeks by intravenous infusion.
- the anti-Gal9 antibody may be administered to the subject at a dose of about 10 mg/kg to about 16 mg/kg once every week.
- the anti-Galectin-9 antibody is administered to the subject at a dose of 10 mg/kg once every week or at a flat dose of 650-700 mg once every week.
- the anti-Galectin-9 antibody is administered to the subject at a dose of 16 mg/kg once every week or at a flat dose of 1040-1120 mg once every week.
- the anti-Gal9 antibody (e.g., G9.2-17 in IgG4 form as disclosed herein, having a heavy chain of SEQ ID NO: 19 and a light chain of SEQ ID NO: 15) is administered to the subject at a dose of about 0.2 mg/kg once every two weeks by intravenous infusion. In some examples, the anti-Gal9 antibody is administered to the subject at a dose of about 0.6 mg/kg once every two weeks by intravenous infusion. In some examples, the anti- Gal9 antibody is administered to the subject at a dose of about 0.63 mg/kg once every two weeks by intravenous infusion.
- the anti-Gal9 antibody is administered to the subject at a dose of about 2 mg/kg once every two weeks by intravenous infusion. In some examples, the anti-Gal9 antibody is administered to the subject at a dose of about 4 mg/kg once every two weeks by intravenous infusion. In some examples, the anti-Gal9 antibody is administered to the subject at a dose of about 6 mg/kg once every two weeks by intravenous infusion. In some examples, the anti-Gal9 antibody is administered to the subject at a dose of about 6.3 mg/kg once every two weeks by intravenous infusion. In some examples, the anti- Gal9 antibody is administered to the subject at a dose of about 8 mg/kg once every two weeks by intravenous infusion.
- the anti-Gal9 antibody is administered to the subject at a dose of about 10 mg/kg once every two weeks by intravenous infusion. In some examples, the anti-Gal9 antibody is administered to the subject at a dose of about 12 mg/kg once every two weeks by intravenous infusion. In some examples, the anti-Gal9 antibody is administered to the subject at a dose of about 16 mg/kg once every two weeks by intravenous infusion. In some embodiments, the anti-Gal9 antibody may be administered to the subject at a dose of about 10 mg/kg to about 16 mg/kg once every week.
- the anti-Galectin-9 antibody is administered to the subject at a dose of 10 mg/kg once every week or at a flat dose of 650-700 mg once every week.
- the anti-Galectin-9 antibody is administered to the subject at a dose of 16 mg/kg once every week or at a flat dose of 1040-1120 mg once every week.
- the anti-Gal9 antibody (e.g., G9.2-17 in IgG4 form as disclosed herein, having a heavy chain of SEQ ID NO: 19 and a light chain of SEQ ID NO: 15) is administered to the subject at a dose of 0.2 mg/kg to 0.5 mg/kg , 0.5 mg/kg to 1 mg/kg, about 1 mg/kg to 2 mg/kg, about 3 mg/kg to 4 mg/kg, about 4 mg/kg to 6 mg/kg, about 4 mg/kg to 6.3 mg/kg, about 4 mg/kg to 8 mg/kg, about 8 mg/kg to 10 mg/kg, about 8 mg/kg to 12 mg/kg, about 10 mg/kg to 12 mg/kg, about 12 mg/kg to 16 mg/kg, about 16 mg/kg to 20 mg/kg, about 20 mg/kg to 24 mg/kg, about 24 mg/kg to 28 mg/kg, or about 28 mg/kg to 32 mg/kg (e.g., about 0.2 mg/kg, about 0.6 mg/kg,
- the anti-Galectin-9 antibody is administered to the subject at a dose of 10 mg/kg once every week or at a flat dose of 650-700 mg once every week.
- the anti- Galectin-9 antibody is administered to the subject at a dose of 16 mg/kg once every week or at a flat dose of 1040-1120 mg once every week.
- the anti-Gal9 antibody (e.g., G9.2-17 in IgG4 form as disclosed herein, having a heavy chain of SEQ ID NO: 19 and a light chain of SEQ ID NO: 15) is administered to the subject at a dose of 0.2 mg/kg to 0.5 mg/kg, 0.5 mg/kg to 1 mg/kg, 1 mg/kg to 2 mg/kg, 3 mg/kg to 4 mg/kg, about 4 mg/kg to 6 mg/kg, about 4 mg/kg to 6.3 mg/kg, 4 mg/kg to 8 mg/kg, 8 mg/kg to 12 mg/kg, 8 mg/kg to 10 mg/kg, 10 mg/kg to 12 mg/kg, 12 mg/kg to 16 mg/kg, 16 mg/kg to 20 mg/kg, 20 mg/kg to 24 mg/kg, 24 mg/kg to 28 mg/kg, or 28 mg/kg to 32 mg/kg (e.g., 0.2 mg/kg, 0.6 mg/kg, 0.63 mg/kg, 0.5 mg/kg, 1 mg/kg,
- the anti-Gal9 antibody may be administered to the subject at a dose of about 10 mg/kg to about 16 mg/kg once every week.
- the anti-Galectin-9 antibody is administered to the subject at a dose of 10 mg/kg once every week or at a flat dose of 650- 700 mg once every week.
- the anti-Galectin-9 antibody is administered to the subject at a dose of 16 mg/kg once every week or at a flat dose of 1040-1120 mg once every week.
- the anti-Gal9 antibody (e.g., G9.2-17 in IgG4 form as disclosed herein, having a heavy chain of SEQ ID NO: 19 and a light chain of SEQ ID NO: 15) is administered to the subject at a dose of about 0.2 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.63 mg/kg, 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, 6.3 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, about 10 mg/kg, about 11 mg/kg, about 12 mg/kg, about 13 mg/kg, about 14 mg/kg, about 15 mg/kg, about 16 mg/kg, about 17 mg/kg, about 18 mg/kg, about 19 mg/kg, or about 20 mg/kg or any increment therein, once a week by intravenous infusion.
- the anti-Gal9 antibody may be administered to the subject at a dose of about 10 mg/kg to about 16 mg/kg once every week.
- the anti-Galectin-9 antibody is administered to the subject at a dose of 10 mg/kg once every week or at a flat dose of 650-700 mg once every week.
- the anti-Galectin-9 antibody is administered to the subject at a dose of 16 mg/kg once every week or at a flat dose of 1040-1120 mg once every week.
- the anti-Galectin-9 antibody such as G9.2-17 (IgG4) may be administered to a human patient at a suitable dose (e.g., the doses disclosed herein) once every week.
- a suitable dose e.g., the doses disclosed herein
- 2.0 mg/kg of G9.2-17(IgG4) may be administered to the human patient once every week.
- 6.3 mg/kg of G9.2-17(IgG4) may be administered to the human patient once every week.
- 10 mg/kg of G9.2-17(IgG4) may be administered to the human patient once every week.
- 12 mg/kg of G9.2-17(IgG4) may be administered to the human patient once every week.
- 16 mg/kg of G9.2- 17(IgG4) may be administered to the human patient once every week.
- the anti-Galectin-9 antibody may be given to the human patient for at least 2 cycles, at least 3 cycles, at least 4 cycles, at least 5 cycles, at least 6 cycles, or more.
- the treatment period may be 6 months to 12 months. In other instances, the treatment period may be 12 months to 24 months. In other instances, the treatment period may be longer than 24 months.
- the anti-Galectin 9 antibody disclosed herein is administered via a 30-minute to 6 hours infusion period intravenously.
- the intravenous infusion of the anti-Galectin 9 antibody may be performed for 30 minutes to 2 hours.
- the anti-Galectin 9 antibody may be administered via a long infusion period, for example, about 2-6 hours, e.g., about 2-4 hours or about 4-6 hours.
- examples anti-Galectin 9 antibody may be infused intravenous in a period of about 3 hours, about 4 hours, about 5 hours, or about 6 hours.
- the interval or cycle is 1 week. In specific embodiments, the interval or cycle is 2 weeks. In some embodiments, the regimen is once every 2 weeks for one cycle, once every 2 weeks for two cycles, once every 2 weeks for three cycles, once every 2 weeks for four cycles, or once every 2 weeks for more than four cycles. In some embodiments, the treatment is once every 2 weeks for 1 to 3 months, once every 2 weeks for 3 to 6 months, once every 2 weeks for 6 to 12 months, or once every 2 weeks for 12 to 24 months, or longer.
- the interval or cycle is 3 weeks.
- the regimen is once every 3 weeks for one cycle, once every 3 weeks for two cycles, once every 3 weeks for three cycles, once every 3 weeks for four cycles, or once every 3 weeks for more than four cycles.
- the treatment is once every 3 weeks for 1 to 3 months, once every 3 weeks for 3 to 6 months, once every 3 weeks for 6 to 12 months, or once every 3 weeks for 12 to 24 months, or longer.
- the interval or cycle is 4 or more weeks.
- the regimen is once every 4 or more weeks for one cycle, once every 4 or more weeks for two cycles, once every 4 or more weeks for three cycles, once every 4 or more weeks for four cycles, or once every 4 or more weeks for more than four cycles.
- the treatment is once every 4 or more weeks for 1 to 3 months, once every 4 or more weeks for 3 to 6 months, once every 4 or more weeks for 6 to 12 months, or once every 4 or more weeks for 12 to 24 months, or longer.
- the treatment is a combination of treatment at various time, e.g., a combination or 2 weeks, 3 weeks, 4 or more 4 weeks.
- the treatment interval is adjusted in accordance with the patient’s response to treatment.
- the dosage(s) is adjusted in accordance with the patient’s response to treatment.
- the dosages are altered between treatment intervals.
- the treatment may be temporarily stopped.
- anti-Galectin-9 therapy is temporarily stopped.
- chemotherapy is temporarily stopped.
- both are temporarily stopped.
- the anti-Gal9 antibody may be G9.2-17 in IgG4 form as disclosed herein, having a heavy chain of SEQ ID NO: 19 and a light chain of SEQ ID NO: 15).
- a human patient may start with a low dose of the anti-Galectin-9 antibody such as G9.2-17 (IgG4) disclosed herein, for example, 0.2 mg/kg, 0.63 mg/kg, or 2 mg/kg.
- the dose of the antibody may be elevated, for example, to 6.3 mg/kg, 10 mg/kg, or 16 mg/kg.
- the one or more chemotherapeutics may comprise an antimetabolite, a microtubule (e.g., tubulin) inhibitor, a platinum agent, or a combination thereof.
- Antimetabolites include, for example, folic acid antagonist (e.g., methotrexate) and nucleotide analogs such as pyrimidine antagonist (e.g., 5-fluorouracil, foxuridine, cytarabine, capecitabine, and gemcitabine), purine antagonist (e.g., 6-mercaptopurine and 6-thioguanine), and adenosine deaminase inhibitor (e.g., cladribine, fludarabine and pentostatin).
- Microtubule inhibitors include, for example, paclitaxel (e.g., Taxol ® ), docetaxel, vinblastine, vincristine, and vinorelbine.
- the antimetabolites used in the methods disclosed herein is gemcitabine, which may be given by intravenous infusion.
- the amount of gemcitabine to be given to a subject depends on many factors, including height and weight, general health or other health problems, and the type of cancer to be treated, which would be within the knowledge of a medical practitioner following guidance provided by the Food and Drug Administration (e.g., see the drug labels of approved gemcitabine products).
- a subject may be administered gemcitabine by intravenous infusion at a dose of 1000 mg/m 2 optionally over 30 minutes once weekly for up to 7 weeks, followed by one week rest from the treatment. Subsequent cycles may consist of infusion once weekly for three consecutive weeks out of every four weeks. If one or more adverse effects occur, the dose of gemcitabine may be reduced or the treatment may be withheld. More details for managing adverse effects associated with gemcitabine treatment are provided in Example 2 below.
- Microtubule inhibitors are a class of compounds that inhibit the formation of cellular microtubules, thereby blocking cell proliferation.
- the microtubule inhibitor is a stabilizing agent that promotes polymerization of microtubules. Examples include taxanes and epothilones.
- the microtubule inhibitor is a destabilizing agent that promotes depolymerization of microtubules. Examples include vinca alkaloids.
- the microtubule inhibitor used in the methods disclosed herein is paclitaxel. In some instances, the paclitaxel is in free form. In other instances, the paclitaxel is conjugated to a protein, for example, albumin. In specific examples, the paclitaxel is Abraxane ® , which is nanoparticle albumin-conjugated paclitaxel.
- paclitaxel e.g., protein-bound paclitaxel such as nab-paclitaxel
- amount of paclitaxel, e.g., protein-bound paclitaxel such as nab-paclitaxel, to be given to a subject depends on many factors, including height and weight, general health or other health problems, and the type of cancer to be treated, which would be within the knowledge of a medical practitioner following guidance provided by the Food and Drug Administration (e.g., see the drug labels of approved paclitaxel products).
