WO2022178307A1 - Recombinant rabies viruses for gene therapy - Google Patents

Recombinant rabies viruses for gene therapy Download PDF

Info

Publication number
WO2022178307A1
WO2022178307A1 PCT/US2022/017075 US2022017075W WO2022178307A1 WO 2022178307 A1 WO2022178307 A1 WO 2022178307A1 US 2022017075 W US2022017075 W US 2022017075W WO 2022178307 A1 WO2022178307 A1 WO 2022178307A1
Authority
WO
WIPO (PCT)
Prior art keywords
rabies virus
recombinant
genome
functional variant
deaminase
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/017075
Other languages
English (en)
French (fr)
Inventor
Fei RAN
ChieYu LIN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Beam Therapeutics Inc
Original Assignee
Beam Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Beam Therapeutics Inc filed Critical Beam Therapeutics Inc
Priority to AU2022224054A priority Critical patent/AU2022224054A1/en
Priority to CN202280028643.XA priority patent/CN117321198A/zh
Priority to CA3208612A priority patent/CA3208612A1/en
Priority to EP22713480.6A priority patent/EP4263825A1/en
Priority to JP2023550277A priority patent/JP2024507533A/ja
Priority to KR1020237029781A priority patent/KR20230158476A/ko
Publication of WO2022178307A1 publication Critical patent/WO2022178307A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/66General methods for inserting a gene into a vector to form a recombinant vector using cleavage and ligation; Use of non-functional linkers or adaptors, e.g. linkers containing the sequence for a restriction endonuclease
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/32Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Bacillus (G)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • C12N15/902Stable introduction of foreign DNA into chromosome using homologous recombination
    • C12N15/907Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/12Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
    • C12N9/1241Nucleotidyltransferases (2.7.7)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22Ribonucleases [RNase]; Deoxyribonucleases [DNase]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/78Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y305/00Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
    • C12Y305/04Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in cyclic amidines (3.5.4)
    • C12Y305/04004Adenosine deaminase (3.5.4.4)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y305/00Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
    • C12Y305/04Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in cyclic amidines (3.5.4)
    • C12Y305/04005Cytidine deaminase (3.5.4.5)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/09Fusion polypeptide containing a localisation/targetting motif containing a nuclear localisation signal
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/80Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor
    • C07K2319/81Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor containing a Zn-finger domain for DNA binding
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2320/00Applications; Uses
    • C12N2320/30Special therapeutic applications
    • C12N2320/31Combination therapy
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2330/00Production
    • C12N2330/50Biochemical production, i.e. in a transformed host cell
    • C12N2330/51Specially adapted vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/20011Rhabdoviridae
    • C12N2760/20111Lyssavirus, e.g. rabies virus
    • C12N2760/20121Viruses as such, e.g. new isolates, mutants or their genomic sequences
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/20011Rhabdoviridae
    • C12N2760/20111Lyssavirus, e.g. rabies virus
    • C12N2760/20122New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/20011Rhabdoviridae
    • C12N2760/20111Lyssavirus, e.g. rabies virus
    • C12N2760/20141Use of virus, viral particle or viral elements as a vector
    • C12N2760/20143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/20011Rhabdoviridae
    • C12N2760/20111Lyssavirus, e.g. rabies virus
    • C12N2760/20151Methods of production or purification of viral material
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/20011Rhabdoviridae
    • C12N2760/20111Lyssavirus, e.g. rabies virus
    • C12N2760/20151Methods of production or purification of viral material
    • C12N2760/20152Methods of production or purification of viral material relating to complementing cells and packaging systems for producing virus or viral particles
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2840/00Vectors comprising a special translation-regulating system
    • C12N2840/20Vectors comprising a special translation-regulating system translation of more than one cistron
    • C12N2840/203Vectors comprising a special translation-regulating system translation of more than one cistron having an IRES

Definitions

  • Gene therapies largely involve the use of viral gene delivery systems in order to transduce a cell of interest and express a transgene.
  • Viral systems that are commonly used for gene therapy are derived from viruses and suffer from significant disadvantages.
  • the challenges in using current viral systems include: limited, small packaging capacities; unintended resultant consequences such as genomic integration; limited tissue tropism; preexisting immunity and/or immune responses in the target population, limited ability for redosing; and limited durability due to genome instability, immune clearance, and cellular toxicity.
  • adenoviral vector-mediated gene therapy demonstrates high transduction efficiency and can be used to infect many different cell types, certain disadvantages include non-integration and high immunogenicity.
  • Disadvantages of adeno- associated viral vector-mediated gene therapy include high immunogenicity, and limited packaging capacity.
  • retroviral vector-mediated gene therapy suffers from low transduction efficiency and the inactivation by complement.
  • recombinant viral vectors and recombinant viruses derived from the rabies virus which can be used to transduce a target cell and express a transgene therein.
  • the recombinant rabies vectors and viruses provided by the present disclosure find use as effective viral gene delivery systems. Also provided are viral packaging systems and methods of producing the recombinant viruses described herein.
  • a recombinant rabies virus genome comprising a nucleic acid encoding a therapeutic transgene, wherein: the genome lacks a G gene encoding for a rabies virus glycoprotein or a functional variant thereof; and/or the genome lacks an L gene encoding for a rabies virus polymerase or a functional variant thereof, is provided.
  • the genome lacks a G gene encoding for a rabies virus glycoprotein or a functional variant thereof. In certain exemplary embodiments, the genome lacks a G gene encoding for a rabies virus glycoprotein or a functional variant thereof, and wherein the genome lacks an L gene encoding for a rabies virus polymerase or a functional variant thereof.
  • the genome comprises: an N gene encoding for a rabies virus nucleoprotein or a functional variant thereof; a P gene encoding for a rabies virus phosphoprotein or a functional variant thereof; and an M gene encoding for a rabies virus matrix protein or a functional variant thereof.
  • a recombinant rabies virus particle comprising a rabies virus glycoprotein and a recombinant rabies virus genome as described herein, is provided.
  • a recombinant rabies virus particle comprising: a rabies virus glycoprotein; and a recombinant rabies virus genome comprising a nucleic acid encoding a therapeutic transgene, wherein: the genome lacks a G gene encoding for a rabies virus glycoprotein or a functional variant thereof; and/or the genome lacks an L gene encoding for a rabies virus polymerase or a functional variant thereof, is provided.
  • the genome lacks a G gene encoding for a rabies virus glycoprotein or a functional variant thereof. In certain exemplary embodiments, the genome lacks a G gene encoding for a rabies virus glycoprotein or a functional variant thereof, and wherein the genome lacks an L gene encoding for a rabies virus polymerase or a functional variant thereof.
  • the genome lacks: a G gene encoding for a rabies virus glycoprotein or a functional variant thereof; an L gene encoding for a rabies virus polymerase or a functional variant thereof; and an M gene encoding for a rabies virus matrix protein or a functional variant thereof.
  • the genome lacks: a G gene encoding for a rabies virus glycoprotein or a functional variant thereof; an L gene encoding for a rabies virus polymerase or a functional variant thereof; an M gene encoding for a rabies virus matrix protein or a functional variant thereof; and a P gene encoding for a rabies virus phosphoprotein or a functional variant thereof.
  • the genome lacks: a G gene encoding for a rabies virus glycoprotein or a functional variant thereof; an L gene encoding for a rabies virus polymerase or a functional variant thereof; an M gene encoding for a rabies virus matrix protein or a functional variant thereof; a P gene encoding for a rabies virus phosphoprotein or a functional variant thereof; and an N gene encoding for a rabies virus nucleoprotein or a functional variant thereof.
  • the genome only encodes a therapeutic transgene.
  • the genome comprises: an N gene encoding for a rabies virus nucleoprotein or a functional variant thereof; a P gene encoding for a rabies virus phosphoprotein or a functional variant thereof; and an M gene encoding for a rabies virus matrix protein or a functional variant thereof.
  • the genome lacks: an N gene encoding for a rabies virus nucleoprotein or a functional variant thereof; a P gene encoding for a rabies virus phosphoprotein or a functional variant thereof; and/or an M gene encoding for a rabies virus matrix protein or a functional variant thereof.
  • the recombinant rabies virus is replication incompetent. In other exemplary embodiments, the recombinant rabies virus is replication deficient.
  • each of the genes are operably linked to a transcriptional regulatory element.
  • the transcriptional regulatory element comprises a transcription initiation signal.
  • the transcription initiation signal is exogenous to the rabies virus.
  • the transcription initiation signal is endogenous to the rabies virus.
  • each of the genes are operably linked to a transcription termination polyadenylation signal.
  • the therapeutic transgene comprises a sequence that encodes a nucleic acid editing system or a component thereof.
  • the nucleic acid editing system comprises a Clustered Regulatory Interspaced Short Palindromic Repeat (CRISPR) system, a zinc finger nuclease (ZFN), a meganuclease, and a Transcription Activator-Like Effector-based Nucleases (TALEN).
  • CRISPR Clustered Regulatory Interspaced Short Palindromic Repeat
  • ZFN zinc finger nuclease
  • TALEN Transcription Activator-Like Effector-based Nucleases
  • the nucleic acid editing system comprises a CRISPR system.
  • the CRISPR-system comprises a nucleobase editor comprising a polynucleotide programmable nucleotide binding domain and a nucleobase editing domain.
  • the nucleobase editing domain is an adenosine deaminase, cytidine deaminase, or a functional variant thereof. In certain exemplary embodiments, the nucleobase editing domain is an adenosine deaminase. In certain exemplary embodiments the adenosine deaminase comprises a Tad A deaminase from any of the adenosine base editors recited in Table 10, Table 11, Table 12, Table 13, Table 14, or Table 15.
  • the nucleobase editing domain comprises a adenosine deaminase from any one of the adenosine base editors of: ABE 0.1 , ABE 0.2, ABE 1.1, ABE 1.2, ABE2.1 , ABE2.2, ABE2.3, ABE2.4, ABE2.5, ABE2.6, ABE2.7, ABE2.8, ABE2.9, ABE2.10, ABE2.11, ABE2.12, ABE3.1, ABE3.2, ABE3.3, ABE3.4, ABE3.5, ABE3.6, ABE3.7, ABE3.8, ABE4.1, ABE4.2, ABE4.3, ABE5.1 , ABE5.2, ABE5.3, ABE5.4, ABE5.5, ABE5.6, ABE5.7, ABE5.8, ABE5.9, ABE5.10, ABE5.11, ABE5.12, ABE5.13, ABE5.14, ABE6.1 , ABE6.2, ABE6.3, ABE6.4, ABE6.5, ABE6.6, ABE7.1, ABE7.2, ABE7.3, ABE6.1 , A
  • the nucleobase editing domain comprises a adenosine base editor selected from the group consisting of: ABE 0.1 , ABE 0.2, ABE 1.1, ABE l .2, ABE2.1, ABE2.2, ABE2.3, ABE2.4, ABE2.5, ABE2.6, ABE2.7, ABE2.8, ABE2.9, ABE2.10, ABE2.11, ABE2.12, ABE3.1, ABE3.2, ABE3.3, ABE3.4, ABE3.5, ABE3.6, ABE3.7, ABE3.8, ABE4.1, ABE4.2, ABE4.3, ABE5.1, ABE5.2, ABE5.3, ABE5.4, ABE5.5, ABE5.6, ABE5.7, ABE5.8, ABE5.9, ABE5.10, ABE5.11, ABE5.12, ABE5.13, ABE5.14, ABE6.1, ABE6.2, ABE6.3, ABE6.4, ABE6.5, ABE6.6, ABE7.1, ABE7.2, ABE7.3, ABE7.4, ABE7.5, ABE7.
  • the nucleobase editing domain comprises a cytidine deaminase.
  • the cytidine deaminase is selected from the group consisting of: Petromyzon marinus cytosine deaminase 1 (PmCDAI), Activation-induced cytidine deaminase (AID), and APOBEC.
  • the polynucleotide programmable nucleotide binding domain comprises a Cas9 polypeptide, a Cas12 polypeptide, or a functional variant thereof.
  • the CRISPR-system further comprises a guide RNA (gRNA) or a nucleic acid sequence encoding a gRNA.
  • gRNA guide RNA
  • the therapeutic transgene comprises a sequence encoding a uracil glycosylase inhibitor (UGI).
  • UMI uracil glycosylase inhibitor
  • the therapeutic transgene comprises a sequence encoding a nuclear localization signal (NILS).
  • NILS nuclear localization signal
  • the polynucleotide programmable nucleotide binding domain and/or the nucleobase editing domain further comprises a nuclear localization signal (NLS).
  • NLS nuclear localization signal
  • the cytidine deaminase further comprises a uracil glycosylase inhibitor (UGI).
  • UMI uracil glycosylase inhibitor
  • the therapeutic transgene comprises a therapeutic polypeptide and/or a therapeutic nucleic acid.
  • the therapeutic polypeptide and/or therapeutic nucleic acid is secreted from a cell.
  • the nucleic acid encoding the therapeutic transgene is greater than: about 300 bp, about 400 bp, about 500 bp, about 600 bp, about 700 bp, about 800 bp, about 900 bp, about 1 ,000 bp, about 1 , 100 bp, about 1 ,200 bp, about 1 ,300 bp, about 1,400 bp, about 1,500 bp, about 1,600 bp, about 1,700 bp, about 1,800 bp, about 1 ,900 bp, about 2,000 bp, about 2,100 bp, about 2,200 bp, about 2,300 bp, about 2,400 bp, about 2,500 bp, about 2,600 bp, about 2,700 bp, about 2,800 bp, about 2,900 bp, or about 3,000 bp.
  • the nucleic acid encoding the therapeutic transgene is greater than about 300 bp. In certain exemplary embodiments, the nucleic acid encoding the therapeutic transgene is greater than about 650 bp. In certain exemplary embodiments, the nucleic acid encoding the therapeutic transgene is greater than about 1 ,000 bp. In certain exemplary embodiments, the nucleic acid encoding the therapeutic transgene is greater than about 3,000 bp. In certain exemplary embodiments, the nucleic acid encoding the therapeutic transgene is greater than about 4,500 bp. In certain exemplary embodiments, the nucleic acid encoding the therapeutic transgene is greater than about 8,500 bp. In certain exemplary embodiments, the nucleic acid encoding the therapeutic transgene is greater than about 10,000 bp.
  • the therapeutic transgene is operably linked to a transcriptional regulatory element.
  • the transcriptional regulatory element comprises a transcription initiation signal.
  • the transcription initiation signal is exogenous to the rabies virus.
  • the transcription initiation signal is endogenous to the rabies virus.
  • the therapeutic transgene is operably linked to a transcription termination polyadenylation signal.
  • composition comprising a recombinant virus particle as described herein.
  • a method for expressing a therapeutic transgene in a target cell comprising transducing a target cell with a recombinant virus particle as described herein, is provided.
  • a method for expressing a nucleobase editor in a target cell comprising transducing a target cell with a recombinant rabies virus particle, wherein the recombinant virus particle comprises: a rabies virus glycoprotein; and a recombinant rabies virus genome comprising a nucleic acid encoding a nucleobase editor comprising a polynucleotide programmable nucleotide binding domain and a nucleobase editing domain, wherein: the genome lacks a G gene encoding for a rabies virus glycoprotein or a functional variant thereof; and/or the genome lacks an L gene encoding for a rabies virus polymerase or a functional variant thereof, is provided.
  • the genome further lacks: an M gene encoding for a rabies virus matrix protein or a functional variant thereof.
  • the genome further lacks: an M gene encoding for a rabies virus matrix protein or a functional variant thereof; and a P gene encoding for a rabies virus phosphoprotein or a functional variant thereof.
  • the genome further lacks: an M gene encoding for a rabies virus matrix protein or a functional variant thereof; a P gene encoding for a rabies virus phosphoprotein or a functional variant thereof; and an N gene encoding for a rabies virus nucleoprotein or a functional variant thereof.
  • the genome only encodes a nucleobase editor.
  • the genome comprises: an N gene encoding for a rabies virus nucleoprotein or a functional variant thereof; a P gene encoding for a rabies virus phosphoprotein or a functional variant thereof; and an M gene encoding for a rabies virus matrix protein or a functional variant thereof.
  • each of the genes are operably linked to a transcriptional regulatory element.
  • the transcriptional regulatory element comprises a transcription initiation signal.
  • the transcription initiation signal is exogenous to the rabies virus.
  • the transcription initiation signal is endogenous to the rabies virus.
  • each of the genes are operably linked to a transcription termination polyadenylation signal.
  • the nucleobase editing domain comprises an adenosine deaminase, cytidine deaminase, or a functional variant thereof.
  • the nucleobase editing domain comprises an adenosine deaminase.
  • the adenosine deaminase comprises a Tad A deaminase from any of the adenosine base editors recited in Table 10, Table 11, Table 12, Table 13, Table 14, or Table 15.
  • the nucleobase editing domain comprises a adenosine deaminase from any one of the adenosine base editors of: ABE 0.1 , ABE 0.2, ABE l .1, ABE 1.2, ABE2.1 , ABE2.2, ABE2.3, ABE2.4, ABE2.5, ABE2.6, ABE2.7, ABE2.8, ABE2.9, ABE2.10, ABE2.11, ABE2.12, ABE3.1, ABE3.2, ABE3.3, ABE3.4, ABE3.5, ABE3.6, ABE3.7, ABE3.8, ABE4.1, ABE4.2, ABE4.3, ABE5.1 , ABE5.2, ABE5.3, ABE5.4, ABE5.5, ABE5.6, ABE5.7, ABE5.8, ABE5.9, ABE5.10, ABE5.11, ABE5.12, ABE5.13, ABE5.14, ABE6.1 , ABE6.2, ABE6.3, ABE6.4, ABE6.5, ABE6.6, ABE7.1, ABE7.2, ABE6.1 , ABE6.2
  • the nucleobase editing domain comprises a adenosine base editor selected from the group consisting of: ABE 0.1 , ABE 0.2, ABE 1.1 , ABE l .2, ABE2.1, ABE2.2, ABE2.3, ABE2.4, ABE2.5, ABE2.6, ABE2.7, ABE2.8, ABE2.9, ABE2.10, ABE2.11, ABE2.12, ABE3.1, ABE3.2, ABE3.3, ABE3.4, ABE3.5, ABE3.6, ABE3.7, ABE3.8, ABE4.1, ABE4.2, ABE4.3, ABE5.1, ABE5.2, ABE5.3, ABE5.4, ABE5.5, ABE5.6, ABE5.7, ABE5.8, ABE5.9, ABE5.10, ABE5.11, ABE5.12, ABE5.13, ABE5.14, ABE6.1, ABE6.2, ABE6.3, ABE6.4, ABE6.5, ABE6.6, ABE7.1, ABE7.2, ABE7.3, ABE7.4, ABE7.5, ABE
  • the nucleobase editing domain comprises a adenosine base editor of ABE7.10 or ABE8.20.
  • the nucleobase editing domain is a cytidine deaminase.
  • the cytidine deaminase is selected from the group consisting of: Petromyzon marinus cytosine deaminase 1 (PmCDAI), Activation- induced cytidine deaminase (AID), and APOBEC.
  • the polynucleotide programmable nucleotide binding domain comprises a Cas9 polypeptide, a Cas12 polypeptide, or a functional variant thereof.
  • the recombinant genome further comprises a guide RNA (gRNA).
  • the guide RNA (gRNA) is provided to the target cell exogenously.
  • the gRNA is capable of targeting a genomic locus of the target cell.
  • the target cell is transduced ex vivo.
  • the target cell is a human cell.
  • the target cell is obtained from a human.
  • the target cell is autologous to the human.
  • the target cell is allogeneic to the human.
  • the target cell is transduced in vivo.
  • the target cell is a human cell.
  • the target cell is a neuronal cell, an epithelial cell, or a hepatocyte.
  • the target cell is in a human.
  • a method for delivering a therapeutic transgene to a subject comprising administering to the subject a recombinant virus particle as described herein, or a pharmaceutical composition as described herein, is provided.
  • a method for delivering a nucleobase editor to a subject comprising administering to the subject a recombinant rabies virus particle, wherein the recombinant virus particle comprises: a rabies virus glycoprotein; and a recombinant rabies virus genome comprising a nucleic acid encoding a nucleobase editor comprising a polynucleotide programmable nucleotide binding domain and a nucleobase editing domain, wherein: the genome lacks a G gene encoding for a rabies virus glycoprotein or a functional variant thereof; and/or the genome lacks an L gene encoding for a rabies virus polymerase or a functional variant thereof, is provided.
  • the genome comprises: an N gene encoding for a rabies virus nucleoprotein or a functional variant thereof; a P gene encoding for a rabies virus phosphoprotein or a functional variant thereof; and an M gene encoding for a rabies virus matrix protein or a functional variant thereof.
  • nucleobase editing domain is an adenosine deaminase, cytidine deaminase, or a functional variant thereof.
  • the base editor is an adenosine deaminase.
  • the adenosine deaminase is ABE7.10.
  • the polynucleotide programmable nucleotide binding domain comprises a Cas9 polypeptide, a Cas12 polypeptide, or a functional variant thereof.
  • the recombinant genome further comprises a nucleic acid sequence encoding a guide RNA (gRNA).
  • gRNA guide RNA
  • the guide RNA (gRNA) is provided to the target cell exogenously.
  • the gRNA is capable of targeting a genomic locus of the target cell.
  • the subject is a mammal. In certain exemplary embodiments, the subject is a human.
  • a packaging system for the recombinant preparation of a rabies virus particle wherein the packaging system comprises: an N gene encoding for a rabies virus nucleoprotein or a functional variant thereof; a P gene encoding for a rabies virus phosphoprotein or a functional variant thereof; an L gene encoding for a rabies virus polymerase or a functional variant thereof; and a recombinant rabies virus genome, wherein: the genome lacks a G gene encoding for a rabies virus glycoprotein or a functional variant thereof; and/or the genome lacks an L gene encoding for a rabies virus polymerase or a functional variant thereof, is provided.
  • the recombinant rabies virus genome comprises a nucleic acid encoding a transgene or therapeutic transgene.
  • the recombinant rabies virus genome is comprised within a virus genome vector.
  • the N, P, and L genes are each comprised within a separate vector.
  • each of the N, P, and L genes are operably linked to a transcriptional regulatory element.
  • the transcriptional regulatory element comprises a promoter and/or enhancer.
  • the promoter is a constitutive promoter.
  • the promoter is an elongation factor 1a promoter.
  • the separate vectors are each contained within a separate transfecting plasmid.
  • the N, P, and L genes are comprised within a single vector.
  • the single vector comprises a first expression cassette comprising the N and P genes, and a second expression cassette comprising the L gene.
  • the first expression cassette comprises from 5' to 3': a transcriptional regulatory element; the P gene; and the N gene.
  • the first expression cassette comprises from 5' to 3': a transcriptional regulatory element; the P gene; a ribosomal skipping element; and the N gene.
  • the ribosomal skipping element is an IRES element.
