WO2022183018A1 - Protective antibodies against respiratory viral infections - Google Patents
Protective antibodies against respiratory viral infections Download PDFInfo
- Publication number
- WO2022183018A1 WO2022183018A1 PCT/US2022/017945 US2022017945W WO2022183018A1 WO 2022183018 A1 WO2022183018 A1 WO 2022183018A1 US 2022017945 W US2022017945 W US 2022017945W WO 2022183018 A1 WO2022183018 A1 WO 2022183018A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- sequence
- antibody
- set forth
- binding fragment
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
- C07K16/108—Orthomyxoviridae (F), e.g. influenza virus
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
- C07K16/102—Coronaviridae (F)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
- C07K16/102—Coronaviridae (F)
- C07K16/104—Severe acute respiratory syndrome coronavirus 2 [SARS‐CoV‐2]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
- C07K16/11—Paramyxoviridae (F); Pneumoviridae (F), e.g. respiratory syncytial virus [RSV]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/64—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the current disclosure provides antibodies that protect against respiratory viral infections including human parainfluenza viruses (HPIV), respiratory syncytial virus (RSV), and human metapneumovirus (HMPV). Certain antibodies disclosed herein neutralize more than one virus (e.g., RSV and HMPV).
- the binding fragments of the antibodies can be engineered into numerous formats including those that provide simultaneous protection against multiple viruses.
- HCT hematopoietic stem cell transplants
- HPIV human parainfluenza viruses
- RSV respiratory syncytial virus
- HMPV human metapneumovirus
- the current disclosure provides new antibodies that are protective against one or more of human parainfluenza viruses (HPIV1 and/or HPIV3), respiratory syncytial virus (RSV), and human metapneumovirus (HMPV). Particular antibodies disclosed herein are protective against HPIV3. Other antibodies disclosed herein are protective against HPIV3 and HPIV1. Other antibodies disclosed herein are protective against RSV and HMPV. The newly disclosed antibodies can be used to protect against these various forms of respiratory viruses.
- HPIV1 and/or HPIV3 human parainfluenza viruses
- RSV respiratory syncytial virus
- HMPV human metapneumovirus
- binding fragments from these newly-disclosed antibodies and others can be engineered into multi-specific formats that offer protection from multiple viruses at a time including multiple additional respiratory viruses.
- these antibodies and engineered formats thereof provide simultaneous protection against multiple medically important respiratory viruses that afflict children, the elderly, and the immunocompromised.
- PI3 antibodies disclosed herein bind and neutralize HPIV3.
- the “3x1” antibody disclosed herein binds and neutralizes HPIV3 and HPIV1.
- the MxR antibodies disclosed herein bind and neutralize RSV and HMPV.
- FIG. 1 Exemplary use of antibodies disclosed herein to bridge windows of vulnerability in hematopoietic stem cell transplant recipients.
- FIGs. 2A-2I Screening human PBMCs, tonsils, and spleen for HPIV3-specific B cells.
- HPIV3-specific B cells were labeled with APC-conjugated streptavidin tetramers of biotinylated HPIV3 fusion (F) protein followed by magnetic enrichment using microbeads against APC.
- Cells in the grey box of the enriched fraction are B cells that bind the prefusion (preF) but not postfusion (postF) conformation of the HPIV3 F protein.
- the percentage indicates the percentage of total cells shown in the flow plot.
- FIGs. 3A-3F Higher throughput screening of human PBMCs, tonsils, and spleen for B cells capable of producing neutralizing antibodies against HPIV3.
- (3A) Detection of IgG by ELISA in supernatant from random B cells (N 2 independent experiments) individually sorted and subsequently expanded on feeder cells.
- FIGs. 4A-4D Structural analysis of monoclonal antibodies against HPIV3 preF.
- FIGs. 5A-5E Efficacy of prophylactic and therapeutic administration of a neutralizing HPIV3 mAb in vivo.
- 5B Lung histopathology at day four post-infection in cotton rats. The arrow indicates an area of peri-bronchiolitis. Peribronchiolitis was scored as percent severity.
- 5C Viral titers by plaque assay in nasal and lung homogenates at day four post-infection.
- (5D) Schematic of the therapeutic experiments performed in immunocompromised cotton rats (N 5 animals per group).
- FIGs. 6A, 6B Dual binding and neutralization by the MxR-class mAbs.
- (6A) Detection of binding between the MxR-01 mAb with RSV preF (top) and HMPV preF (bottom) by biolayer interferometry.
- the MxR-01 antibody is also referred to as MxR-B11.
- (6B) Neutralizing titers of MxR-01 and palivizumab for RSV and HMPV were determined by a plaque reduction neutralization assay.
- MxR-01 potently prevented infection by HMPV and RSV in vitro with low neutralization titers 0.07 pg/mL. In this assay MxR-01 outperformed RSV neutralization by palivizumab by almost 10-fold.
- FIG. 7. Depictions of engineered antibody formats and representative uses.
- FIG. 8 Design of quad-protective antibodies by engineering into a single monoclonal antibody the antigen binding sites of MxR-01 and 3x1 using alternative bispecific formats.
- the depicted configurations are generated using (top) the knobs-into-holes approach, which promotes heterodimerization to produce an Ab connected by the fragment constant (Fc) region but containing one antigen-binding fragment (Fab) from MxR-01 and another from 3x1 ; and (bottom) an IgG-scFv fusion in which the scFv of one antibody is linked to the constant region of the other antibody.
- FIGs. 9A-9C Isolation of HMPV/RSV (MxR) and HPIV3/HPIV1 (3x1) cross-neutralizing mAbs.
- FIGs. 10A-10C B cell phenotype and potency of MxR and 3x1 cross-neutralizing mAbs.
- the asterisk indicates a P value ⁇ 0.01 compared to palivizumab using an unpaired two-tailed t-test with Welch’s correction.
- MxR and 3x1 have in vitro neutralizing potencies that exceed palivizumab against their respective viruses.
- FIGs. 11A-11C Epitope binning and structural analysis.
- Site 0 is located at the apex of HPIV3 preF 36 .
- Site X is a newly discovered antigenic site.
- FIG. 12 In vitro resistance analysis. HPIV3 or RSV was inoculated on Vero cells in the presence of escalating concentrations of 3x1, MxR, or palivizumab (Pali.).
- MxR and HPIV3 may have a higher barrier of resistance compared to palivizumab.
- FIG. 13 Biolayer interferometry measurement of binding kinetics between MxR and RSV preF.
- BLI assays were performed on the Octet. Red instrument (ForteBio) at room temperature with shaking at 500 rpm.
- Penta-His capture sensors (ForteBio, cat#18-5120) were loaded in kinetics buffer containing 1 mM His-tagged F for 300 s. After loading, the baseline signal was recorded for 60 s in kinetics buffer. The sensors were then immersed in kinetics buffer containing purified antibody for a 300 s association step followed by immersion in kinetics buffer for an additional 1200 s dissociation phase. Curve fitting was performed using a 1:1 binding model and ForteBio data analysis software. MxR binds to the RSV preF protein with exceptionally high affinity, beyond the limit of measurement.
- FIG. 14 Biolayer interferometry measurement of binding kinetics between MxR and HMPV preF.
- BLI assays were performed on the Octet. Red instrument (ForteBio) at room temperature with shaking at 500 rpm.
- Penta-His capture sensors (ForteBio, cat#18-5120) were loaded in kinetics buffer containing 1 pM His-tagged F for 300 s. After loading, the baseline signal was recorded for 60 s in kinetics buffer. The sensors were then immersed in kinetics buffer containing purified antibody for a 300 s association step followed by immersion in kinetics buffer for an additional 600 s dissociation phase. Curve fitting was performed using a 1:1 binding model and ForteBio data analysis software.
- FIG. 15 Biolayer interferometry measurement of binding kinetics between 3x1 and HPIV3 preF.
- BLI assays were performed on the Octet. Red instrument (ForteBio) at room temperature with shaking at 500 rpm.
- Penta-His capture sensors (ForteBio, cat#18-5120) were loaded in kinetics buffer containing 1 mM His-tagged F for 300 s. After loading, the baseline signal was recorded for 60 s in kinetics buffer. The sensors were then immersed in kinetics buffer containing purified antibody for a 300 s association step followed by immersion in kinetics buffer for an additional 1200 s dissociation phase. Curve fitting was performed using a 1 :1 binding model and ForteBio data analysis software. 3x1 binds to the HPIV3 preF protein with exceptionally high affinity, beyond the limit of measurement.
- FIG. 16 Suppression of RSV replication in the lungs and nasal turbinates of hamsters with prophylactic administration of MxR.
- Hamsters were infected intranasally with 100 pl_ of 10 5 pfu virus.
- MAb (5 mg/kg) or PBS control was administered intramuscularly 2 days prior to infection.
- Nasal turbinates and lungs were removed for viral titration by plaque assay at day five post-infection.
- Lung and nose homogenates were clarified by centrifugation.
- Confluent Vero cell monolayers were inoculated in duplicate with diluted homogenates in 24-well plates.
- FIG. 17 Suppression of HPIV3 replication in the lungs and nasal turbinates of hamsters with prophylactic administration of 3x1.
- Hamsters were infected intranasally with 100 pL of 10 5 pfu virus.
- Mab (5 mg/kg) or PBS control was administered intramuscularly 2 days prior to infection.
- Nasal turbinates and lungs were removed for viral titration by plaque assay at day five post-infection.
- Lung and nose homogenates were clarified by centrifugation.
- Confluent Vero cell monolayers were inoculated in duplicate with diluted homogenates in 24-well plates.
- FIG. 18 Suppression of RSV and HPIV3 co-infection in the lungs and nasal turbinates of hamsters with prophylactic administration of MxR and 3x1 (each at 5 mg/kg).
- Hamsters were infected intranasally with 100 pL containing 10 5 pfu of each virus.
- MAb or PBS control was administered intramuscularly 2 days prior to infection.
- Nasal turbinates and lungs were removed for viral titration by plaque assay at day five post-infection.
- Lung and nose homogenates were clarified by centrifugation.
- Confluent Vero cell monolayers were inoculated in duplicate with diluted homogenates in 24-well plates.
- FIGs. 19A-19E (19A) Schematic of suppression of RSV and HPIV3 replication in the lungs and nasal turbinates of co-infected hamsters with prophylactic administration of MxR and 3x1 (each at 5 mg/kg).
- Hamsters were infected intranasally with 100 pL of 105 pfu of each virus.
- MAb or PBS control was administered intramuscularly 2 days prior to infection.
- Nasal turbinates and lungs were removed for viral quantitation by real-time PCR at day five post-infection. Lung and nose homogenates were clarified by centrifugation.
- Viral RNA was extracted from sample homogenate using the QIAamp vRNA Mini Kit.
- Custom reverse transcription primers for RSV TCCAGCAAAT ACACCATCCAAC (SEQ ID NO: 187)
- HPIV3 Custom reverse transcription primers for RSV (TCCAGCAAAT ACACC
- T GTTT CAACCAT AAGAGTT ACCAAGCT (SEQ ID NO: 193), and reporter ACCGCATGATTGACCC (SEQ ID NO: 194)) were used with Taqman Universal mastermix II with UNG.
- Samples were run on the QuantStudio 7 Flex Real-Time PCR System. Quantitation was based on generating a standard curve with vRNA extracted from viral stocks of RSV and HPIV3 with known titers. Cycle thresholds were interpolated and used to calculate viral titers in pfu/g.
- HCT recipients Patients receiving hematopoietic stem cell transplant (HCT) are especially vulnerable during the 6-month period it takes for their immune system to repopulate. Over 50,000 HCTs are performed worldwide, with 20,000 occurring in the US. Up to a third of HCT recipients acquire a respiratory viral infection within six months of transplant. In up to a third of those patients, the virus progresses from the upper to the lower respiratory tract. Once the virus gains a foothold in the lower tract, little can be done for most viruses beyond supportive care. As a result, up to 40% of patients with lower tract disease die within three months. Collectively, RSV, HMPV, and the HPIVs account for half of the serious respiratory viral infections after HCT. Of patients who survive the acute infection, over 25% develop fixed air flow obstruction, a debilitating condition of accelerated lung function loss associated with increased mortality.
- Lung transplant recipients represent another immunocompromised population at particularly high risk for morbidity and death. Worldwide, over 3,000 lung transplants are performed annually with 2,000 occurring in the US. Up to 25% of lung transplant recipients become infected by RSV, HMPV, or HPIV, with most infections occurring after the first year of transplant when patients resume community activities. Infection by these viruses can lead to bacterial superinfection, tissue rejection, and chronic allograft dysfunction. [0031] Adults. Individuals over 65 and those with homelessness or chronic lung diseases are at risk for developing severe lung disease. Almost 50 million people in the US are over 65, making up 15% of the population. 550,000 people in the US are homeless and an estimated 24 million adults are living with chronic obstructive pulmonary disease (COPD) in the US.
- COPD chronic obstructive pulmonary disease
- binding fragments from these newly-disclosed antibodies and others can be engineered into multi-specific formats that offer protection from multiple viruses at a time. That is, cross-neutralizing antibodies can be engineered into a single compound capable of protecting against numerous medically important respiratory viruses.
- MRP3/1 includes a quad-protective, extended half-life bi-specific antibody engineered by tethering two cross-neutralizing mAbs (see, e.g., FIGs. 7 and 8). MRP3/1, simultaneously protects against HMPV, RSV, HPIV3, and HPIV1 This antibody is expected to have greater in vitro potency and breadth and a 4-6x longer half-life compared to palivizumab.
- MRP3/1 can replace palivizumab as the standard of care for RSV prophylaxis in premature infants with the added benefit of protecting against 3 additional viruses.
- engineered constructs can be used as immunoprophylaxis in HOT recipients during their 6-month period of vulnerability post transplant or as a therapy for anyone hospitalized with any of these infections.
- Naturally occurring antibody structural units include a tetramer.
- Each tetramer includes two pairs of polypeptide chains, each pair having one light chain and one heavy chain.
- the amino-terminal portion of each chain includes a variable region that is responsible for antigen recognition and epitope binding.
- the variable regions exhibit the same general structure of relatively conserved framework regions (FR) joined by three hyper variable regions, also called complementarity determining regions (CDRs).
- FR relatively conserved framework regions
- CDRs complementarity determining regions
- the CDRs from the two chains of each pair are aligned by the framework regions, which enables binding to a specific epitope.
- both light and heavy chain variable regions include the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
- each chain defines a constant region, which can be responsible for effector function particularly in the heavy chain (the Fc).
- effector functions include: C1q binding and complement dependent cytotoxicity (CDC); antibody- dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B-cell receptors); and B-cell activation.
- variable and constant regions are joined by a “J” region of amino acids, with the heavy chain also including a “D” region of amino acids. See, e.g., Fundamental Immunology, Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)).
- Human light chains are classified as kappa and lambda light chains. Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
- IgG has several subclasses, including, lgG1 , lgG2, lgG3, and lgG4.
- IgM has subclasses including IgM 1 and lgM2.
- IgA is similarly subdivided into subclasses including lgA1 and lgA2.
- antibodies bind epitopes on antigens.
- antigen refers to a molecule or a portion of a molecule capable of being bound by an antibody.
- An epitope is a region of an antigen that is bound by the variable region of an antibody.
- Epitope determinants can include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl or sulfonyl groups, and can have specific three-dimensional structural characteristics, and/or specific charge characteristics.
- the antigen is a protein or peptide
- the epitope includes specific amino acids within that protein or peptide that contact the variable region of an antibody.