- nanoparticle albumin-conjugated paclitaxel nab-paclitaxel, e.g., Abraxane ®
- the dose of paclitaxel may be reduced if severe adverse effects (e.g., neutropenia or severe sensory neuropathy) are observed. In some instances, the dose of nab-paclitaxel may be reduced to 180 mg/m 2 . When in combination with the anti-Gal9 antibody, the dose of paclitaxel may be 125 mg/m 2 . If needed, the dose of paclitaxel may be reduced to 100 mg/m 2 or 75 mg/m 2 . More details for managing side effects associated with paclitaxel are provided in Example 2 below.
- the chemotherapeutic agents to be co-used with the anti-Gal-9 antibody can comprise a platinum agent, for example, cisplatin, carboplatin, oxaliplatin, nedaplatin, triplatin tetranitrate, phenanthriplatin, picoplatin, or satraplatin.
- a platinum agent for example, cisplatin, carboplatin, oxaliplatin, nedaplatin, triplatin tetranitrate, phenanthriplatin, picoplatin, or satraplatin.
- the combined therapy provided herein comprises any of the anti-Galectin-9 antibody therapy disclosed herein (e.g., involving the antibody of G9.2-17(IgG4)) and any of the chemotherapy disclosed herein (e.g., involving the combination of gemcitabine and paclitaxel).
- the anti-Gal9 antibody e.g., G9.2-17 in IgG4 form
- gemcitabine e.g., gemcitabine
- paclitaxel e.g., nanoparticle albumin-conjugated paclitaxel or Abraxane ®
- the treatment may comprise one or more cycles, each consisting of 28 days.
- the anti-Gal9 antibody e.g., G9.2- 17(IgG4)
- the subject e.g., a human patient having PDAC
- the anti-Gal9 antibody is given to the subject (e.g., a human patient having PDAC) once every two weeks (e.g., on Day 1 and Day 15) at a dose of about 2 mg/kg to 16 mg/mg (e.g., about 2 mg/kg, about 4 mg/kg, about 8 mg/kg, about 12 mg/kg, or about 16 mg/kg) via intravenous infusion.
- the anti-Gal9 antibody (e.g., G9.2-17(IgG4)) is given to the subject (e.g., a human patient having PD AC) once every two weeks (e.g., on Day 1 and Day 15) at a dose of about 0.2 mg/kg to 16 mg/mg (e.g., about 0.2 mg/kg, about 0.6 mg/kg, about 0.63 mg/kg, about 2 mg/kg, about 4 mg/kg, about 6 mg/kg, about 6.3 mg/kg, about 10 mg/kg, or about 16 mg/kg) via intravenous infusion.
- the subject e.g., a human patient having PD AC
- a dose of about 0.2 mg/kg to 16 mg/mg e.g., about 0.2 mg/kg, about 0.6 mg/kg, about 0.63 mg/kg, about 2 mg/kg, about 4 mg/kg, about 6 mg/kg, about 6.3 mg/kg, about 10 mg/kg, or about 16 mg/kg
- Gemcitabine and paclitaxel can be administered to the subject once every week for three weeks followed by one week without treatment (e.g., on Day 1, Day 8, and Day 15 in the 28- day cycle), using the dosage and dosing scheduled as approved by the FDA.
- gemcitabine may be given to the subject once every week at 1000 mg/m 2 in each cycle via intravenous infusion and paclitaxel may be given to the subject once every week at 125 mg/m 2 .
- the dose of gemcitabine may be reduced to 800 mg/m 2 or 600 mg/m 2 .
- the dose of paclitaxel may be reduced to 100 mg/m 2 or 75 mg/m 2 .
- the method for treating a solid tumor (e.g., PDAC) described herein comprises one or more treatment cycle(s) of 28 days, wherein the anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 0.2 mg/kg to about 32 mg/kg via intravenous infusion and gemcitabine and paclitaxel (e.g., nanoparticle albumin-bound paclitaxel) are administered to the subject on day 1, day 8, and day 15.
- paclitaxel is administered to the subject at 125 mg/m 2 intravenously (e.g., intravenous infusion).
- gemcitabine is administered to the subject at 1000 mg/m 2 intravenously (e.g., intravenous infusion).
- the dose of gemcitabine may be reduced to 800 mg/m 2 or 600 mg/m 2 .
- the dose of paclitaxel may be reduced to 100 mg/m 2 or 75 mg/m 2 .
- the method comprises one or more treatment cycle(s) of 28 days, wherein
- (1) anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 0.2 mg/kg to 0.5 mg/kg, about 0.5 mg/kg to 1 mg/kg, about 1 mg/kg to 2 mg/kg, about 3 mg/kg to 4 mg/kg, about 4 mg/kg to 8 mg/kg, about 4 mg/kg to 6 mg/kg, about 4 mg/kg to 6.3 mg/kg, about 6 mg/kg to 8 mg/kg,, about 6.3 mg/kg to 8 mg/kg, about 8 mg/kg to 12 mg/kg, about 8 mg/kg to 10 mg/kg, about 10 mg/kg to 12 mg/kg, about 12 mg/kg to 16 mg/kg, about 16 mg/kg to 20 mg/kg, about 20 mg/kg to 24 mg/kg, about 24 mg/kg to 28 mg/kg, or about 28 mg/kg to 32 mg/kg (e.g., about 0.2 mg/kg, about 0.5 mg/kg, about 0.
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous injection).
- the dose of gemcitabine may be reduced to 800 mg/m 2 or 600 mg/m 2 ,
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject on day 1, day 8, and day 15 at a dose of 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the dose of paclitaxel may be reduced to 100 mg/m 2 or 75 mg/m 2 .
- the method comprises one or more treatment cycle(s) of 28 days, wherein
- (1) anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of 0.2 mg/kg to 0.5 mg/kg, 0.5 mg/kg to 1 mg/kg, 1 mg/kg to 2 mg/kg, 3 mg/kg to 4 mg/kg, 4 mg/kg to 8 mg/kg, 4 mg/kg to 6 mg/kg, 4 mg/kg to 6.3 mg/kg, 6 mg/kg to 8 mg/kg,, 6.3 mg/kg to 8 mg/kg, 8 mg/kg to 12 mg/kg, 8 mg/kg to 10 mg/kg, 10 mg/kg to 12 mg/kg, 12 mg/kg to 16 mg/kg, 16 mg/kg to 20 mg/kg, 20 mg/kg to 24 mg/kg, 24 mg/kg to 28 mg/kg, or 28 mg/kg to 32 mg/kg (e.g., 0.2 mg/kg, 0.5 mg/kg, about 0.6 mg/kg, about 0.63 mg/kg, 1 mg/kg, 2m
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous injection).
- the dose of gemcitabine may be reduced to 800 mg/m 2 or 600 mg/m 2 ,
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject on day 1, day 8, and day 15 at a dose of 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the dose of paclitaxel may be reduced to 100 mg/m 2 or 75 mg/m 2 .
- the method for treating a solid tumor (e.g., PDAC) described herein comprises one or more treatment cycle(s) of 28 days, wherein the anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 2 mg/kg to about 16 mg/kg via intravenous infusion and gemcitabine and paclitaxel (e.g., nanoparticle albumin-bound paclitaxel) are administered to the subject on day 1, day 8, and day 15.
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- the method for treating a solid tumor (e.g., PDAC) described herein comprises one or more treatment cycle(s) of 28 days, wherein the anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e, once every 2 weeks (q2w)) at a dose of about 0.2 mg/kg to about 16 mg/kg via intravenous infusion and gemcitabine and paclitaxel (e.g., nanoparticle albumin-bound paclitaxel) are administered to the subject on day 1, day 8, and day 15.
- paclitaxel is administered to the subject at 125 mg/m 2 intravenously (e.g., intravenous infusion).
- gemcitabine is administered to the subject at 1000 mg/m 2 intravenously (e.g., intravenous infusion).
- the dose of gemcitabine may be reduced to 800 mg/m 2 or 600 mg/m 2 .
- the dose of paclitaxel may be reduced to 100 mg/m 2 or 75 mg/m 2 .
- the method for treating a solid tumor (e.g., PDAC) described herein comprises one or more treatment cycle(s) of 28 days, wherein the anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 0.2 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.63 mg/kg, about 1 mg/kg , about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 6.3 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, about 10 mg/kg, about 11 mg/kg, about 12 mg/kg, about 13 mg/kg, about 14 mg/kg, about 15 mg/kg, about 16 mg/kg, about 17 mg/kg, about 18 mg/kg, about 19 mg/kg, or about 20 mg/kg or any increment therein, via intravenous infusion and gemcitabine and paclit
- paclitaxel is administered to the subject at 125 mg/m 2 intravenously (e.g., intravenous infusion).
- gemcitabine is administered to the subject at 1000 mg/m 2 intravenously (e.g., intravenous infusion).
- the dose of gemcitabine may be reduced to 800 mg/m 2 or 600 mg/m 2 .
- the dose of paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- the dose of paclitaxel may be reduced to 100 mg/m 2 or 75 mg/m 2 .
- the method comprises one or more treatment cycle(s) of 28 days, wherein
- (1) anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 0.2 mg/kg to 0.5 mg/kg, about 0.5 mg/kg to 1 mg/kg, about 1 mg/kg to 2 mg/kg, about 3 mg/kg to 4 mg/kg, about 4 mg/kg to 8 mg/kg, about 4 mg/kg to 6 mg/kg, about 4 mg/kg to 6.3 mg/kg, about
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject on day 1, day 8, and day 15 at a dose of 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the method comprises one or more treatment cycle(s) of 28 days, wherein:
- (1) anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of 0.2 mg/kg to 0.5 mg/kg, 0.5 mg/kg to 1 mg/kg, 1 mg/kg to 2 mg/kg, 3 mg/kg to 4 mg/kg, 4 mg/kg to 8 mg/kg, 4 mg/kg to 6 mg/kg, 4 mg/kg to 6.3 mg/kg, 6 mg/kg to 8 mg/kg,, 6.3 mg/kg to 8 mg/kg, 8 mg/kg to 12 mg/kg, 8 mg/kg to 10 mg/kg, 10 mg/kg to 12 mg/kg, 12 mg/kg to 16 mg/kg, 16 mg/kg to 20 mg/kg, 20 mg/kg to 24 mg/kg, 24 mg/kg to 28 mg/kg, or 28 mg/kg to 32 mg/kg (e.g., 0.2 mg/kg, 0.5 mg/kg, about 0.6 mg/kg, about 0.63 mg/kg, 1 mg/kg, 2m
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject on day 1, day 8, and day 15 at a dose of 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the method comprises one or more treatment cycle(s) of 28 days, wherein
- (1) anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 0.2 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.63 mg/kg, about 1 mg/kg, about 2mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 6.3 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, about 10 mg/kg, about 11 mg/kg, about 12 mg/kg, about 13 mg/kg, about 14 mg/kg, about 15 mg/kg, about 16 mg/kg, about 17 mg/kg, about 18 mg/kg, about 19 mg/kg, about 20 mg/kg, about 21 mg/kg, about 22 mg/kg, about 23 mg/kg, about 24 mg/kg, about 25 mg/kg, about 26 mg/kg, about 27 mg/kg, about 28 mg/kg, about 29 mg/kg, about 30 mg/kg
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject on day 1, day 8, and day 15 at a dose of 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the method comprises one or more treatment cycle(s) of 28 days, wherein:
- (1) anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 0.2 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.63 mg/kg, 1 mg/kg , about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 6.3 mg/kg.
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject on day 1, day 8, and day 15 at a dose of 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the method comprises one or more treatment cycle(s) of 28 days, wherein:
- anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 0.2 mg/kg via intravenous infusion,
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject on day 1, day 8, and day 15 at a dose of 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the method comprises one or more treatment cycle(s) of 28 days, wherein:
- anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 0.6 mg/kg via intravenous infusion,
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject on day 1, day 8, and day 15 at a dose of 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the method comprises one or more treatment cycle(s) of 28 days, wherein:
- anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 0.63 mg/kg via intravenous infusion,
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- the method comprises one or more treatment cycle(s) of 28 days, wherein:
- anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 2 mg/kg via intravenous infusion,
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject on day 1, day 8, and day 15 at a dose of 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the method comprises one or more treatment cycle(s) of 28 days, wherein:
- anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 4 mg/kg via intravenous infusion,
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject on day 1, day 8, and day 15 at a dose of 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the method comprises one or more treatment cycle(s) of 28 days, wherein:
- anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 6 mg/kg via intravenous infusion,
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject on day 1, day 8, and day 15 at a dose of 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the method comprises one or more treatment cycle(s) of 28 days, wherein:
- anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 6.3 mg/kg via intravenous infusion,
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject on day 1, day 8, and day 15 at a dose of 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the method comprises one or more treatment cycle(s) of 28 days, wherein:
- anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 8 mg/kg via intravenous infusion,
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject on day 1, day 8, and day 15 at a dose of 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the method comprises one or more treatment cycle(s) of 28 days, wherein:
- anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 10 mg/kg via intravenous infusion,
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject on day 1, day 8, and day 15 at a dose of 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the method comprises one or more cycle(s) treatment of 28 days, wherein:
- anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 12 mg/kg via intravenous infusion,
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject on day 1, day 8, and day 15 at a dose of 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the method comprises one or more treatment cycle(s) of 28 days, wherein:
- anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 16 mg/kg via intravenous infusion,
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject on day 1, day 8, and day 15 at a dose of 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the method comprises one or more treatment cycle(s) of 28 days, wherein:
- anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 32 mg/kg via intravenous infusion,
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject on day 1, day 8, and day 15 at a dose of 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the dose of gemcitabine when needed, may be reduced to 800 mg/m 2 or 600 mg/m 2 , and alternatively or in addition, the dose of paclitaxel (e.g., nanoparticle albumin-bound paclitaxel) may be reduced to 100 mg/m 2 or 75 mg/m 2 .