  • the ribosomal skipping element is a 2A element.
  • the second expression cassette comprises from 5' to 3': a transcriptional regulatory element; and the L gene.
  • the transcriptional regulatory element comprises a promoter and/or enhancer.
  • the promoter is a constitutive promoter.
  • the promoter is an elongation factor 1a promoter.
  • the first and the second expression cassettes are in opposite orientations in the vector.
  • the single vector is contained within a single transfecting plasmid.
  • the packaging system further comprises an M gene encoding for a rabies virus matrix protein or a functional variant thereof.
  • the M gene is comprised within a vector.
  • the M gene is operably linked to a transcriptional regulatory element.
  • the transcriptional regulatory element comprises a promoter and/or enhancer.
  • the vector comprising the M gene is contained within a transfecting plasmid.
  • the packaging system further comprises a G gene encoding for a rabies virus glycoprotein or a functional variant thereof.
  • the G gene is comprised within a vector.
  • the G gene is operably linked to a transcriptional regulatory element.
  • the transcriptional regulatory element comprises a promoter and/or enhancer.
  • the vector comprising the G gene is contained within a transfecting plasmid.
  • a method for producing a recombinant rabies virus particle comprising introducing a packaging system as described herein into a cell under conditions operative for enveloping the recombinant rabies virus genome to form the recombinant rabies virus particle, is provided.
  • the introducing is mediated by electroporation, nucleofection, or lipofection.
  • a recombinant rabies virus particle packaging cell comprising a packaging system as described herein, is provided.
  • a recombinant rabies virus particle packaging cell comprising: an N gene encoding for a rabies virus nucleoprotein or a functional variant thereof; a P gene encoding for a rabies virus phosphoprotein or a functional variant thereof; and an L gene encoding for a rabies virus polymerase or a functional variant thereof, is provided.
  • a first expression cassette comprises the N and P genes.
  • the first expression cassette comprises from 5' to 3': a transcriptional regulatory element; the P gene; and the N gene.
  • the first expression cassette comprises from 5' to 3': a transcriptional regulatory element; the P gene; a ribosomal skipping element; and the N gene.
  • the ribosomal skipping element is an IRES element.
  • the ribosomal skipping element is a 2A element.
  • a second expression cassette comprises the L gene.
  • the second expression cassette comprises from 5' to 3': a transcriptional regulatory element; and the L gene.
  • the transcriptional regulatory element comprises a promoter and/or enhancer.
  • the promoter is a constitutive promoter.
  • the promoter is an elongation factor 1a promoter.
  • the first and the second expression cassettes are in opposite orientations in the vector.
  • the recombinant rabies virus particle packaging cell further comprises an M gene encoding for a rabies virus matrix protein and/or a G gene encoding for a rabies virus glycoprotein.
  • the M gene and/or the G gene are operably linked to a transcriptional regulatory element.
  • the transcriptional regulatory element comprises a promoter and/or enhancer.
  • a third expression and/or fourth cassette comprises the rabies virus G gene and/or rabies virus M gene.
  • the packaging cell is of a mammalian, a bacterial, or an insect origin. In certain exemplary embodiments, the packaging cell is selected from the group consisting of a HEK293 cell, a VERO cell, a BHK cell, and a BSR cell.
  • a method for producing a recombinant rabies virus comprising introducing into a packaging cell as described herein, a nucleic acid comprising a recombinant rabies virus genome comprising a nucleic acid comprising a therapeutic transgene, under conditions operative for enclosing the recombinant rabies virus genome in the glycoprotein to form the recombinant rabies virus, wherein: the genome lacks an endogenous G gene encoding for a rabies virus glycoprotein; and the genome lacks an endogenous L gene encoding for a rabies virus polymerase, is provided.
  • the recombinant genome comprises: an N gene encoding for a rabies virus nucleoprotein or a functional variant thereof; a P gene encoding for a rabies virus phosphoprotein or a functional variant thereof; and an M gene encoding for a rabies virus matrix protein or a functional variant thereof.
  • each of the genes are operably linked to a transcriptional regulatory element.
  • the transcriptional regulatory element comprises a transcription initiation signal.
  • the transcription initiation signal is exogenous to the rabies virus.
  • the transcription initiation signal is endogenous to the rabies virus.
  • each of the genes are operably linked to a transcription termination polyadenylation signal.
  • the recombinant rabies virus titer is greater than about 1 E8 TU/mL In certain exemplary embodiments, the recombinant rabies virus titer is from about 1 E8 TU/mL to about 1 E9 TU/mL.
  • a method of treating a disease or disorder in a subject comprising administering a recombinant rabies virus particle as described herein, or a pharmaceutical composition as described herein to the subject, is provided.
  • the disease or disorder is a neurologic disease or disorder.
  • the disease or disorder is an ophthalmic disease or disorder.
  • a recombinant rabies virus as described herein, or a pharmaceutical composition as described herein, in the manufacture of a medicament for treating a disease or disorder in a subject is provided.
  • FIG. 1 is a chart showing relative infectivity on 293T cells from equal volumes of virus- containing supernatant harvested on the indicated days from various stable cell lines.
  • FIG. 2A is a schematic depicting the VIR218 replicon.
  • FIG. 2B is a schematic depicting the production and infection scheme for recombinant rabies virus particle mediated gene delivery.
  • FIG. 2C is a chart depicting that a recombinant rabies virus particle comprising a recombinant rabies virus genome encoding a nucleobase editor can effect gene editing of a target sequence.
  • FIG. 3A is a schematic depicting the organization of a recombinant rabies viral genome comprising a gRNA, polynucleotide programmable nucleotide binding domain, and nucleobase editors.
  • FIG. 3B is a schematic depicting a gRNA - tRNA expression cassette encoding a gRNA between two tRNA sequences with arrows indicating cleavage sites of the RNA.
  • FIG. 3C is a schematic depicting a gRNA -tRNA expression cassette encoding gRNAs (a first gRNA and a second gRNA), wherein the first gRNA is between a first tRNA and a second tRNA, followed by the second gRNA.
  • FIG. 3D is a schematic depicting a gRNA -tRNA expression cassette encoding gRNAs (a first gRNA and a second gRNA), wherein the first gRNA is between a first tRNA and a second tRNA, and the second gRNA is between a second tRNA and a third tRNA.
  • FIG. 3E is a chart depicting % infection and % A>G base editing in HEK cells transduced with a recombinant rabies virus particle comprising a recombinant rabies virus genome encoding a nucleobase editor and gRNAs encoded between multiple tRNAs.
  • the % base editing was measured at a Hek2 site and IEDG site targeted by a Hek2-targeting gRNA and a lEDG-targeting gRNA.
  • FIG. 4A is a schematic depicting a AG, AGL, and AALL (i.e., AGLNPM) rabies virus replicon encoding a Cre recombinase-2A-GFP reporter gene.
  • AALL i.e., AGLNPM
  • FIG. 4B depicts flourescent images of cells transfected with rabies virus vectors in a AG, AGL, or AALL (i.e., AGLNPM) background, each vector encoding a Cre recombinase-2A- GFP reporter gene. Images were taken 6 days post-transfection under a standard transfection and an optimized transfection as depicted in FIG. 2B.
  • AALL i.e., AGLNPM
  • FIG. 4C depicts bar graphs representing % viral entry into reporter cells, as measured by GFP flourescence.
  • FIG. 5 is a chart depicting percent A to G base editing in 293T cells tranduced with RABV having a RABV genome encoding the ABE 8.20 base editor.
  • the base editor gene replaced the G gene in the RABV genome.
  • U6-driven guide RNAs (gRNAs), targeting HEK2 and ABCA4 loci, were transfected in trans into target cells at the time of infection. Multiplicity of infection (MOI) based on functional viral titers is indicated.
  • MOI Multiplicity of infection
  • FIG. 6 depicts two charts depicting percent C to T base editing in 293T cells tranduced with RABV having a RABV genome encoding one of several different base editors.
  • the SynV RABV genome was used.
  • the base editor gene replaced the G gene in the RABV genome.
  • FIG. 7 depicts two charts depicting percent A to G base editing in 293T cells tranduced with RABV having a RABV genome encoding the ABE7.10 base.
  • a SAD B19 AGL RABV genome was used to encode the base editor, where the base editor replaced the G protein within the RABV genome.
  • One set of cells was additionally transfected by a plasmid encoding RABV L protein (virus + L).
  • U6-driven gRNAs, targeting HEK2 and ABCA4 loci were transfected in trans into target cells at the time of infection. MOI based on functional viral titers is indicated.
  • FIG. 8 depicts flourescent images of cells transfected with rabies virus vectors in a DN, DR, DM, and D ⁇ background, each vector encoding a Cre recombinase-2A-GFP reporter gene. Either 293T cells or CE1.30 cells were transfected, with and without complementation of the missing gene. Images were taken 4 days post-insfection.
  • FIG. 9 depicts bar graphs representing % viral entry into reporter cells (293T or CE1.30), as measured by GFP flourescence. Supernantant from the cells transfected in FIG. 8 were used.
  • FIG. 10 depicts graphs representing % viral entry into CE1.30 cells, as measured by GFP and mScarlet flourescence.
  • AGL, AMGL, APMGL, and AALL rabies virus replicons encoding Cre-2a-GFP as a transgene were grown in CE1.30 cells, and titered on reporter cells to show functional delivery of both Cre and GFP mRNA.
  • FIG. 11 depicts flourescent images of cells transfected with rabies virus vectors in a AGL, AMGL, APMGL, and AALL background, each vector encoding a Cre recombinase-2A- GFP reporter gene. Either 293T cells or CE1.30 cells were transfected. Images were taken 3 days post-insfection.
  • FIG. 12 depicts schmeatics of expression vectors used to express RABV genes.
  • Vector VIR069 contains a first expression cassette, from 5' to 3', of an EF1a promoter, the RABV N gene, a 2a ribosomal skipping element, the RABV P gene, a 2a ribosomal skipping element, and the RABV M gene.
  • VIR069 contains a second expression cassette in the reverse orientation to the first expression cassette, from 5' to 3', of an RPBSA promoter and a BFP- zeocin selection marker gene.
  • Vector VIR071 contains a first expression cassette, from 5' to 3', of an EF1a promoter, the RABV N gene, an IRES, the RABV P gene, a 2a ribosomal skipping element, and the RABV M gene.
  • VIR071 contains a second expression cassette in the reverse orientation to the first expression cassette, from 5' to 3', of an RPBSA promoter, the RABV L gene, a 2a ribosomal skipping element, and a zeocin selection marker gene.
  • Vector VIR112 contains a first expression cassette, from 5' to 3', of an EF1a promoter, the RABV N gene, an IRES, the RABV P gene, an IRES, and the RABV M gene.
  • VIR071 contains a second expression cassette in the reverse orientation to the first expression cassette, from 5' to 3', of an RPBSA promoter, the RABV L gene, a 2a ribosomal skipping element, and a zeocin selection marker gene.
  • a recombinant rabies virus genome that comprises a nucleic acid comprising a transgene (e.g., a therapeutic transgene).
  • the recombinant rabies virus genome lacks an endogenous G gene encoding for a rabies virus glycoprotein, and lacks an endogenous L gene encoding for a rabies virus polymerase.
  • methods for producing the recombinant rabies virus particles Such methods generally comprise introducing a packaging system described herein into a suitable packaging cell.
  • adenosine deaminase is meant a polypeptide or fragment thereof capable of catalyzing the hydrolytic deamination of adenine or adenosine.
  • the deaminase or deaminase domain is an adenosine deaminase catalyzing the hydrolytic deamination of adenosine to inosine or deoxy adenosine to deoxyinosine.
  • the adenosine deaminase catalyzes the hydrolytic deamination of adenine or adenosine in deoxyribonucleic acid (DNA).
  • the adenosine deaminases e.g. engineered adenosine deaminases, evolved adenosine deaminases
  • the adenosine deaminases may be from any organism, such as a bacterium.
  • Adenosine Deaminase Base Editor 8 polypeptide or “ABE8” is meant a base editor as defined herein comprising an adenosine deaminase variant comprising an alteration at amino acid position 82 and/or 166 of the following reference sequence: MSEVEFSHEYWMRHALTLAKRARDEREVPVGAVLVLNNRVIGEGWNRAIGLHDPTAHAEI MALRQGGLVMQNYRLIDATLYVTFEPCVMCAGAMIHSRIGRWFGVRNAKTGAAGSLMDV LHYPGMNHRVEITEGILADECAALLCYFFRMPRQVFNAQKKAQSSTD (SEQ ID NO: 8).
  • ABE8 comprises further alterations, as described herein, relative to the reference sequence.
  • ABE8 polynucleotide is meant a polynucleotide encoding an ABE8.
  • administering is referred to herein as providing one or more compositions described herein to a patient or a subject.
  • agent any small molecule chemical compound, antibody, nucleic acid molecule, or polypeptide, or fragments thereof.
  • alteration is meant a change (increase or decrease) in the level, structure, or activity of an analyte, gene or polypeptide as detected by standard art known methods such as those described herein.
  • an alteration includes a 10% change in expression levels, a 25% change, a 40% change, and a 50% or greater change in expression levels.
  • an alteration includes an insertion, deletion, or substitution of a nucleobase or amino acid.
  • ameliorate is meant decrease, suppress, attenuate, diminish, arrest, or stabilize the development or progression of a disease.
  • analog is meant a molecule that is not identical, but has analogous functional or structural features.
  • a polypeptide analog retains the biological activity of a corresponding naturally-occurring polypeptide, while having certain biochemical modifications that enhance the analog's function relative to a naturally occurring polypeptide. Such biochemical modifications could increase the analog's protease resistance, membrane permeability, or half-life, without altering, for example, ligand binding.
  • An analog may include an unnatural amino acid.
  • base editor or “nucleobase editor polypeptide (NBE)” is meant an agent that binds a polynucleotide and has nucleobase modifying activity.
  • the base editor comprises a nucleobase modifying polypeptide (e.g., a deaminase) and a polynucleotide programmable nucleotide binding domain (e.g., Cas9 or Cpf1) in conjunction with a guide polynucleotide (e.g., guide RNA (gRNA)).
  • gRNA guide RNA
  • base editing activity is meant acting to chemically alter a base within a polynucleotide.
  • a first base is converted to a second base.
  • the base editing activity is cytidine deaminase activity, e.g., converting target OG to T ⁇ A.
  • the base editing activity is adenosine or adenine deaminase activity, e.g., converting A ⁇ T to G*C.
  • the base editor (BE) system refers to an intermolecular complex for editing a nucleobase of a target nucleotide sequence.
  • the base editor (BE) system comprises (1) a polynucleotide programmable nucleotide binding domain, a deaminase domain (e.g., cytidine deaminase or adenosine deaminase) for deaminating nucleobases in the target nucleotide sequence; and (2) one or more guide polynucleotides (e.g., guide RNA) in conjunction with the polynucleotide programmable nucleotide binding domain.
  • a deaminase domain e.g., cytidine deaminase or adenosine deaminase
  • guide polynucleotides e.g., guide RNA
  • the base editor (BE) system comprises a nucleobase editor domain selected from an adenosine deaminase ora cytidine deaminase, and a domain having nucleic acid sequence specific binding activity.
  • the base editor system comprises (1) a base editor (BE) comprising a polynucleotide programmable DNA binding domain and a deaminase domain for deaminating one or more nucleobases in a target nucleotide sequence; and (2) one or more guide RNAs in conjunction with the polynucleotide programmable DNA binding domain.
  • the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable DNA binding domain.
  • the base editor is a cytidine base editor (CBE).
  • the base editor is an adenine or adenosine base editor (ABE).
  • the base editor is an adenine or adenosine base editor (ABE) or a cytidine base editor (CBE).
  • base editing activity is meant acting to chemically alter a base within a polynucleotide. In one embodiment, a first base is converted to a second base.
  • the base editing activity is cytidine deaminase activity, e.g., converting target OG to T ⁇ A.
  • the base editing activity is adenosine deaminase activity, e.g., converting A ⁇ T to G*C.
  • Cas9 or “Cas9 domain” refers to an RNA guided nuclease comprising a Cas9 protein, or a fragment thereof (e.g., a protein comprising an active, inactive, or partially active DNA cleavage domain of Cas9, and/or the gRNA binding domain of Cas9).
  • a Cas9 nuclease is also referred to sometimes as a casnl nuclease or a CRISPR (clustered regularly interspaced short palindromic repeat) associated nuclease.
  • “conservative amino acid substitution” or “conservative mutation” refers to the replacement of one amino acid by another amino acid with a common property.
  • a functional way to define common properties between individual amino acids is to analyze the normalized frequencies of amino acid changes between corresponding proteins of homologous organisms (Schulz, G. E. and Schirmer, R. H., Principles of Protein Structure, Springer-Verlag, New York (1979)). According to such analyses, groups of amino acids can be defined where amino acids within a group exchange preferentially with each other, and therefore resemble each other most in their impact on the overall protein structure (Schulz, G. E. and Schirmer, R. H., supra).
  • Non-limiting examples of conservative mutations include amino acid substitutions of amino acids, for example, lysine for arginine and vice versa such that a positive charge can be maintained; glutamic acid for aspartic acid and vice versa such that a negative charge can be maintained; serine for threonine such that a free -OH can be maintained; and glutamine for asparagine such that a free -NH2 can be maintained.
  • coding sequence or “protein coding sequence” as used interchangeably herein refers to a segment of a polynucleotide that codes for a protein. Coding sequences can also be referred to as open reading frames. The region or sequence is bounded nearer the 5' end by a start codon and nearer the 3’ end with a stop codon. Stop codons useful with the base editors described herein include the following:
  • cytidine deaminase is meant a polypeptide or fragment thereof capable of catalyzing a deamination reaction that converts an amino group to a carbonyl group.
  • the cytidine deaminase converts cytosine to uracil or 5-methylcytosine to thymine.
  • PmCDAI (SEQ ID NO: 41-42), which is derived from Petromyzon marinus ( Petromyzon marinus cytosine deaminase 1 , “PmCDAI”), AID (Activation-induced cytidine deaminase; AICDA)
  • AID Activation-induced cytidine deaminase; AICDA
  • SEQ ID NOs: 43-44, 1372, and 1374-1377 which is derived from a mammal (e.g., human, swine, bovine, horse, monkey etc.)
  • APOBEC are exemplary cytidine deaminases (Exemplary APOBEC polypeptide sequences are provided in the Sequence Listing as SEQ ID NOs: 1378-1416, 1421, and 1422.
  • CDA cytidine deaminase
  • SEQ ID NOs: 1373, 1417-1420 Additional exemplary cytidine deaminase sequences, including APOBEC polypeptide sequences, are provided in the Sequence Listing as SEQ ID NOs: 1378-1422.
  • Some aspects of the disclosure provide base editor proteins and base editor systems that are capable of deaminating a cytosine in a nucleic acid molecule (e.g., DNA or RNA).
  • the base editor protein or base editor system comprises a cytidine deaminase or cytosine deaminase that is capable of deaminating a cytidine to uridine in a nucleic acid molecule (e.g., DNA or RNA).
  • a nucleic acid molecule e.g., DNA or RNA
  • any of the cytidine or cytosine deaminases provided herein include variants of naturally-occurring cytidine and cytosine deaminases. Such variants may be engineered to increase the efficiency of on-target deaminase activity of a base editor protein or system in a nucleic acid molecule (e.g., DNA or RNA).
  • deaminase or “deaminase domain,” as used herein, refers to a protein or enzyme that catalyzes a deamination reaction.
  • Detect refers to identifying the presence, absence or amount of the analyte to be detected. In one embodiment, a sequence alteration in a polynucleotide or polypeptide is detected. In another embodiment, the presence of indels is detected.
  • detectable label is meant a composition that when linked to a molecule of interest renders the latter detectable, via spectroscopic, photochemical, biochemical, immunochemical, or chemical means.
  • useful labels include radioactive isotopes, magnetic beads, metallic beads, colloidal particles, fluorescent dyes, electron-dense reagents, enzymes (for example, as commonly used in an enzyme linked immunosorbent assay (ELISA)), biotin, digoxigenin, or haptens.
  • disease is meant any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ.
  • exemplary diseases include neurological diseases and opthalmic diseases.
  • an effective amount is meant the amount of an agent or active compound, e.g., a base editor as described herein, that is required to ameliorate the symptoms of a disease relative to an untreated patient or an individual without disease, i.e., a healthy individual, or is the amount of the agent or active compound sufficient to elicit a desired biological response.
  • the effective amount of active compound(s) used to practice the present invention for therapeutic treatment of a disease varies depending upon the manner of administration, the age, body weight, and general health of the subject. Ultimately, the attending physician or veterinarian will decide the appropriate amount and dosage regimen. Such amount is referred to as an “effective” amount.
  • an effective amount is the amount of a base editor of the invention sufficient to introduce an alteration in a gene of interest in a cell (e.g., a cell in vitro or in vivo). In one embodiment, an effective amount is the amount of a base editor required to achieve a therapeutic effect. Such therapeutic effect need not be sufficient to alter a pathogenic gene in all cells of a subject, tissue or organ, but only to alter the pathogenic gene in about 1%, 5%, 10%, 25%, 50%, 75% or more of the cells present in a subject, tissue or organ. In one embodiment, an effective amount is sufficient to ameliorate one or more symptoms of a disease.
  • exonuclease refers to a protein or polypeptide capable of digesting a nucleic acid (e.g., RNA or DNA) from free ends.
  • nucleic acid e.g., DNA or RNA
  • fragment is meant a portion of a polypeptide or nucleic acid molecule. This portion contains, at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide.
  • a fragment may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 nucleotides or amino acids.
  • guide RNA or “gRNA” is meant a polynucleotide or polynucleotide complex which is specific for a target sequence and can form a complex with a polynucleotide programmable nucleotide binding domain protein (e.g., Cas9 or Cpf1).
  • the guide polynucleotide is a guide RNA (gRNA).
  • gRNAs can exist as a complex of two or more RNAs, or as a single RNA molecule.
  • RNA or “transfer RNA” is meant an RNA molecule comprising a secondary and/or tertiary structure that is capable of being cleaved in a cell. Cleavage may occur, for example, though an RNase, such as RNase P or RNase Z.
  • RNase such as RNase P or RNase Z.
  • Hybridization means hydrogen bonding, which may be Watson-Crick, Hoogsteen or reversed Hoogsteen hydrogen bonding, between complementary nucleobases.
  • adenine and thymine are complementary nucleobases that pair through the formation of hydrogen bonds.
  • inhibitor of base repair refers to a protein that is capable in inhibiting the activity of a nucleic acid repair enzyme, for example a base excision repair enzyme.
  • isolated refers to material that is free to varying degrees from components which normally accompany it as found in its native state.
  • Isolate denotes a degree of separation from original source or surroundings.
  • Purify denotes a degree of separation that is higher than isolation.
  • a “purified” or “biologically pure” protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences.
  • nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid chromatography. The term "purified" can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. For a protein that can be subjected to modifications, for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
  • isolated polynucleotide is meant a nucleic acid (e.g., a DNA) that is free of the genes which, in the naturally-occurring genome of the organism from which the nucleic acid molecule of the invention is derived, flank the gene.
  • the term therefore includes, for example, a recombinant DNA that is incorporated into a vector; into an autonomously replicating plasmid or virus; or into the genomic DNA of a prokaryote or eukaryote; or that exists as a separate molecule (for example, a cDNA or a genomic or cDNA fragment produced by PCR or restriction endonuclease digestion) independent of other sequences.
  • the term includes an RNA molecule that is transcribed from a DNA molecule, as well as a recombinant DNA that is part of a hybrid gene encoding additional polypeptide sequence.
  • an “isolated polypeptide” is meant a polypeptide of the invention that has been separated from components that naturally accompany it.
  • the polypeptide is isolated when it is at least 60%, by weight, free from the proteins and naturally-occurring organic molecules with which it is naturally associated.
  • the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight, a polypeptide of the invention.
  • An isolated polypeptide of the invention may be obtained, for example, by extraction from a natural source, by expression of a recombinant nucleic acid encoding such a polypeptide; or by chemically synthesizing the protein. Purity can be measured by any appropriate method, for example, column chromatography, polyacrylamide gel electrophoresis, or by HPLC analysis.
  • mutation refers to a substitution of a residue within a sequence, e.g., a nucleic acid or amino acid sequence, with another residue, or a deletion or insertion of one or more residues within a sequence. Mutations are typically described herein by identifying the original residue followed by the position of the residue within the sequence and by the identity of the newly substituted residue. Various methods for making the amino acid substitutions (mutations) provided herein are well known in the art, and are provided by, for example, Green and Sambrook, Molecular Cloning: A Laboratory Manual (4 th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)).
  • nucleic acid and “nucleic acid molecule,” as used herein, refer to a compound comprising a nucleobase and an acidic moiety, e.g., a nucleoside, a nucleotide, or a polymer of nucleotides.
  • polymeric nucleic acids e.g., nucleic acid molecules comprising three or more nucleotides are linear molecules, in which adjacent nucleotides are linked to each other via a phosphodiester linkage.
  • nucleic acid refers to individual nucleic acid residues (e.g. nucleotides and/or nucleosides).
  • nucleic acid refers to an oligonucleotide chain comprising three or more individual nucleotide residues.
  • oligonucleotide and polynucleotide can be used interchangeably to refer to a polymer of nucleotides (e.g., a string of at least three nucleotides).
  • nucleic acid encompasses RNA as well as single and/or double-stranded DNA.
  • Nucleic acids may be naturally occurring, for example, in the context of a genome, a transcript, an mRNA, tRNA, rRNA, siRNA, snRNA, a plasmid, cosmid, chromosome, chromatid, or other naturally occurring nucleic acid molecule.
  • a nucleic acid molecule may be a non-naturally occurring molecule, e.g., a recombinant DNA or RNA, an artificial chromosome, an engineered genome, or fragment thereof, or a synthetic DNA, RNA, DNA/RNA hybrid, or including non-naturally occurring nucleotides or nucleosides.
  • nucleic acid examples include nucleic acid analogs, e.g., analogs having other than a phosphodiester backbone.
  • Nucleic acids can be purified from natural sources, produced using recombinant expression systems and optionally purified, chemically synthesized, etc. Where appropriate, e.g., in the case of chemically synthesized molecules, nucleic acids can comprise nucleoside analogs such as analogs having chemically modified bases or sugars, and backbone modifications. A nucleic acid sequence is presented in the 5' to 3' direction unless otherwise indicated.
  • a nucleic acid is or comprises natural nucleosides (e.g.
  • nucleoside analogs e.g., 2-aminoadenosine, 2- thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine, 5-methylcytidine, 2- aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5-propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7-deazaadenosine, 7- deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, 0(6)-methylguanine, and 2-thiocytidine
  • nuclear localization sequence refers to an amino acid sequence that promotes import of a protein into the cell nucleus.
  • Nuclear localization sequences are known in the art and described, for example, in Plank et a!., International PCT application, PCT/EP2000/011690, filed November 23, 2000, published as WO/2001 /038547 on May 31, 2001, the contents of which are incorporated herein by reference for their disclosure of exemplary nuclear localization sequences.
  • the NLS is an optimized NLS described, for example, by Koblan etal., Nature Biotech. 2018 doi:10.1038/nbt.4172.
  • an NLS comprises the amino acid sequence KRTADGSEFESPKKKRKV (SEQ ID NO: 84), KRPAATKKAGQAKKKK (SEQ ID NO: 85), KKTELQTTNAENKTKKL (SEQ ID NO: 86), KRGINDRNFWRGENGRKTR (SEQ ID NO: 87), RKSGKIAAIWKRPRK (SEQ ID NO: 88), PKKKRKV (SEQ ID NO: 89), or MDSLLMNRRKFLYQFKNVRWAKGRRETYLC (SEQ ID NO: 90).
  • nucleobase refers to a nitrogen-containing biological compound that forms a nucleoside, which in turn is a component of a nucleotide.
  • RNA ribonucleic acid
  • DNA deoxyribonucleic acid
  • nucleobases - adenine (A), cytosine (C), guanine (G), thymine (T), and uracil (U) - are called primary or canonical.
  • Adenine and guanine are derived from purine, and cytosine, uracil, and thymine are derived from pyrimidine.
  • DNA and RNA can also contain other (non-primary) bases that are modified.
  • Non-limiting exemplary modified nucleobases can include hypoxanthine, xanthine, 7-methylguanine, 5,6-dihydrouracil, 5- methylcytosine (m5C), and 5-hydromethylcytosine.
  • Hypoxanthine and xanthine can be created through mutagen presence, both of them through deamination (replacement of the amine group with a carbonyl group). Hypoxanthine can be modified from adenine.
  • Xanthine can be modified from guanine. Uracil can result from deamination of cytosine.
  • a “nucleoside” consists of a nucleobase and a five carbon sugar (either ribose or deoxyribose). Examples of a nucleoside include adenosine, guanosine, uridine, cytidine, 5-methyluridine (m5U), deoxyadenosine, deoxyguanosine, thymidine, deoxyuridine, and deoxycytidine.
  • nucleoside with a modified nucleobase examples include inosine (I), xanthosine (X), 7- methylguanosine (m7G), dihydrouridine (D), 5-methylcytidine (m5C), and pseudouridine (Y).
  • a “nucleotide” consists of a nucleobase, a five carbon sugar (either ribose or deoxyribose), and at least one phosphate group.
  • nucleic acid and “nucleic acid molecule,” as used herein, refer to a compound comprising a nucleobase and an acidic moiety, e.g., a nucleoside, a nucleotide, or a polymer of nucleotides.
  • oligonucleotide and “polynucleotide” can be used interchangeably to refer to a polymer of nucleotides.
  • nucleic acid programmable DNA binding protein or “napDNAbp” may be used interchangeably with “polynucleotide programmable nucleotide binding domain” to refer to a protein that associates with a nucleic acid (e.g., DNA or RNA), such as a guide nucleic acid or guide polynucleotide (e.g., gRNA), that guides the napDNAbp to a specific nucleic acid sequence.
  • a nucleic acid e.g., DNA or RNA
  • gRNA guide nucleic acid or guide polynucleotide
  • the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable DNA binding domain.
  • the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable RNA binding domain.
  • the polynucleotide programmable nucleotide binding domain is a Cas9 protein.
  • a Cas9 protein can associate with a guide RNA that guides the Cas9 protein to a specific DNA sequence that is complementary to the guide RNA.
  • the napDNAbp is a Cas9 domain, for example a nuclease active Cas9, a Cas9 nickase (nCas9), or a nuclease inactive Cas9 (dCas9).
  • Non-limiting examples of nucleic acid programmable DNA binding proteins include, Cas9 (e.g., dCas9 and nCas9), Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, Cas12i, and Cas12j/CasO (Cas12j/Casphi).
  • Cas enzymes include Cas1, Cas1 B, Cas2, Cas3, Cas4, Cas5, Cas5d, Cas5t, Cas5h, Cas5a, Cas6, Cas7, Cas8, Cas8a, Cas8b, Cas8c, Cas9 (also known as Csn1 or Csx12), Cas10, Cas10d, Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, Cas12i, Cas12j/CasO, Cpf1 , Csy1 , Csy2, Csy3, Csy4, Cse1 , Cse2, Cse3, Cse4, Cse5e, Csd , Csc2, Csa5, Csn1, Csn2, Csm1 , Csm2, Csm
  • nucleic acid programmable DNA binding proteins are also within the scope of this disclosure, although they may not be specifically listed in this disclosure. See, e.g., Makarova eta/. “Classification and Nomenclature of CRISPR-Cas Systems: Where from Here?” CRISPRJ. 2018 Oct; 1:325- 336. doi: 10.1089/crispr.2018.0033; Yan et a/., “Functionally diverse type V CRISPR-Cas systems” Science. 2019 Jan 4;363(6422):88-91. doi: 10.1126/science.aav7271 , the entire contents of each are hereby incorporated by reference.
  • nucleic acid programmable DNA binding proteins and nucleic acid sequences encoding nucleic acid programmable DNA binding proteins are provided in the Sequence Listing as SEQ ID NOs: 223, 230-232, 235- 242, 246-256, and 285-294.
  • nucleobase editing domain refers to a protein or enzyme that can catalyze a nucleobase modification in RNA or DNA, such as cytosine (or cytidine) to uracil (or uridine) or thymine (or thymidine), and adenine (or adenosine) to hypoxanthine (or inosine) deaminations, as well as non-templated nucleotide additions and insertions.
  • cytosine or cytidine
  • uracil or uridine
  • thymine or thymidine
  • adenine or adenosine
  • hypoxanthine or inosine
  • the nucleobase editing domain is a deaminase domain (e.g., an adenine deaminase or an adenosine deaminase; or a cytidine deaminase or a cytosine deaminase).
  • a deaminase domain e.g., an adenine deaminase or an adenosine deaminase; or a cytidine deaminase or a cytosine deaminase.
  • obtaining as in “obtaining an agent” includes synthesizing, purchasing, or otherwise acquiring the agent.
  • a “patient” or “subject” as used herein refers to a mammalian subject or individual diagnosed with, at risk of having or developing, or suspected of having or developing a disease or a disorder.
  • the term “patient” refers to a mammalian subject with a higher than average likelihood of developing a disease or a disorder.
  • Exemplary patients can be humans, non-human primates, cats, dogs, pigs, cattle, cats, horses, camels, llamas, goats, sheep, rodents (e.g., mice, rabbits, rats, or guinea pigs) and other mammalians that can benefit from the therapies disclosed herein.
  • Exemplary human patients can be male and/or female.
  • Patient in need thereof or “subject in need thereof’ is referred to herein as a patient diagnosed with, at risk or having, predetermined to have, or suspected of having a disease or disorder.
  • pathogenic mutation refers to a genetic alteration or mutation that increases an individual’s susceptibility or predisposition to a certain disease or disorder.
  • the pathogenic mutation comprises at least one wild-type amino acid substituted by at least one pathogenic amino acid in a protein encoded by a gene.
  • protein refers to a polymer of amino acid residues linked together by peptide (amide) bonds.
  • a protein, peptide, or polypeptide can be naturally occurring, recombinant, or synthetic, or any combination thereof.
  • fusion protein refers to a hybrid polypeptide which comprises protein domains from at least two different proteins.
  • recombinant protein or nucleic acid molecule comprises an amino acid or nucleotide sequence that comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations as compared to any naturally occurring sequence.
  • a “reference sequence” is a defined sequence used as a basis for sequence comparison.
  • a reference sequence may be a subset of or the entirety of a specified sequence; for example, a segment of a full-length cDNA or gene sequence, or the complete cDNA or gene sequence.
  • the length of the reference polypeptide sequence will generally be at least about 16 amino acids, at least about 20 amino acids, at least about 25 amino acids, about 35 amino acids, about 50 amino acids, or about 100 amino acids.
  • the length of the reference nucleic acid sequence will generally be at least about 50 nucleotides, at least about 60 nucleotides, at least about 75 nucleotides, about 100 nucleotides or about 300 nucleotides or any integer thereabout or therebetween.
  • a reference sequence is a wild-type sequence of a protein of interest.
  • a reference sequence is a polynucleotide sequence encoding a wild-type protein.
  • RNA-programmable nuclease and "RNA-guided nuclease” are used with (e.g., binds or associates with) one or more RNA(s) that is not a target for cleavage.
  • an RNA-programmable nuclease when in a complex with an RNA, may be referred to as a nuclease: RNA complex.
  • the bound RNA(s) is referred to as a guide RNA (gRNA).
  • the RNA-programmable nuclease is the (CRISPR- associated system) Cas9 endonuclease, for example, Cas9 (Csnl) from Streptococcus pyogenes.
  • single nucleotide polymorphism is a variation in a single nucleotide that occurs at a specific position in the genome, where each variation is present to some appreciable degree within a population (e.g., > 1 %).
  • telomere binding molecule By “specifically binds” is meant a nucleic acid molecule, polypeptide, polypeptide/polynucleotide complex, compound, or molecule that recognizes and binds a polypeptide and/or nucleic acid molecule of the invention, but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample.
  • substantially identical is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence.
  • a reference sequence is a wild-type amino acid or nucleic acid sequence.
  • a reference sequence is any one of the amino acid or nucleic acid sequences described herein. In one embodiment, such a sequence is at least 60%, 80%, 85%, 90%, 95% or even 99% identical at the amino acid level or nucleic acid level to the sequence used for comparison.
  • Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. In an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e 3 and e 100 indicating a closely related sequence.
  • sequence analysis software for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center,
  • COBALT is used, for example, with the following parameters: a) alignment parameters: Gap penalties-11 ,-1 and End-Gap penalties-5,-1, b) CDD Parameters: Use RPS BLAST on; Blast E-value 0.003; Find conserveed columns and Recompute on, and c) Query Clustering Parameters: Use query clusters on; Word Size 4; Max cluster distance 0.8; Alphabet Regular.
  • EMBOSS Needle is used, for example, with the following parameters: a) Matrix: BLOSUM62; b) GAP OPEN: 10; c) GAP EXTEND: 0.5; d) OUTPUT FORMAT: pair; e) END GAP PENALTY: false; f) END GAP OPEN: 10; and g) END GAP EXTEND: 0.5.
  • Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having “substantial identity” to an endogenous sequence are typically capable of hybridizing with at least one strand of a double- stranded nucleic acid molecule. Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity.
  • Polynucleotides having “substantial identity” to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule.
  • hybridize is meant pair to form a double-stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency.
  • complementary polynucleotide sequences e.g., a gene described herein
  • stringent salt concentration will ordinarily be less than about 750 mM NaCI and 75 mM trisodium citrate, preferably less than about 500 mM NaCI and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCI and 25 mM trisodium citrate.
  • Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide.
  • Stringent temperature conditions will ordinarily include temperatures of at least about 30° C, more preferably of at least about 37° C, and most preferably of at least about 42° C.
  • Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art.
  • concentration of detergent e.g., sodium dodecyl sulfate (SDS)
  • SDS sodium dodecyl sulfate
  • Various levels of stringency are accomplished by combining these various conditions as needed.
  • hybridization will occur at 30° C in 750 mM NaCI, 75 mM trisodium citrate, and 1% SDS.
  • hybridization will occur at 37° C in 500 mM NaCI, 50 mM trisodium citrate, 1% SDS, 35% formamide, and 100 pg/ml denatured salmon sperm DNA (ssDNA).
  • hybridization will occur at 42° C in 250 mM NaCI, 25 mM trisodium citrate, 1% SDS, 50% formamide, and 200 pg/ml ssDNA. Useful variations on these conditions will be readily apparent to those skilled in the art.
  • wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt concentration or by increasing temperature.
  • stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCI and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCI and 1.5 mM trisodium citrate.
  • Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25° C, more preferably of at least about 42° C, and even more preferably of at least about 68° C.
  • wash steps will occur at 25° C in 30 mM NaCI, 3 mM trisodium citrate, and 0.1% SDS. In another embodiment, wash steps will occur at 42 C in 15 mM NaCI, 1.5 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 68° C in 15 mM NaCI, 1.5 mM trisodium citrate, and 0.1% SDS. Additional variations on these conditions will be readily apparent to those skilled in the art. Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196:180, 1977); Grunstein and Hogness (Proc. Natl. Acad.
  • split is meant divided into two or more fragments.
  • a “split Cas9 protein” or “split Cas9” refers to a Cas9 protein that is provided as an N- terminal fragment and a C-terminal fragment encoded by two separate nucleotide sequences.
  • the polypeptides corresponding to the N-terminal portion and the C-terminal portion of the Cas9 protein may be spliced to form a “reconstituted” Cas9 protein.
  • target site refers to a sequence within a nucleic acid molecule that is deaminated by a deaminase (e.g., cytidine or adenine deaminase) or a fusion protein comprising a deaminase (e.g., a dCas9-adenosine deaminase fusion protein or a base editor disclosed herein).
  • a deaminase e.g., cytidine or adenine deaminase
  • a fusion protein comprising a deaminase (e.g., a dCas9-adenosine deaminase fusion protein or a base editor disclosed herein).
  • the terms “treat,” treating,” “treatment,” and the like refer to reducing or ameliorating a disorder and/or symptoms associated therewith or obtaining a desired pharmacologic and/or physiologic effect. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated. In some embodiments, the effect is therapeutic, i.e., without limitation, the effect partially or completely reduces, diminishes, abrogates, abates, alleviates, decreases the intensity of, or cures a disease and/or adverse symptom attributable to the disease.
  • the effect is preventative, i.e., the effect protects or prevents an occurrence or reoccurrence of a disease or condition.
  • the presently disclosed methods comprise administering a therapeutically effective amount of a compositions as described herein.
  • uracil glycosylase inhibitor or “UGI” is meant an agent that inhibits the uracil- excision repair system.
  • Base editors comprising a cytidine deaminase convert cytosine to uracil, which is then converted to thymine through DNA replication or repair.
  • Including an inhibitor of uracil DNA glycosylase (UGI) in the base editor prevents base excision repair which changes the U back to a C.
  • An exemplary UGI comprises an amino acid sequence as follows:
  • Ranges provided herein are understood to be shorthand for all of the values within the range.
  • a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
  • the words “comprising” (and any form of comprising, such as “comprise” and “comprises”), “having” (and any form of having, such as “have” and “has”), “including” (and any form of including, such as “includes” and “include”) or “containing” (and any form of containing, such as “contains” and “contain”) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps. It is contemplated that any embodiment discussed in this specification can be implemented with respect to any method or composition of the present disclosure, and vice versa. Furthermore, compositions of the present disclosure can be used to achieve methods of the present disclosure.
  • the term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within 1 or more than 1 standard deviation, per the practice in the art. Alternatively, “about” can mean a range of up to 20%, up to 10%, up to 5%, or up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, e.g., within 5-fold, within 2-fold of a value. Where particular values are described in the application and claims, unless otherwise stated, the term “about” means within an acceptable error range for the particular value should be assumed.
  • a recombinant rabies virus of the present disclosure comprises a rabies virus glycoprotein and a recombinant rabies virus genome.
  • the recombinant rabies virus genome encodes a nucleic acid comprising a transgene.
  • the recombinant rabies virus genome encodes a nucleic acid comprising a therapeutic transgene.
  • recombinant rabies viruses of the present disclosure can be employed in a method for transducing a target cell, wherein the recombinant rabies virus comprises a rabies virus glycoprotein and a recombinant rabies virus genome comprising a nucleic acid comprising a transgene (e.g., a therapeutic transgene).
  • a transgene e.g., a therapeutic transgene
  • the transgene comprised within the recombinant rabies virus genome is expressed and a transgene product is produced.
  • Rabies virus is a negative sense single stranded RNA virus of the Lyssavirus genus of the Rhabdoviridae family. Rabies virus has a cylindrical morphology, and the structure includes a lipoprotein envelope composed of glygoprotein G surrounding a helical ribonucleoprotein core.
  • the rabies virus genome contains five genes that encode for proteins that promote transcription and replication of the genome and proteins that make up the structural components of the virus.
  • the five genes are: the N gene encoding for a rabies virus nucleoprotein; the P gene encoding for a rabies virus phosphoprotein; the M gene encoding for a rabies virus matrix protein; the G gene encoding for a rabies virus glycoprotein; and the L gene encoding for a rabies virus polymerase.
  • Viral genome RNA and the nucleoprotein together form a ribonucleoprotein that functions as a template for replication and transcription by the rabies virus polymerase (an RNA-dependent RNA polymerase).
  • a recombinant rabies virus genome of the present disclosure has one or more rabies virus genes removed.
  • the N gene, the P gene, the M gene, the L gene, and/or the G gene may be absent from the recombinant rabies virus genome.
  • the recombinant rabies virus genome lacks a G gene encoding for a rabies virus glycoprotein or a functional variant thereof. Recombinant rabies virus genomes that lack a G gene encoding for a rabies virus glycoprotein prevents the virus from being able to endogenously produce glycoprotein.
  • the recombinant rabies virus genome lacks an L gene encoding for a rabies virus polymerase or a functional variant thereof.
  • the L gene product is required both for transcription of viral genes and for replication of the viral genome, and deletion of the L gene may result in less cytotoxicity of a target transduced cell. See, e.g., Chatterjee et al., Nat. Neurosci. (2016) 21(4): 638-646, the disclosure of which is herein incorporated by reference in its entirety.
  • the recombinant rabies virus genome lacks a G gene encoding for a rabies virus glycoprotein or a functional variant thereof, and lacks an L gene encoding for a rabies virus polymerase or a functional variant thereof.
  • a recombinant rabies virus genome that lacks a rabies virus gene refers to a rabies virus genome that lacks all or a portion of the rabies virus gene.
  • a recombinant rabies virus genome that lacks a G gene may lack all or a portion of the G gene, wherein the portion of the G gene is required for the function of the G gene product.
  • lacking a portion of the G gene that is required for the function of the G gene product may result in the production of a truncated, non-functional glycoprotein.
  • a recombinant rabies virus genome that lacks an L gene may lack all or a portion of the L gene, wherein the portion of the L gene is required for the function of the L gene product. In certain embodiments, lacking a portion of the L gene that is required for the function of the L gene product may result in the production of a truncated, non-functional RNA-dependent RNA polymerase.
  • a recombinant rabies virus genome of the present disclosure encodes a nucleic acid comprising a transgene.
  • the nucleic acid comprising a transgene replaces the one or more rabies virus genes that are removed, as described herein.
  • the nucleic acid comprising a transgene may replace all or a portion of a rabies virus gene.
  • the nucleic acid comprising a transgene replaces all or a portion of a G gene, wherein the portion of the G gene is required for the function of the G gene product.