- an epitope denotes the binding site on a viral peptide bound by a corresponding variable region of an antibody.
- the variable region either binds to a linear epitope, (e.g., an epitope including a stretch of 5 to 12 consecutive amino acids), or the variable region binds to a three-dimensional structure formed by the spatial arrangement of several short stretches of the protein target.
- Three-dimensional epitopes recognized by a variable region e.g. by the epitope recognition site or paratope of an antibody or antibody fragment, can be thought of as three-dimensional surface features of an epitope molecule.
- an epitope can be considered to have two levels: (i) the “covered patch” which can be thought of as the shadow an antibody variable region would cast on the antigen to which it binds; and (ii) the individual participating side chains and backbone residues that facilitate binding. Binding is then due to the aggregate of ionic interactions, hydrogen bonds, and hydrophobic interactions.
- Epitopes of the currently disclosed antibodies are found on a virus selected from HPIV3, HPIV1 , RSV, and/or HMPV.
- the epitope is located within a viral F protein, for example in its prefusion state.
- “bind” means that the variable region associates with its target epitope with a dissociation constant (Kd or KD) of 10 8 M or less, in particular embodiments of from 10 5 M to 10 13 M, in particular embodiments of from 10 5 M to 10 10 M, in particular embodiments of from 10 5 M to 10- 7 M, in particular embodiments of from 10 8 M to 1CH 3 M, or in particular embodiments of from 10 9 M to 1CH 3 M.
- Kd or KD dissociation constant
- the term can be further used to indicate that the variable region does not bind to other biomolecules present (e.g., it binds to other biomolecules with a dissociation constant (Kd) of 10 4 M or more, in particular embodiments of from 10 4 M to 1 M).
- Kd can be characterized using BIAcore.
- Kd can be measured using surface plasmon resonance assays using a BIACORE®-2000 or a BIACORE®-3000 (BIAcore, Inc., Piscataway, N.J.) at 25°C with immobilized antigen CM5 chips at 10 response units (RU).
- CM5 carboxymethylated dextran biosensor chips
- EDC N-ethyl-N'--(3- dimethylaminopropyl)-carbodiimide hydrochloride
- NHS N-hydroxysuccinimide
- Antigen can be diluted with 10 mM sodium acetate, pH 4.8, to 5 pg/ml (0.2 mM) before injection at a flow rate of 5 mI/minute to achieve 10 response units (RU) of coupled protein. Following the injection of antigen, 1 M ethanolamine can be injected to block unreacted groups. For kinetics measurements, two-fold serial dilutions of Fab (0.78 nM to 500 nM) are injected in PBS with 0.05% polysorbate 20 (TWEEN-20TM) surfactant (PBST) at 25°C at a flow rate of 25 mI/min.
- TWEEN-20TM polysorbate 20
- Association rates (k on ) and dissociation rates (k 0ff ) can be calculated using a simple one-to-one Langmuir binding model (BIACORE® Evaluation Software version 3.2) by simultaneously fitting the association and dissociation sensorgrams.
- the equilibrium dissociation constant (Kd) can be calculated as the ratio k 0ff /k 0n . See, e.g., Chen et al., J. Mol. Biol. 293:865-881 , 1999.
- antibody includes (in addition to antibodies having two full-length heavy chains and two full-length light chains as described above) variants, derivatives, and fragments thereof, examples of which are described below.
- antibodies can include monoclonal antibodies, human or humanized antibodies, bispecific antibodies, trispecific antibodies, tetraspecific antibodies, multi-specific antibodies, polyclonal antibodies, linear antibodies, minibodies, domain antibodies, synthetic antibodies, chimeric antibodies, antibody fusions, and fragments thereof, respectively.
- antibodies can include oligomers or multiplexed versions of antibodies.
- a monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e.
- the individual antibodies including the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
- each monoclonal antibody of a monoclonal antibody preparation is directed against a single epitope on an antigen.
- the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies and is not to be construed as requiring production of the antibody by any particular method.
- monoclonal antibodies can be made by a variety of techniques, including the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci.
- a “human antibody” is one which includes an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences.
- a “human consensus framework” is a framework that represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
- the selection of human immunoglobulin V L or V H sequences is from a subgroup of variable domain sequences.
- the subgroup of sequences can be a subgroup as in Kabat et al. , Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91- 3242, Bethesda Md. (1991), vols. 1-3.
- the subgroup is subgroup kappa I as in Kabat et al. (supra).
- the subgroup is subgroup III as in Kabat et al. (supra).
- a “humanized” antibody refers to a chimeric antibody including amino acid residues from non-human CDRs and amino acid residues from human FRs.
- a humanized antibody will include substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDRs correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody.
- a humanized antibody optionally may include at least a portion of an antibody constant region derived from a human antibody.
- a “humanized form” of an antibody, e.g., a non-human antibody refers to an antibody that has undergone humanization.
- EP-B-0239400 provides additional description of “CDR-grafting”, in which one or more CDR sequences of a first antibody is/are placed within a framework of sequences not of that antibody, for instance of another antibody.
- Human framework regions that may be used for humanization include: framework regions selected using the “best-fit” method (see, e.g., Sims et al. J. Immunol. 151 :2296, 1993); framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al., Proc. Nati. Acad. Sci. USA, 89:4285, 1992; and Presta et al. , J. Immunol., 151 :2623, 1993); human mature (somatically mutated) framework regions or human germline framework regions (see, e.g., Almagro and Fransson, Front. Biosci.
- mAb PI3-E12 disclosed herein has a CDRH1 including GFTFSDHY (SEQ ID NO: 1); a CDRH2 including ISSSGSNT (SEQ ID NO: 2); a CDRH3 including ARAKWGTMGRGAPPTIYDH (SEQ ID NO: 3); a CDRL1 including QSLLQSNGNNY (SEQ ID NO: 4); a CDRL2 including LGS; and a CDRL3 including MQALQTPLT (SEQ ID NO: 5).
- PI3-E12 has a heavy chain sequence including QVQLLESGGKLVKPGGSLRLSCAASGFTFSDHYMIWIRQAPGKGLEWISYISSSGSNTIYADSL MGRFTISRDNAKNSLYLQMNSLRTEDTAVYYCARAKWGTMGRGAPPTIYDHWGQGTLVTVSS (SEQ ID NO: 166) and a light chain sequence including
- the PI3-E12 antibody includes a variable heavy chain sequence encoded by:
- mAb PI3-A3 disclosed herein has a CDRH1 including GFTFSNYW (SEQ ID NO: 8); a CDRH2 including VKEEGSEK (SEQ ID NO: 9); a CDRH3 including AGEVKSGWFGRYFDS (SEQ ID NO: 10); a CDRL1 including QSVGSW (SEQ ID NO: 11); a CDRL2 including KTS; and a CDRL3 including QQYSSFPYT (SEQ ID NO: 12).
- mAb PI3-A3 has a heavy chain sequence including EVQLVESGGGLVQPGGSLRLSCTASGFTFSNYWMSWVRQAPGKGLEWVANVKEEGSEKHY VDSVKGRFTISRDNAKNSVYLQMSSLRAEDTAVYYCAGEVKSGWFGRYFDSWGQGTLVTVSS (SEQ ID NO: 168) and a light chain sequence including
- the PI3-A3 antibody includes a variable heavy chain sequence encoded by:
- mAb PI3-B5 disclosed herein has a CDRH1 including GYNFTNYW (SEQ ID NO: 15); a CDRH2 including IYPADSDT (SEQ ID NO: 16); a CDRH3 including ARPSTRWFVPGGMDV (SEQ ID NO: 17); a CDRL1 including QSIGAW (SEQ ID NO: 18); a CDRL2 including KAS; and a CDRL3 including QQHSSYPST (SEQ ID NO: 19).
- mAb PI3-B5 has a heavy chain sequence including EVQLVQSGAEVKKPGESLRISCKGSGYNFTNYWIAWVRQMPGKGLEWMGIIYPADSDTRYSP SFQGQVTISADKSITTAYLQWSSLKASDTAIYYCARPSTRWFVPGGMDVWGQGTTVIVSS (SEQ ID NO: 170) and a light chain sequence including
- the PI3-B5 antibody includes a variable heavy chain sequence encoded by:
- mAb PI3-A10 disclosed herein has a CDRH1 including GFNFNNYG (SEC ID NO: 22); a CDRH2 including VSFDGSNR (SEC ID NO: 23); a CDRH3 including SKSKYSDFWSEI (SEQ ID NO: 24); a CDRL1 including QNVMRY (SEQ ID NO: 25); a CDRL2 including DAS; and a CDRL3 including QQRTNHRFS (SEQ ID NO: 26).
- mAb PI3-A10 has a heavy chain sequence including QVQLVESGGGVVRPGRSLRLSCVASGFNFNNYGLQWIRQAPGKGLEWVAGVSFDGSNRYYA DSVKGRVTISRDDSKNTLYLEMNSLRAEDTGIYYCSKSKYSDFWSEIWGQGTLVTVSS (SEQ ID NO: 172) and a light chain sequence including
- the PI3-A10 antibody includes a variable heavy chain sequence encoded by:
- mAb PI3-A12 disclosed herein has a CDRH1 including GDSVKSDDFY (SEQ ID NO: 29); a CDRH2 including IYYGGRT (SEQ ID NO: 30); a CDRH3 including VRVEGLLWFGELFDY (SEQ ID NO: 31); a CDRL1 including NSNIGNNF (SEQ ID NO: 32); a CDRL2 including KDY; and a CDRL3 including AAWQDGLSGPL (SEQ ID NO: 33).
- mAb PI3-A12 has a heavy chain sequence including QVQLQESGPGLVKPSETLSLTCTVSGDSVKSDDFYWSWIRQPPGKGLEWIGFIYYGGRTYYNP SLSGRGTISVDTSKNHFFLELTSVTAADTAVYYCVRVEGLLWFGELFDYWGQGTLVTVSS (SEQ ID NO: 174) and a light chain sequence including
- the PI3-A12 antibody includes a variable heavy chain sequence encoded by:
- mAb 3x1 disclosed herein has a CDRH1 including GFTFSSFG (SEQ ID NO: 36); a CDRH2 including ISHSAGFL (SEQ ID NO: 37); a CDRH3 including AKRLAGLPDLEWLLYPNFLDH (SEQ ID NO: 38); a CDRL1 including ILRTYY (SEQ ID NO: 39); a CDRL2 including GKN; and a CDRL3 including SSRDRSGNHVL (SEQ ID NO: 40).
- mAb 3x1 has a heavy chain sequence including EVQLLESGGGLVQPGGSLRLSCAASGFTFSSFGMSWVRQSPGKGLEWVADISHSAGFLNYAD SVKGRFTVSRDNSKSTLHLQMKSLRAEDTAVYYCAKRLAGLPDLEWLLYPNFLDHWGQGTLV TVSS (SEQ ID NO: 176) and a light chain sequence including SSELTQDPAVSVALGQTVRITCQGDILRTYYVSWYQQKPGQAPLLVIYGKNNRPSVIPDRFSGS TSGDTASLTITGAQAEDEAEYYCSSRDRSGNHVLFGGGTKLTVL (SEQ ID NO: 177).
- the 3x1 xnAb antibody includes a variable heavy chain sequence encoded by:
- mAb MxR-B11 disclosed herein has a CDRH1 including GFPFSSYK (SEC ID NO: 43); a CDRH2 including ISASGSYI (SEQ ID NO: 44); a CDRH3 including ARDGGRELSPFEK (SEQ ID NO: 45); a CDRL1 including NSNIGTGYD (SEQ ID NO: 46); a CDRL2 including DNN; and a CDRL3 including QSYDKSLGGWV (SEQ ID NO: 47).
- MxR-B11 (MxR-01) includes a variable heavy chain having the sequence as set forth in
- the MxR-B11 antibody includes a variable heavy chain encoded by the sequence:
- mAb MxR-D10 disclosed herein has a CDRH1 including GFIFSNYD (SEQ ID NO: 50); a CDRH2 including ITGGSSFI (SEQ ID NO: 51); a CDRH3 including ARDGGRQLSPCEH (SEQ ID NO: 52); a CDRL1 including SSNIGAGYD (SEQ ID NO: 53); a CDRL2 including DNN; and a CDRL3 including QSYDRGLSGWA (SEQ ID NO: 54).
- mAb MxR-D10 (MxR-02) includes a variable heavy chain having the sequence
- the MxR-D10 antibody includes a variable heavy chain encoded by the sequence:
- antibodies disclosed herein can be utilized to prepare various forms of relevant binding fragment molecules.
- particular embodiments can include binding fragments of an antibody, e.g., Fv, Fab, Fab', F(ab')2, and single chain Fv fragments (scFvs) or any biologically effective fragments of an immunoglobulin that bind specifically to an epitope described herein.
- an antibody fragment is used.
- An “antibody fragment” denotes a portion of a complete or full-length antibody that retains the ability to bind to an epitope.
- Antibody fragments can be made by various techniques, including proteolytic digestion of an intact antibody as well as production by recombinant host-cells (e.g., mammalian suspension cell lines, E. coli or phage), as described herein.
- Antibody fragments can be screened for their binding properties in the same manner as intact antibodies. Examples of antibody fragments include Fv, scFv, Fab, Fab', Fab'-SH, F(ab')2; diabodies; and linear antibodies.
- a single chain variable fragment is a fusion protein of the variable regions of the heavy and light chains of immunoglobulins connected with a short linker peptide.
- Fv fragments include the VL and VH domains of a single arm of an antibody but lack the constant regions.
- the two domains of the Fv fragment, VL and VH are coded by separate genes, they can be joined, using, for example, recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules (single chain Fv (scFv)).
- scFv single chain Fv
- Linker sequences that are used to connect the VL and VH of an scFv are generally five to 35 amino acids in length.
- a VL-VH linker includes from five to 35, ten to 30 amino acids or from 15 to 25 amino acids. Variation in the linker length may retain or enhance activity, giving rise to superior efficacy in activity studies.
- Linker sequences of scFv are commonly Gly-Ser linkers, described in more detail elsewhere herein.
- antibody-based binding fragment formats include scFv-based grababodies and soluble VH domain antibodies. These antibodies form binding regions using only heavy chain variable regions. See, for example, Jespers et al., Nat. Biotechnol. 22:1161, 2004; Cortez-Retamozo et al. , Cancer Res. 64:2853, 2004; Baral et al. , Nature Med. 12:580, 2006; and Barthelemy et al., J. Biol. Chem. 283:3639, 2008.
- a Fab fragment is a monovalent antibody fragment including V L , V H , CL and CH1 domains.
- a F(ab') 2 fragment is a bivalent fragment including two Fab fragments linked by a disulfide bridge at the hinge region.
- Diabodies include two epitope-binding sites that may be bivalent. See, for example, EP 0404097; W01993/01161; and Holliger, et al., Proc. Natl. Acad. Sci. USA 90:6444-6448, 1993.
- Dual affinity retargeting antibodies (DARTTM; based on the diabody format but featuring a C-terminal disulfide bridge for additional stabilization (Moore et al., Blood 117:4542-51, 2011) can also be used.
- Antibody fragments can also include isolated CDRs. For a review of antibody fragments, see Hudson, et al. , Nat. Med. 9:129-134, 2003.
- Variants of antibodies described herein are also included. Variants of antibodies can include those having one or more conservative amino acid substitutions or one or more non conservative substitutions that do not adversely affect the binding of the protein.