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- the method comprises one or more treatment cycle(s) of 28 days, wherein:
- (1) anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 0.2 mg/kg to 0.5 mg/kg, about 0.5 mg/kg to 1 mg/kg, about 1 mg/kg to 2 mg/kg, about 3 mg/kg to 4 mg/kg, about 4 mg/kg to 8 mg/kg, about 4 mg/kg to 6 mg/kg, about 4 mg/kg to 6.3 mg/kg, about 6mg/kg to 8 mg/kg, about 6.3 mg/kg to 8 mg/kg, about 8 mg/kg to 12 mg/kg, about 8 mg/kg to 10 mg/kg, about 10 mg/kg to 12 mg/kg, about 12 mg/kg to 16 mg/kg, about 16 mg/kg to 20 mg/kg, about 20 mg/kg to 24 mg/kg, about 24 mg/kg to 28 mg/kg, or about 28 mg/kg to 32 mg/kg (e.g., about 0.2 mg/kg, about 0.5 mg/kg, about
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 800 mg/m 2 , 600 mg/m 2 , or 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- day 1, day 8, and day 15 at a dose of 100 mg/m 2 , 75 mg/m 2 or 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the method comprises one or more treatment cycle(s) of 28 days, wherein:
- (1) anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of 0.2 mg/kg to 0.5 mg/kg, 0.5 mg/kg to 1 mg/kg, 1 mg/kg to 2 mg/kg, 3 mg/kg to 4 mg/kg, 4 mg/kg to 8 mg/kg, 4 mg/kg to 6 mg/kg, 4 mg/kg to 6.3 mg/kg, 6 mg/kg to 8 mg/kg, 6.3 mg/kg to 8 mg/kg, 8 mg/kg to 12 mg/kg, 8 mg/kg to 10 mg/kg, 10 mg/kg to 12 mg/kg, 12 mg/kg to 16 mg/kg, 16 mg/kg to 20 mg/kg, 20 mg/kg to 24 mg/kg, 24 mg/kg to 28 mg/kg, or 28 mg/kg to 32 mg/kg (e.g., 0.2 mg/kg, 0.5 mg/kg, about 0.6 mg/kg, about 0.63 mg/kg, 1 mg/kg, 2mg
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 800 mg/m 2 , 600 mg/m 2 , or 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- day 1, day 8, and day 15 at a dose of 100 mg/m 2 , 75 mg/m 2 or 125 mg/m 2 intravenously (e.g., intravenous infusion).
- the method comprises one or more treatment cycle(s) of 28 days, wherein:
- (1) anti-Gal9 antibody is administered to the subject on day 1 and day 15 (i.e., once every 2 weeks (q2w)) at a dose of about 0.2 mg/kg, about 0.5 mg/kg, about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 6.3 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, about 10 mg/kg, about 11 mg/kg, about 12 mg/kg, about 13 mg/kg, about 14 mg/kg, about 15 mg/kg, about 16 mg/kg, about 17 mg/kg, about 18 mg/kg, about 19 mg/kg, or about 20 mg/kg or any increment therein, via intravenous infusion,
- gemcitabine is administered to the subject on day 1, day 8, and day 15 at a dose of 800 mg/m 2 , 600 mg/m 2 , or 1000 mg/m 2 intravenously (e.g., intravenous infusion),
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- day 1, day 8, and day 15 at a dose of 100 mg/m 2 , 75 mg/m 2 or 125 mg/m 2 intravenously (e.g., intravenous infusion).
- treatment cycles may continue over a period of 12-24 months.
- the anti-galectin-9 antibody can be administered (alone or in combination with one or more chemotherapeutic agents, e.g., gemcitabine and nab-paclitaxel, e.g., at the doses described herein) once a week, once every 2 weeks for one cycle, once every 2 weeks for two cycles, once every 2 weeks for three cycles, once every 2 weeks for four cycles, or once every 2 weeks for more than four cycles.
- the treatment is 1 to 3 months, 3 to 6 months, 6 to 12 months, 12 to 24 months, or longer.
- the treatment is once every 2 weeks for 1 to 3 months, once every 2 weeks for 3 to 6 months, once every 2 weeks for 6 to 12 months, or once every 2 weeks for 12 to 24 months, or longer.
- the method for treating a solid tumor (e.g., PD AC) described herein comprises one or more treatment cycle(s) of 28 days, wherein the anti-Gal9 antibody is administered to the subject on day 1, day 7, day 15, and day 21 (i.e., once weekly (qlw)) at a dose of about 0.2 mg/kg to 0.5 mg/kg, about 0.5 mg/kg to 1 mg/kg, about 1 mg/kg to 2 mg/kg, about 3 mg/kg to 4 mg/kg, about 4 mg/kg to 8 mg/kg, about 4 mg/kg to 6 mg/kg, about 4 mg/kg to 6.3 mg/kg, about 6 mg/kg to 8 mg/kg, about 6.3 mg/kg to 8 mg/kg, about 8 mg/kg to 12 mg/kg, about 8 mg/kg to 10 mg/kg, about 10 mg/kg to 12 mg/kg, about 12 mg/kg to 16 mg/kg, about 16 mg/kg to 20 mg/kg, about 20 mg/kg to 24 mg/kg, about 24 mg
- paclitaxel is administered to the subject at 125 mg/m 2 intravenously (e.g., intravenous infusion).
- gemcitabine is administered to the subject at 1000 mg/m 2 intravenously (e.g., intravenous infusion).
- the dose of gemcitabine may be reduced to 800 mg/m 2 or 600 mg/m 2 .
- the dose of paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- the anti-Gal9 antibody may be administered to the subject at a dose of about 10 mg/kg to about 16 mg/kg once every week.
- the anti-Galectin-9 antibody is administered to the subject at a dose of 10 mg/kg once every week or at a flat dose of 650-700 mg once every week.
- the anti-Galectin-9 antibody is administered to the subject at a dose of 16 mg/kg once every week or at a flat dose of 1040-1120 mg once every week.
- the method for treating a solid tumor (e.g., PDAC) described herein comprises one or more treatment cycle(s) of 28 days, wherein the anti-Gal9 antibody is administered to the subject on day 1, day 7, day 15, and day 21 (i.e, once weekly (qlw)) at a dose of 0.2 mg/kg to 0.5 mg/kg, 0.5 mg/kg to 1 mg/kg, 1 mg/kg to 2 mg/kg, 3 mg/kg to 4 mg/kg, 4 mg/kg to 8 mg/kg, 4 mg/kg to 6 mg/kg, 4 mg/kg to 6.3 mg/kg, 6 mg/kg to 8 mg/kg,
- qlw once weekly
- paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- paclitaxel is administered to the subject at 125 mg/m 2 intravenously (e.g., intravenous infusion).
- gemcitabine is administered to the subject at 1000 mg/m 2 intravenously (e.g., intravenous infusion).
- the dose of gemcitabine may be reduced to 800 mg/m 2 or 600 mg/m 2 .
- the dose of paclitaxel e.g., nanoparticle albumin-bound paclitaxel
- the anti-Gal9 antibody may be administered to the subject at a dose of about 10 mg/kg to about 16 mg/kg once every week.
- the anti-Galectin-9 antibody is administered to the subject at a dose of 10 mg/kg once every week or at a flat dose of 650- 700 mg once every week.
- the anti-Galectin-9 antibody is administered to the subject at a dose of 16 mg/kg once every week or at a flat dose of 1040-1120 mg once every week.
- the method for treating a solid tumor (e.g., PDAC) described herein comprises one or more treatment cycle(s) of 28 days, wherein the anti-Gal9 antibody is administered to the subject on day 1, day 7, day 15, and day 21 (i.e., once weekly (qlw)) at a dose of about 0.2 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.63 mg/kg, about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 6.3 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, about 10 mg/kg, about 11 mg/kg, about 12 mg/kg, about 13 mg/kg, about 14 mg/kg, about 15 mg/kg, about 16 mg/kg, about 17 mg/kg, about 18 mg/kg, about 19 mg/kg, or about 20 mg/kg or any increment therein, via intravenous infusion and gemcitabine and pac
- paclitaxel is administered to the subject at 125 mg/m 2 intravenously (e.g., intravenous infusion).
- gemcitabine is administered to the subject at 1000 mg/m 2 intravenously (e.g., intravenous infusion). When needed, the dose of gemcitabine may be reduced to 800 mg/m 2 or 600 mg/m 2 .
- the dose of paclitaxel e.g., nanoparticle albumin- bound paclitaxel
- the anti- Gal9 antibody may be administered to the subject at a dose of about 10 mg/kg to about 16 mg/kg once every week.
- the anti-Galectin-9 antibody is administered to the subject at a dose of 10 mg/kg once every week or at a flat dose of 650-700 mg once every week.
- the anti-Galectin-9 antibody is administered to the subject at a dose of 16 mg/kg once every week or at a flat dose of 1040-1120 mg once every week.
- Gal-9 antibody treatment may be initiated concomitantly with chemotherapy (e.g., gemcitabine and nab-paclitaxel).
- Gal-9 antibody treatment may be initiated after a chemotherapeutic regimen (e.g., gemcitabine and nab-paclitaxel) has already started.
- a chemotherapeutic regimen e.g., gemcitabine and nab-paclitaxel
- Gal-9 antibody treatment is administered concomitantly with chemotherapy (e.g., gemcitabine and nab-paclitaxel), and subsequently chemotherapy is discontinued.
- administration of anti- Gal-9 antibody treatment regimen may be continued.
- the interval or cycle may be once every week. In any of the above embodiments, the interval or cycle may be once every 2 weeks. In some embodiments, the regimen may be once every 2 weeks for one cycle, once every 2 weeks for two cycles, once every 2 weeks for three cycles, once every 2 weeks for four cycles, or once every 2 weeks for more than four cycles. In some embodiments, the treatment may be once every 2 weeks for 1 to 3 months, once every 2 weeks for 3 to 6 months, once every 2 weeks for 6 to 12 months, or once every 2 weeks for 12 to 24 months, or longer.
- the interval or cycle may be 3 weeks.
- the regimen may be once every 3 weeks for one cycle, once every 3 weeks for two cycles, once every 3 weeks for three cycles, once every 3 weeks for four cycles, or once every 3 weeks for more than four cycles.
- the treatment may be once every 3 weeks for 1 to 3 months, once every 3 weeks for 3 to 6 months, once every 3 weeks for 6 to 12 months, or once every 3 weeks for 12 to 24 months, or longer.
- the interval or cycle may be 4 or more weeks.
- the regimen is once every 4 or more weeks for one cycle, once every 4 or more weeks for two cycles, once every 4 or more weeks for three cycles, once every 4 or more weeks for four cycles, or once every 4 or more weeks for more than four cycles.
- the treatment may be once every 4 or more weeks for 1 to 3 months, once every 4 or more weeks for 3 to 6 months, once every 4 or more weeks for 6 to 12 months, or once every 4 or more weeks for 12 to 24 months, or longer.
- the treatment may be a combination of treatment at various time, e.g., a combination or 2 weeks, 3 weeks, 4 or more 4 weeks.
- the treatment interval may be adjusted in accordance with the patient’s response to treatment.
- the dosage(s) is adjusted in accordance with the patient’s response to treatment.
- the dosages are altered between treatment intervals.
- the treatment may be temporarily stopped.
- anti-Galectin-9 therapy is temporarily stopped.
- chemotherapy is temporarily stopped. In some embodiments, both are temporarily stopped.
- the one or more chemotherapeutic agents e.g., gemcitabine and nab-paclitaxel
- the anti-Galectin-9 antibody e.g., G9.2-17 IgG4
- the one or more chemotherapeutic agents can be administered to the subject prior to the administration of the anti-Galectin-9 antibody.
- the one or more chemotherapeutic agents e.g., gemcitabine and nab-paclitaxel
- the anti-Galectin-9 antibody e.g., G9.2-17 IgG4
- the chemotherapeutic agents can be administered on the first day of doing and the anti-Galectin-9 antibody can be administered on the following day.