  • the nucleic acid comprising a transgene replaces all or a portion of an L gene, wherein the portion of the L gene is required for the function of the L gene product. In certain embodiments, the nucleic acid comprising a transgene replaces all or a portion of an L gene, wherein the portion of the L gene is required for the function of the L gene product; and all or a portion of a G gene, wherein the portion of the G gene is required for the function of the G gene product.
  • a recombinant rabies virus genome of the present disclosure encodes a nucleic acid comprising a transgene, wherein the transgene replaces the one or more rabies virus genes that are removed, as described herein.
  • the recombinant rabies virus genome comprises an N gene encoding for a rabies virus nucleoprotein or a functional variant thereof, a P gene encoding for a rabies virus phosphoprotein or a functional variant thereof, and/or an M gene encoding for a rabies virus matrix protein or a functional variant thereof.
  • nucleic acid sequences of the N, P, M, L, and G genes are provided in Table 1 .
  • the recombinant rabies virus genome comprises an N gene having a nucleic acid sequence that is about 60%, about 65%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91 %, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% identical to the nucleic acid sequence set forth in SEQ ID NO: 4001 .
  • the recombinant rabies virus genome comprises an N gene having a nucleic acid sequence that is at least 60%, at least 65%, about 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical to the nucleic acid sequence set forth in SEQ ID NO: 4001.
  • the recombinant rabies virus genome comprises an N gene comprising the nucleic acid sequence set forth in SEQ ID NO: 4001. In certain embodiments, the recombinant rabies virus genome comprises an N gene consisting of the nucleic acid sequence set forth in SEQ ID NO: 4001. In certain embodiments, the N gene encodes for an amino acid sequence that is about 80%, about 81 %, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% identical to the amino acid sequence set forth in SEQ ID NO: 4002.
  • the N gene encodes for an amino acid sequence that is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical to the amino acid sequence set forth in SEQ ID NO: 4002.
  • the N gene encodes for an amino acid sequence comprising the amino acid sequence set forth in SEQ ID NO: 4002.
  • the N gene encodes for an amino acid sequence consisting of the amino acid sequence set forth in SEQ ID NO: 4002.
  • the recombinant rabies virus genome comprises an L gene having a nucleic acid sequence that is about 60%, about 65%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91 %, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% identical to the nucleic acid sequence set forth in SEQ ID NO: 4003.
  • the recombinant rabies virus genome comprises an L gene having a nucleic acid sequence that is at least 60%, at least 65%, about 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical to the nucleic acid sequence set forth in SEQ ID NO: 4003.
  • the recombinant rabies virus genome comprises an L gene comprising the nucleic acid sequence set forth in SEQ ID NO: 4003. In certain embodiments, the recombinant rabies virus genome comprises an L gene consisting of the nucleic acid sequence set forth in SEQ ID NO: 4003. In certain embodiments, the L gene encodes for an amino acid sequence that is about 80%, about 81 %, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% identical to the amino acid sequence set forth in SEQ ID NO: 4004.
  • the L gene encodes for an amino acid sequence that is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical to the amino acid sequence set forth in SEQ ID NO: 4004.
  • the L gene encodes for an amino acid sequence comprising the amino acid sequence set forth in SEQ ID NO: 4004.
  • the L gene encodes for an amino acid sequence consisting of the amino acid sequence set forth in SEQ ID NO: 4004.
  • the recombinant rabies virus genome comprises an M gene having a nucleic acid sequence that is about 60%, about 65%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91 %, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% identical to the nucleic acid sequence set forth in SEQ ID NO: 4005.
  • the recombinant rabies virus genome comprises an M gene having a nucleic acid sequence that is at least 60%, at least 65%, about 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical to the nucleic acid sequence set forth in SEQ ID NO: 4005.
  • the recombinant rabies virus genome comprises an M gene comprising the nucleic acid sequence set forth in SEQ ID NO: 4005. In certain embodiments, the recombinant rabies virus genome comprises an M gene consisting of the nucleic acid sequence set forth in SEQ ID NO: 4005. In certain embodiments, the M gene encodes for an amino acid sequence that is about 80%, about 81 %, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% identical to the amino acid sequence set forth in SEQ ID NO: 4006.
  • the M gene encodes for an amino acid sequence that is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical to the amino acid sequence set forth in SEQ ID NO: 4006.
  • the M gene encodes for an amino acid sequence comprising the amino acid sequence set forth in SEQ ID NO: 4006.
  • the M gene encodes for an amino acid sequence consisting of the amino acid sequence set forth in SEQ ID NO: 4006.
  • the recombinant rabies virus genome comprises a P gene having a nucleic acid sequence that is about 60%, about 65%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91 %, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% identical to the nucleic acid sequence set forth in SEQ ID NO: 4007.
  • the recombinant rabies virus genome comprises a P gene having a nucleic acid sequence that is at least 60%, at least 65%, about 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical to the nucleic acid sequence set forth in SEQ ID NO: 4007.
  • the recombinant rabies virus genome comprises a P gene comprising the nucleic acid sequence set forth in SEQ ID NO: 4007. In certain embodiments, the recombinant rabies virus genome comprises a P gene consisting of the nucleic acid sequence set forth in SEQ ID NO: 4007. In certain embodiments, the P gene encodes for an amino acid sequence that is about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91 %, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% identical to the amino acid sequence set forth in SEQ ID NO: 4008.
  • the P gene encodes for an amino acid sequence that is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical to the amino acid sequence set forth in SEQ ID NO: 4008.
  • the P gene encodes for an amino acid sequence comprising the amino acid sequence set forth in SEQ ID NO: 4008.
  • the P gene encodes for an amino acid sequence consisting of the amino acid sequence set forth in SEQ ID NO: 4008.
  • the recombinant rabies virus genome comprises a G gene having a nucleic acid sequence that is about 60%, about 65%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% identical to the nucleic acid sequence set forth in SEQ ID NO: 4009.
  • the recombinant rabies virus genome comprises a G gene having a nucleic acid sequence that is at least 60%, at least 65%, about 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical to the nucleic acid sequence set forth in SEQ ID NO: 4009.
  • the recombinant rabies virus genome comprises a G gene comprising the nucleic acid sequence set forth in SEQ ID NO: 4009. In certain embodiments, the recombinant rabies virus genome comprises a G gene consisting of the nucleic acid sequence set forth in SEQ ID NO: 4009. In certain embodiments, the G gene encodes for an amino acid sequence that is about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91 %, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% identical to the amino acid sequence set forth in SEQ ID NO: 4010.
  • the G gene encodes for an amino acid sequence that is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical to the amino acid sequence set forth in SEQ ID NO: 4010.
  • the G gene encodes for an amino acid sequence comprising the amino acid sequence set forth in SEQ ID NO: 4010.
  • the G gene encodes for an amino acid sequence consisting of the amino acid sequence set forth in SEQ ID NO: 4010.
  • Each of the genes comprised within a recombinant rabies virus genome of the present disclosure may be operably linked to a transcriptional regulatory element.
  • a single transcriptional regulatory element may be capable of controlling the expression of the genes.
  • each gene is operably linked to a separate transcriptional regulatory element.
  • the transcriptional regulatory elements for each gene may be the same. In certain embodiments, the transcriptional regulatory elements for each gene may be different.
  • each of the genes are operably linked to a transcriptional regulatory element, wherein the transcriptional regulatory element is capable of controlling the expression of the gene that is operably linked thereto.
  • the transcriptional regulatory element comprises a transcription initiation signal.
  • the transcription initiation signal can be endogenous or exogenous to the rabies virus.
  • the transcription initiation signal is a synthetic transcription initiation signal.
  • the nucleic acid encoding a transgene is further operably linked to a transcription termination polyadenylation signal.
  • the transcription termination polyadenylation signal can be endogenous or exogenous to the rabies virus.
  • the transcription termination polyadenylation signal is a synthetic transcription termination polyadenylation signal.
  • transcription initiation signals and transcriptional termination polyadenylaton signals are known to those of ordinary skill in the art, and are described in, e.g., Albertini et al., Adv. Virus. Res. (2011) 79: 1-22; Ogino and Green, Viruses (2019) 11 (6): 504; Ogino et al., Nucl. Acids. Res. (2019) 47(1 ): 299-309; and Ogino and Green, Front. Microbiol. (2019) 10: 1490, the disclosures of which are herein incorporated by reference in their entireties.
  • the recombinant rabies virus is replication incompetent.
  • replication incompetent refers to a virus that is incapable of completing a full replication cycle in a host cell after infection.
  • viruses may be rendered replication incompetent through the deletion or inactivation of viral genes necessary for viral replication.
  • the recombinant rabies virus is rendered replication incompetent through the deletion or inactivation of any one or more of the P gene, the L gene, the M gene, the N gene, and the G gene, in the recombinant rabies virus genome.
  • the recombinant rabies virus is replication deficient.
  • replication deficient refers to a modified virus that is capable of completing a full replication cycle in a host cell after infection less efficiently compared to a wild-type or unmodified virus.
  • the disclosure provides a recombinant rabies virus genome, comprising a nucleic acid encoding a first guide RNA (gRNA) that comprises a 5’ end and a 3’ end; and a nucleic acid encoding a first transfer RNA (tRNA) positioned at one of both of upstream of the 5’ end of the nucleic acid encoding the first gRNA or downstream of the 3’ end of the nucleic acid encoding the first gRNA.
  • gRNA first guide RNA
  • tRNA first transfer RNA
  • the recombinant rabies virus genome comprises a nucleic acid encoding a second tRNA. In certain embodiments, the recombinant rabies virus genome comprises a nucleic acid encoding a third tRNA. In certain embodiments, the recombinant rabies virus genome comprises a nucleic acid encoding a fourth tRNA. In certain embodiments, the recombinant rabies virus genome comprises a nucleic acid encoding a fifth tRNA.
  • the nucleic acid encoding the first tRNA is positioned upstream of the 5’ end of the nucleic acid encoding the first gRNA; and the nucleic acid encoding the second tRNA is positioned downstream of the 3’ end of the nucleic acid encoding the first gRNA.
  • the nucleotide sequence of the first tRNA and the nucleotide sequence of the second tRNA, third tRNA, fourth tRNA, and/or fifth tRNA are at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical.
  • the first tRNA and the second tRNA, third tRNA, fourth tRNA, and/or fifth tRNA specify the same amino acid.
  • the first tRNA and the second tRNA possess different anti-codon loop sequences, each anti-codon loop sequence corresponding to the same amino acid (e.g., a first tRNA with an anti-codon loop sequence comprising 5’ GGC 3’ specifying Ala, and a second tRNA with an anti-codon loop sequence comprising 5’ AGC 3’, also specifying Ala).
  • the first tRNA and the second tRNA, third tRNA, fourth tRNA, and/or fifth tRNA specify different amino acids.
  • the first tRNA and the second tRNA possess different anti-codon loop sequences, each anti-codon loop sequence corresponding to different amino acids (e.g., a first tRNA with an anti-codon loop sequence comprising 5’ GGC 3’ specifying Ala, and a second tRNA with an anti-codon loop sequence comprising 5 ⁇ AA 3’, specifying Phe).
  • the recombinant rabies virus genome comprises two or more nucleic acids encoding the first tRNA, second tRNA, third tRNA, fourth tRNA, and/or fifth tRNA. In certain embodiments, the recombinant rabies virus genome comprises two nucleic acids encoding the first tRNA, second tRNA, third tRNA, fourth tRNA, and/or fifth tRNA. In certain embodiments, the recombinant rabies virus genome comprises three nucleic acids encoding the first tRNA, second tRNA, third tRNA, fourth tRNA, and/or fifth tRNA.
  • the recombinant rabies virus genome comprises four nucleic acids encoding the first tRNA, second tRNA, third tRNA, fourth tRNA, and/or fifth tRNA. In certain embodiments, the recombinant rabies virus genome comprises five nucleic acids encoding the first tRNA, second tRNA, third tRNA, fourth tRNA, and/or fifth tRNA.
  • the recombinant rabies virus genome comprises a nucleic acid encoding a second gRNA, a third gRNA, a fourth gRNA, and/or a fifth gRNA.
  • the two or more nucleic acids encode identical gRNA. In certain embodiments, the two or more nucleic acids encode at least one different gRNA. In certain embodiments, the nucleotide sequence of the first gRNA and the nucleotide sequence of the second gRNA, a third gRNA, a fourth gRNA, and/or a fifth gRNA are at least 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical.
  • the first gRNA and the second gRNA, a third gRNA, a fourth gRNA, and/or a fifth gRNA specifically hybridize to the same target nucleic acid sequence. In certain embodiments, the first gRNA and the second gRNA, a third gRNA, a fourth gRNA, and/or a fifth gRNA specifically hybridize to different target nucleic acid sequence.
  • the first tRNA, second tRNA, third tRNA, fourth tRNA, and/or fifth tRNA is each selected from the group consisting of: tRNA-ala, tRNA-arg, tRNA-asn, tRNA- asp, tRNA-cys, tRNA-gln, tRNA-gly, tRNA-his, tRNA-ile, tRNA-leu, tRNA-lys, tRNA-met, tRNA-phe, tRNA-pro, tRNA-pyl, tRNA-sec, tRNA-ser, tRNA-thr, tRNA-trp, tRNA-tyr, and tRNA-val.
  • the recombinant rabies virus genome comprises a nucleic acid encoding a negative-strand RNA virus gene.
  • the recombinant rabies virus genome comprises a nucleic acid encoding a transgene (e.g., a nucleobase editor).
  • the nucleic acid encoding the first gRNA and the nucleic acid encoding the first tRNA are positioned between two nucleic acids each encoding a negative- strand RNA virus gene. In certain embodiments, the nucleic acid encoding the first gRNA and the nucleic acid encoding the first tRNA are positioned between two nucleic acids each encoding a transgene.
  • the nucleic acid encoding the first gRNA and the nucleic acid encoding the first tRNA are positioned between a nucleic acid encoding a negative-strand RNA virus gene and a nucleic acid encoding a transgene.
  • the recombinant rabies virus genome comprises a gRNA expression cassette comprising, from 5’ to 3’, a negative-strand RNA virus transcription initiation signal, a nucleic acid encoding a tRNA, a nucleic acid encoding a gRNA, and a transcription termination polyadenylation signal.
  • the recombinant rabies virus genome comprises a gRNA expression cassette comprising, from 5’ to 3’, a negative-strand RNA virus transcription initiation signal, a nucleic acid encoding the first tRNA, a nucleic acid encoding the first gRNA, a nucleic acid encoding a second tRNA, and a transcription termination polyadenylation signal.
  • the recombinant rabies virus genome comprises a gRNA expression cassette comprising, from 5’ to 3’, a negative-strand RNA virus transcription initiation signal, a nucleic acid encoding the first tRNA, a nucleic acid encoding the first gRNA, a nucleic acid encoding a second tRNA, a nucleic acid encoding a second gRNA, and a transcription termination polyadenylation signal.
  • the recombinant rabies virus genome comprises a gRNA expression cassette comprising, from 5’ to 3’, a negative-strand RNA virus transcription initiation signal, a nucleic acid encoding the first tRNA, a nucleic acid encoding the first gRNA, a nucleic acid encoding a second tRNA, a nucleic acid encoding a second gRNA, and a transcription termination polyadenylation signal.
  • the recombinant rabies virus genome comprises a gRNA expression cassette comprising, from 5’ to 3’, a negative-strand RNA virus transcription initiation signal, a nucleic acid encoding the first tRNA, a nucleic acid encoding the first gRNA, a nucleic acid encoding a second tRNA, a nucleic acid encoding a second gRNA, a nucleic acid encoding a third tRNA, and a transcription termination polyadenylation signal.
  • the nucleic acid encoding the first tRNA, second tRNA, and/or third tRNA are identical. In certain embodiments of the gRNA expression cassette, the nucleic acid encoding the first tRNA, second tRNA, and/or third tRNA are different. In certain embodiments of the gRNA expression cassette, the nucleotide sequence of the first tRNA and the nucleotide sequence of the second tRNA are at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical. In certain embodiments of the gRNA expression cassette, the first tRNA and the second tRNA specify the same amino acid.
  • the first tRNA and the second tRNA specify different amino acids.
  • the nucleic acid encoding the first gRNA and/or second gRNA are identical.
  • the nucleic acid encoding the first gRNA and/or second gRNA are different.
  • the nucleotide sequence of the first gRNA and the nucleotide sequence of the second gRNA are at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical.
  • the first gRNA and the second gRNA specifically hybridize to the same target nucleic acid sequence. In certain embodiments of the gRNA expression cassette, the first gRNA and the second gRNA specifically hybridize to different target nucleic acid sequence.
  • the transcription termination polyadenylation signal comprises an endogenous transcription termination polyadenylation signal. In certain embodiments of the gRNA expression cassette, the transcription termination polyadenylation signal comprises a heterologous transcription termination polyadenylation signal.
  • a recombinant rabies virus genome of the present disclosure encodes a nucleic acid comprising a therapeutic transgene.
  • therapeutic refers to treatment and/or prophylaxis.
  • therapeutic transgene refers to a transgene that encodes a transgene product that is capable of effecting treatment and/or prophylaxis to a subject in need.
  • the therapeutic effect is accomplished by suppression, remission, or eradication of a disease state suffered by the subject.
  • the therapeutic transgene may encode any therapeutic agent that is capable of effecting treatment and/or prophylaxis in a subject in need, resulting in suppression, remission, or eradication of a disease state in the subject.
  • the therapeutic transgene encodes a precursor of a transgene product that is capable of effecting treatment and/or prophylaxis to a subject in need thereof once processed, e.g., processed in a cell.
  • the nucleic acid encoding the therapeutic transgene is greater than: about 300 bp, about 400 bp, about 500 bp, about 600 bp, about 700 bp, about 800 bp, about 900 bp, about 1,000 bp, about 1,100 bp, about 1,200 bp, about 1,300 bp, about 1,400 bp, about 1,500 bp, about 1,600 bp, about 1,700 bp, about 1,800 bp, about 1,900 bp, about 2,000 bp, about 2,100 bp, about 2,200 bp, about 2,300 bp, about 2,400 bp, about 2,500 bp, about 2,600 bp, about 2,700 bp, about 2,800 bp, about 2,900 bp, or about 3,000 bp.
  • the nucleic acid encoding the therapeutic transgene is greater than about 300 bp (e.g., the therapeutic transgene is about 350 bp, about 400 bp, about 450 bp, about 500 bp, about 550 bp, about 600 bp, or about 650 bp). In certain embodiments, the nucleic acid encoding the therapeutic transgene is greater than about 650 bp (e.g., the therapeutic transgene is about 700 bp, about 750 bp, about 800 bp, about 850 bp, about 900 bp, about 950 bp, or about 1,000 bp).
  • the nucleic acid encoding the therapeutic transgene is greater than about 1 ,000 bp (e.g., the therapeutic transgene is about 1 ,500 bp, about 2,000 bp, about 2,500 bp, or about 3,000 bp). In certain embodiments, the nucleic acid encoding the therapeutic transgene is greater than about 3,000 bp (e.g., the therapeutic transgene is about 3,500 bp, about 4,000 bp, or about 4,500 bp).
  • the nucleic acid encoding the therapeutic transgene is greater than about 4,500 bp (e.g., the therapeutic transgene is about 5,000 bp, about 5,500 bp, about 6,000 bp, about 6,500 bp, about 7,000 bp, about 7,500 bp, about 8,000 bp, or about 8,500 bp).
  • the nucleic acid encoding the therapeutic transgene is greater than about 8,500 bp (e.g., the therapeutic transgene is about 9,000 bp, about 9,500 bp, or about 10,000 bp).
  • the nucleic acid encoding the therapeutic transgene is greater than about 10,000 bp (e.g., the therapeutic transgene is about 10,500 bp, about 11,000 bp, about 11,500 bp, about 12,000 bp, about 12,500 bp, about 13,000 bp, about 13,500 bp, about 14,000 bp, about 14,500 bp, or about 15,000 bp).
  • the nucleic acid encoding the therapeutic transgene is between about 4,000 bp and about 6,000 bp (e.g., the therapeutic transgene is about 4,000 bp, about 4,500 bp, about 5,000 bp, about 5,500 bp, or about 6,000 bp).
  • the therapeutic transgene encodes a therapeutic nucleic acid.
  • the therapeutic transgene may encode any therapeutic nucleic acid known in the art, for example, without limitation, any antisense RNA (single-stranded RNA), any small interfering RNA (double-stranded RNA), any RNA aptamer, and/or any messenger RNA (mRNA).
  • the therapeutic transgene can encode, without limitation, a miRNA, a miRNA mimic, a siRNA, a shRNA, a gRNA, a long noncoding RNA, an enhancer RNA, a RNA aptazyme, a RNA aptamer, an antagomiR, and/or a synthetic RNA.
  • a therapeutic nucleic acid may be a RNA binding site, e.g., a miRNA binding site.
  • Various other types of therapeutic nucleic acids are known to those of ordinary skill in the art.
  • the therapeutic transgene encodes a therapeutic polypeptide.
  • the therapeutic transgene may encode any therapeutic polypeptide known in the art, for example, without limitation, a therapeutic polypeptide that can replace a deficient or abnormal protein; a therapeutic polypeptide that can augment an existing pathway; a therapeutic polypeptide that can provide a novel function or activity (e.g., a novel function or activity beneficial to a subject suffering from the lack thereof); a therapeutic polypeptide that interferes with a molecule or an organism (e.g., an organism that is different to the organism that hosts the target cell); and/or a therapeutic polypeptide that delivers other compounds or proteins (e.g., a radionuclide, a cytotoxic drug, and/or an effector protein).
  • a therapeutic polypeptide that can replace a deficient or abnormal protein
  • a therapeutic polypeptide that can augment an existing pathway e.g., a novel function or activity beneficial to a subject suffering from the lack thereof
  • the therapeutic transgene can encode, without limitation, a nucleic acid modifying protein (e.g., an adenine or cytidine base editor) or system, an antibody or antibody-based drug, an anticoagulant, a blood factor, a bone morphogenetic protein, an engineered protein scaffold, an enzyme, an Fc fusion protein, a growth factor, a hormone, an interferon, an interleukin, and/or a thrombolytic.
  • a nucleic acid modifying protein e.g., an adenine or cytidine base editor
  • an antibody or antibody-based drug e.g., an anticoagulant, a blood factor, a bone morphogenetic protein, an engineered protein scaffold, an enzyme, an Fc fusion protein, a growth factor, a hormone, an interferon, an interleukin, and/or a thrombolytic.
  • an Fc fusion protein e.g., a growth factor, a hormone, an interferon,
  • the therapeutic transgene encodes a nucleic acid editing system or components thereof.
  • the therapeutic transgene encodes a protein comprising a nucleic acid binding protein (e.g., a zinc finger, a TALE, or a nucleic acid programmable nucleic acid binding protein, such as Cas9).