- a conservative amino acid substitution may not substantially change the structural characteristics of the reference sequence (e.g., a replacement amino acid should not tend to break a helix that occurs in the reference sequence or disrupt other types of secondary structure that characterizes the reference sequence).
- a replacement amino acid should not tend to break a helix that occurs in the reference sequence or disrupt other types of secondary structure that characterizes the reference sequence.
- Examples of art-recognized polypeptide secondary and tertiary structures are described in Proteins, Structures and Molecular Principles (Creighton, Ed., W. H. Freeman and Company, New York (1984)); Introduction to Protein Structure (C. Branden & J. Tooze, eds., Garland Publishing, New York, N.Y. (1991)); and Thornton et al. , Nature, 354:105 (1991).
- a V L region can be derived from or based on a disclosed V L and can include one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) insertions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) deletions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) amino acid substitutions (e.g., conservative amino acid substitutions), or a combination of the above-noted changes, when compared with the disclosed Vi_.
- one or more e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) insertions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) deletions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) amino acid substitutions (e.g., conservative amino acid substitutions), or a combination of the above-noted changes, when compared with the disclosed Vi_.
- An insertion, deletion or substitution may be anywhere in the VL region, including at the amino- or carboxy-terminus or both ends of this region, provided that each CDR includes zero changes or at most one, two, or three changes and provided an antibody including the modified VL region can still specifically bind its target epitope with an affinity similar to the wild type binding fragment.
- a VH region can be derived from or based on a disclosed VH and can include one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) insertions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) deletions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) amino acid substitutions (e.g., conservative amino acid substitutions or non-conservative amino acid substitutions), or a combination of the above-noted changes, when compared with the VH disclosed herein.
- one or more e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) insertions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) deletions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) amino acid substitutions (e.g., conservative amino acid substitutions or non-conservative amino acid substitutions), or a combination of the above-noted changes, when compared with the VH disclosed herein.
- a variant includes or is a sequence that has at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% sequence identity to an antibody sequence disclosed herein.
- a variant includes or is a sequence that has at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% sequence identity to a light chain variable region (VL) and/or to a heavy chain variable region (VH), or both, wherein each CDR includes zero changes or at most one, two, or three changes, from the reference antibody disclosed herein or fragment or derivative thereof that specifically binds to the target viral epitope.
- VL light chain variable region
- VH heavy chain variable region
- one or more amino acid modifications may be introduced into the Fc region of an antibody, thereby generating an Fc region variant.
- the Fc region variant may include a human Fc region sequence (e.g., a human lgG1, lgG2, lgG3 or lgG4 Fc region) including an amino acid modification (e.g., a substitution) at one or more amino acid positions.
- variants have been modified from a reference sequence to produce an administration benefit.
- exemplary administration benefits can include (1) reduced susceptibility to proteolysis, (2) reduced susceptibility to oxidation, (3) altered binding affinity for forming protein complexes, (4) altered binding affinities, (5) reduced immunogenicity; and/or (6) extended half-live. While the disclosure below describes these modifications in terms of their application to antibodies, when applicable to another particular binding fragment format (e.g., an scFv, bispecific antibodies), the modifications can also be applied to these other formats.
- another particular binding fragment format e.g., an scFv, bispecific antibodies
- the antibodies can be mutated to increase their affinity for Fc receptors.
- Exemplary mutations that increase the affinity for Fc receptors include: G236A/S239D/A330L/I332E (GASDALIE). Smith et al. , Proceedings of the National Academy of Sciences of the United States of America, 109(16), 6181-6186, 2012.
- an antibody variant includes an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).
- alterations are made in the Fc region that result in altered C1q binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in U.S. Pat. No. 6,194,551 , WO 99/51642, and Idusogie et al., J. Immunol. 164: 4178-4184, 2000.
- CDC Complement Dependent Cytotoxicity
- cysteine engineered antibodies e.g., “thioMAbs,” in which one or more residues of an antibody are substituted with cysteine residues.
- the substituted residues occur at accessible sites of the antibody.
- reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further below.
- residue 5400 (EU numbering) of the heavy chain Fc region is selected.
- Cysteine engineered antibodies may be generated as described, e.g., in U.S. Pat. No. 7,521 ,541.
- Antibody variants are provided having a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region.
- the amount of fucose in such antibody may be from 1 % to 80%, from 1 % to 65%, from 5% to 65% or from 20% to 40%.
- the amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e.g. complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example.
- Asn297 refers to the asparagine residue located at position 297 in the Fc region (Eu numbering of Fc region residues); however, Asn297 may also be located ⁇ 3 amino acids upstream or downstream of position 297, i.e. , between positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation variants may have improved ADCC function. See, e.g., W02000/61739; WO 2001/29246; W02002/031140; US2002/0164328;
- Examples of cell lines capable of producing defucosylated antibodies include Led 3 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys.
- knockout cell lines such as alpha- 1, 6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al., Biotech. Bioeng. 87: 614, 2004; Kanda et al., Biotechnol. Bioeng., 94(4):680-688, 2006; and W02003/085107).
- modified antibodies include those wherein one or more amino acids have been replaced with a non-amino acid component, or where the amino acid has been conjugated to a functional group or a functional group has been otherwise associated with an amino acid.
- the modified amino acid may be, e.g., a glycosylated amino acid, a PEGylated amino acid, a farnesylated amino acid, an acetylated amino acid, a biotinylated amino acid, an amino acid conjugated to a lipid moiety, or an amino acid conjugated to an organic derivatizing agent.
- Amino acid(s) can be modified, for example, co-translationally or post-translationally during recombinant production (e.g., N-linked glycosylation at N-X-S/T motifs during expression in mammalian cells) or modified by synthetic means.
- the modified amino acid can be within the sequence or at the terminal end of a sequence.
- Modifications also include nitrited constructs.
- variants include glycosylation variants wherein the number and/or type of glycosylation site has been altered compared to the amino acid sequences of a reference sequence.
- glycosylation variants include a greater or a lesser number of N-linked glycosylation sites than the reference sequence.
- N-linked glycosylation site is characterized by the sequence: Asn-X-Ser or Asn-X-Thr, wherein the amino acid residue designated as X can be any amino acid residue except proline.
- the substitution of amino acid residues to create this sequence provides a potential new site for the addition of an N-linked carbohydrate chain. Alternatively, substitutions which eliminate this sequence will remove an existing N-linked carbohydrate chain. Also provided is a rearrangement of N-linked carbohydrate chains wherein one or more N-linked glycosylation sites (e.g., those that are naturally occurring) are eliminated and one or more new N-linked sites are created.
- Additional antibody variants include cysteine variants wherein one or more cysteine residues are deleted from or substituted for another amino acid (e.g., serine) as compared to the reference sequence. These cysteine variants can be useful when antibodies must be refolded into a biologically active conformation such as after the isolation of insoluble inclusion bodies. These cysteine variants generally have fewer cysteine residues than the reference sequence, and typically have an even number to minimize interactions resulting from unpaired cysteines.
- PEGylation particularly is a process by which polyethylene glycol (PEG) polymer chains are covalently conjugated to other molecules such as proteins.
- PEG polyethylene glycol
- Several methods of PEGylating proteins have been reported in the literature. For example, N-hydroxy succinimide (NHS)-PEG was used to PEGylate the free amine groups of lysine residues and N-terminus of proteins; PEGs bearing aldehyde groups have been used to PEGylate the amino-termini of proteins in the presence of a reducing reagent; PEGs with maleimide functional groups have been used for selectively PEGylating the free thiol groups of cysteine residues in proteins; and site- specific PEGylation of acetyl-phenylalanine residues can be performed.
- NHS N-hydroxy succinimide
- PEGylation can also decrease protein aggregation (Suzuki et al., Biochem. Bioph. Acta 788:248, 1984), alter protein immunogenicity (Abuchowski et al. , J. Biol. Chem. 252: 3582, 1977), and increase protein solubility as described, for example, in PCT Publication No. WO 92/16221).
- PEGs are commercially available (Nektar Advanced PEGylation Catalog 2005-2006; and NOF DDS Catalogue Ver 7.1), which are suitable for producing proteins with targeted circulating half-lives.
- active PEGs have been used including mPEG succinimidyl succinate, mPEG succinimidyl carbonate, and PEG aldehydes, such as mPEG- propionaldehyde.
- the antibody can be fused or coupled to an Fc polypeptide that includes amino acid alterations that extend the in vivo half-life of an antibody that contains the altered Fc polypeptide as compared to the half-life of a similar antibody containing the same Fc polypeptide without the amino acid alterations.
- Fc polypeptide amino acid alterations can include M252Y, S254T, T256E, M428L, and/or N434S and can be used together, separately or in any combination.
- the introduction of the ⁇ TE” mutation (M252Y, S254T, and T256E) into the Fc region of an IgG can extend its half-life 4-fold from 3-weeks to over 3-months in non human primates, potentially allowing the administration of a single dose to span the entire respiratory virus season. More detail regarding the YTE mutation can be found in Acqua et al., J. Immunol. 169(9) 5171-5180 (2002).
- M428L/N434S is a pair of mutations that increase the half- life of antibodies in serum, as described in Zalevsky et al., Nature Biotechnology 28, 157-159, 2010. Other alterations that can be helpful are described in US Patent No. 7,083,784, US Patent No. 7,670,600, US Publication No. 2010/0234575, PCT/US2012/070146, and Zwolak, Scientific Reports 7: 15521, 2017.
- any substitution at one of the following amino acid positions in an Fc polypeptide can be considered an Fc alteration that extends half-life: 250, 251, 252, 259, 307, 308, 332, 378, 380, 428, 430, 434, 436.
- antibodies disclosed herein are formed using the Daedalus expression system as described in Pechman et al. (Am J Physiol 294: R1234-R1239, 2008).
- the Daedalus system utilizes inclusion of minimized ubiquitous chromatin opening elements in transduction vectors to reduce or prevent genomic silencing and to help maintain the stability of decigram levels of expression. This system can bypass tedious and time-consuming steps of other protein production methods by employing the secretion pathway of serum-free adapted human suspension cell lines, such as 293 Freestyle.
- Anti-viral bispecific antibodies bind at least two epitopes wherein at least one of the epitopes is located on HPIV3, HPIV1, RSV or HMPV.
- Anti-viral trispecific antibodies bind at least 3 epitopes, wherein at least one of the epitopes is located on HPIV3, HPIV1, RSV or HMPV, and so on.
- Bispecific antibodies can be prepared as full-length antibodies or antibody fragments (for example, F(ab')2 bispecific antibodies).
- WO 1996/016673 describes a bispecific anti-ErbB2/anti-Fc gamma Rill antibody; US Pat. No.
- a bispecific antibody can be in the form of a Bispecific T-cell Engaging (BiTE®) antibody.
- bispecific antibodies have two heavy chains (each having three heavy chain CDRs, followed by (N-terminal to C-terminal) a CH1 domain, a hinge, a CH2 domain, and a CH3 domain), and two immunoglobulin light chains that confer antigen-binding specificity through association with each heavy chain.
- additional architectures are envisioned, including bi-specific antibodies in which the light chain(s) associate with each heavy chain but do not (or minimally) contribute to antigen-binding specificity, or that can bind one or more of the epitopes bound by the heavy chain antigen-binding regions, or that can associate with each heavy chain and enable binding of one or both of the heavy chains to one or both epitopes.
- scFv dimers or diabodies may be used, rather than whole antibodies. Diabodies and scFv can be constructed without an Fc region, using only variable domains (usually including the variable domain components from both light and heavy chains of the source antibody), potentially reducing the effects of anti-idiotypic reaction.
- Other forms of bispecific antibodies include the single chain “Janusins” described in Traunecker et al. (Embo Journal, 10, 3655-3659, 1991).
- Bispecific antibodies with extended half-lives are described in, for example, US Patent No. 8,921 ,528 and US Patent Publication No. 2014/0308285.
- bispecific antibodies are known in the art. For example, traditional production of full-length bispecific antibodies is based on the co-expression of two immunoglobulin heavy chain-light chain pairs, where the two chains have different specificities (see, for example, Millstein et al. Nature 305:37-39, 1983). Similar procedures are disclosed in, for example, WO 1993/008829, Traunecker et al., EMBO J. 10:3655-3659, 1991 and Holliger & Winter, Current Opinion Biotechnol. 4, 446-449 (1993).
- bispecific antibodies can be prepared using chemical linkage.
- Brennan et al. (Science 229: 81, 1985) describes a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab')2 fragments. These fragments are reduced in the presence of the dithiol complexing agent, sodium arsenite, to stabilize vicinal dithiols and prevent intermolecular disulfide formation.
- the Fab' fragments generated then are converted to thionitrobenzoate (TNB) derivatives.
- One of the Fab'-TNB derivatives then is reconverted to the Fab'-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab'-TNB derivative to form the bispecific antibody.
- bispecific antibodies can be prepared using knobs-into holes techniques.
- Knobs-into-holes refers to forcing the pairing of two different antibody heavy chains by introducing mutations into the CH3 domains to modify the contact interface. On one chain bulky amino acids are replaced by amino acids with short side chains to create a ‘hole’. Conversely, amino acids with large side chains were introduced into the other CH3 domain, to create a ‘knob’.
- high yields of heterodimer formation (‘knob-hole’) versus homodimer formation (‘hole-hole’ or ‘knob-knob’) is observed (Ridgway, J. B., Protein Eng. 9 (1996) 617-621 ; and WO 96/027011).
- the ‘knob’ and/or the ‘hole’ may exist in the original polypeptide or may be introduced synthetically (e.g. by altering nucleic acid encoding the polypeptide).
- the nucleic acid encoding the original amino acid residue (or other non-amino acid groups such as, for example carbohydrate groups) in the interface of the polypeptide is replaced with DNA encoding at least one import amino acid residue, wherein the interface refers to amino acid residues in contact between a first heavy chain constant region and one or more amino acid residues (or other non-amino acid groups) in a second heavy chain constant region.
- the preferred import residues for the formation of a hole are amino acids with smaller side chain volumes than the original amino acid residue such as alanine (A), serine (S), threonine (T), valine (V), or glycine (G).
- the preferred import residues for the formation of a knob are amino acids with larger side chain volumes than the original amino acid residue such as tyrosine (Y), arginine (R), phenylalanine (F), or tryptophan (W).
- the percentage of heterodimer can be increased by remodeling the interaction surfaces of the two CH3 domains using a phage display approach and the introduction of a disulfide bridge to stabilize the heterodimers (Merchant A.
- binding fragments disclosed herein can be used to create bi- tri-, quad- (or more) specific antibody constructs that bind a secondary virus.
- a secondary virus is one that is not HPIV3, HPIV1, RSV or HMPV.
- the secondary virus is a respiratory virus.
- the secondary respiratory virus is selected from an adenovirus, a boca virus, a coronavirus, an enterovirus, an influenza virus, a metapneumovirus, a parainfluenza virus, and/or a rhinovirus.
- the respiratory virus includes: human adenovirus, human boca virus (HBoV), human coronavirus (HCoV, including SARS-CoV, MERS-CoV, coronavirus 229E, coronavirus OC43, coronavirus NL63, coronavirus HKU1, coronavirus NL, coronavirus NH), influenza (groups A and B), human parainfluenza virus (HPIV2 or 4), and/or human rhinovirus (HRV A - HRVC).