- the checkpoint inhibitor such as any of the chemotherapeutic agents disclosed herein (e.g., gemcitabine and nab-paclitaxel) may be administered about 1-7 days (e.g., 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, or 7 days) prior to administration of the anti- Galectin 9 antibodies disclosed herein such as G9.2-17.
- the anti-Galectin 9 antibody can be administered to a subject prior to administration of the chemotherapeutic agent. In other instances, the administration of the anti- Galectin 9 antibody and the administration of the chemotherapeutic agent are performed on two consecutive days.
- the anti-Galectin-9 antibody may be administered to the subject on the first day of dosing and chemotherapeutic agent can be administered to the subject on the subsequent day.
- the anti-Galectin-9 antibodies disclosed herein may be administered about 1-7 days (e.g., 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, or 7 days) prior to administration of the chemotherapeutic agent, such as gemcitabine and nab-paclitaxel.
- the chemotherapeutic agent such as gemcitabine and nab-paclitaxel.
- methods are provided herein, wherein an anti-gal-9 antibody is administered in combination with chemotherapy (e.g., gemcitabine and nab-paclitaxel), for improving the overall response (e.g., at 3, 6 or 12 months), e.g., as compared to a baseline level prior to initiation of treatment.
- chemotherapy e.g., gemcitabine and nab-paclitaxel
- methods are provided herein for achieving a complete response, a partial response or stable disease (e.g., as measured at 3 months, 6 months or 12 months, or at a later time according to RECIST or iRECIST criteria).
- Such a response can be temporary over a certain time period or permanent.
- the methods may improve the likelihood of a complete response, a partial response or stable disease (e.g., as measured at 3 months, 6 months or 12 months), e.g., as compared to a baseline level prior to initiation of treatment.
- a response can be temporary over a certain time period or permanent.
- treating can result in longer survival or greater likelihood of survival, e.g., at a certain time, e.g., at 6 or 12 months or at a later time point.
- partial response, stable disease, complete response, a partial response, stable disease, progressive disease, disease progressing (e.g., as measured at 3 months, 6 months or 12 months, or at a later time), can be assessed according to RECIST criteria or iRECIST criteria.
- a response to treatment can be assessed according to RECIST or the RECIST 1.1 criteria and /or irRC, irRECIST, iRECIST, imRECISTPDAC, as described in Eisenhower et al., New response evaluation criteria in solid tumours: Revised RECIST guideline (version 1.1); European Journal Of Cancer 45 (2009) 228 - 247; or Borcoman et al., Annals of Oncology 30: 385-396, 2019;Nishino et al., Clin Cancer Res 2013; 19(14): 3936-3943, the contents of each of which is herein incorporated by reference in its entirety.
- methods are described herein to improve quality of life and symptom control as compared to baseline prior to initiation of treatment (e.g., as measured at 3 months, 6 months or 12 months, or at a later time). In some embodiments, improvements can be measured on the ECOG scale described in Example 2 herein.
- the disclosure provides methods for reducing or maintaining tumor size in a subject, including a human subject, (e.g., as measured at 3 months, 6 months or 12 months, or at a later time) either permanently or over a minimum time period, relative to a baseline tumor size prior to initiation of the treatment in the subject, the method comprising administering to the subject a therapeutically effective amount of an anti-Galectin-9 antibody as disclosed herein.
- the disclosure provides methods for improving the likelihood of reducing or maintaining tumor size in a subject, including a human subject, either permanently or over a minimum time period, (e.g., as measured at 3 months, 6 months or 12 months, or at a later time), e.g., as compared to a baseline level prior to initiation of treatment.
- the disclosure provides methods for reducing or maintaining a tumor burden, in a subject, including a human subject (e.g., as measured at 3 months, 6 months or 12 months, or at a later time), as compared to baseline levels prior to initiation of the treatment.
- tumor size and/or burden is measured in regularly scheduled restaging scans (e.g., CT with contrast, MRI with contrast, PET-CT (diagnostic CT) and/or X-ray).
- methods for increasing the time to disease progression or increase the time in progression-free survival (e.g., as measured at 6 months), comprising administering an anti-gal-9 antibody is in combination with chemotherapy (e.g. gemcitabine and nab-paclitaxel).
- chemotherapy e.g. gemcitabine and nab-paclitaxel.
- the methods can result in a greater likelihood of progression free survival (e.g., as measured at 3 months, 6 months or 12 months, or at a later time post initiation of treatment).
- methods are provided herein for improving duration and depth of response according to RECIST 1.1 criteria, (e.g., as measured at 3 months, 6 months or 12 months, or at a later time post initiation of treatment), comprising administering an anti-gal-9 antibody is in combination with chemotherapy (e.g. gemcitabine and nab-paclitaxel).
- chemotherapy e.g. gemcitabine and nab-paclitaxel
- the methods provided herein, wherein an anti-gal-9 antibody is administered in combination with chemotherapy may improve quality of life and/or improving symptom control (e.g., as measured at 1 month, 3 months, 6 months or 12 months, or at a later time using ECOG scale) as compared to baseline prior to initiation.
- the anti-Galectin-9 antibody may be used in combination with a regimen comprising UGN-102, UGN-201, or UGN-302.
- UGN-102, UGN-201, or UGN-302 are formulated in a hydrogel e.g., a reverse-thermal hydrogel technology-based hydrogel.
- the anti-Galectin-9 antibody can be administered prior to UGN-102, UGN-201, or UGN-302.
- the anti-Galectin- 9 antibody can be administered concurrently with UGN-102, UGN-201, or UGN-302.
- the anti-Galectin-9 antibody may be administered after UGN-102, UGN-201, or UGN-302.
- a patient’ s responses to any of the treatments disclosed herein may be monitored via routine practice or as disclosed herein.
- response to treatment can also be characterized by immunophenotype in blood and tumors, cytokine profile (serum), soluble galectin-9 levels in blood (serum or plasma), galectin-9 tumor tissue expression levels and pattern of expression by immunohistochemistry (tumor, stroma, immune cells), tumor mutational burden (TMB), PDL-1 expression (e.g., by immunohistochemistry), mismatch repair status, or tumor markers relevant for the disease (e.g., as measured at 3 months, 6 months or 12 months, or at a later time).
- tumor markers relevant for the disease e.g., as measured at 3 months, 6 months or 12 months, or at a later time.
- tumor markers include Cal5-3, CA-125, CEA, CA19-9, alpha fetoprotein.
- the subject may examined for one or more of the following features before, during, and/or after the treatment: (a) one or more tumor markers in blood samples from the subject, optionally wherein the one or more tumor markers comprise CA15-3, CA-125, CEA, CA19-9, and/or alpha fetoprotein, and any other tumor -type specific tumor markers; (b) cytokine profile; and (c)galectin 9 serum/plasma levels, d) peripheral blood mononuclear cell immunophenotyping, e) tumor tissue biopsy/excisional specimen multiplex immunophenotyping, f) tumor tissue biopsy/excisional specimen galectin-9 expression levels and pattern, g) any other immune score test such as: PDL-1 immunohistochemistry, tumor mutational burden (TMB), tumor microsatellite instability status, as well as panels such as: Immunoscore®- HalioDx, ImmunoSeq- Adaptive Biotechnologies, TIS, developed on the NanoString nCount
- methods of modulating treatment conditions are contemplated herein based on one or more of the features disclosed herein.
- an increase in an overall immune response is determined by a reduction in tumor weight, tumor size or tumor burden or any RECIST criteria described herein.
- an increase in an overall immune response is determined by increased level(s) of one or more proinflammatory cytokine(s), e.g., including two or more, three or more, or a majority of proinflammatory cytokines (one or more, two or more, or a majority of anti-inflammatory and/or immune suppressive cytokines and/or one or more of the most potent anti-inflammatory or immune suppressive cytokines either decrease or remain constant).
- an increase in an overall immune response is determined by increased levels of one or more of the most potent proinflammatory cytokines (one or more anti-inflammatory and/or immune suppressive cytokines including one or more of the most potent cytokines either decrease or remain constant). In some embodiments an increase in an overall immune response is determined by decreased levels of one or more, including a majority of, immune suppressive and/or anti-inflammatory cytokines (the levels of one or more, or a majority of, proinflammatory cytokines, including e.g., the most potent proinflammatory cytokines, either increase or remain constant).
- an increase in an overall immune response is determined by increased levels of one or more of the most potent anti-inflammatory and/or immune suppressive cytokines (one or more, or a majority of, proinflammatory cytokines, including, e.g., the most potent proinflammatory cytokines either increase or remain constant).
- an increase in an overall immune response is determined by a combination of any of the above.
- an increase (or upregulation) of one type of immune response parameter can lead to a corresponding decrease (or downregulation) in another type of immune response parameter.
- an increase in the production of certain proinflammatory cytokines can lead to the downregulation of certain anti-inflammatory and/or immune suppressive cytokines and vice versa.
- methods described herein wherein a Gal-9 antibody is administered with a chemotherapy, e.g., gemcitabine and nab-paclitaxel, may modulate levels of immune cells and immune cell markers in the blood or in tumors.
- a chemotherapy e.g., gemcitabine and nab-paclitaxel
- Such changes can be measured in patient blood and tissue samples using methods known in the art, such as multiplex flow cytometry and multiplex immunohistochemistry.
- a panel of phenotypic and functional PBMC immune markers can be assessed at baseline prior to commencement of the treatment and at various time point during treatment. Table 2 lists nonlimiting examples of markers useful for these assessment methods.
- FC Flow cytometry
- the disclosure provides methods for modulating an immune response (e.g., as measured at 3 months, 6 months or 12 months, or at a later time) in a subject, including a human subject, comprising administering to the subject a therapeutically effective amount of an anti-Galectin-9 antibody as disclosed herein.
- the disclosure provides methods for modulating levels of immune cells and immune cell markers, including but not limited to those described herein in Table 2, e.g., as compared to baseline levels prior to initiation of treatment, in the blood or in tumors of a subject, including a human subject, comprising administering to the subject a therapeutically effective amount of an anti- Galectin-9 antibody as disclosed herein.
- the overall result of modulation is upregulation of proinflammatory immune cells and/or down regulation of immune- suppressive immune cells.
- the methods described herein, wherein an anti-gal9 antibody is administered in combination with a chemotherapy may modulate immune activation markers such as those in Table 2.
- the methods described herein, wherein an anti-gal9 antibody is administered alone or in combination with a checkpoint inhibitor therapy results in one or more of (1) an increase in more CD8 cells in plasma or tumor tissue, (2) a reduction in T regulatory cells (Tregs) in plasma or tumor tissue, (3) an increase in Ml macrophages in plasma or tumor tissue and (4) a decrease in MDSCs in plasma or tumor tissue, and (5) a decrease in M2 macrophages in plasma or tumor tissue (e.g., as measured at 3 months, 6 months or 12 months, or at a later time).
- the markers that are assessed using the techniques described above or known in the art are selected from CD4, CD8 CD14, CDllb/c, and CD25. These parameters can either be compared to baseline levels prior to initiation of treatment.
- treating as described herein results in changes in proinflammatory and anti-inflammatory cytokines.
- methods are provided herein for one or more of (1) increasing levels of IFNgamma in plasma or tumor tissue; (2) increasing levels of TNFalpha in plasma or tumor tissue; (3) decreasing levels of IL- 10 in plasma or tumor tissue (e.g., as measured at 3 months, 6 months or 12 months, or at a later time). These parameters can be compared to baseline levels prior to initiation of treatment.
- changes in cytokines or immune cells may be assessed between a pre dose 1 tumor biopsy and repeat biopsy conducted at a feasible time. In some embodiments, changes in cytokines or immune cells may be assessed between 2 repeat biopsies. In some embodiments, methods are described herein of modulating levels one or more of soluble galectin-9 levels in blood (serum or plasma), or galectin-9 tumor tissue expression levels and pattern of expression by immunohistochemistry (tumor, stroma, immune cells), (e.g., as measured at 3 months, 6 months or 12 months, or at a later time).
- methods are described herein for decreasing of one or more of soluble galectin-9 levels in blood (serum or plasma), or in galectin-9 tumor tissue expression levels and pattern of expression by immunohistochemistry (tumor, stroma, immune cells) decrease, (e.g., as measured at 2 weeks, 4 weeks, 1 month, 3 months, 6 months or 12 months, or at a later time).
- galectin-9 levels can be compared to baseline levels prior to initiation of treatment. In some embodiments, measurements are taken at 2 months.
- methods are described herein for modulating levels of PD-L1 expression, e.g., as assessed by immunohistochemistry.
- the disclosure provides methods for modulating PDL-1 expression, e.g., as assessed by immunohistochemistry (e.g., as measured at 2 weeks, 4 weeks, 1 month, 3 months, 6 months or 12 months, or at a later time), comprising administering to the subject a therapeutically effective amount of an anti- Galectin-9 antibody as disclosed herein.
- PDL-1 expression e.g., as assessed by immunohistochemistry, remains unchanged.