  • the nucleic acid editing system component is a nucleic acid programmable nucleic acid binding protein (e.g., Cas9).
  • the nucleic acid editing system component is a guide RNA (gRNA).
  • the therapeutic transgene encodes a CRISPR system.
  • the CRISPR system comprises a nucleobase editor comprising a polynucleotide programmable nucleotide binding domain and a nucleobase editing domain.
  • the nucleobase editing domain is an adenosine deaminase, cytidine deaminase, cytosine deaminase, or a functional variant thereof (e.g, a functional variant capable of deaminating a nucleobase in a nucleic acid molecule such as DNA or RNA).
  • the nucleobase editing domain is an adenosine deaminase.
  • the adenosine deaminase is ABE7.10.
  • the polynucleotide programmable nucleotide binding domain is a Cas9 polypeptide, a Cas12 polypeptide, or a functional variant thereof.
  • the CRISPR system further comprises a guide RNA (gRNA) or a nucleic acid encoding a gRNA.
  • the therapeutic transgene encodes a nucleobase modifying protein (e.g., a base editor protein). In some embodiments the therapeutic transgene encodes an adenosine base editor (e.g., ABE7.10). In some embodiments the therapeutic transgene encodes a cytidine base editor. In some embodiments the therapeutic transgene encodes a cytosine base editor capable of deaminating a cytosine in DNA or RNA.
  • a nucleobase modifying protein e.g., a base editor protein
  • the therapeutic transgene encodes an adenosine base editor (e.g., ABE7.10).
  • the therapeutic transgene encodes a cytidine base editor.
  • the therapeutic transgene encodes a cytosine base editor capable of deaminating a cytosine in DNA or RNA.
  • the therapeutic transgene encodes a nucleic acid editing system, e.g., a base editor system further described herein.
  • a recombinant rabies virus genome of the present disclosure described herein encodes a nucleic acid comprising a therapeutic transgene, wherein the therapeutic transgene encodes a therapeutic polypeptide and/or a therapeutic nucleic acid, e.g., in certain embodiments, the therapeutic transgene encodes a combination of the therapeutic polypeptide and the therapeutic nucleic acid.
  • the therapeutic transgene encodes one or more therapeutic polypeptides.
  • the therapeutic transgene encodes one or more therapeutic nucleic acids.
  • the therapeutic transgene encodes a combination of one or more therapeutic polypeptides and one or more therapeutic nucleic acids.
  • a therapeutic polypeptide may be delivered to a target cell, wherein the delivery is detargeted to certain other cell types.
  • a therapeutic transgene can encode a therapeutic polypeptide and/or therapeutic nucleic acid, and also comprise a miRNA binding site.
  • the miRNA binding site may function for cell type detargeting.
  • miRNA122a which is expressed exlusively in liver, can be employed for hepatocyte detargeting. See, e.g., Dhungel et al., Molecules (2016) 23(7): 1500.
  • the therapeutic transgene further encodes one or more reporter sequences.
  • Reporter sequences when expressed in the target cell, produces a directly or an indirectly detectable signal.
  • suitable reporter sequences include, without limitation, sequences encoding for fluorescent proteins (e.g., GFP, RFP, YFP), alkaline phosphatase, thymidine kinase, chloramphenicol acetyltransferase (CAT), luciferase, b-galactosidase (LacZ), and b-lactamase.
  • Sequences encoding for cell surface membrane- bound proteins may also be suitable as reporter sequences, for example, membrane-bound proteins to which high affinity antibodies bind, e.g., influenza hemagglutinin protein (HA), CD2, CD4, CD8, and others known to those of ordinary skill in the art, including, e.g., membrane- bound proteins tagged with an antigen domain (e.g., an HA tag, a FLAG tag, a Myc tag, a polyhistidine tag).
  • membrane-bound proteins to which high affinity antibodies bind e.g., influenza hemagglutinin protein (HA), CD2, CD4, CD8, and others known to those of ordinary skill in the art, including, e.g., membrane- bound proteins tagged with an antigen domain (e.g., an HA tag, a FLAG tag, a Myc tag, a polyhistidine tag).
  • an antigen domain e.g., an HA tag, a FLAG tag, a Myc tag, a poly
  • the therapeutic transgene does not encode a reporter gene and/or a selectable marker. In certain embodiments, the therapeutic transgene does not encode a fluorescent reporter protein (e.g., GFP, YFP, RFP, tdTomato). In certain embodiments, the therapeutic transgene does not encode b-galactosidase (LacZ). In certain embodiments, the therapeutic transgene does not encode chloramphenicol acetyltransferase (CAT).
  • a fluorescent reporter protein e.g., GFP, YFP, RFP, tdTomato
  • the therapeutic transgene does not encode b-galactosidase (LacZ). In certain embodiments, the therapeutic transgene does not encode chloramphenicol acetyltransferase (CAT).
  • the therapeutic transgene does not encode a polymerase (e.g., DNA polymerase, DNA-directed RNA polymerase, RNA-directed DNA polumerase (RT), telomerase).
  • a polymerase e.g., DNA polymerase, DNA-directed RNA polymerase, RNA-directed DNA polumerase (RT), telomerase.
  • the therapeutic transgene does not encode a site-specific recombinase (e.g., Cre, FLP, Hin, or Tre recombinases).
  • a site-specific recombinase e.g., Cre, FLP, Hin, or Tre recombinases.
  • the therapeutic transgene does not encode a viral antigen.
  • the therapeutic transgene does not encode a pro-apoptotic protein (e.g., cytochrome c). In certain embodiments, the therapeutic transgene does not encode an an immunoglobulin (e.g., an immunoglobulin heavy and/or light chain.
  • a pro-apoptotic protein e.g., cytochrome c
  • an immunoglobulin e.g., an immunoglobulin heavy and/or light chain.
  • the therapeutic transgene does not encode a neurotransmitter, a neuropeptide, a receptor, a neuronal growth factor, or a neurome gene.
  • the therapeutic transgene encodes for a therapeutic polypeptide and/or a therapeutic nucleic acid, wherein the therapeutic polypeptide and/or the therapeutic nucleic acid are secreted (e.g., secreted from a cell).
  • a recombinant rabies virus genome of the present disclosure described herein may be introduced into a target cell, wherein the recombinant rabies virus genome encodes a nucleic acid comprising a therapeutic transgene, and wherein the therapeutic transgene encodes a therapeutic polypeptide and/or a therapeutic nucleic acid that is secreted (e.g., a secretable therapeutic transgene and/or a secretable therapeutic nucleic acid).
  • the therapeutic polypeptide and/or nucleic acid upon expression may be secreted outside of the target cell.
  • the therapeutic polypeptide and/or nucleic acid, upon expression is secreted by virtue of endogenous elements that reside on the therapeutic polypeptide and/or nucleic acid (e.g., an endogenous signal peptide that directs extracellular secretion).
  • the therapeutic polypeptide and/or nucleic acid, upon expression is secreted by virtue of exogenous elements that reside on the therapeutic polypeptide and/or nucleic acid (e.g., an exogenous signal peptide that directs extracellular secretion). Delivery of secretable therapeutic polypeptides and/or nucleic acids are useful in the treatment of certain diseases.
  • lysosomal storage disorders that result from the metabolic dysfunction of the lysosome comprise a unique cross-correction characteristic that allows specific extracellular LSD enzymes to be taken up and targeted to the lysosomes of enzyme-deficient or enzyme-abnormal cells.
  • Cross-correction chracteristics of certain enzymes form the basis of approved therapies known as enzyme replacement therapies. See, e.g., Rastall and Amalfitano, Appl. Clin. Genet. (2015) 8: 157-169.
  • a recombinant rabies virus genome of the present disclosure comprises a transcriptional regulatory element operably linked to the nucleic acid encoding a transgene.
  • the transcriptional regulatory element is capable of controlling the expression of the transgene (e.g., expression of the encoded therapeutic polypeptide and/or nucleic acid) that is operably linked thereto.
  • the transcriptional regulatory element comprises a transcription initiation signal.
  • the transcription initiation signal can be endogenous or exogenous to the rabies virus.
  • the transcription initiation signal is a synthetic transcription initiation signal.
  • the nucleic acid encoding a transgene is further operably linked to a transcription termination polyadenylation signal.
  • the transcription termination polyadenylation signal can be endogenous or exogenous to the rabies virus.
  • the transcription termination polyadenylation signal is a synthetic transcription termination polyadenylation signal.
  • suitable transcription initiation signals and transcriptional termination polyadenylaton signals are known to those of ordinary skill in the art, and are described in, e.g., Albertini et al., Adv. Virus. Res. (2011 ) 79: 1 -22; Ogino and Green, Viruses (2019) 11 (6): 504; and Ogino and Green, Front. Microbiol. (2019) 10: 1490, the disclosures of which are herein incorporated by reference in their entireties.
  • a recombinant rabies virus genome of the present disclosure comprising a nucleic acid comprising a therapeutic transgene may further comprise any elements known to those of ordinary skill in the art that aid and/or enhance in the expression of the therapeutic transgene.
  • a recombinant rabies virus particle of the present disclosure comprises a rabies virus glycoprotein and a recombinant rabies virus genome comprising a nucleic acid comprising a therapeutic transgene as described herein.
  • the recombinant rabies virus particle comprises: a rabies virus glycoprotein; and a recombinant rabies virus genome comprising a nucleic acid comprising a therapeutic transgene, wherein the genome lacks an endogenous G gene encoding for a rabies virus glycoprotein.
  • the recombinant rabies virus particle comprises: a rabies virus glycoprotein; and a recombinant rabies virus genome comprising a nucleic acid comprising a therapeutic transgene, wherein the genome lacks an endogenous G gene encoding for a rabies virus glycoprotein; and wherein the genome lacks an endogenous L gene encoding for a rabies virus polymerase.
  • therapeutic transgenes useful in the methods and compositions described herein are nucleobase editors that edit, modify or alter a target nucleotide sequence of a polynucleotide.
  • Nucleobase editors described herein typically include a polynucleotide programmable nucleotide binding domain and a nucleobase editing domain (e.g., adenosine deaminase or cytidine deaminase).
  • a polynucleotide programmable nucleotide binding domain when in conjunction with a bound guide polynucleotide (e.g., gRNA), can specifically bind to a target polynucleotide sequence and thereby localize the base editor to the target nucleic acid sequence desired to be edited.
  • a bound guide polynucleotide e.g., gRNA
  • Polynucleotide programmable nucleotide binding domains bind polynucleotides (e.g., RNA, DNA).
  • a polynucleotide programmable nucleotide binding domain of a base editor can itself comprise one or more domains (e.g., one or more nuclease domains).
  • the nuclease domain of a polynucleotide programmable nucleotide binding domain can comprise an endonuclease or an exonuclease.
  • An endonuclease can cleave a single strand of a double-stranded nucleic acid or both strands of a double-stranded nucleic acid molecule.
  • a nuclease domain of a polynucleotide programmable nucleotide binding domain can cut zero, one, or two strands of a target polynucleotide.
  • Non-limiting examples of a polynucleotide programmable nucleotide binding domain which can be incorporated into a base editor include a CRISPR protein-derived domain, a restriction nuclease, a meganuclease, TAL nuclease (TALEN), and a zinc finger nuclease (ZFN).
  • a base editor comprises a polynucleotide programmable nucleotide binding domain comprising a natural or modified protein or portion thereof which via a bound guide nucleic acid is capable of binding to a nucleic acid sequence during CRISPR (i.e., Clustered Regularly Interspaced Short Palindromic Repeats)-mediated modification of a nucleic acid.
  • CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
  • CRISPR protein Such a protein is referred to herein as a “CRISPR protein.”
  • a base editor comprising a polynucleotide programmable nucleotide binding domain comprising all or a portion of a CRISPR protein (i.e. a base editor comprising as a domain all or a portion of a CRISPR protein, also referred to as a “CRISPR protein- derived domain” of the base editor).
  • a CRISPR protein-derived domain incorporated into a base editor can be modified compared to a wild-type or natural version of the CRISPR protein.
  • a CRISPR protein-derived domain can comprise one or more mutations, insertions, deletions, rearrangements and/or recombinations relative to a wild-type or natural version of the CRISPR protein.
  • Cas proteins that can be used herein include class 1 and class 2.
  • Non-limiting examples of Cas proteins include Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas5d, Cas5t, Cas5h, Cas5a, Cas6, Cas7, Cas8, Cas9 (also known as Csn1 or Csx12), Cas10, Csy1 , Csy2, Csy3, Csy4, Cse1, Cse2, Cse3, Cse4, Cse5e, Csd, Csc2, Csa5, Csn1, Csn2, Csm1, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1 , Csx1S,
  • a CRISPR enzyme can direct cleavage of one or both strands at a target sequence, such as within a target sequence and/or within a complement of a target sequence.
  • a CRISPR enzyme can direct cleavage of one or both strands within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 50, 100, 200, 500, or more base pairs from the first or last nucleotide of a target sequence.
  • a vector that encodes a CRISPR enzyme that is mutated to with respect, to a corresponding wild-type enzyme such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target polynucleotide containing a target sequence can be used.
  • a Cas protein e.g., Cas9, Cas12
  • a Cas domain e.g., Cas9, Cas12
  • Cas protein can refer to a polypeptide or domain with at least or at least about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity and/or sequence homology to a wild-type exemplary Cas polypeptide or Cas domain.
  • Cas e.g., Cas9, Cas12
  • a CRISPR protein-derived domain of a base editor can include all or a portion of Cas9 from Corynebacterium ulcerans (NCBI Refs: NC_015683.1, NC_017317.1); Corynebacterium diphtheria (NCBI Refs: NC_016782.1 , NC_016786.1); Spiroplasma syrphidicoia (NCBI Ref: NC .021284.1); Prevotella intermedia (NCBI Ref: NC_017861.1); Spiroplasma taiwanense (NCBI Ref: NC_021846.1); Streptococcus iniae (NCBI Ref: NC_021314.1); Belliella baltica (NCBI Ref: NC_018010.1); Psychroflexus torquis (NCBI Ref: NC_018721.1); Streptococcus thermophilus (NCBI Ref: YP_820832.1); Listeria innocua (NCBI Ref
  • Cas9 nuclease sequences and structures are well known to those of skill in the art (See, e.g., “Complete genome sequence of an Ml strain of Streptococcus pyogenes.” Ferretti et al., Proc. Natl. Acad. Sci. U.S.A.
  • Cas9 nucleases and sequences include Cas9 sequences from the organisms and loci disclosed in Chylinski, Rhun, and Charpentier, “The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems” (2013) RNA Biology 10:5, 726-737; the entire contents of which are incorporated herein by reference.
  • High fidelity Cas9 domains are known in the art and described, for example, in Kleinstiver, B.P., et al. “High-fidelity CRISPR-Cas9 nucleases with no detectable genome-wide off-target effects.” Nature 529, 490-495 (2016); and Slaymaker, I.M., et al. “Rationally engineered Cas9 nucleases with improved specificity.” Science 351, 84-88 (2015); the entire contents of each of which are incorporated herein by reference.
  • An Exemplary high fidelity Cas9 domain is provided in the Sequence Listing as SEQ ID NO: 1423.
  • high fidelity Cas9 domains are engineered Cas9 domains comprising one or more mutations that decrease electrostatic interactions between the Cas9 domain and the sugar-phosphate backbone of a DNA, relative to a corresponding wild-type Cas9 domain.
  • High fidelity Cas9 domains that have decreased electrostatic interactions with the sugar-phosphate backbone of DNA have less off-target effects.
  • the Cas9 domain e.g., a wild type Cas9 domain (SEQ ID NOs: 223 and 233)
  • a Cas9 domain comprises one or more mutations that decreases the association between the Cas9 domain and the sugar-phosphate backbone of DNA by at least 1%, at least 2%, at least 3%, at least 4%, at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, or at least 70%.
  • any of the Cas9 fusion proteins provided herein comprise one or more of a D10A, N497X, a R661X, a Q695X, and/or a Q926X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
  • the high fidelity Cas9 enzyme is SpCas9(K855A), eSpCas9(1.1), SpCas9-HF1 , or hyper accurate Cas9 variant (HypaCas9).
  • the modified Cas9 eSpCas9(1.1) contains alanine substitutions that weaken the interactions between the HNH/RuvC groove and the non-target DNA strand, preventing strand separation and cutting at off-target sites.
  • SpCas9-HF1 lowers off-target editing through alanine substitutions that disrupt Cas9's interactions with the DNA phosphate backbone.
  • HypaCas9 contains mutations (SpCas9 N692A/M694A/Q695A/H698A) in the REC3 domain that increase Cas9 proofreading and target discrimination. All three high fidelity enzymes generate less off-target editing than wildtype Cas9.
  • Cas9 proteins such as Cas9 from S. pyogenes (spCas9)
  • PAM protospacer adjacent motif
  • PAM-like motif is a 2-6 base pair DNA sequence immediately following the DNA sequence targeted by the Cas9 nuclease in the CRISPR bacterial adaptive immune system.
  • NGG PAM sequence is required to bind a particular nucleic acid region, where the “N” in “NGG” is adenosine (A), thymidine (T), or cytosine (C), and the G is guanosine. This may limit the ability to edit desired bases within a genome.
  • the base editing fusion proteins provided herein may need to be placed at a precise location, for example a region comprising a target base that is upstream of the PAM. See e.g., Komor, A.C., et al., “Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage” Nature 533, 420-424 (2016), the entire contents of which are hereby incorporated by reference.
  • Exemplary polypeptide sequences for spCas9 proteins capable of binding a PAM sequence are provided in the Sequenc Listing as SEQ ID NOs: 223, 234, and 1304-1307.
  • any of the fusion proteins provided herein may contain a Cas9 domain that is capable of binding a nucleotide sequence that does not contain a canonical (e.g., NGG) PAM sequence.
  • Cas9 domains that bind to non-canonical PAM sequences have been described in the art and would be apparent to the skilled artisan.
  • Cas9 domains that bind non-canonical PAM sequences have been described in Kleinstiver, B. P., et al., “Engineered CRISPR-Cas9 nucleases with altered PAM specificities” Nature 523, 481-485 (2015); and Kleinstiver, B.
  • the polynucleotide programmable nucleotide binding domain can comprise a nickase domain.
  • nickase refers to a polynucleotide programmable nucleotide binding domain comprising a nuclease domain that is capable of cleaving only one strand of the two strands in a duplexed nucleic acid molecule (e.g., DNA).
  • a nickase can be derived from a fully catalytically active (e.g., natural) form of a polynucleotide programmable nucleotide binding domain by introducing one or more mutations into the active polynucleotide programmable nucleotide binding domain.
  • a polynucleotide programmable nucleotide binding domain comprises a nickase domain derived from Cas9
  • the Cas9-derived nickase domain can include a D10A mutation and a histidine at position 840.
  • the residue H840 retains catalytic activity and can thereby cleave a single strand of the nucleic acid duplex.
  • a Cas9-derived nickase domain can comprise an H840A mutation, while the amino acid residue at position 10 remains a D.
  • a nickase can be derived from a fully catalytically active (e.g., natural) form of a polynucleotide programmable nucleotide binding domain by removing all or a portion of a nuclease domain that is not required for the nickase activity.
  • a polynucleotide programmable nucleotide binding domain comprises a nickase domain derived from Cas9
  • the Cas9-derived nickase domain can comprise a deletion of all or a portion of the RuvC domain or the HNH domain.
  • wild-type Cas9 corresponds to, or comprises the following amino acid sequence:
  • TKEVLDATLIHQSITGLYETRIDLSQLGGD (SEQ ID NO:223) (single underline: HNH domain; double underline: RuvC domain).
  • the strand of a nucleic acid duplex target polynucleotide sequence that is cleaved by a base editor comprising a nickase domain is the strand that is not edited by the base editor (i.e., the strand that is cleaved by the base editor is opposite to a strand comprising a base to be edited).
  • a base editor comprising a nickase domain (e.g., Cas9-derived nickase domain, Cas12-derived nickase domain) can cleave the strand of a DNA molecule which is being targeted for editing.
  • the non-targeted strand is not cleaved.
  • a Cas9 nuclease has an inactive (e.g., an inactivated) DNA cleavage domain, that is, the Cas9 is a nickase, referred to as an “nCas9” protein (for “nickase” Cas9).
  • the Cas9 nickase may be a Cas9 protein that is capable of cleaving only one strand of a duplexed nucleic acid molecule (e.g., a duplexed DNA molecule).
  • the Cas9 nickase cleaves the target strand of a duplexed nucleic acid molecule, meaning that the Cas9 nickase cleaves the strand that is base paired to (complementary to) a gRNA (e.g., an sgRNA) that is bound to the Cas9.
  • a Cas9 nickase comprises a D10A mutation and has a histidine at position 840.
  • the Cas9 nickase cleaves the non-target, non-base-edited strand of a duplexed nucleic acid molecule, meaning that the Cas9 nickase cleaves the strand that is not base paired to a gRNA (e.g., an sgRNA) that is bound to the Cas9.
  • a Cas9 nickase comprises an H840A mutation and has an aspartic acid residue at position 10, or a corresponding mutation.
  • the Cas9 nickase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the Cas9 nickases provided herein. Additional suitable Cas9 nickases will be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure.
  • nCas9 The amino acid sequence of an exemplary catalytically Cas9 nickase (nCas9) is as follows:
  • the Cas9 nuclease has two functional endonuclease domains: RuvC and HNH.
  • Cas9 undergoes a conformational change upon target binding that positions the nuclease domains to cleave opposite strands of the target DNA.
  • the end result of Cas9-mediated DNA cleavage is a double-strand break (DSB) within the target DNA ( ⁇ 3-4 nucleotides upstream of the PAM sequence).
  • the resulting DSB is then repaired by one of two general repair pathways: (1) the efficient but error-prone non-homologous end joining (NHEJ) pathway; or (2) the less efficient but high-fidelity homology directed repair (HDR) pathway.
  • NHEJ efficient but error-prone non-homologous end joining
  • HDR homology directed repair
  • the “efficiency” of non-homologous end joining (NHEJ) and/or homology directed repair (HDR) can be calculated by any convenient method.
  • efficiency can be expressed in terms of percentage of successful HDR.
  • a surveyor nuclease assay can be used to generate cleavage products and the ratio of products to substrate can be used to calculate the percentage.
  • a surveyor nuclease enzyme can be used that directly cleaves DNA containing a newly integrated restriction sequence as the result of successful HDR. More cleaved substrate indicates a greater percent HDR (a greater efficiency of HDR).
  • a fraction (percentage) of HDR can be calculated using the following equation [(cleavage products)/(substrate plus cleavage products)] (e.g., (b+c)/(a+b+c), where “a” is the band intensity of DNA substrate and “b” and “c” are the cleavage products).
  • efficiency can be expressed in terms of percentage of successful NHEJ.
  • a T7 endonuclease I assay can be used to generate cleavage products and the ratio of products to substrate can be used to calculate the percentage NHEJ.