- Exemplary binding fragments that can be used in an engineered format that binds a secondary virus include: 8C4, 5Hx-l, 5Hx-2 , 5Hx-3, 5Hx-4, 5Hx-5, 5.100K-1 , 5PB-1 , 5Fb-l, and 1E11 to bind to adenovirus; EPR23305-44 to bind to coxsackie adenovirus; 47D11 antibody to bind to SARS-CoV and SARS-CoV-2; CR3022 to bind to SARS-CoV-2; CDC2-A2, G2, 5F9, FIB- H1 , and JC57-13 to bind to MERS-CoV; 32D6 to bind to H1 N1 influenza virus; CH65 to bind to H1 influenza virus; CR9114, MAb 22/1, MAb70/l, MAb 110/1, MAb 264/2, MAb W18/1 , MAb 14/3, MAb 24/4, MAb 47/8, MA
- Exemplary binding fragments that can be used in an engineered format that binds a secondary virus such as MERS-CoV include: a heavy chain with three CDRs including the amino acid sequences EFTFNTYG (SEQ ID NO: 57), ISYDGTKK (SEQ ID NO: 58), and ARSGDSDAFDI (SEQ ID NO: 59) respectively and/or a light chain with three CDRs including the amino acid sequences ELGDKF (SEQ ID NO: 60), QDS, and QAWDSNSYV (SEQ ID NO: 61) respectively.
- Exemplary binding fragments that can be used in an engineered format that binds a secondary virus such as MERS-CoV include: a heavy chain with three CDRs including the amino acid sequences GGTFGSYA (SEQ ID NO: 62), IDAANGNT (SEQ ID NO: 63), and ARDRWMTTRAFDI (SEQ ID NO: 64) respectively and/or a light chain with three CDRs including the amino acid sequences SSNIGSNY (SEQ ID NO: 65), RNN, and AAWDDSLRGPV (SEQ ID NO: 66) respectively.
- Exemplary binding fragments that can be used in an engineered format that binds a secondary virus such as MERS-CoV include: a heavy chain with three CDRs including the amino acid sequences GGTFSSYA (SEQ ID NO: 135), IIPIFGKA (SEQ ID NO: 136), and ARDQGISANFKDAFDI (SEQ ID NO: 137) respectively and/or a light chain with three CDRs including the amino acid sequences ESVGSN (SEQ I D NO: 138), GAS, and QQYNNWPLT (SEQ ID NO: 139) respectively.
- Exemplary binding fragments that can be used in an engineered format that binds a secondary virus such as MERS-CoV include: a heavy chain with three CDRs including the amino acid sequences GGTFSSYA (SEQ ID NO: 135), IIPIFGTA (SEQ ID NO: 141), and
- ARVGYCSSTSCHIGAFDI (SEQ ID NO: 142) respectively and/or a light chain with three CDRs including the amino acid sequences QSVSSS (SEQ ID NO: 143), DSS, and QQYSSSPYT (SEQ ID NO: 144) respectively.
- Exemplary binding fragments that can be used in an engineered format that binds a secondary virus such as MERS-CoV include: a heavy chain with three CDRs including the amino acid sequences GGTFSSYA (SEQ ID NO: 135), IIPIFGTA (SEQ ID NO: 141), and
- ARASYCSTTSCASGAFDI (SEQ ID NO: 147) respectively and/or a light chain with three CDRs including the amino acid sequences QSVLYSSNN NY (SEQ ID NO: 148), WAS, and QQYYSVPFT (SEQ ID NO: 149) respectively.
- Exemplary binding fragments that can be used in an engineered format that binds a secondary virus such as MERS-CoV include: a heavy chain with three CDRs including the amino acid sequences GYTFNVYA (SEQ ID NO: 150), IIPILGIA (SEQ ID NO: 151), and
- ARDYYGSGARGFDY (SEQ ID NO: 152) respectively and/or a light chain with three CDRs including the amino acid sequences SNNVGNQG (SEQ ID NO: 153), TNN, and ASWDSSLSVWV (SEQ ID NO: 154) respectively.
- Exemplary binding fragments that can be used in an engineered format that binds a secondary virus such as MERS-CoV include: a heavy chain with three CDRs including the amino acid sequences GGTFSSYA (SEQ ID NO: 135), IIPIFGIA (SEQ ID NO: 156), and
- ASSNYYGSGSYYPRSAFDI (SEQ ID NO: 157) respectively and/or a light chain with three CDRs including the amino acid sequences QSISND (SEQ ID NO: 158), GAS, and QQYGVSPLT (SEQ ID NO: 159) respectively. Additional examples can be found in US Patent No. 9,718,872.
- binding fragments disclosed herein can be used to create bi- tri-, (or more) specific immune cell engaging antibody constructs.
- An example of a multi-specific immune cell engaging antibody construct includes those which bind both a viral epitope on HPIV3, HPIV1, RSV or HMPV and an immune cell (e.g., T-cell or NK-cells) activating epitope, with the goal of bringing immune cells to virally infected cells displaying a viral HPIV3, HPIV1, RSV or HMPV epitope bound by an antibody disclosed herein. See, for example, US 2008/0145362.
- Such constructs are referred to herein as immune-activating multi-specifics or l-AMS).
- BiTEs® (Amgen, Thousand Oaks, CA) are one form of l-AMS.
- Immune cells that can be targeted for localized activation by l-AMS within the current disclosure include, for example, T-cells, natural killer (NK) cells, and macrophages which are discussed in more detail herein.
- T-cell activation can be mediated by two distinct signals: those that initiate antigen- dependent primary activation and provide a T-cell receptor like signal (primary cytoplasmic signaling sequences) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (secondary cytoplasmic signaling sequences).
- I-AMS disclosed herein can target any T-cell activating epitope that upon binding induces T-cell activation.
- T-cell activating epitopes are on T-cell markers including CD2, CD3, CD7, CD27, CD28, CD30, CD40, CD83, 4-1 BB (CD 137), 0X40, lymphocyte function-associated antigen-1 (LFA-1), LIGHT, NKG2C, and B7-H3.
- T-cell markers including CD2, CD3, CD7, CD27, CD28, CD30, CD40, CD83, 4-1 BB (CD 137), 0X40, lymphocyte function-associated antigen-1 (LFA-1), LIGHT, NKG2C, and B7-H3.
- the CD3 binding fragment (e.g., scFv) is derived from the OKT3 antibody (the same as the one utilized in blinatumomab).
- the OKT3 antibody is described in detail in U.S. Patent No. 5,929,212. It includes a variable light chain including a CDRL1 sequence including SASSSVSYMN (SEQ ID NO: 67), a CDRL2 sequence including RWIYDTSKLAS (SEQ ID NO: 68), and a CDRL3 sequence including QQWSSNPFT (SEQ ID NO: 69).
- the CD3 T-cell activating epitope binding fragment is a human or humanized binding fragment (e.g., scFv) including a variable heavy chain including a CDRH1 sequence including KASGYTFTRYTMH (SEQ ID NO: 70), a CDRH2 sequence including INPSRGYTNYNQKFKD (SEQ ID NO: 71), and a CDRH3 sequence including YYDDHYCLDY (SEQ ID NO: 72).
- scFv human or humanized binding fragment including a variable heavy chain including a CDRH1 sequence including KASGYTFTRYTMH (SEQ ID NO: 70), a CDRH2 sequence including INPSRGYTNYNQKFKD (SEQ ID NO: 71), and a CDRH3 sequence including YYDDHYCLDY (SEQ ID NO: 72).
- the CD3 T-cell activating epitope binding fragment is a human or humanized binding fragment (e.g., scFv) including a variable light chain including a CDRL1 sequence including QSLVHNNGNTY (SEQ ID NO: 74), a CDRL2 sequence including KVS, and a CDRL3 sequence including GQGTQYPFT (SEQ ID NO: 75).
- the CD3 T-cell activating epitope binding fragment is a human or humanized binding fragment (e.g., scFv) including a variable heavy chain including a CDRH1 sequence including GFTFTKAW (SEQ ID NO: 76), a CDRH2 sequence including IKDKSNSYAT (SEQ ID NO: 77), and a CDRH3 sequence including RGVYYALSPFDY (SEQ ID NO: 78). These reflect CDR sequences of the 20G6-F3 antibody.
- scFv including a variable heavy chain including a CDRH1 sequence including GFTFTKAW (SEQ ID NO: 76), a CDRH2 sequence including IKDKSNSYAT (SEQ ID NO: 77), and a CDRH3 sequence including RGVYYALSPFDY (SEQ ID NO: 78).
- the CD3 T-cell activating epitope binding fragment is a human or humanized binding fragment (e.g., scFv) including a variable light chain including a CDRL1 sequence including QSLVHDNGNTY (SEQ ID NO: 79), a CDRL2 sequence including KVS, and a CDRL3 sequence including GQGTQYPFT (SEQ ID NO: 75).
- the CD3 T-cell activating epitope binding fragment is a human or humanized binding fragment (e.g., scFv) including a variable heavy chain including a CDRH1 sequence including GFTFSNAW (SEQ ID NO: 80), a CDRH2 sequence including IKARSNNYAT (SEQ ID NO: 81), and a CDRH3 sequence including RGTYYASKPFDY (SEQ ID NO: 82). These reflect CDR sequences of the 4B4-D7 antibody.
- scFv including a variable heavy chain including a CDRH1 sequence including GFTFSNAW (SEQ ID NO: 80), a CDRH2 sequence including IKARSNNYAT (SEQ ID NO: 81), and a CDRH3 sequence including RGTYYASKPFDY (SEQ ID NO: 82).
- the CD3 T-cell activating epitope binding fragment is a human or humanized binding fragment (e.g., scFv) including a variable light chain including a CDRL1 sequence including QSLEHNNGNTY (SEQ ID NO: 83), a CDRL2 sequence including KVS; not included in Sequence Listing), and a CDRL3 sequence including GQGTQYPFT (SEQ ID NO: 75).
- scFv human or humanized binding fragment including a variable light chain including a CDRL1 sequence including QSLEHNNGNTY (SEQ ID NO: 83), a CDRL2 sequence including KVS; not included in Sequence Listing), and a CDRL3 sequence including GQGTQYPFT (SEQ ID NO: 75).
- the CD3 T-cell activating epitope binding fragment is a human or humanized binding fragment (e.g., scFv) including a variable heavy chain including a CDRH1 sequence including GFTFSNAW (SEQ ID NO: 80), a CDRH2 sequence including IKDKSNNYAT (SEQ ID NO: 84), and a CDRH3 sequence including RYVHYGIGYAMDA (SEQ ID NO: 85). These reflect CDR sequences of the 4E7-C9 antibody.
- scFv including a variable heavy chain including a CDRH1 sequence including GFTFSNAW (SEQ ID NO: 80), a CDRH2 sequence including IKDKSNNYAT (SEQ ID NO: 84), and a CDRH3 sequence including RYVHYGIGYAMDA (SEQ ID NO: 85).
- the CD3 T-cell activating epitope binding fragment is a human or humanized binding fragment (e.g., scFv) including a variable light chain including a CDRL1 sequence including QSLVHTNGNTY (SEQ ID NO: 86), a CDRL2 sequence including KVS, and a CDRL3 sequence including GQGTHYPFT (SEQ ID NO: 87).
- scFv human or humanized binding fragment
- a variable light chain including a CDRL1 sequence including QSLVHTNGNTY (SEQ ID NO: 86), a CDRL2 sequence including KVS, and a CDRL3 sequence including GQGTHYPFT (SEQ ID NO: 87).
- the CD3 T-cell activating epitope binding fragment is a human or humanized binding fragment (e.g., scFv) including a variable heavy chain including a CDRH1 sequence including GFTFTNAW (SEQ ID NO: 88), a CDRH2 sequence including KDKSNNYAT (SEQ ID NO: 89), and a CDRH3 sequence including RYVHYRFAYALDA (SEQ ID NO: 90). These reflect CDR sequences of the 18F5-H10 antibody.
- scFv human or humanized binding fragment
- a variable heavy chain including a CDRH1 sequence including GFTFTNAW (SEQ ID NO: 88), a CDRH2 sequence including KDKSNNYAT (SEQ ID NO: 89), and a CDRH3 sequence including RYVHYRFAYALDA (SEQ ID NO: 90).
- anti-CD3 antibodies binding fragments, and CDRs
- TR66 may also be used.
- CD28 is a surface glycoprotein present on 80% of peripheral T-cells in humans and is present on both resting and activated T-cells. CD28 binds to B7-1 (CD80) and B7-2 (CD86) and is the most potent of the known co-stimulatory molecules (June et al. , Immunol. Today 15:321, 1994; Linsley et al., Ann. Rev. Immunol. 11:191 , 1993).
- the CD28 binding fragment e.g., scFv
- Additional antibodies that bind CD28 include 9.3, KOLT-2, 15E8, 248.23.2, and EX5.3D10. Further, 1YJD provides a crystal structure of human CD28 in complex with the Fab fragment of a mitogenic antibody (5.11A1).
- a CD28 binding fragment is derived from TGN1412.
- the variable heavy chain of TGN1412 includes: QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWIGCIYPGNVNTNYNE KFKDRATLTVDTSISTAYMELSRLRSDDTAVYFCTRSHYGLDWNFDVWGQGTTVTVSS (SEQ ID NO: 91) and the variable light chain of TGN1412 includes:
- the CD28 binding fragment includes a variable light chain including a CDRL1 sequence including HASQNIYVWLN (SEQ ID NO: 93), CDRL2 sequence including KASNLHT (SEQ ID NO: 94), and CDRL3 sequence including QQGQTYPYT (SEQ ID NO: 95), a variable heavy chain including a CDRH1 sequence including GYTFTSYYIH (SEQ ID NO: 96), a CDRH2 sequence including CIYPGNVNTNYNEK (SEQ ID NO: 97), and a CDRH3 sequence including SHYGLDWNFDV (SEQ ID NO: 98).
- the CD28 binding fragment including a variable light chain including a CDRL1 sequence including HASQNIYVWLN (SEQ ID NO: 93), a CDRL2 sequence including KASNLHT (SEQ ID NO: 94), and a CDRL3 sequence including QQGQTYPYT (SEQ ID NO: 95) and a variable heavy chain including a CDRH1 sequence including SYYIH (SEQ ID NO: 99), a CDRH2 sequence including CIYPGNVNTNYNEKFKD (SEQ ID NO: 100), and a CDRH3 sequence including SHYGLDWNFDV (SEQ ID NO: 98).
- the 4-1 BB binding fragment includes a variable light chain including a CDRL1 sequence including RASQSVS (SEQ ID NO: 101), a CDRL2 sequence including ASNRAT (SEQ ID NO: 102), and a CDRL3 sequence including QRSNWPPALT (SEQ ID NO: 103) and a variable heavy chain including a CDRH1 sequence including YYWS (SEQ ID NO: 104), a CDRH2 sequence including INH, and a CDRH3 sequence including YGPGNYDWYFDL (SEQ ID NO: 105).
- the 4-1 BB binding fragment includes a variable light chain including a CDRL1 sequence including SGDNIGDQYAH (SEQ ID NO: 106), a CDRL2 sequence including QDKNRPS (SEQ ID NO: 107), and a CDRL3 sequence including ATYTGFGSLAV (SEQ ID NO: 108) and a variable heavy chain including a CDRH1 sequence including GYSFSTYWIS (SEQ ID NO: 109), a CDRH2 sequence including KIYPGDSYTNYSPS (SEQ ID NO: 110) and a CDRH3 sequence including GYGIFDY (SEQ ID NO: 111).
- the CD8 binding fragment (e.g., scFv) is derived from the OKT8 antibody.