- PD-L1 levels can either be compared to baseline levels prior to initiation of treatment.
- the methods provided herein decrease PDL-1 expression, e.g., as assessed by immunohistochemistry.
- PD-L1 levels may be measured using routine methods known in the art.
- PD-L1 SP263
- methods are provided herein for modulating one or more tumor markers (increase or decrease) relevant for the disease (e.g., as measured at 3 months, 6 months or 12 months, or at a later time).
- tumor markers include Cal5-3, CA-125, CEA, CA19-9, alpha fetoprotein. These parameters can be compared to baseline levels prior to initiation of treatment.
- the methods provided herein decrease the occurrence of one or more tumor markers relevant for the disease.
- the disclosure provides methods for modulating PDL-1 expression, e.g., as assessed by immunohistochemistry (e.g., as measured at 2 weeks, 4 weeks,
- PDL-1 expression e.g., as assessed by immunohistochemistry
- PD-L1 levels can be compared to baseline levels prior to initiation of treatment.
- the methods provided herein decrease PDL-1 expression, e.g., as assessed by immunohistochemistry.
- the disclosure provides methods for modulating one or more biomarkers (increasing or decreasing) relevant for the disease (e.g., as measured at 2 weeks, 4 weeks, 1 month, 3 months, 6 months or 12 months, or at a later time), comprising administering to the subject a therapeutically effective amount of an anti-Galectin-9 antibody as disclosed herein.
- levels of biomarkers in clinical tissues from patients can be measured using routine methods, such as multiplex Immunofluorescence (mIF) technology, as described herein in the examples.
- mIF multiplex Immunofluorescence
- An exemplary panel of biomarkers may include CD3, CD4, CD8, CD45RO, FoxP3, CDllb, CD14, CD15, CD16, CD33, CD68, CD163, HLA-DR, Arginasel, Granzyme B, Ki67, PD1, PD-L1, F4/80, Ly6G/C and PanCK.
- cytokine profiles are modulated.
- the disclosure provides methods of modulating an immune response in a subject.
- the immune response may be T cell-mediated and/or B cell-mediated immune responses that are influenced by modulation of immune cell activity, for example, T cell activation.
- an immune response is T cell mediated.
- the term “modulating” means changing or altering, and embraces both upmodulating and downmodulating.
- “modulating an immune response” means changing or altering the status of one or more immune response parameter(s).
- Exemplary parameters of a T cell mediated immune response include levels of T cells (e.g., an increase or decrease in effector T cells) and levels of T cell activation (e.g., an increase or decrease in the production of certain cytokines).
- Exemplary parameters of a B cell mediated immune response include an increase in levels of B cells, B cell activation and B cell mediated antibody production.
- modulating the immune response causes an increase (or upregulation) in one or more immune response parameters and a decrease (or downregulation) in one or more other immune response parameters, and the result is an overall increase in the immune response, e.g., an overall increase in an inflammatory immune response.
- modulating the immune response causes an increase (or upregulation) in one or more immune response parameters and a decrease (or downregulation) in one or more other immune response parameters, and the result is an overall decrease in the immune response, e.g., an overall decrease in an inflammatory response.
- methods comprising administering an anti- gal9 antibody in combination with a chemotherapy, for modulating soluble galectin-9 levels in blood (serum or plasma), or galectin-9 tumor tissue expression levels and pattern of expression by immunohistochemistry (tumor, stroma, immune cells) in a subject, (e.g., as measured at 3 months, 6 months or 12 months, or at a later time).
- Galectin-9 levels in a subject can be compared to baseline levels prior to initiation of treatment.
- methods are provided herein for decreasing of one or more of soluble galectin-9 levels in blood (serum or plasma), or in galectin-9 tumor tissue expression levels and pattern of expression by immunohistochemistry (tumor, stroma, immune cells) decrease, (e.g., as measured at 3 months, 6 months or 12 months, or at a later time).
- methods comprising administering an anti- gal9 antibody in combination with a chemotherapy, for modulating one or more tumor markers (increase or decrease) relevant for the disease (e.g., as measured at 3 months, 6 months or 12 months, or at a later time).
- tumor markers include Cal5-3, CA- 125, CEA, CA19-9, alpha fetoprotein. These parameters can be compared to baseline levels prior to initiation of treatment.
- kits for use in treating or alleviating a solid tumor for example, PDA, CRC, HCC, or cholangiocarcinoma, and others described herein.
- kits can include one or more containers comprising an anti-Galectin-9 antibody, e.g., any of those described herein (e.g., G9.2-17(IgG4)), and optionally one or more chemotherapeutics (e.g., a gemcitabine and/or paclitaxel) to be co-used with the anti-Galectin-9 antibody, which is also described herein.
- an anti-Galectin-9 antibody e.g., any of those described herein (e.g., G9.2-17(IgG4)
- chemotherapeutics e.g., a gemcitabine and/or paclitaxel
- the kit can comprise instructions for use in accordance with any of the methods described herein.
- the included instructions can comprise a description of administration of the anti-Galectin-9 antibody, and the one or more chemotherapeutics, to treat, delay the onset, or alleviate a target disease as those described herein.
- the kit further comprises a description of selecting an individual suitable for treatment based on identifying whether that individual has the target disease, e.g., applying the diagnostic method as described herein.
- the instructions comprise a description of administering an antibody to an individual at risk of the target disease.
- the instructions relating to the use of an anti-Galectin-9 antibody and the one or more chemotherapeutics generally include information as to dosage, dosing schedule, and route of administration for the intended treatment.
- the containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses.
- Instructions supplied in the kits of the invention are typically written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable.
- the label or package insert indicates that the composition is used for treating, delaying the onset and/or alleviating the solid tumor.
- instructions are provided for practicing any of the methods described herein.
- kits of this invention are in suitable packaging.
- suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like.
- packages for use in combination with a specific device such as an inhaler, nasal administration device (e.g., an atomizer) or an infusion device such as a minipump.
- a kit has a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- the container also has a sterile access port (for example the container is an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- a sterile access port for example the container is an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle.
- At least one active agent in the composition is an anti-Galectin-9 antibody as those described herein.
- Kits may optionally provide additional components such as buffers and interpretive information.
- the kit comprises a container and a label or package insert(s) on or associated with the container.
- the invention provides articles of manufacture comprising contents of the kits described above.
- the specific animal used was the orthotopic mPA6115 pancreatic cancer xenograft model in female C57BL/6 mice.
- tumors were sourced from mPA6115 mice, a mouse homograft model of pancreatic ductal adenocarcinoma (PD AC) that retains morphological similarity to human PD AC.
- the mPA6115 mouse stain carried the conditional mutant Kras (Kras LSL G12D/WT ), a constitutive deletion of Trp53 (P53KO/KO) and a Cre driven by the promotor of Pdxl gene and developed severe PD AC tumors at the age of 8 weeks.
- mPA6115 mice with palpable tumors were sacrificed, and their pancreatic tumors were collected.
- the collected tumor tissue was cut into small fragments (-2 mm 3 ) and transplanted subcutaneously (SC) to the syngeneic recipients, C57BL/6 mice. These seed tumors were maintained subcutaneously in the C57BL/6 mice until the volume of seed tumor reached 700-1000 mm 3 .
- the tumors were collected and cut into pieces of about 2 mm 3 in diameter. Tumors then were washed with ice cold Roswell Park Memorial Institute (RPMI) 1640 medium (without serum) to remove the adjacent non- tumor tissues. Then the tumor pieces were placed in ice cold RPMI 1640 medium until orthotopic implantation.
- RPMI Roswell Park Memorial Institute
- mice were subjected to pancreatic orthotopic implantation. Specifically, after animals were fully anesthetized, a small longitudinal incision below the left lower rib cage was made to expose the spleen and the pancreas underneath the spleen. One seed tumor piece per mouse was sewn into the pancreas with 6-0 silk suture. Then the tissue surrounding the tumor piece was sutured with 6-0 silk suture, and the tumor piece was wrapped with pancreas tissue. The abdomen was then closed with a 4-0 silk suture. After tumor implantation, animals were kept in a warm cage, and subsequently returned to the animal room after full recovery from the anesthesia.
- mice On the day when implantation was performed, implemented mice were randomly grouped into 6 groups based on their body weight where randomization was performed based on the "Matched distribution" method (StudyDirectorTM software, version 3.1.399.19). The date of randomization was denoted as day 0. Three days after implantation, animals began a dosing regimen according to group number. The dosing regimen for each group is provided below in Table 3.
- Anti-Gal9 mAh was the mouse IgGl version of the human G9.2-17 antibody, which binds the same carbohydrate binding domain 2 (CRD2) on galectin-9 as G9.2-17 and has the same VH and VL regions as G9.2-17.
- CCD2 carbohydrate binding domain 2
- resulting data using Anti-Gal9 mAh is correlative to human efficacy of G9.2-17.
- groups 5 and 6 of implanted mice were also treated with a standard of care chemotherapy (a gemcitabine/abraxane regimen), or a combination of Anti-Gal9 mAh and chemotherapy.
- mice in groups 1-7 were checked daily for morbidity and mortality. During routine monitoring, the animals were checked for any effects of tumor growth and treatments on behavior such as mobility, food and water consumption, body weight gain/loss, eye/hair matting and any other abnormalities. Body weights and tumor volumes measured twice per week after randomization using StudyDirectorTM software (version 3.1.399.19). Measurements and monitoring were collected as described from day 0 until day 66 when the last mouse was found dead. Blood, plasma, spleen, and tumors were collected from each mouse at end of life. Table 4 below shows the average life span of the mice by experiment group.
- the primary endpoint of survival in animals engrafted with orthotopic KPC tumors was assessed by estimating survival curves for each group, considered separately, using the Kaplan- Meier method and compared statistically using the log rank test. Specifically, Kaplan- Meier survival curves/Log Rank test (SPSS 18) were used. The Kaplan- Meier survival curves and log rank test are shown in Figs. 1A-1D. Results of log rank test are provided in Table 5.
- Cox-regression analysis (coxph function of survival R package) was used to calculate hazard ratios (HR) and their 95% confidence interval (%95CI) of group 4-6 against group 1, group 2 and group 3 respectively.
- Cox-regression analysis to calculate hazard ratios (HR) and their 95% confidence interval (%95CI) of group 5 and 6 against group 4.
- cox-regression analysis to calculate hazard ratio (HR) and its 95% confidence interval (%95CI) of group 6 against group 5. Results of the cox regression analysis are shown in Fig. 2 and Table 6.
- group 4 and group 6 had significant lower hazard ratio than group 1, whereas group 2 and group 3 did not have significant different hazard ratios with group 1.
- group 6 had a significant lower hazard ratio than group 2; however, group 3 did not have significant different hazard ratios with group 2.
- groups 4, 5, and 6 did not have significant different hazard ratios with group 3.
- groups 5 and 6 did not have significant different hazard ratios with group 4.
- the cox regression analysis that used group 5 as the reference showed that group 6 did not have significant different hazard ratios with group 5.
- FIG. 3 shows the body weight measurements collected for the duration of the study period measured by using StudyDirectorTM software (version 3.1.399.19).
- Galectin-9 is a molecule overexpressed by many solid tumors, including those in pancreatic cancer, colorectal cancer, and hepatocellular carcinoma. Moreover, Galectin-9 is expressed on tumor-associated macrophages, as well as intra-tumoral immunosuppressive gamma delta T cells, thereby acting as a potent mediator of cancer-associated immunosuppression.
- G9.2-17 is a fully human IgG4 monoclonal antibody (mAh) targeting galectin-9 (-gal-9) protein.
- Gal-9 functions as an immuno-suppressor, conferring immune privilege to tumor cells and disabling immune mediated cancer attack by regulating macrophages, T-cells, myeloid derived suppressor cells as well as cancer cell susceptibility to cytotoxic T-cell- induced death.
- G9.2-17 (IgG4) blockade of gal-9 interferes with the immunosuppressive functions of gal-9 resulting in effective immune activation and tumor growth inhibition across multiple preclinical models.
- Gal-9 can be overexpressed and/or secreted in many solid tumor types including pancreatic adenocarcinoma, cholangiocarcinoma (CCA), colorectal cancer (CRC), breast cancer, bladder cancer, ovarian cancer, non-small cell and small cell lung cancer, nasopharyngeal cancer, malignant melanoma, ovarian cancer etc., and high levels of tissue and/or circulating gal-9 correlate with aggressive tumor features and adverse survival outcome.
- CCA cholangiocarcinoma
- CRC colorectal cancer
- breast cancer bladder cancer
- ovarian cancer non-small cell and small cell lung cancer
- nasopharyngeal cancer malignant melanoma
- ovarian cancer etc. and high levels of tissue and/or circulating gal-9 correlate with aggressive tumor features and adverse survival outcome.
- G9.2-17 (IgG4) are relapsed or refractory, metastatic solid tumors, where G9.2-17 (IgG4) is investigated both as a single agent and in combination with a checkpoint inhibitor (a programmed cell death 1 [PD 1] antibody).