  • T7 endonuclease I cleaves mismatched heteroduplex DNA which arises from hybridization of wild-type and mutant DNA strands (NHEJ generates small random insertions or deletions (indels) at the site of the original break). More cleavage indicates a greater percent NHEJ (a greater efficiency of NHEJ).
  • a fraction (percentage) of NHEJ can be calculated using the following equation: (1-(1-(b+c)/(a+b+c)) 1/2 )x100, where “a” is the band intensity of DNA substrate and “b” and “c” are the cleavage products (Ran et. a!., Cell. 2013 Sep. 12; 154(6): 1380-9; and Ran eta!., Nat Protoc. 2013 Nov.; 8(11): 2281-2308).
  • NHEJ repair pathway is the most active repair mechanism, and it frequently causes small nucleotide insertions or deletions (indels) at the DSB site.
  • the randomness of NHEJ-mediated DSB repair has important practical implications, because a population of cells expressing Cas9 and a gRNA or a guide polynucleotide can result in a diverse array of mutations.
  • NHEJ gives rise to small indels in the target DNA that result in amino acid deletions, insertions, or frameshift mutations leading to premature stop codons within the open reading frame (ORF) of the targeted gene.
  • ORF open reading frame
  • homology directed repair can be used to generate specific nucleotide changes ranging from a single nucleotide change to large insertions like the addition of a fluorophore or tag.
  • a DNA repair template containing the desired sequence can be delivered into the cell type of interest with the gRNA(s) and Cas9 or Cas9 nickase.
  • the repair template can contain the desired edit as well as additional homologous sequence immediately upstream and downstream of the target (termed left & right homology arms). The length of each homology arm can be dependent on the size of the change being introduced, with larger insertions requiring longer homology arms.
  • the repair template can be a single-stranded oligonucleotide, double-stranded oligonucleotide, or a double-stranded DNA plasmid.
  • the efficiency of HDR is generally low ( ⁇ 10% of modified alleles) even in cells that express Cas9, gRNA and an exogenous repair template.
  • the efficiency of HDR can be enhanced by synchronizing the cells, since HDR takes place during the S and G2 phases of the cell cycle. Chemically or genetically inhibiting genes involved in NHEJ can also increase HDR frequency.
  • Cas9 is a modified Cas9.
  • a given gRNA targeting sequence can have additional sites throughout the genome where partial homology exists. These sites are called off-targets and need to be considered when designing a gRNA.
  • CRISPR specificity can also be increased through modifications to Cas9.
  • Cas9 generates double-strand breaks (DSBs) through the combined activity of two nuclease domains, RuvC and HNH.
  • Cas9 nickase, a D10A mutant of SpCas9 retains one nuclease domain and generates a DNA nick rather than a DSB.
  • the nickase system can also be combined with HDR-mediated gene editing for specific gene edits.
  • base editors comprising a polynucleotide programmable nucleotide binding domain which is catalytically dead (/.e., incapable of cleaving a target polynucleotide sequence).
  • catalytically dead and “nuclease dead” are used interchangeably to refer to a polynucleotide programmable nucleotide binding domain which has one or more mutations and/or deletions resulting in its inability to cleave a strand of a nucleic acid.
  • a catalytically dead polynucleotide programmable nucleotide binding domain base editor can lack nuclease activity as a result of specific point mutations in one or more nuclease domains.
  • the Cas9 can comprise both a D10A mutation and an H840A mutation. Such mutations inactivate both nuclease domains, thereby resulting in the loss of nuclease activity.
  • a catalytically dead polynucleotide programmable nucleotide binding domain can comprise one or more deletions of all or a portion of a catalytic domain (e.g., RuvC1 and/or HNH domains).
  • a catalytically dead polynucleotide programmable nucleotide binding domain comprises a point mutation (e.g., D10A or H840A) as well as a deletion of all or a portion of a nuclease domain.
  • dCas9 domains are known in the art and described, for example, in Qi et al., “Repurposing CRISPR as an RNA-guided platform for sequence-specific control of gene expression.” Cell. 2013; 152(5): 1173-83, the entire contents of which are incorporated herein by reference.
  • nuclease-inactive dCas9 domains will be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure.
  • Such additional exemplary suitable nuclease-inactive Cas9 domains include, but are not limited to, D10A/H840A, D10A/D839A/H840A, and D10A/D839A/H840A/N863A mutant domains (See, e.g., Prashant etal., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature Biotechnology. 2013; 31(9): 833-838, the entire contents of which are incorporated herein by reference).
  • dCas9 corresponds to, or comprises in part or in whole, a Cas9 amino acid sequence having one or more mutations that inactivate the Cas9 nuclease activity.
  • the nuclease-inactive dCas9 domain comprises a D10X mutation and a H840X mutation of the amino acid sequence set forth herein, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid change.
  • the nuclease-inactive dCas9 domain comprises a D10A mutation and a H840A mutation of the amino acid sequence set forth herein, or a corresponding mutation in any of the amino acid sequences provided herein.
  • a nuclease-inactive Cas9 domain comprises the amino acid sequence set forth in Cloning vector pPlatTET-gRNA2 (Accession No. BAV54124).
  • a variant Cas9 protein can cleave the complementary strand of a guide target sequence but has reduced ability to cleave the non-complementary strand of a double stranded guide target sequence.
  • the variant Cas9 protein can have a mutation (amino acid substitution) that reduces the function of the RuvC domain.
  • a variant Cas9 protein has a D10A (aspartate to alanine at amino acid position 10) and can therefore cleave the complementary strand of a double stranded guide target sequence but has reduced ability to cleave the non- complementary strand of a double stranded guide target sequence (thus resulting in a single strand break (SSB) instead of a double strand break (DSB) when the variant Cas9 protein cleaves a double stranded target nucleic acid) (see, for example, Jinek et al., Science. 2012 Aug. 17; 337(6096):816-21).
  • SSB single strand break
  • DSB double strand break
  • a variant Cas9 protein can cleave the non-complementary strand of a double stranded guide target sequence but has reduced ability to cleave the complementary strand of the guide target sequence.
  • the variant Cas9 protein can have a mutation (amino acid substitution) that reduces the function of the HNH domain (RuvC/HNH/RuvC domain motifs).
  • the variant Cas9 protein has an H840A (histidine to alanine at amino acid position 840) mutation and can therefore cleave the non-complementary strand of the guide target sequence but has reduced ability to cleave the complementary strand of the guide target sequence (thus resulting in a SSB instead of a DSB when the variant Cas9 protein cleaves a double stranded guide target sequence).
  • H840A histidine to alanine at amino acid position 840
  • Such a Cas9 protein has a reduced ability to cleave a guide target sequence (e.g., a single stranded guide target sequence) but retains the ability to bind a guide target sequence (e.g., a single stranded guide target sequence).
  • the variant Cas9 protein harbors W476A and W1126A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors P475A, W476A, N477A, D1125A, W1126A, and D1127A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors H840A, W476A, and W1126A, mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors H840A, D10A, W476A, and W1126A, mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • Such a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 has restored catalytic His residue at position 840 in the Cas9 HNH domain (A840H).
  • the variant Cas9 protein harbors, H840A, P475A, W476A, N477A, D1125A, W1126A, and D1127A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors D10A, H840A, P475A, W476A, N477A, D1125A, W1126A, and D1127A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein when a variant Cas9 protein harbors W476A and W1126A mutations or when the variant Cas9 protein harbors P475A, W476A, N477A, D1125A, W1126A, and D1127A mutations, the variant Cas9 protein does not bind efficiently to a PAM sequence. Thus, in some such embodiments, when such a variant Cas9 protein is used in a method of binding, the method does not require a PAM sequence.
  • the method when such a variant Cas9 protein is used in a method of binding, can include a guide RNA, but the method can be performed in the absence of a PAM sequence (and the specificity of binding is therefore provided by the targeting segment of the guide RNA).
  • Other residues can be mutated to achieve the above effects (/.e., inactivate one or the other nuclease portions).
  • residues D10, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and/or A987 can be altered (/.e., substituted).
  • mutations other than alanine substitutions are suitable.
  • a variant Cas9 protein that has reduced catalytic activity e.g., when a Cas9 protein has a D10, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and/or a A987 mutation, e.g., D10A, G12A, G17A, E762A, H840A, N854A, N863A, H982A, H983A, A984A, and/or D986A), the variant Cas9 protein can still bind to target DNA in a site-specific manner (because it is still guided to a target DNA sequence by a guide RNA) as long as it retains the ability to interact with the guide RNA.
  • the variant Cas9 protein can still bind to target DNA in a site-specific manner (because it is still guided to a target DNA sequence by a guide RNA) as long as it retains the ability to interact with the guide RNA.
  • the variant Cas protein can be spCas9, spCas9-VRQR, spCas9-VRER, xCas9 (sp), saCas9, saCas9-KKH, spCas9-MQKSER, spCas9-LRKIQK, or spCas9-LRVSQL.
  • the Cas9 domain is a Cas9 domain from Staphylococcus aureus (SaCas9).
  • the SaCas9 domain is a nuclease active SaCas9, a nuclease inactive SaCas9 (SaCas9d), or a SaCas9 nickase (SaCas9n).
  • the SaCas9 comprises a N579A mutation, or a corresponding mutation in any of the amino acid sequences provided in the Sequence Listing submitted herewith.
  • the SaCas9 domain, the SaCas9d domain, or the SaCas9n domain can bind to a nucleic acid sequence having a non-canonical PAM. In some embodiments, the SaCas9 domain, the SaCas9d domain, or the SaCas9n domain can bind to a nucleic acid sequence having a NNGRRT or a NNGRRV PAM sequence. In some embodiments, the SaCas9 domain comprises one or more of a E781X, a N967X, and a R1014X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
  • the SaCas9 domain comprises one or more of a E781 K, a N967K, and a R1014H mutation, or one or more corresponding mutation in any of the amino acid sequences provided herein. In some embodiments, the SaCas9 domain comprises a E781K, a N967K, or a R1014H mutation, or corresponding mutations in any of the amino acid sequences provided herein.
  • one of the Cas9 domains present in the fusion protein may be replaced with a guide nucleotide sequence-programmable DNA-binding protein domain that has no requirements for a PAM sequence.
  • the Cas9 is an SaCas9. Residue A579 of SaCas9 can be mutated from N579 to yield a SaCas9 nickase. Residues K781, K967, and H1014 can be mutated from E781, N967, and R1014 to yield a SaKKH Cas9.
  • a modified SpCas9 including amino acid substitutions D1135M, S1136Q, G1218K, E1219F, A1322R, D1332A, R1335E, and T1337R (SpCas9-MQKFRAER) and having specificity for the altered PAM 5'-NGC-3' was used.
  • CRISPR/Cpf1 is a DNA-editing technology analogous to the CRISPR/Cas9 system.
  • Cpf1 is an RNA-guided endonuclease of a class II CRISPR/Cas system. This acquired immune mechanism is found in Prevotella and Francisella bacteria.
  • Cpfl genes are associated with the CRISPR locus, coding for an endonuclease that use a guide RNA to find and cleave viral DNA.
  • Cpfl is a smaller and simpler endonuclease than Cas9, overcoming some of the CRISPR/Cas9 system limitations. Unlike Cas9 nucleases, the result of Cpfl- mediated DNA cleavage is a double-strand break with a short 3' overhang. Cpfl ’s staggered cleavage pattern can open up the possibility of directional gene transfer, analogous to traditional restriction enzyme cloning, which can increase the efficiency of gene editing. Like the Cas9 variants and orthologues described above, Cpfl can also expand the number of sites that can be targeted by CRISPR to AT-rich regions or AT-rich genomes that lack the NGG PAM sites favored by SpCas9.
  • the Cpfl locus contains a mixed alpha/beta domain, a RuvC-l followed by a helical region, a RuvC-ll and a zinc finger-like domain.
  • the Cpfl protein has a RuvC-like endonuclease domain that is similar to the RuvC domain of Cas9.
  • Cpfl unlike Cas9, does not have a HNH endonuclease domain, and the N-terminal of Cpfl does not have the alpha-helical recognition lobe of Cas9.
  • Cpfl CRISPR- Cas domain architecture shows that Cpfl is functionally unique, being classified as Class 2, type V CRISPR system.
  • the Cpfl loci encode Cas1 , Cas2 and Cas4 proteins that are more similar to types I and III than type II systems. Functional Cpfl does not require the transactivating CRISPR RNA (tracrRNA), therefore, only CRISPR (crRNA) is required.
  • Cpfl is not only smaller than Cas9, but also it has a smaller sgRNA molecule (approximately half as many nucleotides as Cas9).
  • the Cpfl -crRNA complex cleaves target DNA or RNA by identification of a protospacer adjacent motif 5'-YTN- 3' or 5'-TTN-3' in contrast to the G-rich PAM targeted by Cas9. After identification of PAM, Cpfl introduces a sticky-end-like DNA double- stranded break having an overhang of 4 or 5 nucleotides.
  • the Cas9 is a Cas9 variant having specificity for an altered PAM sequence.
  • the Additional Cas9 variants and PAM sequences are described in Miller, S.M., etal. Continuous evolution of SpCas9 variants compatible with non- G PAMs, Nat. Biotechnol. (2020), the entirety of which is incorporated herein by reference in some embodiments, a Cas9 variate have no specific PAM requirements.
  • a Cas9 variant e.g. a SpCas9 variant has specificity for a NRNH PAM, wherein R is A or G and H is A, C, or T.
  • the SpCas9 variant has specificity for a PAM sequence AAA, TAA, CAA, GAA, TAT, GAT, or CAC.
  • the SpCas9 variant comprises an amino acid substitution at position 1114, 1134, 1135, 1137, 1139, 1151, 1180, 1188, 1211, 1218, 1219, 1221, 1249, 1256, 1264, 1290, 1318, 1317, 1320, 1321, 1323, 1332, 1333, 1335, 1337, or 1339 or a corresponding position thereof.
  • the SpCas9 variant comprises an amino acid substitution at position 1114, 1135, 1218, 1219, 1221, 1249, 1320, 1321, 1323, 1332, 1333, 1335, or 1337 or a corresponding position thereof. In some embodiments, the SpCas9 variant comprises an amino acid substitution at position 1114, 1134, 1135, 1137, 1139, 1151, 1180, 1188, 1211, 1219, 1221, 1256, 1264, 1290, 1318, 1317, 1320, 1323, 1333 or a corresponding position thereof.
  • the SpCas9 variant comprises an amino acid substitution at position 1114, 1131, 1135, 1150, 1156, 1180, 1191, 1218, 1219, 1221, 1227, 1249, 1253, 1286, 1293, 1320, 1321, 1332, 1335, 1339 or a corresponding position thereof.
  • the SpCas9 variant comprises an amino acid substitution at position 1114, 1127, 1135, 1180, 1207, 1219, 1234, 1286, 1301, 1332, 1335, 1337, 1338, 1349 or a corresponding position thereof.
  • Exemplary amino acid substitutions and PAM specificity of SpCas9 variants are shown in Tables 2A-2D.
  • the nucleic acid programmable DNA binding protein is a single effector of a microbial CRISPR-Cas system.
  • Single effectors of microbial CRISPR-Cas systems include, without limitation, Cas9, Cpf1, Cas12b/C2c1, and Cas12c/C2c3.
  • microbial CRISPR-Cas systems are divided into Class 1 and Class 2 systems. Class 1 systems have multisubunit effector complexes, while Class 2 systems have a single protein effector.
  • Cas9 and Cpf1 are Class 2 effectors.
  • Cas12b/C2c1 depends on both CRISPR RNA and tracrRNA for DNA cleavage.
  • the napDNAbp is a circular permutant (e.g., SEQ ID NO: 257).
  • the crystal structure of AlicyclobacciHus acidoterrastris Cas12b/C2c1 has been reported in complex with a chimeric single-molecule guide RNA (sgRNA). See e.g., Liu et al., “C2c1 -sgRNA Complex Structure Reveals RNA-Guided DNA Cleavage Mechanism”, Mol. Cell, 2017 Jan. 19; 65(2):310-322, the entire contents of which are hereby incorporated by reference.
  • the crystal structure has also been reported in AlicyclobaciHus acidoterrestris C2c1 bound to target DNAs as ternary complexes.
  • the nucleic acid programmable DNA binding protein (napDNAbp) of any of the fusion proteins provided herein may be a Cas12b/C2c1, or a Cas12c/C2c3 protein.
  • the napDNAbp is a Cas12b/C2c1 protein.
  • the napDNAbp is a Cas12c/C2c3 protein.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to a naturally-occurring Cas12b/C2c1 or Cas12c/C2c3 protein.
  • the napDNAbp is a naturally-occurring Cas12b/C2c1 or Cas12c/C2c3 protein.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to any one of the napDNAbp sequences provided herein. It should be appreciated that Cas12b/C2c1 or Cas12c/C2c3 from other bacterial species may also be used in accordance with the present disclosure.
  • a napDNAbp refers to Cas12c.
  • the Cas12c protein is a Cas12c1 (SEQ ID NO: 266) or a variant of Cas12c1.
  • the Cas12 protein is a Cas12c2 (SEQ ID NO: 267) or a variant of Cas12c2.
  • the Cas12 protein is a Cas12c protein from Oleiphilus sp. HI0009 ( i.e ., OspCas12c; SEQ ID NO: 268) or a variant of OspCas12c.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally-occurring Cas12c1, Cas12c2, or OspCas12c protein.
  • the napDNAbp is a naturally-occurring Cas12c1, Cas12c2, or OspCas12c protein.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to any Cas12c1 , Cas12c2, or OspCas12c protein described herein. It should be appreciated that Cas12c1 , Cas12c2, or OspCas12c from other bacterial species may also be used in accordance with the present disclosure.
  • a napDNAbp refers to Cas12g, Cas12h, or Cas12i, which have been described in, for example, Yan etal., “Functionally Diverse Type V CRISPR-Cas Systems,” Science, 2019 Jan. 4; 363: 88-91 ; the entire contents of each is hereby incorporated by reference.
  • Exemplary Cas12g, Cas12h, and Cas12i polypeptide sequences are provided in the Sequence Listing as SEQ ID NOs: 269-272.
  • the Cas12 protein is a Cas12g or a variant of Cas12g. In some embodiments, the Cas12 protein is a Cas12h or a variant of Cas12h. In some embodiments, the Cas12 protein is a Cas12i or a variant of Cas12i. It should be appreciated that other RNA-guided DNA binding proteins may be used as a napDNAbp, and are within the scope of this disclosure.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally-occurring Cas12g, Cas12h, or Cas12i protein.
  • the napDNAbp is a naturally-occurring Cas12g, Cas12h, or Cas12i protein.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to any Cas12g, Cas12h, or Cas12i protein described herein. It should be appreciated that Cas12g, Cas12h, or Cas12i from other bacterial species may also be used in accordance with the present disclosure. In some embodiments, the Cas12i is a Cas12i1 or a Cas12i2.
  • the nucleic acid programmable DNA binding protein (napDNAbp) of any of the fusion proteins provided herein may be a Cas12j/Cas ⁇ t> protein.
  • Cas12j/Cas ⁇ t> is described in Pausch etal., “CRISPR-CasO from huge phages is a hypercompact genome editor,” Science, 17 July 2020, Vol. 369, Issue 6501, pp. 333-337, which is incorporated herein by reference in its entirety.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to a naturally-occurring Cas12j/CasO protein.
  • the napDNAbp is a naturally-occurring Cas12j/CasO protein.
  • the napDNAbp is a nuclease inactive (“dead”) Cas12j/Cas ⁇ t> protein. It should be appreciated that Cas12j/Cas ⁇ t> from other species may also be used in accordance with the present disclosure.
  • fusion proteins comprising a heterologous polypeptide fused to a nucleic acid programmable nucleic acid binding protein, for example, a napDNAbp.
  • a heterologous polypeptide can be a polypeptide that is not found in the native or wild-type napDNAbp polypeptide sequence.
  • the heterologous polypeptide can be fused to the napDNAbp at a C-terminal end of the napDNAbp, an N-terminal end of the napDNAbp, or inserted at an internal location of the napDNAbpln some embodiments, the heterologous polypeptide is a deaminase (e.g., cytidine of adenosine deaminase) or a functional fragment thereof.
  • a fusion protein can comprise a deaminase flanked by an N- terminal fragment and a C-terminal fragment of a Cas9 orCas12 (e.g., Cas12b/C2c1), polypeptide.
  • the cytidine deaminase is an APOBEC deaminase (e.g., APOBEC1).
  • the adenosine deaminase is a TadA (e.g., TadA*7.10 or TadA*8).
  • the TadA is a TadA*8 or a TadA*9.
  • TadA sequences e.g., TadA7.10 or TadA*8) as described herein are suitable deaminases for the above-described fusion proteins.
  • the fusion protein comprises the structure:
  • the deaminase can be a circular permutant deaminase.
  • the deaminase can be a circular permutant adenosine deaminase.
  • the deaminase is a circular permutant TadA, circularly permutated at amino acid residue 116, 136, or 65 as numbered in the TadA reference sequence.
  • the fusion protein can comprise more than one deaminase.
  • the fusion protein can comprise, for example, 1 , 2, 3, 4, 5 or more deaminases.
  • the fusion protein comprises one or two deaminase.
  • the two or more deaminases in a fusion protein can be an adenosine deaminase, a cytidine deaminase, or a combination thereof.
  • the two or more deaminases can be homodimers or heterodimers.
  • the two or more deaminases can be inserted in tandem in the napDNAbp. In some embodiments, the two or more deaminases may not be in tandem in the napDNAbp.
  • the napDNAbp in the fusion protein is a Cas9 polypeptide or a fragment thereof.
  • the Cas9 polypeptide can be a variant Cas9 polypeptide.
  • the Cas9 polypeptide is a Cas9 nickase (nCas9) polypeptide or a fragment thereof.
  • the Cas9 polypeptide is a nuclease dead Cas9 (dCas9) polypeptide or a fragment thereof.
  • the Cas9 polypeptide in a fusion protein can be a full-length Cas9 polypeptide. In some cases, the Cas9 polypeptide in a fusion protein may not be a full length Cas9 polypeptide.
  • the Cas9 polypeptide can be truncated, for example, at a N-terminal or C-terminal end relative to a naturally-occurring Cas9 protein.
  • the Cas9 polypeptide can be a circularly permuted Cas9 protein.
  • the Cas9 polypeptide can be a fragment, a portion, or a domain of a Cas9 polypeptide, that is still capable of binding the target polynucleotide and a guide nucleic acid sequence.
  • the Cas9 polypeptide is a Streptococcus pyogenes Cas9 (SpCas9), Staphylococcus aureus Cas9 (SaCas9), Streptococcus thermophilus 1 Cas9 (St1 Cas9), or fragments or variants of any of the Cas9 polypeptides described herein.