- the CD8 T-cell activating epitope binding fragment is a human or humanized binding fragment (e.g., scFv) including a variable light chain including a CDRL1 sequence including RTSRSISQYLA (SEQ ID NO: 112), a CDRL2 sequence including SGSTLQS (SEQ ID NO: 113), and a CDRL3 sequence including QQHNENPLT (SEQ ID NO: 114).
- the CD8 T-cell activating epitope binding fragment is a human or humanized binding fragment (e.g., scFv) including a variable heavy chain including a CDRH1 sequence including GFNIKD (SEQ ID NO: 115), a CDRH2 sequence including RIDPANDNT (SEQ ID NO: 116), and a CDRH3 sequence including GYGYYVFDH (SEQ ID NO: 117). These reflect CDR sequences of the OKT8 antibody.
- scFv human or humanized binding fragment including a variable heavy chain including a CDRH1 sequence including GFNIKD (SEQ ID NO: 115), a CDRH2 sequence including RIDPANDNT (SEQ ID NO: 116), and a CDRH3 sequence including GYGYYVFDH (SEQ ID NO: 117).
- natural killer cells also known as NK-cells, K-cells, and killer cells
- NK cells can induce apoptosis or cell lysis by releasing granules that disrupt cellular membranes and can secrete cytokines to recruit other immune cells.
- Examples of activating proteins expressed on the surface of NK cells include NKG2D, CD8, CD16, KIR2DL4, KIR2DS1, KIR2DS2, KIR3DS1 , NKG2C, NKG2E, NKG2D, and several members of the natural cytotoxicity receptor (NCR) family.
- Examples of NCRs that activate NK cells upon ligand binding include NKp30, NKp44, NKp46, NKp80, and DNAM-1.
- Examples of commercially available antibodies that bind to an NK cell receptor and induce and/or enhance activation of NK cells include: 5C6 and 1 D11 , which bind and activate NKG2D (available from BioLegend ® San Diego, CA); mAb 33, which binds and activates KIR2DL4 (available from BioLegend ® ); P44-8, which binds and activates NKp44 (available from BioLegend ® ); SK1, which binds and activates CD8; and 3G8 which binds and activates CD16.
- the l-AMS can bind to and block an NK cell inhibitory receptor to enhance NK cell activation.
- NK cell inhibitory receptors examples include KIR2DL1 , KIR2DL2/3, KIR3DL1, NKG2A, and KLRG1.
- a binding fragment that binds and blocks the NK cell inhibitory receptors KIR2DL1 and KIR2DL2/3 includes a variable light chain region of the sequence
- KFQGRVTITADESTSTAYMELSSLRSDDTAVYYCARIPSGSYYYDYDMDVWGQGTTVTVSS SEQ ID NO: 119. Additional NK cell activating antibodies are described in WO/2005/0003172 and US Patent No. 9,415,104.
- macrophages are targeted for localized activation by l-AMS.
- Macrophages are a type of leukocyte (or white blood cell) that can engulf and digest cells, cellular debris, and/or foreign substances in a process known as phagocytosis.
- the l-AMS can be designed to bind to a protein expressed on the surface of macrophages.
- activating proteins expressed on the surface of macrophages include CD11b, CD11c, CD64, CD68, CD119, CD163, CD206, CD209, F4/80, IFGR2 Toll-like receptors (TLRs) 1-9, IL-4Ra, and MARCO.
- M1/70 which binds and activates CD11b (available from BioLegend®); KP1 , which binds and activates CD68 (available from ABCAM®, Cambridge, United Kingdom); and ab87099, which binds and activates CD163 (available from ABCAM®).
- l-AMS can target a pathogen recognition receptor (PRR).
- PRRs are proteins or protein complexes that recognize a danger signal and activate and/or enhance the innate immune response.
- PRRs include the TLR4/MD-2 complex, which recognizes gram negative bacteria; Dectin-1 and Dectin-2, which recognize mannose moieties on fungus and other pathogens; TLR2/TLR6 or TLR2/TLR1 heterodimers, which recognize gram positive bacteria; TLR5, which recognizes flagellin; and TLR9 (CD289), which recognizes CpG motifs in DNA.
- l-AMS can bind and activate TLR4/MD-2, Dectin-1, Dectin-2, TRL2/TLR6, TLR2/TLR1 , TLR5, and/or TLR9.
- l-AMS can target the complement system.
- the complement system refers to an immune pathway that is induced by antigen-bound antibodies and involves signaling of complement proteins, resulting in immune recognition and clearance of the antibody- coated antigens.
- Binding fragments of l-AMS and other engineered formats described herein may be joined through a linker.
- a linker is an amino acid sequence which can provide flexibility and room for conformational movement between the binding fragments of a l-AM. Any appropriate linker may be used.
- Linkers can be found in Chen et al., Adv Drug Deliv Rev. 2013 Oct 15; 65(10): 1357-1369. Linkers can be flexible, rigid, or semi-rigid, depending on the desired functional domain presentation to a target.
- Commonly used flexible linkers include linker sequence with the amino acids glycine and serine (Gly-Ser linkers).
- the linker sequence includes sets of glycine and serine repeats such as from one to ten repeats of (Gly x Ser y ) n (SEQ ID NO: 120), wherein x and y are independently an integer from 0 to 10 provided that x and y are not both 0 and wherein n is an integer of 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10).
- Particular examples include (Gly4Ser) n (SEQ ID NO: 121), (Gly 3 Ser) n (Gly 4 Ser) n (SEQ ID NO: 122), (Gl y3 Ser) n (Gly 2 Ser) n (SEQ ID NO: 123), and (Gly 3 Ser) n (Gly4Ser)i (SEQ ID NO: 124).
- the linker is (Gly4Ser) 4 (SEQ ID NO: 125), (Gly 4 Ser) 3 (SEQ ID NO: 126), (Gly 4 Ser) 2 (SEQ ID NO: 127), (Gly 4 Ser)i (SEQ ID NO: 128), (Gly 3 Ser) 2 (SEQ ID NO: 129), (Gly 3 Ser) ! (SEQ ID NO: 130), (Gly 2 Ser) 2 (SEQ ID NO: 131) or (Gly 2 Ser)i, GGSGGGSGGSG (SEQ ID NO: 132), GGSGGGSGSG (SEQ ID NO: 133), or GGSGGGSG (SEQ ID NO: 134).
- Linkers that include one or more antibody hinge regions and/or immunoglobulin heavy chain constant regions, such as CH3 alone or a CH2CH3 sequence can also be used.
- flexible linkers may be incapable of maintaining a distance or positioning of binding fragments needed for a particular use.
- rigid or semi-rigid linkers may be useful.
- rigid or semi-rigid linkers include proline-rich linkers.
- a proline-rich linker is a peptide sequence having more proline residues than would be expected based on chance alone.
- a proline-rich linker is one having at least 30%, at least 35%, at least 36%, at least 39%, at least 40%, at least 48%, at least 50%, or at least 51% proline residues.
- proline-rich linkers include fragments of proline-rich salivary proteins (PRPs).
- l-AMS molecules can be confirmed in comparative in vitro assays. Briefly, for cell line experiments, target virally-infected cells can be incubated in 96-well round bottom plates at 5-10,000 cells/well containing increasing concentrations of the various l-AMS antibodies (e.g., viral-epitope/CD3 l-AMS including a viral epitope-CD3 bispecific antibody (BiAb)) with/without healthy donor T-cells (used at an E:T cell ratio of 1:1 and 3:1). After 48 hours, cell numbers and drug-induced cytotoxicity, using 4',6-diamidino-2-phenylindole (DAPI) to detect non- viable cells, can be determined by flow cytometry. In experiments where healthy donor T-cells are added, virally-infected cells can be identified by forward/side scatter properties and negativity for CellVue Burgundy dye. Experiments can include technical duplicates.
- DAPI 4',6-diamidino-2-phenylindole
- T-cell activating epitope binding fragments include one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) insertions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) deletions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) amino acid substitutions (e.g., conservative amino acid substitutions or non-conservative amino acid substitutions), or a combination of the above-noted changes, when compared with the V a , Vp, C a , or Cp of a known TOR.
- amino acid substitutions e.g., conservative amino acid substitutions or non-conservative amino acid substitutions
- An insertion, deletion or substitution may be anywhere in a V a , Vp, C a , or Cp region, including at the amino- or carboxy-terminus or both ends of these regions, provided that each CDR includes zero changes or at most one, two, or three changes and provided a binding fragment including a modified V a , Vp, C a , or Cp region can still specifically bind its target with an affinity similar to wild type.
- bispecific molecules can be assembled by synthesizing each scFv as a DNA fragment with overlapping Gibson assembly-compatible ends in the canonical BiTE® antibody format.
- Prototypical intervening regions such as (Gly4Ser) 3 (SEQ ID NO: 126) linkers can be used between paired variable domains and a short Gly4Ser (SEQ ID NO: 128) linker between the two scFvs.
- Anti-viral tri-specific antibodies are artificial proteins that simultaneously bind to three different types of antigens, wherein at least one of the antigens is a viral epitope on HPI V1 , HPI V3, RSV or HMPV bound by an antibody disclosed herein. Tri-specific antibodies are described in, for example, WO2016/105450, WO 2010/028796; WO 2009/007124; WO 2002/083738; US 2002/0051780; and WO 2000/018806.
- a pharmaceutically acceptable salt includes any salt that retains the activity of the antibody and is acceptable for pharmaceutical use.
- a pharmaceutically acceptable salt also refers to any salt which may form in vivo as a result of administration of an acid, another salt, or a prodrug which is converted into an acid or salt.
- Suitable pharmaceutically acceptable acid addition salts can be prepared from an inorganic acid or an organic acid.
- inorganic acids are hydrochloric, hydrobromic, hydroiodic, nitric, carbonic, sulfuric and phosphoric acid.
- Appropriate organic acids can be selected from aliphatic, cycloaliphatic, aromatic, arylaliphatic, heterocyclic, carboxylic and sulfonic classes of organic acids.
- Suitable pharmaceutically acceptable base addition salts include metallic salts made from aluminum, calcium, lithium, magnesium, potassium, sodium and zinc or organic salts made from N,N'-dibenzylethylene-diamine, chloroprocaine, choline, diethanolamine, ethylenediamine, N- methylglucamine, lysine, arginine and procaine.
- a prodrug includes an active ingredient which is converted to a therapeutically active compound after administration, such as by cleavage or by hydrolysis of a biologically labile group.
- the compositions include antibodies of at least 0.1% w/v orw/w of the composition; at least 1 % w/v or w/w of composition; at least 10% w/v or w/w of composition; at least 20% w/v or w/w of composition; at least 30% w/v or w/w of composition; at least 40% w/v or w/w of composition; at least 50% w/v or w/w of composition; at least 60% w/v or w/w of composition; at least 70% w/v or w/w of composition; at least 80% w/v or w/w of composition; at least 90% w/v or w/w of composition; at least 95% w/v or w/w of composition; or at least 99% w/v
- Exemplary generally used pharmaceutically acceptable carriers include any and all absorption delaying agents, antioxidants, binders, buffering agents, bulking agents or fillers, chelating agents, coatings, disintegration agents, dispersion media, gels, isotonic agents, lubricants, preservatives, salts, solvents or co-solvents, stabilizers, surfactants, and/or delivery vehicles.
- antioxidants include ascorbic acid, methionine, and vitamin E.
- Exemplary buffering agents include citrate buffers, succinate buffers, tartrate buffers, fumarate buffers, gluconate buffers, oxalate buffers, lactate buffers, acetate buffers, phosphate buffers, histidine buffers, and/or trimethylamine salts.
- An exemplary chelating agent is EDTA (ethylene-diamine-tetra-acetic acid).
- Exemplary isotonic agents include polyhydric sugar alcohols including trihydric or higher sugar alcohols, such as glycerin, erythritol, arabitol, xylitol, sorbitol, or mannitol.
- Exemplary preservatives include phenol, benzyl alcohol, meta-cresol, methyl paraben, propyl paraben, octadecyldimethylbenzyl ammonium chloride, benzalkonium halides, hexamethonium chloride, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, and 3-pentanol.
- Stabilizers refer to a broad category of excipients which can range in function from a bulking agent to an additive which solubilizes the antibodies or helps to prevent denaturation or adherence to the container wall.
- Typical stabilizers can include polyhydric sugar alcohols; amino acids, such as arginine, lysine, glycine, glutamine, asparagine, histidine, alanine, ornithine, L- leucine, 2-phenylalanine, glutamic acid, and threonine; organic sugars or sugar alcohols, such as lactose, trehalose, stachyose, mannitol, sorbitol, xylitol, ribitol, myoinisitol, galactitol, glycerol, and cyclitols, such as inositol; PEG; amino acid polymers; sulfur-containing reducing agents, such as urea, glutathione, thio
- proteins such as human serum albumin, bovine serum albumin, gelatin or immunoglobulins
- hydrophilic polymers such as polyvinylpyrrolidone
- monosaccharides such as xylose, mannose, fructose and glucose
- disaccharides such as lactose, maltose and sucrose
- trisaccharides such as raffinose, and polysaccharides such as dextran.
- Stabilizers are typically present in the range of from 0.1 to 10,000 parts by weight based on therapeutic weight.
- compositions disclosed herein can be formulated for administration by, for example, injection, inhalation, infusion, perfusion, lavage, or ingestion.
- the compositions disclosed herein can further be formulated for intravenous, intradermal, intraarterial, intranodal, intralymphatic, intraperitoneal, intralesional, intraprostatic, intravaginal, intrarectal, topical, intrathecal, intratumoral, intramuscular, intravesicular, oral, sublingual, and/or subcutaneous administration.
- compositions can be formulated as aqueous solutions, such as in buffers including Hanks' solution, Ringer's solution, or physiological saline.
- Hank refers to an isotonic buffer solution including inorganic salts and a carbohydrate.
- Ringer’s solution includes sodium chloride, potassium chloride, calcium chloride at physiologic concentrations with sodium bicarbonate (or sodium lactate) to balance pH.
- the aqueous solutions can include formulatory agents such as suspending, stabilizing, and/or dispersing agents.
- the formulation can be in lyophilized and/or powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
- compositions can be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions and the like.
- suitable excipients include binders (gum tragacanth, acacia, cornstarch, gelatin), fillers such as sugars, e.g., lactose, sucrose, mannitol and sorbitol; dicalcium phosphate, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate; cellulose preparations such as maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carboxy-methylcellulose, and/or polyvinylpyrrolidone (PVP); granulating agents; and binding agents.
- binders gaum tragacanth, acacia, cornstarch, gelatin
- fillers such as sugars, e.g., lacto
- disintegrating agents can be added, such as corn starch, potato starch, alginic acid, cross-linked polyvinylpyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
- solid dosage forms can be sugar-coated or enteric-coated using standard techniques. Flavoring agents, such as peppermint, oil of wintergreen, cherry flavoring, orange flavoring, etc. can also be used.
- compositions can be formulated as an aerosol.
- the aerosol is provided as part of an anhydrous, liquid or dry powder inhaler.
- Aerosol sprays from pressurized packs or nebulizers can also be used with a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
- a dosage unit may be determined by providing a valve to deliver a metered amount.
- Capsules and cartridges of gelatin for use in an inhaler or insufflator may also be formulated including a powder mix of the composition and a suitable powder base such as lactose or starch.
- compositions can also be formulated as depot preparations.
- Depot preparations can be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
- compositions can be formulated as sustained-release systems utilizing semipermeable matrices of solid polymers including at least one type of antibody.