- a checkpoint inhibitor a programmed cell death 1 [PD 1] antibody
- Dose escalation is conducted in all comer solid tumors types in order to establish the safety and tolerability profile of G9.2-17 (IgG4), assess its immunogenicity potential, establish the pharmacokinetic (PK) and pharmacodynamic (PD) profile, and arrive at the recommended Phase 2 dose (RP2D). This may be the maximal tolerated dose (MTD).
- the expansion cohorts are planned in: first line metastatic pancreatic ductal adenocarcinoma (PDAC), in combination with gemcitabine/nab-paclitaxel; as well as CRC and CCA, e.g., as a single agent.
- PDAC metastatic pancreatic ductal adenocarcinoma
- CRC and CCA e.g., as a single agent.
- G9.2-17 (IgG4) has been shown to be highly specific for gal-9 and has been demonstrated to be efficacious in multiple animal models of cancer. The patient populations targeted for enrollment are at late stages in their disease and have failed at standard of care treatments prior to enrollment in this study. G9.2-17 (IgG4), either taken alone or in combination with one or more chemotherapeutic agents such as gemcitabine and paclitaxel as disclosed herein would be expected to benefit treatment of malignant tumors such as malignant solid tumors. Objectives and Endpoints
- Part 1 This is an open-label, uncontrolled, multicenter Phase 1/2 study with a dose escalation phase (Part 1) and a cohort expansion phase (Part 2) in patients with relapsed/refractory metastatic solid tumors.
- Part 2 This study is conducted at up to 20 sites in the United States. The study duration is estimated to be 12-24 months.
- follow-up for survival continues for up to 2 years.
- a study schema is presented in Fig. 4.
- Treatment Duration and Treatment Periods Treatment Duration Study drug administration continues until progression of disease, unacceptable toxicity, or withdrawal from the study. Patients who discontinue the study drug prior to disease progression and are not being treated with other systemic anti-cancer therapy(ies), are followed on the study until the time of disease progression.
- Treatment period 28-day treatment cycles as presented in the Schedule of Assessments (SoA; Table 13 and Table 14)
- Post-treatment period 30 days after last treatment (End of Treatment Visit/Early Termination Visit)
- a dose-finding study is conducted using a continuous reassessment method (CRM)
- Dose escalations are based on analysis of patient safety data focusing on occurrences of DLTs at previous dose levels and other relevant safety and dosing data from previous cohorts. Dose escalations may occur after a minimum of 28 days (1 cycle). No dose level skipping is allowed.
- a once weekly (QW) G9.2-17 (IgG4) dosing schema is evaluated, provided the RP2D has not been reached within the CRM design.
- Cohorts 7 and 8 are not evaluated with the CRM design. Patients are only allowed to enter Cohort 7 once no DLT has been identified.
- four patients at a time are dosed per cohort.
- Four patients per dose level in cohorts 7 and 8 are assigned to receive sequentially higher IV injections of G9.2-17 (IGG4) every week (QW) on Days 1, 8, 15, and 22 of each 28-day cycle. Starting with the first four patients in cohort 7, dose escalations to the next cohort only occur if no DLTs are identified. If a single DLT is documented in cohort 7, no further patients are dosed within that cohort and cohort 8 is not activated.
- Patients treated in early cohorts prior to identification of the RP2D are allowed to dose escalate up to the highest dose level cleared. After a complete cycle, dose escalations may occur after a minimum of 28 days (1 cycle). Dose escalations may not occur in the middle of a cycle. Patients can continue to dose escalate to the highest approved dose level until they are discontinued for toxicity or disease progression, or for other reasons (e.g., a patient elects to discontinue from the study).
- Dose escalations are based on the development of DLTs in patients treated at previous dose levels.
- prior DLT probabilities are specified from GLP-compliant toxicity studies as well as from preclinical models.
- the prior distribution on the parameter “a” has a mean zero normal distribution with the least informative prior variance.
- the trial is stopped for safety if the lower limit of an Agresti and Coull binomial confidence interval (Cl) for the lowest study dose level exceeds the target DLT rate (Agresti and Coull, 1998).
- the RP2D is the MTD dose derived from Part 1.
- a DLT occurs in any patient during the first 28 days of treatment, that patient is permanently discontinued from study drug administration ⁇
- dose reduction is allowed only if clinical benefit is expected and may continue to be derived with lower doses of G9.2-17 (IgG4).
- the dose of G9.2-17 (IgG4) is initially reduced by 50%, and potentially by a further reduction of 50%, as defined by the dose modification guidance provided in Table 7. No further dose reductions are allowed.
- Part 1 is completed when up to six patients have received the dose that has been identified as RP2D.
- the RP2D is based, in part, on the continual reassessment method (CRM) study design, PK and PD data parameters, additional safety and efficacy data and any other factors to be considered.
- CRM continual reassessment method
- backfill cohorts The purpose of backfill cohorts is to assess the safety, tolerability, and the biological effect of G9.2-17 (IGG4) in patients whose tumors are gal-9 positive.
- the gal-9 status of the RP2D cohort is retrospectively determined. If fewer than 6 patients with gal-9 positive tumors are treated at the RP2D, patients designated for the backfill cohort require prospective assessment of gal-9 tumor status by IHC. Up to 6 additional patients, whose tumors are gal-9 positive, may be enrolled to backfill cohorts at the RP2D dose level.
- the second part of the protocol adopts a Simon’s two-stage optimal design and includes approximately 223 patients. It is planned to expand cohorts for PDAC, CRC and CCA and/or potentially other solid tumor types which are based on implementing tumor-specific consideration for expansion cohorts and clinical trial endpoints. The rationale behind this approach is to ensure recruitment feasibility, as well as to capture the clinical need for specific indications.
- CRC and CCA patients receive one of two treatments (4 treatment arms total):
- PDAC patients receive G9.2-17 (IGG4) in combination with gemcitabine/nab-paclitaxel.
- gemcitabine/nab-paclitaxel + G9.2-17 (IgG4) treatments can be administered on the same day.
- Gemcitabine/nab-paclitaxel should be administered prior to G9.2-17 (IgG4). If for any reason same-day administration cannot be accomplished, gemcitabine/nab-paclitaxel should be administered on the first day, and G9.2-17 (IgG4) on the subsequent day.
- the starting dose of G9.2-17 (IgG4) in the single treatment is the RP2D identified in Part 1.
- the optimal two-stage design (Stages I and II) are used to test the null hypothesis that the ORR3 is ⁇ 5% versus the alternative hypothesis that the ORR3 is > 15% within the single- agent arms.
- this trial arm is terminated if ⁇ 1 patient responds. If the trial goes on to the Stage II of Simon’s optimal design, approximately 33 patients are treated additionally in each of the single-agent arms. If the total number of responding patients is ⁇ 5, the investigational drug within that arm is rejected. If > 6 patients have a confirmed ORR 3, the Part 3 expansion cohort for that arm is activated and described in an amendment to the protocol.
- Dose reduction is allowed only if the clinical benefit is expected and may continue to be expected to derive with lower doses of G9.2-17 (IgG4).
- the dose of G9.2-17 (IgG4) is initially reduced by 50%, and potentially by a further reduction of 50%, as defined by the dose modification guidance provided in the protocol. No further dose reductions are allowed.
- the Part 2 cohort for patients with metastatic PDAC entails combination treatment of G9.2-17 (IgG4) and gemcitabine/nab-paclitaxel in the first line metastatic setting.
- the dose of G9.2-17 is the RP2D-1 dose, which is the dose level in the cohort immediately preceding the RP2D dose identified in Part 1.
- a safety run-in is performed in which the first 8 patients are dosed and that arm is continued only if ⁇ 2 patients develop a DLT, which is below the target toxicity level (TTL) of 25%. If 3 or more patients develop a DLT, this combination treatment arm is terminated.
- TTL target toxicity level
- G9.2-17 IgG4
- the dose of G9.2-17 (IgG4) is initially reduced by 50%, and potentially by a further 50%. No further dose reductions are allowed.
- Dose modifications of gemcitabine and/or nab-paclitaxel are allowed.
- the primary efficacy endpoint is patient PFS6.
- the PFS6 was reported to be 50% (von Hoff et al., 2013).
- G9.2-17 (IGG4)/chemotherapy combination in 11 patients in the first stage of the Simon two-stage design, the trial is terminated if 6 or fewer patients exhibit PFS > 6 months. If the trial goes on to the second stage of the Simon’s two-stage design, approximately 14 patients are treated additionally. If the total number of responding patients with PFS-6 is ⁇ 16, the study arm is rejected.
- Completion of Part 2 is dependent upon patient ORR 3 for CRC and CCA patients, and PFS 6 for PD AC.
- an expansion cohort is launched to confirm the finding as described above.
- the sample size for each of the expansion arms is determined based on the point estimates determined in Part 2, in combination with a predetermined level of precision for the 95% Cl around the ORR/OS and PFS.
- a protocol amendment is submitted with details around the expansion population, treatment regimen, and statistical analysis plan prior to initiating Part 3.
- Dose-limiting toxicides assessed in this trial are defined as a clinically significant hematologic and/or non-hematologic AE or abnormal laboratory value assessed as unrelated to metastatic tumor disease progression, intercurrent illness, or concomitant medications and is possibly related or related to the study drug and occurring during the first cycle (28 days) on study. Any patient that experiences a DLT in Part 1 or Part 2 during the first 28 days of treatment is permanently discontinued from study drug administration.
- a DLT is a toxicity that meets any of the following criteria:
- End of study for Part 1 of the study is defined at the point when the RP2D has been identified and all patients have been treated with G9.2-17 (IGG4) until confirmed disease progression.
- the end of the study is defined as the date of the last patient’s last visit.
- the respective trial arm is stopped if ⁇ 1 patient responds. If the trial goes on to the Stage II of Simon’s optimal design, a trial arm is stopped if the total number of responding patients is ⁇ 5 within that arm.
- the trial arm is stopped if ⁇ 6 patients exhibit PFS > 6 months. If the trial goes on to Stage II, the trial arm is stopped if the total number of responding patients with PFS of > 6 months is ⁇ 16.
- a safety run-in is performed in which the first 8 patients are dosed.
- enrollment continues only if ⁇ 2 patients develop a DLT, which is below the target toxicity level (TTL) of 25%. If 3 or more patients with a given cancer type develop a DLT in a combination treatment arm, enrollment for that cancer type in that arm is terminated.
- TTL target toxicity level
- alanine aminotransferase ⁇ 3 x ULN ( ⁇ 5 x ULN when HCC or hepatic metastases present)
- g. bilirubin ⁇ 1.5 x ULN patients with known Gilbert’s disease may have a bilirubin ⁇ 3.0 x ULN) h. albumin > 3.0 g/dL i. international normalized ratio (INR) and partial thromboplastin time (PTT) ⁇ 1.5 x ULN j. amylase and lipase ⁇ 1.5 x ULN
- Women of child-bearing potential must have a negative pregnancy test within 72 h prior to start of treatment.
- a woman is of childbearing potential if she is post-menarche, has not reached a postmenopausal state (> 12 continuous months of amenorrhea with no identified cause other than menopause), and has not undergone surgical sterilization (removal of ovaries and/or uterus).
- contraceptive methods with a failure rate of ⁇ 1 % per year include bilateral tubal ligation, male sterilization, hormonal contraceptives that inhibit ovulation, hormone-releasing intrauterine devices and copper intrauterine devices.
- the reliability of sexual abstinence should be evaluated in relation to the duration of the clinical trial and the preferred and usual lifestyle of the patient.
- Periodic abstinence e.g., calendar, ovulation, symptom-thermal, or post ovulation methods
- withdrawal are not acceptable methods of contraception.
- Fertile men must practice effective contraceptive methods during the study, unless documentation of infertility exists.
- Biliary or gastric outlet obstruction allowed, provided it is effectively drained by endoscopic, operative, or interventional means
- pancreatic, biliary, or enteric fistulae allowed, provided they are controlled with an appropriate non-infected and patent drain (if any drains or stents are in situ, patency needs to be confirmed before study start)
- Patients a. who have already received at least one prior line of systemic therapy for metastatic disease, or b. who have a tumor type for which there are no available standard of care options.
- PD AC expansion cohort 1st line metastatic patients who are either gemcitabine- containing regimen naive or at least 3 months out of having been treated using a gemcitabine-containing regimen previously in a neoadjuvant or adjuvant/locally advanced setting
- Grade 4 immune-mediated toxicities with a prior checkpoint inhibitor Grade 2 or Grade 3 pneumonitis or any other Grade 3 checkpoint inhibitor-related toxicity that led to immunotherapy treatment discontinuation.
- Low-grade ( ⁇ Grade 3) toxicities, such as neuropathy from prior treatments, manageable electrolyte abnormalities and lymphopenia, alopecia and vitiligo are allowed.
- recurrent is defined as >3 drains in the previous 30 days.