  • SpCas9 Streptococcus pyogenes Cas9
  • SaCas9 Staphylococcus aureus Cas9
  • St1 Cas9 Streptococcus thermophilus 1 Cas9
  • the fusion protein comprises an adenosine deaminase domain and a cytidine deaminase domain inserted within a Cas9.
  • an adenosine deaminase is fused within a Cas9 and a cytidine deaminase is fused to the C-terminus.
  • an adenosine deaminase is fused within Cas9 and a cytidine deaminase fused to the N-terminus.
  • a cytidine deaminase is fused within Cas9 and an adenosine deaminase is fused to the C-terminus. In some embodiments, a cytidine deaminase is fused within Cas9 and an adenosine deaminase fused to the N-terminus.
  • Exemplary structures of a fusion protein with an adenosine deaminase and a cytidine deaminase and a Cas9 are provided as follows:
  • the used in the general architecture above indicates the presence of an optional linker.
  • the catalytic domain has DNA modifying activity (e.g., deaminase activity), such as adenosine deaminase activity.
  • the adenosine deaminase is a TadA (e.g., TadA*7.10).
  • the TadA is a TadA*8.
  • a TadA*8 is fused within Cas9 and a cytidine deaminase is fused to the C-terminus.
  • a TadA*8 is fused within Cas9 and a cytidine deaminase fused to the N- terminus.
  • a cytidine deaminase is fused within Cas9 and a Tad A* 8 is fused to the C-terminus. In some embodiments, a cytidine deaminase is fused within Cas9 and a TadA*8 fused to the N-terminus.
  • Exemplary structures of a fusion protein with a TadA*8 and a cytidine deaminase and a Cas9 are provided as follows:
  • the used in the general architecture above indicates the presence of an optional linker.
  • the heterologous polypeptide e.g., deaminase
  • the heterologous polypeptide can be inserted in the napDNAbp (e.g., Cas9 or Cas12 (e.g., Cas12b/C2c1 )) at a suitable location, for example, such that the napDNAbp retains its ability to bind the target polynucleotide and a guide nucleic acid.
  • a deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • a deaminase can be inserted into a napDNAbp without compromising function of the deaminase (e.g., base editing activity) or the napDNAbp (e.g., ability to bind to target nucleic acid and guide nucleic acid).
  • a deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • a deaminase can be inserted in the napDNAbp at, for example, a disordered region or a region comprising a high temperature factor or B-factor as shown by crystallographic studies. Regions of a protein that are less ordered, disordered, or unstructured, for example solvent exposed regions and loops, can be used for insertion without compromising structure or function.
  • a deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase)can be inserted in the napDNAbp in a flexible loop region or a solvent- exposed region.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the insertion location of a deaminase is determined by B-factor analysis of the crystal structure of Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted in regions of the Cas9 polypeptide comprising higher than average B-factors (e.g., higher B factors compared to the total protein or the protein domain comprising the disordered region).
  • B-factor or temperature factor can indicate the fluctuation of atoms from their average position (for example, as a result of temperature-dependent atomic vibrations or static disorder in a crystal lattice).
  • a high B-factor (e.g., higher than average B-factor) for backbone atoms can be indicative of a region with relatively high local mobility. Such a region can be used for inserting a deaminase without compromising structure or function.
  • a deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • a deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) can be inserted at a location with a residue having a Ca atom with a B-factor that is 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, 200% or greater than 200% more than the average B-factor for a Cas9 protein domain comprising the residue.
  • a B-factor that is 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, 200% or greater than 200% more than the average B-factor for a Cas9 protein domain comprising the residue.
  • Cas9 polypeptide positions comprising a higher than average B-factor can include, for example, residues 768, 792, 1052, 1015, 1022, 1026, 1029, 1067, 1040, 1054, 1068, 1246, 1247, and 1248 as numbered in the above Cas9 reference sequence.
  • Cas9 polypeptide regions comprising a higher than average B-factor can include, for example, residues 792-872, 792-906, and 2-791 as numbered in the above Cas9 reference sequence.
  • a heterologous polypeptide e.g., deaminase
  • the heterologous polypeptide is inserted between amino acid positions 768-769, 791-792, 792-793, 1015-1016, 1022-1023, 1026-1027, 1029-1030, 1040- 1041, 1052-1053, 1054-1055, 1067-1068, 1068-1069, 1247-1248, or 1248-1249 as numbered in the above Cas9 reference sequence or corresponding amino acid positions thereof.
  • the heterologous polypeptide is inserted between amino acid positions 769-770, 792-793, 793-794, 1016-1017, 1023-1024, 1027-1028, 1030-1031, 1041-1042, 1053-1054, 1055- 1056, 1068-1069, 1069-1070, 1248-1249, or 1249-1250 as numbered in the above Cas9 reference sequence or corresponding amino acid positions thereof.
  • the heterologous polypeptide replaces an amino acid residue selected from the group consisting of: 768, 791, 792, 1015, 1016, 1022, 1023, 1026, 1029, 1040, 1052, 1054, 1067, 1068, 1069, 1246, 1247, and 1248 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide. It should be understood that the reference to the above Cas9 reference sequence with respect to insertion positions is for illustrative purposes.
  • the insertions as discussed herein are not limited to the Cas9 polypeptide sequence of the above Cas9 reference sequence, but include insertion at corresponding locations in variant Cas9 polypeptides, for example a Cas9 nickase (nCas9), nuclease dead Cas9 (dCas9), a Cas9 variant lacking a nuclease domain, a truncated Cas9, or a Cas9 domain lacking partial or complete HNH domain.
  • nCas9 Cas9 nickase
  • dCas9 nuclease dead Cas9
  • Cas9 variant lacking a nuclease domain for example a Cas9 nickase (nCas9), nuclease dead Cas9 (dCas9), a Cas9 variant lacking a nuclease domain, a truncated Cas9, or a Cas9 domain lacking partial or complete HNH domain.
  • a heterologous polypeptide (e.g., deaminase) can be inserted in the napDNAbp at an amino acid residue selected from the group consisting of: 768, 792, 1022, 1026, 1040, 1068, and 1247 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the heterologous polypeptide is inserted between amino acid positions 768-769, 792-793, 1022-1023, 1026-1027, 1029-1030, 1040-1041,
  • the heterologous polypeptide is inserted between amino acid positions 769-770, 793-794, 1023-1024, 1027-1028, 1030-1031, 1041-1042,
  • the heterologous polypeptide replaces an amino acid residue selected from the group consisting of: 768, 792, 1022, 1026, 1040, 1068, and 1247 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • a heterologous polypeptide (e.g., deaminase) can be inserted in the napDNAbp at an amino acid residue as described herein, or a corresponding amino acid residue in another Cas9 polypeptide.
  • a heterologous polypeptide e.g., deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) can be inserted at the N-terminus or the C- terminus of the residue or replace the residue.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • an adenosine deaminase (e.g., TadA) is inserted at an amino acid residue selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247, 1054, 1026, 768, 1067, 1248, 1052, and 1246 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • an adenosine deaminase e.g., TadA
  • the adenosine deaminase is inserted at the N-terminus of an amino acid selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247, 1054, 1026, 768, 1067, 1248, 1052, and 1246 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the adenosine deaminase is inserted at the C-terminus of an amino acid selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247, 1054, 1026, 768, 1067, 1248, 1052, and 1246 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the adenosine deaminase is inserted to replace an amino acid selected from the group consisting of: 1015, 1022, 1029, 1040,
  • a cytidine deaminase (e.g., APOBEC1) is inserted at an amino acid residue selected from the group consisting of: 1016, 1023, 1029, 1040, 1069, and 1247 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the cytidine deaminase is inserted at the N- terminus of an amino acid selected from the group consisting of: 1016, 1023, 1029, 1040, 1069, and 1247 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the cytidine deaminase is inserted at the C-terminus of an amino acid selected from the group consisting of: 1016, 1023, 1029, 1040,
  • the cytidine deaminase is inserted to replace an amino acid selected from the group consisting of: 1016, 1023, 1029, 1040, 1069, and 1247 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 768 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N- terminus of amino acid residue 768 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 768 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 768 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 791 or is inserted at amino acid residue 792, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N-terminus of amino acid residue 791 or is inserted at the N-terminus of amino acid 792, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid 791 or is inserted at the N- terminus of amino acid 792, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid 791, or is inserted to replace amino acid 792, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 1016 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N- terminus of amino acid residue 1016 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 1016 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 1016 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 1022, or is inserted at amino acid residue 1023, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N-terminus of amino acid residue 1022 or is inserted at the N-terminus of amino acid residue 1023, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 1022 or is inserted at the C-terminus of amino acid residue 1023, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 1022, or is inserted to replace amino acid residue 1023, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 1026, or is inserted at amino acid residue 1029, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N-terminus of amino acid residue 1026 or is inserted at the N-terminus of amino acid residue 1029, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 1026 or is inserted at the C-terminus of amino acid residue 1029, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 1026, or is inserted to replace amino acid residue 1029, as numbered in the above Cas9 reference sequence, or corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 1040 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N- terminus of amino acid residue 1040 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 1040 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 1040 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 1052, or is inserted at amino acid residue 1054, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N-terminus of amino acid residue 1052 or is inserted at the N-terminus of amino acid residue 1054, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 1052 or is inserted at the C-terminus of amino acid residue 1054, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 1052, or is inserted to replace amino acid residue 1054, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted at amino acid residue 1067, or is inserted at amino acid residue 1068, or is inserted at amino acid residue 1069, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted at the N-terminus of amino acid residue 1067 or is inserted at the N-terminus of amino acid residue 1068 or is inserted at the N-terminus of amino acid residue 1069, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted at the C-terminus of amino acid residue 1067 or is inserted at the C-terminus of amino acid residue 1068 or is inserted at the C-terminus of amino acid residue 1069, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted to replace amino acid residue 1067, or is inserted to replace amino acid residue 1068, or is inserted to replace amino acid residue 1069, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted at amino acid residue 1246, or is inserted at amino acid residue 1247, or is inserted at amino acid residue 1248, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted at the N-terminus of amino acid residue 1246 or is inserted at the N-terminus of amino acid residue 1247 or is inserted at the N-terminus of amino acid residue 1248, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted at the C-terminus of amino acid residue 1246 or is inserted at the C-terminus of amino acid residue 1247 or is inserted at the C-terminus of amino acid residue 1248, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted to replace amino acid residue 1246, or is inserted to replace amino acid residue 1247, or is inserted to replace amino acid residue 1248, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • a heterologous polypeptide e.g., deaminase
  • the flexible loop portions can be selected from the group consisting of 530-537, 569-570, 686-691, 943-947, 1002-1025, 1052-1077, 1232-1247, or 1298- 1300 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the flexible loop portions can be selected from the group consisting of: 1-529, 538-568, 580-685, 692-942, 948-1001, 1026-1051 , 1078-1231, or 1248-1297 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • a heterologous polypeptide e.g., adenine deaminase
  • a heterologous polypeptide can be inserted into a Cas9 polypeptide region corresponding to amino acid residues: 1017-1069, 1242-1247, 1052-1056, 1060-1077, 1002 - 1003, 943-947, 530-537, 568-579, 686-691, 1242-1247, 1298 - 1300, 1066- 1077, 1052-1056, or 1060-1077 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • a heterologous polypeptide (e.g., adenine deaminase) can be inserted in place of a deleted region of a Cas9 polypeptide.
  • the deleted region can correspond to an N-terminal or C- terminal portion of the Cas9 polypeptide.
  • the deleted region corresponds to residues 792-872 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deleted region corresponds to residues 792-906 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deleted region corresponds to residues 2-791 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide. In some embodiments, the deleted region corresponds to residues 1017-1069 as numbered in the above Cas9 reference sequence, or corresponding amino acid residues thereof.
  • a heterologous polypeptide (e.g., deaminase) can be inserted within a structural or functional domain of a Cas9 polypeptide.
  • a heterologous polypeptide (e.g., deaminase) can be inserted between two structural or functional domains of a Cas9 polypeptide.
  • a heterologous polypeptide (e.g., deaminase) can be inserted in place of a structural or functional domain of a Cas9 polypeptide, for example, after deleting the domain from the Cas9 polypeptide.
  • the structural or functional domains of a Cas9 polypeptide can include, for example, RuvC I, RuvC II, RuvC III, Red, Rec2, PI, or HNH.
  • the Cas9 polypeptide lacks one or more domains selected from the group consisting of: RuvC I, RuvC II, RuvC III, Red, Rec2, PI, or HNH domain. In some embodiments, the Cas9 polypeptide lacks a nuclease domain. In some embodiments, the Cas9 polypeptide lacks an HNH domain. In some embodiments, the Cas9 polypeptide lacks a portion of the HNH domain such that the Cas9 polypeptide has reduced or abolished HNH activity. In some embodiments, the Cas9 polypeptide comprises a deletion of the nuclease domain, and the deaminase is inserted to replace the nuclease domain.
  • the HNH domain is deleted and the deaminase is inserted in its place.
  • one or more of the RuvC domains is deleted and the deaminase is inserted in its place.
  • a fusion protein comprising a heterologous polypeptide can be flanked by a N-terminal and a C-terminal fragment of a napDNAbp.
  • the fusion protein comprises a deaminase flanked by a N- terminal fragment and a C-terminal fragment of a Cas9 polypeptide. The N terminal fragment or the C terminal fragment can bind the target polynucleotide sequence.
  • the C-terminus of the N terminal fragment or the N-terminus of the C terminal fragment can comprise a part of a flexible loop of a Cas9 polypeptide.
  • the C-terminus of the N terminal fragment or the N-terminus of the C terminal fragment can comprise a part of an alpha-helix structure of the Cas9 polypeptide.
  • the N- terminal fragment or the C-terminal fragment can comprise a DNA binding domain.
  • the N-terminal fragment or the C-terminal fragment can comprise a RuvC domain.
  • the N-terminal fragment or the C-terminal fragment can comprise an HNH domain. In some embodiments, neither of the N-terminal fragment and the C-terminal fragment comprises an HNH domain.
  • the C-terminus of the N terminal Cas9 fragment comprises an amino acid that is in proximity to a target nucleobase when the fusion protein deaminates the target nucleobase.
  • the N-terminus of the C terminal Cas9 fragment comprises an amino acid that is in proximity to a target nucleobase when the fusion protein deaminates the target nucleobase.
  • the insertion location of different deaminases can be different in order to have proximity between the target nucleobase and an amino acid in the C-terminus of the N terminal Cas9 fragment or the N-terminus of the C terminal Cas9 fragment.
  • the insertion position of an deaminase can be at an amino acid residue selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247, 1054, 1026, 768, 1067, 1248, 1052, and 1246 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the N-terminal Cas9 fragment of a fusion protein (i.e. the N-terminal Cas9 fragment flanking the deaminase in a fusion protein) can comprise the N-terminus of a Cas9 polypeptide.
  • the N-terminal Cas9 fragment of a fusion protein can comprise a length of at least about: 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, or 1300 amino acids.
  • the N-terminal Cas9 fragment of a fusion protein can comprise a sequence corresponding to amino acid residues: 1-56, 1-95, 1-200, 1-300, 1-400, 1-500, 1-600, 1-700, 1-718, 1-765, 1-780, 1-906, 1- 918, or 1-1100 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the N-terminal Cas9 fragment can comprise a sequence comprising at least: 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% sequence identity to amino acid residues: 1-56, 1-95, 1-200, 1-300, 1-400, 1-500, 1-600, 1-700, 1-718, 1-765, 1-780, 1-906, 1-918, or 1-1100 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the C-terminal Cas9 fragment of a fusion protein (i.e. the C-terminal Cas9 fragment flanking the deaminase in a fusion protein) can comprise the C-terminus of a Cas9 polypeptide.
  • the C-terminal Cas9 fragment of a fusion protein can comprise a length of at least about: 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, or 1300 amino acids.
  • the C-terminal Cas9 fragment of a fusion protein can comprise a sequence corresponding to amino acid residues: 1099-1368, 918-1368, 906-1368, 780-1368, 765-1368, 718-1368, 94-1368, or 56-1368 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the N-terminal Cas9 fragment can comprise a sequence comprising at least: 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% sequence identity to amino acid residues: 1099-1368, 918-1368, 906-1368, 780-1368, 765-1368, 718-1368, 94-1368, or 56-1368 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the N-terminal Cas9 fragment and C-terminal Cas9 fragment of a fusion protein taken together may not correspond to a full-length naturally occurring Cas9 polypeptide sequence, for example, as set forth in the above Cas9 reference sequence.
  • the fusion protein described herein can effect targeted deamination with reduced deamination at non-target sites (e.g., off-target sites), such as reduced genome wide spurious deamination.
  • the fusion protein described herein can effect targeted deamination with reduced bystander deamination at non-target sites.
  • the undesired deamination or off-target deamination can be reduced by at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% compared with, for example, an end terminus fusion protein comprising the deaminase fused to a N terminus or a C terminus of a Cas9 polypeptide.
  • the undesired deamination or off-target deamination can be reduced by at least one-fold, at least two-fold, at least three-fold, at least four-fold, at least five-fold, at least tenfold, at least fifteen fold, at least twenty fold, at least thirty fold, at least forty fold, at least fifty fold, at least 60 fold, at least 70 fold, at least 80 fold, at least 90 fold, or at least hundred fold, compared with, for example, an end terminus fusion protein comprising the deaminase fused to a N terminus or a C terminus of a Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase of the fusion protein deaminates no more than two nucleobases within the range of an R-loop. In some embodiments, the deaminase of the fusion protein deaminates no more than three nucleobases within the range of the R-loop. In some embodiments, the deaminase of the fusion protein deaminates no more than 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleobases within the range of the R-loop.
  • An R-loop is a three-stranded nucleic acid structure including a DNA:RNA hybrid, a DNA:DNA or an RNA: RNA complementary structure and the associated with single-stranded DNA.
  • an R-loop may be formed when a target polynucleotide is contacted with a CRISPR complex or a base editing complex, wherein a portion of a guide polynucleotide, e.g. a guide RNA, hybridizes with and displaces with a portion of a target polynucleotide, e.g. a target DNA.
  • an R-loop comprises a hybridized region of a spacer sequence and a target DNA complementary sequence.
  • An R-loop region may be of about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 nucleobase pairs in length. In some embodiments, the R-loop region is about 20 nucleobase pairs in length. It should be understood that, as used herein, an R-loop region is not limited to the target DNA strand that hybridizes with the guide polynucleotide.
  • editing of a target nucleobase within an R-loop region may be to a DNA strand that comprises the complementary strand to a guide RNA, or may be to a DNA strand that is the opposing strand of the strand complementary to the guide RNA.
  • editing in the region of the R-loop comprises editing a nucleobase on non-complementary strand (protospacer strand) to a guide RNA in a target DNA sequence.
  • a target nucleobase is from about
  • a target nucleobase is from about 2 to about 12 bases upstream of a PAM sequence in the target polynucleotide sequence.
  • a target nucleobase is from about 1 to 9 base pairs, about 2 to 10 base pairs, about 3 to 11 base pairs, about 4 to 12 base pairs, about 5 to 13 base pairs, about 6 to 14 base pairs, about 7 to 15 base pairs, about 8 to 16 base pairs, about 9 to 17 base pairs, about 10 to 18 base pairs, about 11 to 19 base pairs, about 12 to 20 base pairs, about 1 to 7 base pairs, about 2 to 8 base pairs, about 3 to 9 base pairs, about 4 to 10 base pairs, about 5 to 11 base pairs, about 6 to 12 base pairs, about 7 to 13 base pairs, about 8 to 14 base pairs, about 9 to 15 base pairs, about 10 to 16 base pairs, about
  • a target nucleobase is about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more base pairs away from or upstream of the PAM sequence. In some embodiments, a target nucleobase is about 1, 2, 3, 4, 5, 6, 7, 8, or 9 base pairs upstream of the PAM sequence. In some embodiments, a target nucleobase is about 2, 3, 4, or 6 base pairs upstream of the PAM sequence.
  • the fusion protein can comprise more than one heterologous polypeptide.
  • the fusion protein can additionally comprise one or more UGI domains and/or one or more nuclear localization signals.
  • the two or more heterologous domains can be inserted in tandem. The two or more heterologous domains can be inserted at locations such that they are not in tandem in the NapDNAbp.
  • a fusion protein can comprise a linker between the deaminase and the napDNAbp polypeptide.
  • the linker can be a peptide or a non-peptide linker.
  • the linker can be an XTEN, (GGGS)n (SEQ ID NO: 1308), (GGGGS)n (SEQ ID NO: 109), (G)n, (EAAAK)n (SEQ ID NO: 1309), (GGS)n, SGSETPGTSESATPES (SEQ ID NO: 56).
  • the fusion protein comprises a linker between the N-terminal Cas9 fragment and the deaminase.
  • the fusion protein comprises a linker between the C-terminal Cas9 fragment and the deaminase.
  • the N-terminal and C-terminal fragments of napDNAbp are connected to the deaminase with a linker.
  • the N-terminal and C-terminal fragments are joined to the deaminase domain without a linker.
  • the fusion protein comprises a linker between the N-terminal Cas9 fragment and the deaminase, but does not comprise a linker between the C-terminal Cas9 fragment and the deaminase.
  • the fusion protein comprises a linker between the C-terminal Cas9 fragment and the deaminase, but does not comprise a linker between the N-terminal Cas9 fragment and the deaminase.
  • the napDNAbp in the fusion protein is a Cas12 polypeptide, e.g., Cas12b/C2c1 , or a fragment thereof.
  • the Cas12 polypeptide can be a variant Cas12 polypeptide.
  • the N- or C-terminal fragments of the Cas12 polypeptide comprise a nucleic acid programmable DNA binding domain or a RuvC domain.
  • the fusion protein contains a linker between the Cas12 polypeptide and the catalytic domain.
  • the amino acid sequence of the linker is GGSGGS (SEQ ID NO: 273) or GSSGSETPGTSESATPESSG (SEQ ID NO: 1310).
  • the linker is a rigid linker.
  • the linker is encoded by GGAGGCTCTGGAGGAAGC (SEQ ID NO: 1311) or
  • Fusion proteins comprising a heterologous catalytic domain flanked by N- and C-terminal fragments of a Cas12 polypeptide are also useful for base editing in the methods as described herein. Fusion proteins comprising Cas12 and one or more deaminase domains, e.g., adenosine deaminase, or comprising an adenosine deaminase domain flanked by Cas12 sequences are also useful for highly specific and efficient base editing of target sequences.
  • a chimeric Cas12 fusion protein contains a heterologous catalytic domain (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) inserted within a Cas12 polypeptide.
  • the fusion protein comprises an adenosine deaminase domain and a cytidine deaminase domain inserted within a Cas12.
  • an adenosine deaminase is fused within Cas12 and a cytidine deaminase is fused to the C-terminus.
  • an adenosine deaminase is fused within Cas12 and a cytidine deaminase fused to the N-terminus.