- sustained-release materials have been established and are well known by those of ordinary skill in the art. Sustained-release systems may, depending on their chemical nature, release one or more antibodies following administration for a few weeks up to over 100 days. Depot preparations can be administered by injection; parenteral injection; instillation; or implantation into soft tissues, a body cavity, or occasionally into a blood vessel with injection through fine needles.
- Depot formulations can include a variety of bioerodible polymers including poly(lactide), poly(glycolide), poly(caprolactone) and poly(lactide)-co(glycolide) (PLG) of desirable lactide:glycolide ratios, average molecular weights, polydispersities, and terminal group chemistries. Blending different polymer types in different ratios using various grades can result in characteristics that borrow from each of the contributing polymers.
- solvents for example, dichloromethane, chloroform, ethyl acetate, triacetin, N-methyl pyrrolidone, tetrahydrofuran, phenol, or combinations thereof
- Other useful solvents include water, ethanol, dimethyl sulfoxide (DMSO), N-methyl-2-pyrrolidone (NMP), acetone, methanol, isopropyl alcohol (IPA), ethyl benzoate, and benzyl benzoate.
- Exemplary release modifiers can include surfactants, detergents, internal phase viscosity enhancers, complexing agents, surface active molecules, co-solvents, chelators, stabilizers, derivatives of cellulose, (hydroxypropyl)methyl cellulose (HPMC), HPMC acetate, cellulose acetate, pluronics (e.g., F68/F127), polysorbates, Span® (Croda Americas, Wilmington, Delaware), poly(vinyl alcohol) (PVA), Brij® (Croda Americas, Wilmington, Delaware), sucrose acetate isobutyrate (SAIB), salts, and buffers.
- surfactants e.g., hydroxypropyl)methyl cellulose (HPMC), HPMC acetate, cellulose acetate, pluronics (e.g., F68/F127), polysorbates, Span® (Croda Americas, Wilmington, Delaware), poly(vinyl alcohol) (PVA), Brij® (Croda Americas, Wilmington, Delaware), suc
- Excipients that partition into the external phase boundary of microparticles such as surfactants including polysorbates, dioctylsulfosuccinates, poloxamers, PVA, can also alter properties including particle stability and erosion rates, hydration and channel structure, interfacial transport, and kinetics in a favorable manner.
- Additional processing of the disclosed sustained release depot formulations can utilize stabilizing excipients including mannitol, sucrose, trehalose, and glycine with other components such as polysorbates, PVAs, and dioctylsulfosuccinates in buffers such as Tris, citrate, or histidine.
- a freeze-dry cycle can also be used to produce very low moisture powders that reconstitute to similar size and performance characteristics of the original suspension.
- compositions disclosed herein can advantageously include any other pharmaceutically acceptable carriers which include those that do not produce significantly adverse, allergic, or other untoward reactions that outweigh the benefit of administration.
- exemplary pharmaceutically acceptable carriers and formulations are disclosed in Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990.
- formulations can be prepared to meet sterility, pyrogenicity, general safety, and purity standards as required by U.S. FDA Office of Biological Standards and/or other relevant foreign regulatory agencies.
- Methods disclosed herein include treating subjects (e.g., humans, veterinary animals (dogs, cats, reptiles, birds) livestock (e.g., horses, cattle, goats, pigs, chickens) and research animals (e.g., monkeys, rats, mice, fish) with compositions disclosed herein. Treating subjects includes delivering therapeutically effective amounts. Therapeutically effective amounts include those that provide effective amounts, prophylactic treatments and/or therapeutic treatments.
- an "effective amount” is the amount of a composition necessary to result in a desired physiological change in the subject. Effective amounts are often administered for research purposes. Effective amounts disclosed herein can cause a statistically-significant effect in an animal model or in vitro assay relevant to the assessment of an infection’s development, progression, and/or resolution.
- a prophylactic treatment includes a treatment administered to a subject who does not display signs or symptoms of an infection or displays only early signs or symptoms of an infection such that treatment is administered for the purpose of diminishing or decreasing the risk of developing the infection further.
- a prophylactic treatment functions as a preventative treatment against an infection.
- prophylactic treatments reduce, delay, or prevent the worsening of an infection.
- a "therapeutic treatment” includes a treatment administered to a subject who displays symptoms or signs of an infection and is administered to the subject for the purpose of diminishing or eliminating those signs or symptoms of the infection.
- the therapeutic treatment can reduce, control, or eliminate the presence or activity of the infection and/or reduce control or eliminate side effects of the infection.
- prophylactic treatment or therapeutic treatment are not mutually exclusive, and in particular embodiments, administered dosages may accomplish more than one treatment type.
- therapeutically effective amounts provide anti-infection effects.
- Anti-infection effects include a reducing or preventing a virus from infecting a cell, decreasing the number of infected cells, decreasing the volume of infected tissue, increasing lifespan, increasing life expectancy, reducing or eliminating infection-associated symptoms (e.g., reduced lung capacity).
- therapeutically effective amounts induce an immune response. The immune response can be against a virus.
- therapeutically effective amounts can be initially estimated based on results from in vitro assays and/or animal model studies. Such information can be used to more accurately determine useful doses in subjects of interest.
- the actual dose amount administered to a particular subject can be determined by a physician, veterinarian or researcher taking into account parameters such as physical and physiological factors including target, body weight, severity of condition, type of infection, stage of infection, previous or concurrent therapeutic interventions, idiopathy of the subject and route of administration.
- Useful doses can range from 0.1 to 5 pg/kg or from 0.5 to 1 pg /kg.
- a dose can include 1 pg /kg, 15 pg /kg, 30 pg /kg, 50 pg/kg, 55 pg/kg, 70 pg/kg, 90 pg/kg, 150 pg/kg, 350 pg/kg, 500 pg/kg, 750 pg/kg, 1000 pg/kg, 0.1 to 5 mg/kg or from 0.5 to 1 mg/kg.
- a dose can include 1 mg/kg, 10 mg/kg, 30 mg/kg, 50 mg/kg, 70 mg/kg, 100 mg/kg, 300 mg/kg, 500 mg/kg, 700 mg/kg, 1000 mg/kg or more.
- Therapeutically effective amounts can be achieved by administering single or multiple doses during the course of a treatment regimen (e.g., daily, every other day, every 3 days, every 4 days, every 5 days, every 6 days, weekly, every 2 weeks, every 3 weeks, monthly, every 2 months, every 3 months, every 4 months, every 5 months, every 6 months, every 7 months, every 8 months, every 9 months, every 10 months, every 11 months or yearly).
- a treatment regimen e.g., daily, every other day, every 3 days, every 4 days, every 5 days, every 6 days, weekly, every 2 weeks, every 3 weeks, monthly, every 2 months, every 3 months, every 4 months, every 5 months, every 6 months, every 7 months, every 8 months, every 9 months, every 10 months, every 11 months or yearly.
- the treatment protocol may be dictated by a clinical trial protocol or an FDA- approved treatment protocol.
- particular methods include uses in susceptible individuals, such as those undergoing HCT, lung transplant recipients, premature infants, adults over age 65, or those with other health-related issues that increase susceptibility to infection with respiratory viruses.
- compositions described herein can be administered by, for example, injection, inhalation, infusion, perfusion, lavage, or ingestion.
- Routes of administration can include intravenous, intradermal, intraarterial, intranodal, intravesicular, intrathecal, intraperitoneal, intraparenteral, intranasal, intralesional, intramuscular, oral, subcutaneous, and/or sublingual administration.
- An antibody or binding fragment thereof including the complementarity determining regions (CDRs) of PI3-E12, PI3-A3, PI3-B5, PI3-A10, PI3-A12, 3x1, MxR-B11 , or MxR-D10.
- CDRs complementarity determining regions
- An antibody or binding fragment of embodiment 1 having a CDRH1 including GFTFSDHY (SEQ ID NO: 1); a CDRH2 including ISSSGSNT (SEQ ID NO: 2); a CDRH3 including ARAKWGTMGRGAPPTIYDH (SEQ ID NO: 3); a CDRL1 including QSLLQSNGNNY (SEQ ID NO: 4); a CDRL2 including LGS; and a CDRL3 including MQALQTPLT (SEQ ID NO: 5); a CDRH1 including GFTFSNYW (SEQ ID NO: 8); a CDRH2 including VKEEGSEK (SEQ ID NO: 9); a CDRH3 including AGEVKSGWFGRYFDS (SEQ ID NO: 10); a CDRL1 including QSVGSW (SEQ ID NO: 11); a CDRL2 including KTS; and a CDRL3 including QQYSSFPYT (SEQ ID NO: 12); a CDRH1 including GYNFTNYW (SEQ
- QSYDKSLGGWV (SEQ ID NO: 47); or a CDRH1 including GFIFSNYD (SEQ ID NO: 50); a CDRH2 including ITGGSSFI (SEQ ID NO: 51); a CDRH3 including ARDGGRQLSPCEH (SEQ ID NO: 52); a CDRL1 including
- SSNIGAGYD SEQ ID NO: 53
- CDRL2 including DNN
- CDRL3 CDRL
- An antibody or binding fragment thereof including a variable heavy chain having a sequence with at least 90% or at least 95% sequence identity to the sequence as set forth in SEQ ID NO: 166 and a variable light chain having a sequence with at least 90% or at least 95% sequence identity to the sequence as set forth in SEQ ID NO: 167; a variable heavy chain having a sequence with at least 90% or at least 95% sequence identity to the sequence as set forth in SEQ ID NO: 168 and a variable light chain having a sequence with at least 90% or at least 95% sequence identity to the sequence as set forth in SEQ ID NO: 169; a variable heavy chain having a sequence with at least 90% or at least 95% sequence identity to the sequence as set forth in SEQ ID NO: 170 and a variable light chain having a sequence with at least 90% or at least 95% sequence identity to the sequence as set forth in SEQ ID NO: 171; a variable heavy chain having a sequence with at least 90% or at least 95% sequence identity to the sequence as set forth in SEQ ID NO: 172 and a
- An antibody or binding fragment thereof having a variable heavy chain including the sequence as set forth in SEQ ID NO: 166 and a variable light chain including the sequence as set forth in SEQ ID NO: 167; a variable heavy chain including the sequence as set forth in SEQ ID NO: 168 and a variable light chain including the sequence as set forth in SEQ ID NO: 169; a variable heavy chain including the sequence as set forth in SEQ ID NO: 170 and a variable light chain including the sequence as set forth in SEQ ID NO: 171; a variable heavy chain including the sequence as set forth in SEQ ID NO: 172 and a variable light chain including the sequence as set forth in SEQ ID NO: 173; a variable heavy chain including the sequence as set forth in SEQ ID NO: 174 and a variable light chain including the sequence as set forth in SEQ ID NO: 175; a variable heavy chain including the sequence as set forth in SEQ ID NO: 176 and a variable light chain including the sequence as set forth in SEQ ID NO: 177; a variable heavy chain including the
- a binding molecule including a binding fragment of at least 2 antibodies of any of embodiments 1 8
- binding molecule of embodiment 9 wherein the binding fragments of at least 2 antibodies of any of embodiments 1-3 include Fab or single chain variable fragments (scFv).
- binding molecule of embodiment 9 or 10 wherein the binding fragments include Fab linked through a knobs-into-holes linkage of heavy chains (FIG. 8, top).
- binding molecule of any of embodiments 9-11 wherein the binding fragments include an ScFv with one binding fragment linked to the constant region of an antibody having a different binding fragment (FIG. 8, bottom).
- binding molecule of any of embodiments 9-14 including a binding fragment of a PI3 antibody and a binding fragment of an MxR antibody; a binding fragment of a PI3 antibody and a binding fragment of the 3x1 antibody; or a binding fragment of the 3x1 antibody and a binding fragment of an MxR antibody.
- binding molecule of any of embodiments 9-15 including a binding fragment of a PI3 antibody, a binding fragment of the 3x1 antibody, and a binding fragment of an MxR antibody.
- binding molecule of embodiment 15, wherein the binding fragments include Fab and/or scFv.
- binding molecule of any of embodiments 9-17 including the MxR-B11 Fab and the 3x1 Fab; a MxR-B11 scFv and the 3x1 Fab; the MxR-B11 Fab and a 3x1 scFv; or a MxR-B11 scFv and a 3x1 scFv.
- binding molecule of any of embodiments 9-18 including the MxR-D10 Fab and the 3x1 Fab; a MxR-D10 scFv and the 3x1 Fab; the MxR- D10 Fab and a 3x1 scFv; or a MxR- D10 scFv and a 3x1 scFv.
- a binding molecule including a binding fragment of any of embodiments 1-8 and a binding fragment of an antibody that binds a secondary virus.
- the binding molecule of embodiment 20, wherein the secondary virus is selected from an adenovirus, a boca virus, a coronavirus, an enterovirus, an influenza virus, a metapneumovirus, a parainfluenza virus, and/or a rhinovirus.
- binding molecule of embodiment 20 or 21, wherein the secondary virus is selected from human adenovirus, human boca virus (HBoV), and/or human coronavirus (HCoV).
- the secondary virus is a coronavirus selected from SARS-CoV, MERS-CoV, coronavirus 229E, coronavirus OC43, coronavirus NL63, coronavirus HKU1 , coronavirus NL, and/or coronavirus NH.
- the secondary virus is a coronavirus selected from SARS-CoV, MERS-CoV, coronavirus 229E, coronavirus OC43, coronavirus NL63, coronavirus HKU1 , coronavirus NL, and/or coronavirus NH.
- binding molecule of any of embodiments 20-23, wherein the secondary virus is selected from influenza group A, influenza group B, human parainfluenza virus 2 (HPIV2), HPIV4, human rhinovirus (HRV)A, HRVB, and/or HRVC.
- a binding molecule including a binding fragment of any of embodiments 1-8 and a binding fragment that activates an immune cell.
- binding molecule of embodiment 26, wherein the binding fragment that activates an immune cell binds CD3, CD28, or 4-1 BB.
- binding molecule of embodiment 26 or 27, wherein the binding fragment that activates an immune cell includes the CDRs of OKT3 or TGN1412.
- compositions including an antibody or binding fragment of any of embodiments 1-28 and a pharmaceutically acceptable carrier.
- composition of any of embodiments 29-31, wherein the pharmaceutically-acceptable carrier includes sodium chloride, potassium chloride and calcium chloride.
- composition of any of embodiments 29-32, wherein the pharmaceutically-acceptable carrier includes sodium bicarbonate or sodium lactate.
- a method of providing an anti-viral effect in a subject in need thereof including administering a therapeutically effective amount of the composition of any of embodiments 29-38 to the subject thereby providing the anti-viral effect.
- anti-viral effect includes an anti-HPIV3 effect, an anti-HPIV1 effect, an anti- respiratory syncytial virus (RSV) effect, and/or an anti- human metapneumovirus (HMPV) effect.
- RSV respiratory syncytial virus
- HMPV human metapneumovirus
- anti-viral effect includes an anti-HPIV effect, an anti-RSV effect and an anti-HMPV effect.
- HCT hematopoietic stem cell transplant
- COPD chronic obstructive pulmonary disease
- the secondary virus is selected from an adenovirus, a boca virus, a coronavirus, an enterovirus, an influenza virus, a metapneumovirus, a parainfluenza virus, and/or a rhinovirus.
- invention 48 The method of embodiment 46 or 47, wherein the secondary virus is selected from human adenovirus, human boca virus (HBoV), and/or human coronavirus (HCoV).
- the secondary virus is selected from human adenovirus, human boca virus (HBoV), and/or human coronavirus (HCoV).