- Active auto-immune disorder except type I/II diabetes, hypothyroidism requiring only hormone replacement, vitiligo, psoriasis, or alopecia areata
- Requires systemic immunosuppressive treatment including, but not limited to cyclophosphamide, azathioprine, methotrexate, thalidomide, and anti-TNF agents.
- Patients who have received or are receiving acute, low dose systemic immunosuppressant medications e.g., ⁇ 10 mg/day of prednisone or equivalent
- replacement therapy e.g., thyroxine, insulin, physiologic corticosteroid replacement therapy [eg, ⁇ 10 mg/day of prednisone equivalent] for adrenal or pituitary insufficiency
- thyroxine thyroxine, insulin
- physiologic corticosteroid replacement therapy eg, ⁇ 10 mg/day of prednisone equivalent] for adrenal or pituitary insufficiency
- Study intervention(s) is/are defined as any investigational agent(s), marketed product(s), placebo, or medical device(s) intended to be administered/used to/in a study participant according to the study protocol.
- Gemcitabine is a nucleoside metabolic inhibitor indicated for treatment of multiple cancer types, both alone and in combination with other therapies.
- Nab-paclitaxel (Abraxane ® ; a protein-bound form of paclitaxel) is a microtubule inhibitor also indicated for treatment of multiple tumor types. Specifically, Nab-paclitaxel is indicated as a first line treatment for metastatic PD AC in combination with gemcitabine.
- Gemcitabine is administered as a 1000 mg/m2 dose over 30 minutes on Days 1, 8 and 15 of each 28-day cycle.
- Nab-paclitaxel is administered as a 125 mg/m2 dose over 3-40 minutes on Days 1, 8 and 15 of each 28-day cycle.
- G9.2-17 (IgG4) is administered via IV infusion, weekly, or every 2 weeks, until progression of disease, unacceptable toxicity, or withdrawal of consent.
- patients receive the RP2D of G9.2-17 (IgG4) (as determined in Part 1) as a single agent or the G9.2-17 (IgG4) RP2D-1 in combination with gemcitabine/nab-paclitaxel as follows:
- Manufacture and packaging of the investigational medicinal product (IMP) G9.2-17 (IgG4) is in accordance with applicable current Good Manufacturing Practice (cGMP) and the product meets applicable criteria for use in humans.
- cGMP Current Good Manufacturing Practice
- G9.2-17 (IgG4) drug product is diluted to the target dose prior to administration ⁇ All dilutions should be performed in a controlled and sterile environment (patient dose is prepared for and delivered via an approximately 60 minutes IV infusion).
- G9.2-17 (IgG4) is a sterile liquid and is stored at 2°C to 8°C and protected from light.
- G9.2-17 may be continued if:
- Nab-paclitaxel is not recommended in patients who have total bilirubin >5 x ULN or AST >10 x ULN.
- Nab-paclitaxel is not recommended in patients with metastatic adenocarcinoma of the pancreas who have moderate to severe hepatic impairment (total bilirubin >1.5 x ULN and AST ⁇ 10 x ULN). The starting dose should be reduced for patients with moderate or severe hepatic impairment.
- study intervention is permanently discontinued due to reasons other than disease progression, and the patient is not being treated with other anti-cancer therapy(ies), the patient continues to be evaluated for disease progression for up to 2 years. See the SoA for data to be collected at the time of discontinuation of study intervention and follow-up and for any further evaluations that need to be completed.
- a patient may be discontinued prior to disease progression for any of the following reasons:
- Any medication or vaccine (including over-the-counter or prescription medicines, recreational drugs, vitamins, and/or herbal supplements) that the participant is receiving at the time of enrollment or receives during the study must be recorded along with:
- C1D1 • The use of inhaled corticosteroids and mineralocorticoids (e.g., fludrocortisone), topical steroids, intranasal steroids, intra- articular, and ophthalmic steroids
- Systemic immunosuppressive treatment including, but not limited to cyclophosphamide, azathioprine, methotrexate, thalidomide, and anti-TNF agents.
- systemic immunosuppressant medications e.g., ⁇ 10 mg/day of prednisone or equivalent.
- Replacement therapy e.g., thyroxine, insulin, physiologic corticosteroid replacement therapy [eg, ⁇ 10 mg/day of prednisone equivalent] for adrenal or pituitary insufficiency
- thyroxine e.g., insulin, physiologic corticosteroid replacement therapy [eg, ⁇ 10 mg/day of prednisone equivalent] for adrenal or pituitary insufficiency
- physiologic corticosteroid replacement therapy eg, ⁇ 10 mg/day of prednisone equivalent] for adrenal or pituitary insufficiency
- Patients should receive full supportive care during the study, including transfusions of blood and blood products, and treatment with antibiotics, antiemetics, antidiarrheals, and analgesics, and other care as deemed appropriate, and in accordance with institutional guidelines
- ADA anti-drug antibodies
- AE adverse event
- ALT alanine aminotransferase
- APTT activated partial thromboplastin time
- AST aspartate aminotransferase
- C cycle
- CPK creatine phosphokinase
- COVID19 Coronavims SARS-CoV-2
- CRP C-reactive protein
- CT computed tomography
- D or d day(s)
- ECG electrocardiogram
- ECOG Eastern Cooperative Oncology Group
- ECHO echocardiography/cardiac ultrasound
- FSH follicle-stimulating hormone
- IMAR immune-mediated adverse reaction
- INR international normalized ratio
- LDH lactate dehydrogenase
- LH luteinizing hormone
- PD pharmacodynamics
- PK pharmacokinetics
- PT prothrombin time
- PTH parathyroid hormone
- PTT partial thrombo
- G9.2-17 (IGG4) treatment is administered, on C1D1 and C1D15 on every cycle.
- gemcitabine and nab-paclitaxel is administered to PDAC patients on the G9.2-17 (IGG4) combination regimen.
- Study drug may be administered on Days 1, 8 and 15 +/- 3 days from C2 onwards.
- Demographics Data include age, gender, race, and ethnicity.
- Medical history In addition to general medical history, data collection also includes oncology history, surgical/transplant and radiation therapy history and COVID-19 history and testing.
- Previous and concomitant medications including vaccines and complementary treatments/supplements: Data to include name, indication, dose, route, start and end dates for each. Allergies and intolerances, dose modifications while on study, schedule of dosing changes and reasons for them should also be obtained.
- Adverse events Any AEs starting or worsening after study drug administration is recorded. AEs should be followed until resolved to one of the following: baseline, stabilized, or deemed irreversible. All SAEs are to be collected until 30 days after last dose of study medication. All study-procedure-related SAEs must be collected from the date of patient’s written consent.
- ECHO/MUGA This assessment of heart function is conducted at Screening and repeated on Day 1 of Cycle 4; the assessment window is +/- 5 days. It should be conducted more frequently when clinically indicated and once every 3 months.
- G Physical exam: Include height at screening for determination of body surface area. Include weight at all scheduled exam times. A Neurological exam is conducted only on patients who have stable and/or pre-treated brain metastases.
- Hematology Analysis includes complete blood count, differential, platelets, hemoglobin. Collect blood samples pre-dose.
- Serum chemistry Analysis includes albumin, alkaline phosphatase, bilirubin (total, direct), blood urea nitrogen, calcium, CPK, creatinine, electrolytes (sodium, potassium, chloride, magnesium, phosphorus), gamma glutamyl transferase (gamma GT), glucose, hemoglobin Ale (HgbAlc) (only if history of Type 1 or Type 2 diabetes mellitus), LDH, SGPT (ALT) or SGOT (AST), total protein. Fasting glucose to be assessed only if clinically indicated. Collect blood samples pre-dose.
- Blood Coagulation Collect blood samples pre-dose. Analysis includes APTT, PT, PTT, and INR (if on allowable anti-coagulants), CRP, and troponin.
- Urinalysis Analysis includes color, appearance, dipstick for specific gravity, protein, white blood cell-esterase, glucose, ketones, urobilinogen, nitrite, WBC, RBC, pH. (Urine culture and sensitivity to be run only if patient is clinically symptomatic.)
- Tumor biopsies If patient MMR/MSI status is unknown at screening, the test should be run at the local laboratory. In Part 2, TMB tissue analysis is performed. The on-study biopsy is scheduled for C3D15 + 7 days and should occur only after the tumor imaging scan in Cycle 3. It is recognized that a variety of clinical factors may make it difficult to obtain adequate specimens. Decisions not to perform biopsy on-treatment should be discussed with the Medical Monitor.
- Tumor type-relevant biomarkers Blood samples are to be collected at screening and every cycle pre-dose administration as appropriate for the tumor type. Blood sampling may be decreased to every 3rd cycle after 6 months of treatment.
- Cycle 1 and Cycle 3 Day 1 blood samples are collected pre-dose and at end of study drug infusion (EOI), 2 and 4 h (+ 30 min) post-study drug administration.
- Cycle 1 and Cycle 3 Day 15 blood samples are collected pre-dose and at EOI only.
- Cycle 1 and Cycle 3 Day 2 and 8 non-dosing days
- PK blood samples are collected at only one time point.
- Cycle 2 and Cycle 4 blood samples are collected Day 1 only and should occur pre-dose and at EOI. Blood samples for PK are collected every 2 cycles thereafter (i.e., C6D1, C8D1, etc.) pre-dose and at EOI.
- ADA blood sampling Blood samples are collected Day 1 of Cycles 1-4, blood samples are collected Day 1, pre-dose. Thereafter, it is collected every 2 cycles, Day 1, pre-dose (ie, C6D1, C8D1, etc.).
- ADA anti-drug antibodies
- AE adverse event
- ALT alanine aminotransferase
- APTT activated partial thromboplastin time
- AST aspartate aminotransferase
- C cycle
- CPK creatine phosphokinase
- COVID19 Coronavims SARS-CoV-2
- CRP C-reactive protein
- CT computed tomography
- D or d day(s)
- ECG electrocardiogram
- ECOG Eastern Cooperative Oncology Group
- ECHO echocardiography/cardiac ultrasound
- FSH follicle-stimulating hormone
- IMAR immune-mediated adverse reaction
- INR international normalized ratio
- LDH lactate dehydrogenase
- LH luteinizing hormone
- PD pharmacodynamics
- PK pharmacokinetics
- PT prothrombin time
- PTH parathyroid hormone
- PTT partial thrombo
- G9.2-17 (IGG4) treatment is administered, on CXD1, CXD8, CXD15, and CXD22 on every weekly cycle (Cohorts 7-8).
- gemcitabine and nab-paclitaxel is administered to PDAC patients on the G9.2-17 (IGG4) combination regimen.
- Study drug may be administered on Days 1, 8 and 15 +/- 3 days from C2 onwards.
- Demographics Data include age, gender, race, and ethnicity.
- Medical history In addition to general medical history, data collection also includes oncology history, surgical/transplant and radiation therapy history and COVID- 19 history and testing.
- Previous and concomitant medications including vaccines and complementary treatments/supplements: Data to include name, indication, dose, route, start and end dates for each. Allergies and intolerances, dose modifications while on study, schedule of dosing changes and reasons for them should also be obtained.
- Adverse events Any AEs starting or worsening after study drug administration is recorded. AEs should be followed until resolved to one of the following: baseline, stabilized, or deemed irreversible. All SAEs are to be collected until 30 days after last dose of study medication. All study-procedure-related SAEs must be collected from the date of patient’s written consent.
- ECHO/MUGA This assessment of heart function is conducted at Screening and repeated on Day 1 of Cycle 4; the assessment window is +/- 5 days. It should be conducted more frequently when clinically indicated and once every 3 months.
- G Physical exam: Include height at screening for determination of body surface area. Include weight at all scheduled exam times. A Neurological exam is conducted only on patients who have stable and/or pre-treated brain metastases.
- Hematology Analysis includes complete blood count, differential, platelets, hemoglobin. Collect blood samples pre-dose.
- Serum chemistry Analysis includes albumin, alkaline phosphatase, bilirubin (total, direct), blood urea nitrogen, calcium, CPK, creatinine, electrolytes (sodium, potassium, chloride, magnesium, phosphorus), gamma glutamyl transferase (gamma GT), glucose, hemoglobin Ale (HgbAlc) (only if history of Type 1 or Type 2 diabetes mellitus), LDH, SGPT (ALT) or SGOT (AST), total protein. Fasting glucose to be assessed only if clinically indicated. Collect blood samples pre-dose.
- Blood Coagulation Collect blood samples pre-dose. Analysis includes APTT, PT, PTT, and INR (if on allowable anti-coagulants), CRP, and troponin.
- Urinalysis Analysis includes color, appearance, dipstick for specific gravity, protein, white blood cell-esterase, glucose, ketones, urobilinogen, nitrite, WBC, RBC, pH. (Urine culture and sensitivity to be run only if patient is clinically symptomatic.)
- Tumor biopsies If patient MMR/MSI status is unknown at screening, the test should be run at the local laboratory. In Part 2, TMB tissue analysis is performed. The on-study biopsy is scheduled for C3D15 + 7 days and should occur only after the tumor imaging scan in Cycle 3. It is recognized that a variety of clinical factors may make it difficult to obtain adequate specimens. Decisions not to perform biopsy on-treatment should be discussed with the Medical Monitor.
- Tumor type-relevant biomarkers Blood samples are to be collected at screening and every cycle pre-dose administration as appropriate for the tumor type. Blood sampling may be decreased to every 3rd cycle after 6 months of treatment.
- Cycle 1 and Cycle 3 Day 1 blood samples are collected pre-dose, end of study drug infusion (EOI) and 1 h (+ 15 min) post-study drug administration.
- Cycle 1 and Cycle 3 Day 3 blood samples are collected at one time point, any time.
- ADA blood sampling Blood samples are collected Day 1 and Day 15 of Cycles 1 and 2, pre-dose. Thereafter, it is collected every cycle, Day 1, pre-dose (ie, C3D1, C4D1, etc.).
- Procedures conducted as part of the participant’s routine clinical management (e.g., blood count) and obtained before signing of the ICF may be utilized for screening or baseline purposes provided the procedures met the protocol-specified criteria and were performed within the time frame defined in the SoA.
- the SoA (Table 13 and Table 14) provides a list of assessments to be performed during the screening period (up to 28 days), the treatment period (presented as 28-day cycles), the End of Treatment/Early Termination period, IMAR follow-up and the long-term follow-up period. Optional visits are allowed during each treatment cycle if medically indicated, during which any of the study assessments may be performed.
- Tumor imaging assessment computed tomography [CT] or magnetic resonance imaging (MRI), with or without contrast; or positron emission tomography (PET)-CT; CT with contrast is preferred
- Serum chemistry • Thyroid stimulating hormone (TSH), free T4 or thyroxine (fT4), serum lipase, amylase, parathyroid hormone (PTH), follicle- stimulating hormone (FSH), luteinizing hormone (LH), free cortisol
- Tumor biopsy o Biopsy can be omitted if it is deemed that the procedure is a risk to the patient. o If a biopsy is unavailable, site will make every effort to obtain an archival tumor tissue sample available as a formalin-fixed paraffin-embedded (FFPE) block. Acceptable archival samples include those obtained via a core needle biopsy or excisional surgery within the last five years.
- FFPE formalin-fixed paraffin-embedded
- Each treatment cycle has a duration of 28 days.
- Treatment Procedures for Day 1 of each cycle (CXD1; ⁇ 2 days beginning Cycle 2) The following procedures are performed on Day 1 of each treatment cycle.
- CT Tumor imaging assessment
- Cohorts 1-6 Treatment Procedures for Days 2 and 8 of Cycle 1 and Cycle 3 (CXD2 ⁇ 1 day and CXD8 ⁇ 1 day )
- Cohorts 1-6 Treatment Procedures for Day 15 of each Cycle (CXD15 ⁇ 1 day for Cycle 1 and ⁇ 2 days for beginning Cycle 2 ) The following procedures are performed on Day 15 of each treatment cycle.
- Cohorts 7 and 8 Treatment Procedures for Day 3 of Cycle 1 and Cycle 3 (C1D3 ⁇ 1 day and C3D3 ⁇ 1 day )
- Cohorts 7 and 8 Treatment Procedures for Days 15 and 22 of each Cycle (CXD15 ⁇ 1 day for Cycle 1 and ⁇ 2 days for beginning Cycle 2 )
- Treatment cycles beyond Cycle 4 can be repeated as indicated in the SoA (Table 13 and Table 14). If the patient is experiencing clinical benefit, even in the event of radiological progression, the patient can continue on treatment.
- End of Treatment or Early Termination Procedures The following procedures are done 30 days ( ⁇ 3 days) after the last dose, including patients who have discontinued treatment early.
- Tumor imaging assessment Confirmatory scan if end of study is > 8 weeks after previous scan.
- OS is assessed every 3 months for up to 2 years after the patient has the End of Treatment/Early Termination. Tumor imaging assessment continues, where possible, for patients discontinuing treatment due to reasons other than progression of disease and not receiving additional systemic anticancer treatments.
- tumor lesions/lymph nodes are categorized as measurable or non-measurable with measurable tumor lesions recorded according to the longest diameter in the plane of measurement (except for pathological lymph nodes, which are measured in the shortest axis).
- measurable lesion When more than one measurable lesion is present at screening all lesions up to a maximum of five lesions total (and a maximum of two lesions per organ) representative of all involved organs should be identified as target lesions.
- Target lesions should be selected on the basis of their size (lesions with the longest diameter). A sum of the diameters for all target lesions is calculated and reported as the baseline sum diameters.
- All other lesions (or sites of disease) including pathological lymph nodes should be identified as non-target lesions and should also be recorded at screening. Measurements are not required, and these lesions should be followed as ‘present’, ‘absent’, or ‘unequivocal progression’.
- Tumor target lesions are assessed according to the RECIST vl.l Guidelines (Eisenhauer et al., 2009) using the following disease response measures: Evaluation of target lesions :
- CR Complete Response
- Partial Response At least a 30% decrease in the sum of diameters of target lesions, taking as reference the baseline sum diameters.
- Stable Disease Neither sufficient shrinkage to qualify for PR nor sufficient increase to qualify for PD, taking as reference the smallest sum diameters while on study.
- ⁇ CR Disappearance of all non-target lesions and normalization of tumor marker level.
- All lymph nodes must be non-pathological in size ( ⁇ 10 mm short axis).
- Non-CR/Non-progressive disease Persistence of one or more non-target lesion(s) and/or maintenance of tumor marker level above the normal limits.
- Non-evaluable Complete Response
- Non-PD Non-progressive Disease
- PR Partial Response
- SD Stable Disease
- NE Non-evaluable
- DCR Disease control rate
- ORR Objective response rate
- PFS Progression-free survival
- DoR Duration of response
- OS Overall survival
- Medical and physical examinations must be performed by a qualified physician, nurse practitioner, or physician assistant, and should include a thorough review of all body systems. Additionally, height (at screening only) and weight are measured.
- Vital signs are measured in a post-supine position after 5 minutes rest and include temperature, blood pressure (systolic and diastolic), heart rate, and respiratory rate.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Genetics & Genomics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Oncology (AREA)
- Biomedical Technology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Dermatology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3217833A CA3217833A1 (en) | 2021-04-30 | 2022-04-29 | Combination of anti-galectin-9 antibodies and chemotherapeutics for use in cancer therapy |
| JP2023563934A JP2024519449A (ja) | 2021-04-30 | 2022-04-29 | がん治療における使用のための抗ガレクチン-9抗体と化学療法剤との併用 |
| CN202280045695.8A CN117580589A (zh) | 2021-04-30 | 2022-04-29 | 在癌症疗法中使用的抗半乳糖凝集素-9抗体和化疗剂的组合 |
| US18/556,394 US20240182583A1 (en) | 2021-04-30 | 2022-04-29 | Combination of anti-galectin-9 antibodies and chemotherapeutics for use in cancer therapy |
| IL308020A IL308020A (en) | 2021-04-30 | 2022-04-29 | Combination of anti-galectin-9 antibodies and chemotherapeutic agents for use in cancer treatment |
| AU2022264597A AU2022264597A1 (en) | 2021-04-30 | 2022-04-29 | Combination of anti-galectin-9 antibodies and chemotherapeutics for use in cancer therapy |
| EP22796898.9A EP4329808A4 (en) | 2021-04-30 | 2022-04-29 | Combination of anti-galectin-9 antibodies and chemotherapeutics for use in cancer therapy |
| ZA2023/09774A ZA202309774B (en) | 2021-04-30 | 2023-10-19 | Combination of anti-galectin-9 antibodies and chemotherapeutics for use in cancer therapy |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163182519P | 2021-04-30 | 2021-04-30 | |
| US63/182,519 | 2021-04-30 | ||
| US202163193381P | 2021-05-26 | 2021-05-26 | |
| US63/193,381 | 2021-05-26 | ||
| US202263313882P | 2022-02-25 | 2022-02-25 | |
| US63/313,882 | 2022-02-25 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022232653A1 true WO2022232653A1 (en) | 2022-11-03 |
Family
ID=83847357
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/027142 Ceased WO2022232653A1 (en) | 2021-04-30 | 2022-04-29 | Combination of anti-galectin-9 antibodies and chemotherapeutics for use in cancer therapy |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US20240182583A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4329808A4 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2024519449A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2022264597A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3217833A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL308020A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2022232653A1 (cg-RX-API-DMAC7.html) |
| ZA (1) | ZA202309774B (cg-RX-API-DMAC7.html) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP7581238B2 (ja) * | 2019-05-01 | 2024-11-12 | ニューヨーク・ユニバーシティ | 抗ガレクチン9抗体およびその使用 |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20190256604A1 (en) * | 2017-10-27 | 2019-08-22 | New York University | Anti-galectin-9 antibodies and uses thereof |
| WO2021022256A1 (en) * | 2019-08-01 | 2021-02-04 | New York University | Combined cancer therapy of anti-galectin-9 antibodies and chemotherapeutics |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP7581238B2 (ja) * | 2019-05-01 | 2024-11-12 | ニューヨーク・ユニバーシティ | 抗ガレクチン9抗体およびその使用 |
-
2022
- 2022-04-29 CA CA3217833A patent/CA3217833A1/en active Pending
- 2022-04-29 JP JP2023563934A patent/JP2024519449A/ja active Pending
- 2022-04-29 EP EP22796898.9A patent/EP4329808A4/en active Pending
- 2022-04-29 IL IL308020A patent/IL308020A/en unknown
- 2022-04-29 US US18/556,394 patent/US20240182583A1/en active Pending
- 2022-04-29 AU AU2022264597A patent/AU2022264597A1/en not_active Abandoned
- 2022-04-29 WO PCT/US2022/027142 patent/WO2022232653A1/en not_active Ceased
-
2023
- 2023-10-19 ZA ZA2023/09774A patent/ZA202309774B/en unknown
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20190256604A1 (en) * | 2017-10-27 | 2019-08-22 | New York University | Anti-galectin-9 antibodies and uses thereof |
| WO2021022256A1 (en) * | 2019-08-01 | 2021-02-04 | New York University | Combined cancer therapy of anti-galectin-9 antibodies and chemotherapeutics |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP4329808A4 * |
Also Published As
| Publication number | Publication date |
|---|---|
| US20240182583A1 (en) | 2024-06-06 |
| EP4329808A4 (en) | 2025-03-12 |
| ZA202309774B (en) | 2024-12-18 |
| EP4329808A1 (en) | 2024-03-06 |
| AU2022264597A9 (en) | 2023-11-16 |
| AU2022264597A1 (en) | 2023-11-09 |
| CA3217833A1 (en) | 2022-11-03 |
| IL308020A (en) | 2023-12-01 |
| JP2024519449A (ja) | 2024-05-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2020319899B2 (en) | Combined cancer therapy of anti-galectin-9 antibodies and chemotherapeutics | |
| US20220185896A1 (en) | Anti-galectin-9 antibodies and uses thereof | |
| JP2023525085A (ja) | がんを治療するための組成物および方法 | |
| US20240043543A1 (en) | Anti-galectin-9 antibodies and therapeutic uses thereof | |
| EP4232089A1 (en) | Anti-galectin-9 antibodies and uses thereof in the treatment of ocular melanoma | |
| US20240109968A1 (en) | Anti-galectin-9 antibodies and therapeutic uses thereof | |
| US20240182583A1 (en) | Combination of anti-galectin-9 antibodies and chemotherapeutics for use in cancer therapy | |
| US20240190970A1 (en) | Anti-galectin-9 antibodies and therapeutic uses thereof | |
| US20250269019A1 (en) | Anti-galectin-9 antibodies and therapeutic uses thereof | |
| CN117580589A (zh) | 在癌症疗法中使用的抗半乳糖凝集素-9抗体和化疗剂的组合 | |
| HK40108543A (zh) | 在癌症疗法中使用的抗半乳糖凝集素-9抗体和化疗剂的组合 | |
| HK40074716A (en) | Combined cancer therapy of anti-galectin-9 antibodies and chemotherapeutics | |
| CN117500522A (zh) | 抗半乳糖凝集素-9抗体及其治疗用途 | |
| WO2025085792A1 (en) | Treatment of hematological malignancies with antibodies inhibiting galectin-9 | |
| HK40109234A (zh) | 用於治疗癌症的方法和组合物 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22796898 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023563934 Country of ref document: JP |
|
| ENP | Entry into the national phase |
Ref document number: 3217833 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 308020 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 804965 Country of ref document: NZ Ref document number: AU2022264597 Country of ref document: AU Ref document number: 2022264597 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 2022264597 Country of ref document: AU Date of ref document: 20220429 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202308087S Country of ref document: SG Ref document number: 2022796898 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2022796898 Country of ref document: EP Effective date: 20231130 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280045695.8 Country of ref document: CN |