- the secondary virus is a coronavirus selected from SARS-CoV, MERS-CoV, coronavirus 229E, coronavirus OC43, coronavirus NL63, coronavirus HKU1, coronavirus NL, and/or coronavirus NH.
- the secondary virus is selected from influenza group A, influenza group B, human parainfluenza virus 2 (HPIV2), HPIV4, human rhinovirus (HRV)A, HRVB, and/or HRVC.
- HPIV3 is a common cause of respiratory illness in infants and children. Over 11,000 hospitalizations per year in the US occur for fever or acute respiratory illness due to HPIV3.
- HPIV3 is also an important cause of mortality, morbidity, and health care costs in other vulnerable populations, particularly immunocompromised hematopoietic stem cell transplant (HCT) recipients. Up to a third of HCT recipients acquire a respiratory viral infection within six months of transplant.
- HCT immunocompromised hematopoietic stem cell transplant
- HPIV3 is an important cause of serious respiratory viral infections after HCT with an incidence of 18% post-transplant at some centers. In the absence of any vaccine or therapy, there is significant need for preventive and therapeutic interventions against HPIV3.
- the monoclonal antibody palivizumab is a humanized antibody targeting the Fusion (F) protein of RSV and was licensed for use as immunoprophylaxis to prevent severe disease in high-risk infants.
- the F protein of RSV is an essential surface glycoprotein and therefore a major neutralizing antibody target.
- F mediates viral entry by transitioning between a metastable prefusion (preF) conformation and a stable postfusion (postF) conformation. Since preF is the major conformation on infectious virus, antibodies to preF are potent at neutralizing virus, whereas antibodies targeting postF generally are not (Ngwuta, et al.
- HPIV3-specific B cells within the human B cell repertoire.
- the HPIV3 F protein was biotinylated in either the prefusion (preF) and postfusion (postF) conformation and mixed each with fluorochrome-labeled streptavidin.
- HPIV3 preF- and postF-specific B cells were then enriched for using magnetic microbeads conjugated to antibodies targeting the fluorochrome.
- Vaccination of animals with the preF conformation of HPIV3 F was previously found to elicit much higher neutralizing titers than postF (Stewart-Jones, et al. Proc Natl Acad Sci U S A 115, 12265-12270, (2016)).
- the assay was modified to sort individual B cells onto irradiated CD40L/IL2/IL21 -expressing 3T3 feeder cells.
- the stimulation of antibody secretion enabled higher-throughput screening of culture supernatants for neutralization prior to antibody cloning.
- over half of sorted B cells produced detectable antibody by ELISA (FIG 3A).
- This assay was applied to stimulate single HPIV3 preF-specific B cells and exclude IgD-expressing cells since these cells would be the least likely to have undergone the somatic hypermutation and affinity maturation necessary for potent neutralization.
- 14% of IgD- HPIV3 pre-F-specific B cells sorted from tonsils produced HPIV3 neutralizing antibodies as compared to 5% from the spleen and 2 % from peripheral blood (2%) (FIG 3B).
- This antigenic site is referred to as 0 on HPIV3 preF for consistency since the apices of RSV and HMPV preF are called antigenic site 0 (McLellan, etal. Science 340, 1113-1117, (2013); Battles, et al. Nat Commun 8, 1528, (2017)).
- PI3-E12 appeared to bind the HPIV3 preF apical antigenic site 0 differently than the previously described PIA174, negative stain electron microscopy of PI3-E12 in complex with HPIV3 preF and crystallization of PI3-E12 alone was performed. Negative stain electron microscopy (nsEM) was used to obtain a low-resolution 3D reconstruction of PI3-E12 F ab in complex with HPIV3 preF. As predicted earlier, the PI3-E12 F ab bound in a 1 :1 ratio (F ab Trimer) at the apex of HPIV3 preF.
- PI3-E12 F ab appears to bind HPIV3 preF with a different angle of approach compared to PIA174 (FIGs 4A & 4B).
- a 2.1 A structure of PI3-E12 F ab using X-ray crystallography was obtained (FIGs. 4B & 4C & Table 3).
- HPIV3 preF apical antigenic site 0 is a common target of neutralizing antibodies that can be accessed by antibodies using different gene segments and with different angles of approach.
- Wild-type rHPIV3 was a recombinant version of strain JS (GenBank accession number Z11575) and modified as previously described to express enhanced GFP. Liu, et al. PLoS One 15, e0228572, (2020). Virus was cultured on LLC-MK2 cells and subsequently purified by centrifugation in a discontinuous 30%/60% sucrose gradient with 0.05 M HEPES and 0.1 M MgS0 4 (Sigma-Aldrich) at 120,000 c g for 90 min at4°C.
- Virus titers were determined by infecting Vero cell monolayers in 24-well plates with serial 10-fold dilutions of virus, overlaying with DMEM containing 4% methylcellulose (Sigma-Aldrich), and counting fluorescent plaques using a Typhoon scanner at five days post-infection (GE Life Sciences).
- the clarified supernatant was incubated with Ni Sepharose beads overnight at 4°C, followed by washing with wash buffer containing 50 mM Tris, 300 mM NaCI, and 8 mM imidazole. His-tagged protein was eluted with an elution buffer containing 25 mM Tris, 150 mM NaCI, and 500 mM imidazole. The purified protein was run over a 10/300 Superose 6 size-exclusion column (GE Life Sciences). Fractions containing the trimeric HPIV3 F proteins were pooled and concentrated by centrifugation in an Amicon ultrafiltration unit (Millipore) with a 50 kDa molecular weight cut-off.
- Amicon ultrafiltration unit Amicon ultrafiltration unit
- APC tetramers were next added at a final concentration of 5 nM and incubated on ice for 25 min, followed by a 10-mL wash with ice-cold FACS buffer.
- 50 pL of both anti-APC-conjugated microbeads (Miltenyi Biotec) were added and incubated on ice for 30 min.
- 3 mL of FACS buffer was then added and the mixture was passed over a magnetized LS column (Miltenyi Biotec). The column was washed once with 5 mL ice-cold FACS buffer and then removed from the magnetic field. 5 mL ice-cold FACS buffer was pushed through the unmagnetized column twice using a plunger to elute the bound cell fraction.
- Flow cytometry Cells were incubated in 50 pL of FACS buffer containing a cocktail of antibodies for 30 minutes on ice prior to washing and analysis on a FACS Aria (BD).
- Antibodies included anti-lgM FITC (G20-127, BD), anti-CD19 BUV395 (SJ25C1 , BD), anti-CD3 BV711 (UCHT1 , BD), anti-CD14 BV711 (MOP-9, BD), anti-CD16 BV711 (3G8, BD), anti-CD20 BUV737 (2H7, BD), anti-lgD BV605 (IA6-2, BD), and a fixable viability dye (FV).
- B cells were individually sorted into either 1) empty 96-well PCR plates and immediately frozen or 2) into flat-bottom 96 well plates containing feeder cells that had been seeded at a density of 28,600 cells/well one day prior in 100 pl_ of IMDM media (Gibco) containing 10% fetal calf serum, 100 U/ml penicillin plus 100 pg/ml streptomycin, and 2.5 pg/mL amphotericin.
- IMDM media Gibco
- ELISA ELISA.
- Nunc maxsorp 96-well plates (Thermo Fisher) were coated with 100 ng of goat anti-human F ab (Jackson ImmunoResearch) for 90 minutes at 4°C.
- Wells were washed three times with PBS and then blocked with PBS containing 1% bovine serum albumin (Sigma-Aldrich) for one hour at room temperature.
- Antigen coated plates were incubated with culture supernatants for 90 minutes at 4°C. A standard curve was generated with serial two-fold dilutions of palivizumab.
- Neutralization assays For neutralization screening of culture supernatants, Vero cells were seeded in 96-well flat bottom plates and cultured for 48 hours. After 13 days of culture, 40 pL of culture supernatant was mixed with 25 pL of sucrose purified GFP-HPIV3 diluted to 2,000 plaque forming units (pfu)/mL for one hour at 37°C. Vero cells were incubated with 50 pL of the supernatant/virus mixture for one hour at 37°C to allow viral adsorption. Each well was then overlaid with 100 pL DMEM containing 4% methylcellulose. Fluorescent plaques were counted at five days post-infection using a Typhoon imager.
- HPIV3-specific monoclonal antibodies were determined by a 60% plaque reduction neutralization test (PRNTeo). Vero cells were seeded in 24-well plates and cultured for 48 hours. Monoclonal antibodies were serially diluted 1 :4 in 120 pL DMEM and mixed with 120 pL of sucrose purified HPIV3 diluted to 2,000 pfu/mL for one hour at 37°C. Vero cells were incubated with 100 pL of the antibody/virus mixture for one hour at 37°C to allow viral adsorption. Each well was then overlaid with 500 pL DMEM containing 4% methylcellulose. Fluorescent plaques were counted at five days post-infection using a Typhoon imager. PRNTeo titers were calculated by linear regression analysis.
- 3 pl_ RT reaction mix consisting of 3 mI_ 50 mM random hexamers (Thermo Fisher), 0.8 mI_ of 25 mM deoxyribonucleotide triphosphates (dNTPs; Thermo Fisher), 1 mI_ (20 U) Superscript IV RT, 0.5 mI_ (20 U) RNaseOUT (Thermo Fisher), 0.6 mI_ of 10% Igepal (Sigma- Aldrich), and 15 mI_ RNase free water was added to each well containing a single sorted B cell and incubated at 50°C for 1 hour.
- mI_ of cDNA was added to 19 mI PCR reaction mix so that the final reaction contained 0.2 mI_ (0.5 U) HotStarTaq Polymerase (Qiagen), 0.075 mI_ of 50 mM 3' reverse primers, 0.115 mI_ of 50 mM 5' forward primers, 0.24 mI_ of 25 mM dNTPs, 1.9 mI_ of 10X buffer (Qiagen), and 16.5 mI_ of water.
- the PCR program was 50 cycles of 94°C for 30 s, 57°C for 30 s, and 72°C for 55 s followed by 72°C for 10 min for heavy and kappa light chains.
- the PCR program was 50 cycles of 94°C for 30 s, 60°C for 30 s, and 72°C for 55 s followed by 72°C for 10 min for lambda light chains.
- 2 mI_ of the PCR product was added to 19 pL of the second-round PCR reaction so that the final reaction contained 0.2 mI_ (0.5 U) HotStarTaq Polymerase, 0.075 mI_ of 50 mM 3' reverse primers, 0.075 mI_ of 50 mM 5' forward primers, 0.24 mI_ of 25 mM dNTPs, 1.9 mI_ 10X buffer, and 16.5 mI_ of water.
- PCR programs were the same as the first round of PCR. 4 mI_ of the PCR product was run on an agarose gel to confirm the presence of a 500-bp heavy chain band or 450-bp light chain band. 5 mI_ from the PCR reactions showing the presence of heavy or light chain amplicons was mixed with 2 mI_ of ExoSAP-IT (Thermo Fisher) and incubated at 37°C for 15 min followed by 80°C for 15 min to hydrolyze excess primers and nucleotides. Hydrolyzed second-round PCR products were sequenced by Genewiz with the respective reverse primer used in the 2 nd round PCR, and sequences were analyzed using IMGT/V-Quest to identify V, D, and J gene segments.
- ExoSAP-IT Thermo Fisher
- Paired heavy chain VDJ and light chain VJ sequences were cloned into pTT3-derived expression vectors containing the human lgG1 , IgK, or IgL constant regions using In-Fusion cloning (Clontech) as described in McGuire, et al. Nat Commun 7, 10618, (2016).
- Antibodies were eluted with IgG Elution Buffer (Thermo Scientific) into a neutralization buffer containing 1 M Tris-base pH 9.0. Purified antibody was concentrated and buffer exchanged into DBPS using an Amicon ultrafiltration unit with a 50 kDa molecular weight cut-off.
- the maximum response was determined by averaging the nanometer shift over the last 5 s of the association step after subtracting the background signal from each analyte-containing well using a negative control monoclonal antibody at each time point. Curve fitting was performed using a 1:1 binding model and ForteBio data analysis software.
- penta- His capture sensors (ForteBio) were loaded in kinetics buffer containing 1 mM His-tagged HPIV3 F for 300 s. After loading the baseline signal was recorded for 30 s in kinetics buffer. The sensors were then immersed for 300 s in kinetics buffer containing 40 pg/mL of the first antibody followed by immersion for another 300 s in kinetics buffer containing 40 pg/mL of the second antibody. Percent competition was determined by dividing the maximum increase in signal of the second antibody in the presence of the first antibody by the maximum signal of the second antibody alone.
- HEp-2 cells were seeded into 96-well plates at a density of 50,000 cells/well one day prior to fixation with 50% acetone and 50% methanol for 10 minutes at -20°C. Cells were then permeabilized and blocked with PBS containing 1% triton (Sigma-Aldrich) and 1% bovine serum albumin for 30 minutes at room temperature. 100 mI_ of each monoclonal antibody at 0.1 mg/ml_ was added for 30 min at room temperature. The 2F5 positive control was obtained from the NIH AIDS Reagent Program.
- PI3-E12 F ab was produced by incubating each 10 mg of IgG with 10 pg of LysC (New England Biolabs) overnight at 37°C followed by incubating with protein A for 1 hour at room temperature. The mixture was then centrifuged through a PVDF filter, concentrated in PBS with a 30 kDa Amicon Ultra size exclusion column, and purified further by size exclusion chromatography using Superdex 200 (GE Healthcare Life Sciences) in 5 mM Hepes and 150 mM NaCI.
- Crystals of PI3-E12 F ab were obtained using a NT8 dispensing robot (Formulatrix), and screening was done using commercially available screens (Rigaku Wizard Precipitant Synergy block #2, Molecular Dimensions Proplex screen HT-96, Hampton Research Crystal Screen HT) by mixing 0.1 m1_/0.1 pL (protein/reservoir) by the vapor diffusion method. Crystals used for diffraction data were grown in the following conditions in solution containing 0.2 M ammonium phosphate monobasic, 0.1 M Tris, pH 8.5, and 50% (+/-) 2-methyl-2,4-pentanediol. Crystals were cryoprotected in Parabar Oil (Hampton).
- Crystal diffracted to 2.1 A (Table 3). Data was collected on the Fred Hutch X-ray home source and processed using HKL2000 55 . The structure was solved by molecular replacement using Phaser in CCP4 (Collaborative Computational Project, Number 4) and PDB accession number 6MJZ for HPIV3 preF as a search model. Stewart-Jones, et al. Proc Natl Acad Sci U S A 115, 12265-12270, (2016); Collaborative Computational Project, N. The CCP4 suite: programs for protein crystallography. Acta Crystallogr D Biol Crystallogr 50, 760-763, (1994).
- Lung and nose homogenates were clarified by centrifugation in EMEM (Gibco).
- Confluent HEp-2 monolayers were inoculated in duplicate with diluted homogenates in 24-well plates. After incubating for two hours at 37°C, wells were overlaid with 0.75% methylcellulose. After four days, the cells were fixed and stained with 0.1% crystal violet for one hour, and plaques were counted to determine titers as pfu per gram of tissue. Histopathology was performed by inflating dissected lungs with 10% formalin, immersing in 10% formalin, embedding in paraffin, sectioning, and staining with hematoxylin and eosin. Slides were scored blind on a 0-4 severity scale.
- amino acid changes in the protein variants disclosed herein are conservative amino acid changes, i.e. , substitutions of similarly charged or uncharged amino acids.
- a conservative amino acid change involves substitution of one of a family of amino acids which are related in their side chains.
- Naturally occurring amino acids are generally divided into conservative substitution families as follows: Group 1: Alanine (Ala), Glycine (Gly), Serine (Ser), and Threonine (Thr); Group 2: (acidic): Aspartic acid (Asp), and Glutamic acid (Glu); Group 3: (acidic; also classified as polar, negatively charged residues and their amides): Asparagine (Asn), Glutamine (Gin), Asp, and Glu; Group 4: Gin and Asn; Group 5: (basic; also classified as polar, positively charged residues): Arginine (Arg), Lysine (Lys), and Histidine (His); Group 6 (large aliphatic, nonpolar residues): Isoleucine (lie), Leucine (Leu), Methionine (Met), Valine (Val) and Cysteine (Cys); Group 7 (uncharged polar): Tyrosine (Tyr), Gly, Asn, Gin, Cys, Ser, and Thr; Group 8
- the hydropathic index of amino acids may be considered.
- the importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte and Doolittle, 1982, J. Mol. Biol. 157(1), 105-32). Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics (Kyte and Doolittle, 1982).
- amino acid substitutions may be based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
- variants of gene sequences can include codon optimized variants, sequence polymorphisms, splice variants, and/or mutations that do not affect the function of an encoded product to a statisti cally-significant degree.
- Variants of the protein, nucleic acid, and gene sequences disclosed herein also include sequences with at least 70% sequence identity, 80% sequence identity, 85% sequence, 90% sequence identity, 95% sequence identity, 96% sequence identity, 97% sequence identity, 98% sequence identity, or 99% sequence identity to the protein, nucleic acid, or gene sequences disclosed herein.
- % sequence identity refers to a relationship between two or more sequences, as determined by comparing the sequences.
- identity also means the degree of sequence relatedness between protein, nucleic acid, or gene sequences as determined by the match between strings of such sequences.
- Identity (often referred to as “similarity") can be readily calculated by known methods, including those described in: Computational Molecular Biology (Lesk, A. M., ed.) Oxford University Press, NY (1988); Biocomputing: Informatics and Genome Projects (Smith, D. W., ed.) Academic Press, NY (1994); Computer Analysis of Sequence Data, Part I (Griffin, A. M., and Griffin, H.
- Variants also include nucleic acid molecules that hybridizes under stringent hybridization conditions to a sequence disclosed herein and provide the same function as the reference sequence.
- Exemplary stringent hybridization conditions include an overnight incubation at 42 °C in a solution including 50% formamide, 5XSSC (750 mM NaCI, 75 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5XDenhardt's solution, 10% dextran sulfate, and 20 pg/ml denatured, sheared salmon sperm DNA, followed by washing the filters in 0.1XSSC at 50 °C.
- 5XSSC 750 mM NaCI, 75 mM trisodium citrate
- 50 mM sodium phosphate pH 7.6
- 5XDenhardt's solution 10% dextran sulfate
- 20 pg/ml denatured, sheared salmon sperm DNA followed by washing the filters in 0.1XSSC at 50 °C
- Changes in the stringency of hybridization and signal detection are primarily accomplished through the manipulation of formamide concentration (lower percentages of formamide result in lowered stringency); salt conditions, or temperature.
- washes performed following stringent hybridization can be done at higher salt concentrations (e.g. 5XSSC).
- Variations in the above conditions may be accomplished through the inclusion and/or substitution of alternate blocking reagents used to suppress background in hybridization experiments.
- Typical blocking reagents include Denhardt's reagent, BLOTTO, heparin, denatured salmon sperm DNA, and commercially available proprietary formulations.
- the inclusion of specific blocking reagents may require modification of the hybridization conditions described above, due to problems with compatibility.
- binds refers to an association of a binding fragment (of, for example, a binding fragment) to its cognate binding molecule with an affinity or Ka (i.e., an equilibrium association constant of a particular binding interaction with units of 1/M) equal to or greater than 10 5 M 1 , while not significantly associating with any other molecules or components in a relevant environment sample. “Specifically binds” is also referred to as “binds” herein. Binding fragments may be classified as "high affinity” or "low affinity”.
- high affinity binding fragments refer to those binding fragments with a Ka of at least 10 7 M 1 , at least 10 8 M 1 , at least 10 9 M 1 , at least 10 10 M 1 , at least 10 11 M 1 , at least 10 12 M 1 , or at least 10 13 M 1 .
- low affinity binding fragments refer to those binding fragments with a Ka of up to 10 7 M 1 , up to 10 ® M 1 , up to 10 5 M 1 .
- affinity may be defined as an equilibrium dissociation constant (Kd) of a particular binding interaction with units of M (e.g., 10 -5 M to 10 -13 M).
- a binding fragment may have "enhanced affinity," which refers to a selected or engineered binding fragments with stronger binding to a cognate binding molecule than a wild type (or parent) binding fragment.
- enhanced affinity may be due to a Ka (equilibrium association constant) for the cognate binding molecule that is higher than the reference binding fragment or due to a Kd (dissociation constant) for the cognate binding molecule that is less than that of the reference binding fragment, or due to an off-rate (Koff) for the cognate binding molecule that is less than that of the reference binding fragment.
- assays are known for detecting binding fragments that specifically bind a particular cognate binding molecule as well as determining binding affinities, such as Western blot, ELISA, and BIACORE® analysis (see also, e.g., Scatchard, et al., 1949, Ann. N.Y. Acad. Sci. 51:660; and US 5,283,173, US 5,468,614, or the equivalent).
- each embodiment disclosed herein can comprise, consist essentially of or consist of its particular stated element, step, ingredient or component.
- the terms “include” or “including” should be interpreted to recite: “comprise, consist of, or consist essentially of.”
- the transition term “comprise” or “comprises” means has, but is not limited to, and allows for the inclusion of unspecified elements, steps, ingredients, or components, even in major amounts.
- the transitional phrase “consisting of” excludes any element, step, ingredient or component not specified.
- the transition phrase “consisting essentially of” limits the scope of the embodiment to the specified elements, steps, ingredients or components and to those that do not materially affect the embodiment. A material effect would cause a statistically significant reduction in binding between a disclosed antibody and its viral epitope.
- the term “about” has the meaning reasonably ascribed to it by a person skilled in the art when used in conjunction with a stated numerical value or range, i.e. denoting somewhat more or somewhat less than the stated value or range, to within a range of ⁇ 20% of the stated value; ⁇ 19% of the stated value; ⁇ 18% of the stated value; ⁇ 17% of the stated value; ⁇ 16% of the stated value; ⁇ 15% of the stated value; ⁇ 14% of the stated value; ⁇ 13% of the stated value; ⁇ 12% of the stated value; ⁇ 11% of the stated value; ⁇ 10% of the stated value; ⁇ 9% of the stated value; ⁇ 8% of the stated value; ⁇ 7% of the stated value; ⁇ 6% of the stated value; ⁇ 5% of the stated value; ⁇ 4% of the stated value; ⁇ 3% of the stated value; ⁇ 2% of the stated value; or ⁇ 1% of the stated value.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- General Chemical & Material Sciences (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Communicable Diseases (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pulmonology (AREA)
- Medicinal Preparation (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020237032306A KR20230148418A (ko) | 2021-02-26 | 2022-02-25 | 호흡기 바이러스 감염에 대한 보호 항체 |
| CA3209869A CA3209869A1 (en) | 2021-02-26 | 2022-02-25 | Protective antibodies against respiratory viral infections |
| EP22760503.7A EP4297780A4 (en) | 2021-02-26 | 2022-02-25 | PROTECTIVE ANTIBODIES AGAINST RESPIRATORY VIRAL INFECTIONS |
| US18/548,017 US20240150444A1 (en) | 2021-02-26 | 2022-02-25 | Protective antibodies against respiratory viral infections |
| AU2022227761A AU2022227761A1 (en) | 2021-02-26 | 2022-02-25 | Protective antibodies against respiratory viral infections |
| JP2023552013A JP2024507948A (ja) | 2021-02-26 | 2022-02-25 | 呼吸器ウイルス感染症に対する防御抗体 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163154166P | 2021-02-26 | 2021-02-26 | |
| US63/154,166 | 2021-02-26 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022183018A1 true WO2022183018A1 (en) | 2022-09-01 |
Family
ID=83048466
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/017945 Ceased WO2022183018A1 (en) | 2021-02-26 | 2022-02-25 | Protective antibodies against respiratory viral infections |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US20240150444A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4297780A4 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2024507948A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20230148418A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2022227761A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3209869A1 (cg-RX-API-DMAC7.html) |
| WO (1) | WO2022183018A1 (cg-RX-API-DMAC7.html) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024050371A1 (en) * | 2022-08-29 | 2024-03-07 | Fred Hutchinson Cancer Center | Antibodies with novel fc modification combinations that increase antibody function |
| US12006366B2 (en) | 2020-06-11 | 2024-06-11 | Provention Bio, Inc. | Methods and compositions for preventing type 1 diabetes |
| WO2024077268A3 (en) * | 2022-10-07 | 2024-06-27 | Fred Hutchinson Cancer Center | Human metapneumovirus antibodies and uses thereof |
| WO2025165833A1 (en) * | 2024-01-29 | 2025-08-07 | Vanderbilt University | Hpiv3-neutralizing antibodies and methods of use thereof |
| US12565529B2 (en) | 2021-05-24 | 2026-03-03 | Provention Bio, Inc. | Methods for treating type 1 diabetes |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN119039429B (zh) * | 2024-08-27 | 2025-10-03 | 浙江大学 | 一种抗RBD单链抗体No.35及制备抗体偶联药物的用途 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2011066389A1 (en) * | 2009-11-24 | 2011-06-03 | Medimmmune, Limited | Targeted binding agents against b7-h1 |
| US20140037648A1 (en) * | 2012-03-20 | 2014-02-06 | Humabs Biomed Sa | Antibodies that neutralize rsv, mpv and pvm and uses thereof |
| US20140322218A1 (en) * | 2013-01-25 | 2014-10-30 | Amgen Research (Munich) Gmbh | Antibody Constructs for CDH19 and CD3 |
| US20200392225A1 (en) * | 2019-06-12 | 2020-12-17 | Novartis Ag | Natriuretic peptide receptor 1 antibodies and methods of use |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110035771B (zh) * | 2016-10-21 | 2024-03-08 | 阿迪马布有限责任公司 | 抗呼吸道合胞病毒抗体及其产生和使用方法 |
| WO2019165019A1 (en) * | 2018-02-21 | 2019-08-29 | Vanderbilt University | Antibodies to human respiratory syncytial virus protein f pre-fusion conformation and methods of use therefor |
-
2022
- 2022-02-25 JP JP2023552013A patent/JP2024507948A/ja active Pending
- 2022-02-25 KR KR1020237032306A patent/KR20230148418A/ko active Pending
- 2022-02-25 US US18/548,017 patent/US20240150444A1/en active Pending
- 2022-02-25 CA CA3209869A patent/CA3209869A1/en active Pending
- 2022-02-25 WO PCT/US2022/017945 patent/WO2022183018A1/en not_active Ceased
- 2022-02-25 EP EP22760503.7A patent/EP4297780A4/en active Pending
- 2022-02-25 AU AU2022227761A patent/AU2022227761A1/en active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2011066389A1 (en) * | 2009-11-24 | 2011-06-03 | Medimmmune, Limited | Targeted binding agents against b7-h1 |
| US20140037648A1 (en) * | 2012-03-20 | 2014-02-06 | Humabs Biomed Sa | Antibodies that neutralize rsv, mpv and pvm and uses thereof |
| US20140322218A1 (en) * | 2013-01-25 | 2014-10-30 | Amgen Research (Munich) Gmbh | Antibody Constructs for CDH19 and CD3 |
| US20200392225A1 (en) * | 2019-06-12 | 2020-12-17 | Novartis Ag | Natriuretic peptide receptor 1 antibodies and methods of use |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP4297780A4 * |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12006366B2 (en) | 2020-06-11 | 2024-06-11 | Provention Bio, Inc. | Methods and compositions for preventing type 1 diabetes |
| US12565529B2 (en) | 2021-05-24 | 2026-03-03 | Provention Bio, Inc. | Methods for treating type 1 diabetes |
| WO2024050371A1 (en) * | 2022-08-29 | 2024-03-07 | Fred Hutchinson Cancer Center | Antibodies with novel fc modification combinations that increase antibody function |
| WO2024077268A3 (en) * | 2022-10-07 | 2024-06-27 | Fred Hutchinson Cancer Center | Human metapneumovirus antibodies and uses thereof |
| WO2025165833A1 (en) * | 2024-01-29 | 2025-08-07 | Vanderbilt University | Hpiv3-neutralizing antibodies and methods of use thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2024507948A (ja) | 2024-02-21 |
| KR20230148418A (ko) | 2023-10-24 |
| CA3209869A1 (en) | 2022-09-01 |
| US20240150444A1 (en) | 2024-05-09 |
| AU2022227761A9 (en) | 2024-01-25 |
| EP4297780A1 (en) | 2024-01-03 |
| EP4297780A4 (en) | 2025-07-16 |
| AU2022227761A1 (en) | 2023-09-28 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240150444A1 (en) | Protective antibodies against respiratory viral infections | |
| US11479599B2 (en) | Antibodies against SARS-CoV-2 and methods of using the same | |
| WO2021203053A1 (en) | Immunotherapy targeting a conserved region in sars coronaviruses | |
| US20230331824A1 (en) | Single-domain antibodies that bind sars-cov-2 | |
| US20240043507A1 (en) | Antibodies | |
| CA3175533A1 (en) | Antibodies against sars-cov-2 and methods of using the same | |
| WO2021247925A1 (en) | Structure-guided immunotherapy against sars-cov-2 | |
| EP4230650B1 (en) | Antibodies capable of binding to the spike protein of coronavirus sars-cov-2 | |
| WO2018209125A1 (en) | Epstein barr virus antibodies, vaccines, and uses of the same | |
| US20250188154A1 (en) | Coronavirus antibodies and uses thereof | |
| CA3180477A1 (en) | Antibody therapies for sars-cov-2 infection | |
| GB2614651A (en) | Antibodies | |
| US20250066455A1 (en) | Neutralising antibodies and uses thereof | |
| EP4687973A1 (en) | Combined antibodies against sarbecoviruses and uses thereof | |
| TW202204395A (zh) | 抗sars-cov-2之抗體及使用其之方法 | |
| US20250382354A1 (en) | Cross-specific antibodies, uses and methods for discovery thereof | |
| US20250304657A1 (en) | Antibodies with novel fc modification combinations that increase antibody function | |
| WO2024211789A1 (en) | Cross-flavivirus binding domains and uses thereof | |
| WO2024068996A1 (en) | Anti-sars-cov-2 antibodies and use thereof in the treatment of sars-cov-2 infection | |
| HK40098138B (en) | Antibodies capable of binding to the spike protein of coronavirus sars-cov-2 | |
| HK40098138A (en) | Antibodies capable of binding to the spike protein of coronavirus sars-cov-2 | |
| WO2025255258A2 (en) | Antibodies targeting gii genotypes of human norovirus | |
| WO2025222144A1 (en) | Antibodies and vaccines having vh3-21 and vl1-40 binding domains and uses thereof | |
| CA3234598A1 (en) | Butyrophilin (btn) 3a activating antibodies for use in methods for treating infectious disorders |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22760503 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023552013 Country of ref document: JP Ref document number: 3209869 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022227761 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 20237032306 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020237032306 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022760503 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022227761 Country of ref document: AU Date of ref document: 20220225 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2022760503 Country of ref document: EP Effective date: 20230926 |