  • a cytidine deaminase is fused within Cas12 and an adenosine deaminase is fused to the C-terminus.
  • a cytidine deaminase is fused within Cas12 and an adenosine deaminase fused to the N-terminus.
  • the used in the general architecture above indicates the presence of an optional linker.
  • the catalytic domain has DNA modifying activity (e.g., deaminase activity), such as adenosine deaminase activity.
  • the adenosine deaminase is a TadA (e.g., TadA*7.10).
  • the TadA is a TadA*8.
  • a Tad A* 8 is fused within Cas12 and a cytidine deaminase is fused to the C- terminus.
  • a TadA*8 is fused within Cas12 and a cytidine deaminase fused to the N-terminus.
  • a cytidine deaminase is fused within Cas12 and a TadA*8 is fused to the C-terminus. In some embodiments, a cytidine deaminase is fused within Cas12 and a TadA*8 fused to the N-terminus.
  • Exemplary structures of a fusion protein with a TadA*8 and a cytidine deaminase and a Cas12 are provided as follows:
  • the used in the general architecture above indicates the presence of an optional linker.
  • the fusion protein contains one or more catalytic domains. In other embodiments, at least one of the one or more catalytic domains is inserted within the Cas12 polypeptide or is fused at the Cas12 N- terminus or C-terminus. In other embodiments, at least one of the one or more catalytic domains is inserted within a loop, an alpha helix region, an unstructured portion, or a solvent accessible portion of the Cas12 polypeptide. In other embodiments, the Cas12 polypeptide is Cas12a, Cas12b, Cas12c, Cas12d, Cas12e, Cas12g, Cas12h, Cas12i, or Cas12j/Cas ⁇ t>.
  • the Cas12 polypeptide has at least about 85% amino acid sequence identity to Bacillus hisashii Cas12b, Bacillus thermoamylovorans Cas12b, Bacillus sp. V3-13 Cas12b, or Alicyclobacillus acidiphilus Cas12b (SEQ ID NO: 259). In other embodiments, the Cas12 polypeptide has at least about 90% amino acid sequence identity to Bacillus hisashii Cas12b (SEQ ID NO: 260), Bacillus thermoamylovorans Cas12b, Bacillus sp. V3-13 Cas12b, or Alicyclobacillus acidiphilus Cas12b.
  • the Cas12 polypeptide has at least about 95% amino acid sequence identity to Bacillus hisashii Cas12b, Bacillus thermoamylovorans Cas12b (SEQ ID NO: 265), Bacillus sp. V3-13 Cas12b (SEQ ID NO: 264), or Alicyclobacillus acidiphilus Cas12b.
  • the Cas12 polypeptide contains or consists essentially of a fragment of Bacillus hisashii Cas12b, Bacillus thermoamylovorans Cas12b, Bacillus sp. V3-13 Cas12b, or Alicyclobacillus acidiphilus Cas12b.
  • the Cas12 polypeptide contains BvCas12b (V4), which in some embodiments is expressed as 5' mRNA Cap — 5' UTR— bhCas12b — STOP sequence — 3' UTR — 120polyA tail (SEQ ID NOs: 261-263).
  • the catalytic domain is inserted between amino acid positions 153- 154, 255-256, 306-307, 980-981, 1019-1020, 534-535, 604-605, or 344-345 of BhCas12b or a corresponding amino acid residue of Cas12a, Cas12c, Cas12d, Cas12e, Cas12g, Cas12h, Cas12i, or Cas12j/CasO.
  • the catalytic domain is inserted between amino acids P153 and S154 of BhCas12b.
  • the catalytic domain is inserted between amino acids K255 and E256 of BhCas12b.
  • the catalytic domain is inserted between amino acids D980 and G981 of BhCas12b. In other embodiments, the catalytic domain is inserted between amino acids K1019 and L1020 of BhCas12b. In other embodiments, the catalytic domain is inserted between amino acids F534 and P535 of BhCas12b. In other embodiments, the catalytic domain is inserted between amino acids K604 and G605 of BhCas12b. In other embodiments, the catalytic domain is inserted between amino acids H344 and F345 of BhCas12b.
  • catalytic domain is inserted between amino acid positions 147 and 148, 248 and 249, 299 and 300, 991 and 992, or 1031 and 1032 of BvCas12b or a corresponding amino acid residue of Cas12a, Cas12c, Cas12d, Cas12e, Cas12g, Cas12h, Cas12i, or Cas12j/CasO.
  • the catalytic domain is inserted between amino acids P147 and D148 of BvCas12b.
  • the catalytic domain is inserted between amino acids G248 and G249 of BvCas12b.
  • the catalytic domain is inserted between amino acids P299 and E300 of BvCas12b. In other embodiments, the catalytic domain is inserted between amino acids G991 and E992 of BvCas12b. In other embodiments, the catalytic domain is inserted between amino acids K1031 and M1032 of BvCas12b.
  • the catalytic domain is inserted between amino acid positions 157 and 158, 258 and 259, 310 and 311, 1008 and 1009, or 1044 and 1045 of AaCas12b or a corresponding amino acid residue of Cas12a, Cas12c, Cas12d, Cas12e, Cas12g, Cas12h, Cas12i, or Cas12j/CasO.
  • the catalytic domain is inserted between amino acids P157 and G158 of AaCas12b.
  • the catalytic domain is inserted between amino acids V258 and G259 of AaCas12b.
  • the catalytic domain is inserted between amino acids D310 and P311 of AaCas12b. In other embodiments, the catalytic domain is inserted between amino acids G1008 and E1009 of AaCas12b. In other embodiments, the catalytic domain is inserted between amino acids G1044 and K1045 at of AaCas12b.
  • the fusion protein contains a nuclear localization signal (e.g., a bipartite nuclear localization signal).
  • a nuclear localization signal e.g., a bipartite nuclear localization signal
  • the amino acid sequence of the nuclear localization signal is MAPKKKRKVGIHGVPAA (SEQ ID NO: 1313).
  • the nuclear localization signal is encoded by the following sequence:
  • the Cas12b polypeptide contains a mutation that silences the catalytic activity of a RuvC domain.
  • the Cas12b polypeptide contains D574A, D829A and/or D952A mutations.
  • the fusion protein further contains a tag (e.g., an influenza hemagglutinin tag).
  • the fusion protein comprises a napDNAbp domain (e.g., Cas12- derived domain) with an internally fused nucleobase editing domain (e.g., all or a portion of a deaminase domain, e.g., an adenosine deaminase domain).
  • the napDNAbp is a Cas12b.
  • the base editor comprises a BhCas12b domain with an internally fused TadA*8 domain inserted at the loci provided in Table 4 below.
  • an adenosine deaminase (e.g., TadA*8.13) may be inserted into a BhCas12b to produce a fusion protein (e.g., TadA*8.13-BhCas12b) that effectively edits a nucleic acid sequence.
  • adenosine deaminase e.g., TadA*8.13
  • a fusion protein e.g., TadA*8.13-BhCas12b
  • the base editing system described herein is an ABE with TadA inserted into a Cas9.
  • Polypeptide sequences of relevant ABEs with TadA inserted into a Cas9 are provided in the attached Sequence Listing as SEQ ID NOs: 1315-1360.
  • adenosine deaminase base editors were generated to insert TadA or variants thereof into the Cas9 polypeptide at the identified positions.
  • fusion proteins are described in International PCT Application Nos. PCT /U S2020/016285 and U.S. Provisional Application Nos. 62/852,228 and 62/852,224, the contents of which are incorporated by reference herein in their entireties.
  • a base editor described herein comprises an adenosine deaminase domain.
  • Such an adenosine deaminase domain of a base editor can facilitate the editing of an adenine (A) nucleobase to a guanine (G) nucleobase by deaminating the A to form inosine (I), which exhibits base pairing properties of G.
  • Adenosine deaminase is capable of deaminating (i.e., removing an amine group) adenine of a deoxyadenosine residue in deoxyribonucleic acid (DNA).
  • an A-to-G base editor further comprises an inhibitor of inosine base excision repair, for example, a uracil glycosylase inhibitor (UGI) domain or a catalytically inactive inosine specific nuclease.
  • a uracil glycosylase inhibitor UGI domain
  • a catalytically inactive inosine specific nuclease can inhibit or prevent base excision repair of a deaminated adenosine residue (e.g., inosine), which can improve the activity or efficiency of the base editor.
  • a base editor comprising an adenosine deaminase can act on any polynucleotide, including DNA, RNA and DNA-RNA hybrids.
  • a base editor comprising an adenosine deaminase can deaminate a target A of a polynucleotide comprising RNA.
  • the base editor can comprise an adenosine deaminase domain capable of deaminating a target A of an RNA polynucleotide and/or a DNA-RNA hybrid polynucleotide.
  • an adenosine deaminase incorporated into a base editor comprises all or a portion of adenosine deaminase acting on RNA (ADAR, e.g., ADAR1 or ADAR2) or tRNA (ADAT).
  • ADAR e.g., ADAR1 or ADAR2
  • ADAT tRNA
  • a base editor comprising an adenosine deaminase domain can also be capable of deaminating an A nucleobase of a DNA polynucleotide.
  • an adenosine deaminase domain of a base editor comprises all or a portion of an ADAT comprising one or more mutations which permit the ADAT to deaminate a target A in DNA.
  • the base editor can comprise all or a portion of an ADAT from Escherichia coli (EcTadA) comprising one or more of the following mutations: D108N, A106V, D147Y, E155V, L84F, H123Y, I156F, or a corresponding mutation in another adenosine deaminase.
  • EcTadA Escherichia coli
  • Exemplary ADAT homolog polypeptide sequences are provided in the Sequence Listing as SEQ ID NOs: 1363-1370.
  • the adenosine deaminase can be derived from any suitable organism (e.g., E. coli). In some embodiments, the adenosine deaminase is from a prokaryote. In some embodiments, the adenosine deaminase is from a bacterium. In some embodiments, the adenosine deaminase is from Escherichia coli, Staphylococcus aureus, Salmonella typhi, Shewanella putrefaciens, Haemophilus influenzae, Caulobacter crescentus, or Bacillus subtilis. In some embodiments, the adenosine deaminase is from E. coli.
  • the adenine deaminase is a naturally-occurring adenosine deaminase that includes one or more mutations corresponding to any of the mutations provided herein (e.g., mutations in ecTadA).
  • the corresponding residue in any homologous protein can be identified by e.g., sequence alignment and determination of homologous residues.
  • the mutations in any naturally-occurring adenosine deaminase e.g., having homology to ecTadA
  • any of the mutations identified in ecTadA can be generated accordingly.
  • the adenosine deaminase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the amino acid sequences set forth in any of the adenosine deaminases provided herein.
  • adenosine deaminases provided herein may include one or more mutations (e.g., any of the mutations provided herein). The disclosure provides any deaminase domains with a certain percent identify plus any of the mutations or combinations thereof described herein.
  • the adenosine deaminase comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or more mutations compared to a reference sequence, or any of the adenosine deaminases provided herein.
  • the adenosine deaminase comprises an amino acid sequence that has at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, at least 160, or at least 170 identical contiguous amino acid residues as compared to any one of the amino acid sequences known in the art or described herein.
  • any of the mutations provided herein can be introduced into other adenosine deaminases, such as E. coli TadA (ecTadA), S. aureus TadA (saTadA), or other adenosine deaminases (e.g., bacterial adenosine deaminases). It would be apparent to the skilled artisan that additional deaminases may similarly be aligned to identify homologous amino acid residues that can be mutated as provided herein.
  • adenosine deaminases such as E. coli TadA (ecTadA), S. aureus TadA (saTadA), or other adenosine deaminases (e.g., bacterial adenosine deaminases). It would be apparent to the skilled artisan that additional deaminases may similarly be aligned to identify homologous amino acid residues that can be mutated as provided herein
  • any of the mutations identified in the TadA reference sequence can be made in other adenosine deaminases (e.g., ecTada) that have homologous amino acid residues. It should also be appreciated that any of the mutations provided herein can be made individually or in any combination in the TadA reference sequence or another adenosine deaminase.
  • the adenosine deaminase comprises a D108X mutation in the TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a D108G, D108N, D108V, D108A, or D108Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase. It should be appreciated, however, that additional deaminases may similarly be aligned to identify homologous amino acid residues that can be mutated as provided herein.
  • the adenosine deaminase comprises an A106X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an A106V mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises a E155X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a E155D, E155G, or E155V mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises a D147X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a D147Y, mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an A106X, E155X, or D147X, mutation in the TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an E155D, E155G, or E155V mutation.
  • the adenosine deaminase comprises a D147Y.
  • any of the mutations provided herein may be made individually or in any combination in ecTadA or another adenosine deaminase.
  • an adenosine deaminase may contain a D108N, a A106V, a E155V, and/or a D147Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • an adenosine deaminase comprises the following group of mutations (groups of mutations are separated by a in TadA reference sequence, or corresponding mutations in another adenosine deaminase: D108N and A106V; D108N and E155V; D108N and D147Y; A106V and E155V; A106V and D147Y; E155V and D147Y; D108N, A106V, and E155V; D108N, A106V, and D147Y; D108N, E155V, and D147Y; A106V, E155V, and D147Y; and D108N, A106V, E155V, and D147Y. It should be appreciated, however, that any combination of corresponding mutations provided herein may be made in an adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one or more of a H8X, T17X, L18X, W23X, L34X, W45X, R51X, A56X, E59X, E85X, M94X, I95X, V102X, F104X, A106X, R107X, D108X, K110X, M118X, N127X, A138X, F149X, M151X, R153X, Q154X, I156X, and/or K157X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one or more of H8Y, T17S, L18E, W23L, L34S, W45L, R51H, A56E, or A56S, E59G, E85K, or E85G, M94L, I95L, V102A, F104L, A106V, R107C, or R107H, or R107P, D108G, or D108N, or D108V, or D108A, or D108Y, K110I, M118K, N127S, A138V, F149Y, M151V, R153C, Q154L, I156D, and/or K157R mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises one or more of a H8X, D108X, and/or N127X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where X indicates the presence of any amino acid.
  • the adenosine deaminase comprises one or more of a H8Y, D108N, and/or N127S mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises one or more of H8X, R26X, M61X, L68X, M70X, A106X, D108X, A109X, N127X, D147X, R152X, Q154X, E155X, K161X, Q163X, and/or T166X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one or more of H8Y, R26W, M61I, L68Q, M70V, A106T, D108N, A109T, N127S, D147Y, R152C, Q154H or Q154R, E155G or E155V or E155D, K161Q, Q163H, and/or T166P mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8X, D108X, N127X, D147X, R152X, and Q154X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8X, M61X, M70X, D108X, N127X, Q154X, E155X, and Q163X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8X, D108X, N127X, E155X, and T166X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild- type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8X, A106X, and D108X, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8X, R26X, L68X, D108X, N127X, D147X, and E155X, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, six, or seven mutations selected from the group consisting of H8X, R126X, L68X, D108X, N127X, D147X, and E155X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, or five mutations selected from the group consisting of H8X, D108X, A109X, N127X, and E155X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8Y, D108N, N127S, D147Y, R152C, and Q154H in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8Y, M61 I, M70V, D108N, N127S, Q154R, E155G and Q163H in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8Y, D108N, N127S, E155V, and T166P in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8Y, A106T, D108N, N127S, E155D, and K161Q in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8Y, R26W, L68Q, D108N, N127S, D147Y, and E155V in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8Y, D108N, A109T, N127S, and E155G in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one or more of the or one or more corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises a D108N, D108G, or D108V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises a A106V and D108N mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises R107C and D108N mutations in TadA reference sequence, or corresponding mutations in another adenosine deaminase. In some embodiments, the adenosine deaminase comprises a H8Y, D108N, N127S, D147Y, and Q154H mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises a H8Y, D108N, N127S, D147Y, and E155V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase. In some embodiments, the adenosine deaminase comprises a D108N, D147Y, and E155V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase. In some embodiments, the adenosine deaminase comprises a H8Y, D108N, and N127S mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises a A106V, D108N, D147Y, and E155V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one or more of S2X, H8X, I49X, L84X, H123X, N127X, I156X, and/or K160X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one or more of S2A, H8Y, I49F, L84F, H123Y, N127S, I156F, and/or K160S mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an L84X mutation adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an L84F mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an H123X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an H123Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase comprises an I156X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an I156F mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, six, or seven mutations selected from the group consisting of L84X, A106X, D108X, H123X, D147X, E155X, and 1156X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of S2X, I49X, A106X, D108X, D147X, and E155X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, or five mutations selected from the group consisting of H8X, A106X, D108X, N127X, and K160X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, six, or seven mutations selected from the group consisting of L84F, A106V, D108N, H123Y, D147Y, E155V, and I156F in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase. In some embodiments, the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of S2A, I49F, A106V, D108N, D147Y, and E155V in TadA reference sequence.
  • the adenosine deaminase comprises one, two, three, four, or five mutations selected from the group consisting of H8Y, A106T, D108N, N127S, and K160S in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase.
  • the adenosine deaminase comprises one or more of a E25X, R26X, R107X, A142X, and/or A143X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one or more of E25M, E25D, E25A, E25R, E25V, E25S, E25Y, R26G, R26N, R26Q, R26C, R26L, R26K, R107P, R107K, R107A, R107N, R107W, R107H, R107S, A142N, A142D, A142G, A143D, A143G, A143E, A143L, A143W, A143M, A143S, A143Q, and/or A143R mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises one or more of the mutations described herein corresponding to TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises an E25X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an E25M, E25D, E25A, E25R, E25V, E25S, or E25Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an R26X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises R26G, R26N, R26Q, R26C, R26L, or R26K mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an R107X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an R107P, R107K, R107A, R107N, R107W, R107H, or R107S mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an A142X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an A142N, A142D, A142G, mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an A143X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an A143D, A143G, A143E, A143L, A143W, A143M, A143S, A143Q, and/or A143R mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one or more of a H36X, N37X, P48X, I49X, R51X, M70X, N72X, D77X, E134X, S146X, Q154X, K157X, and/or K161X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one or more of H36L, N37T, N37S, P48T, P48L, I49V, R51 H, R51 L, M70L, N72S, D77G, E134G, S146R, S146C, Q154H, K157N, and/or K161T mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g., ecTadA).
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises an H36X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an H36L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase comprises an N37X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an N37T or N37S mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase comprises an P48X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an P48T or P48L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase comprises an R51X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an R51 H or R51 L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase comprises an S146X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an S146R or S146C mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase comprises an K157X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a K157N mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase comprises an P48X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a P48S, P48T, or P48A mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase comprises an A142X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a A142N mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase comprises an W23X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a W23R or W23L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase comprises an R152X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a R152P or R52H mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase may comprise the mutations H36L, R51L, L84F, A106V, D108N, H123Y, S146C, D147Y, E155V, I156F, and K157N.
  • the adenosine deaminase comprises the following combination of mutations relative to TadA reference sequence, where each mutation of a combination is separated by a and each combination of mutations is between parentheses:
  • the TadA deaminase is TadA variant.
  • the TadA variant is TadA*7.10.
  • the fusion proteins comprise a single TadA*7.10 domain (e.g., provided as a monomer).
  • the fusion protein comprises TadA*7.10 and TadA(wt), which are capable of forming heterodimers.
  • a fusion protein of the invention comprises a wild-type TadA linked to TadA*7.10, which is linked to Cas9 nickase.
  • TadA*7.10 comprises at least one alteration.
  • the adenosine deaminase comprises an alteration in the following sequence: TadA*7.10
  • TadA*7.10 comprises an alteration at amino acid 82 and/or 166.
  • TadA*7.10 comprises one or more of the following alterations: Y147T, Y147R, Q154S, Y123H, V82S, T166R, and/or Q154R.
  • a variant of TadA*7.10 comprises a combination of alterations selected from the group of: Y147T + Q154R; Y147T + Q154S; Y147R + Q154S; V82S + Q154S; V82S + Y147R; V82S + Q154R; V82S + Y123H; I76Y + V82S; V82S + Y123H + Y147T; V82S + Y123H + Y147R; V82S + Y123H + Q154R; Y147R + Q154R +Y123H; Y147R + Q154R + I76Y; Y147R + Q154R + T166R; Y123H + Y147R + Q154R + I76Y; V82S + Y123H + Y147R + Q154R; and I76Y + V82S + Y123H + Y147R + Q154R.
  • an adenosine deaminase variant (e.g., TadA*8) comprises a deletion.
  • an adenosine deaminase variant comprises a deletion of the C terminus.
  • an adenosine deaminase variant comprises a deletion of the C terminus beginning at residue 149, 150, 151 , 152, 153, 154, 155, 156, and 157, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • an adenosine deaminase variant (e.g., TadA*8) is a monomer comprising one or more of the following alterations: Y147T, Y147R, Q154S, Y123H, V82S, T166R, and/or Q154R, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • the adenosine deaminase variant (TadA*8) is a monomer comprising a combination of alterations selected from the group of: Y147T + Q154R; Y147T + Q154S; Y147R + Q154S; V82S + Q154S; V82S + Y147R; V82S + Q154R; V82S + Y123H; I76Y + V82S; V82S + Y123H + Y147T; V82S + Y123H + Y147R; V82S + Y123H + Q154R; Y147R + Q154R +Y123H; Y147R + Q154R + I76Y; Y147R + Q154R + T166R; Y123H + Y147R + Q154R + I76Y; V82S + Y123H + Y147R + Q154R; and I76Y + V82S + Y123H + Y147R + Q154R, relative to
  • the adenosine deaminase variant is a homodimer comprising two adenosine deaminase domains (e.g., TadA*8) each having one or more of the following alterations Y147T, Y147R, Q154S, Y123H, V82S, T166R, and/or Q154R, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • TadA*8 two adenosine deaminase domains
  • the adenosine deaminase variant is a homodimer comprising two adenosine deaminase domains (e.g., TadA*8) each having a combination of alterations selected from the group of: Y147T + Q154R; Y147T + Q154S; Y147R + Q154S; V82S + Q154S; V82S + Y147R; V82S + Q154R; V82S + Y123H; I76Y + V82S; V82S + Y123H + Y147T; V82S + Y123H + Y147R; V82S + Y123H + Q154R; Y147R + Q154R +Y123H; Y147R + Q154R + I76Y; Y147R + Q154R + T166R; Y123H + Y147R + Q154R + I76Y; V82S + Y123H + Y147R + Q154R; and I
  • the adenosine deaminase variant is a heterodimer of a wild-type adenosine deaminase domain and an adenosine deaminase variant domain (e.g., TadA*8) comprising one or more of the following alterations Y147T, Y147R, Q154S, Y123H, V82S, T166R, and/or Q154R, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • TadA*8 a heterodimer of a wild-type adenosine deaminase domain and an adenosine deaminase variant domain (e.g., TadA*8) comprising one or more of the following alterations Y147T, Y147R, Q154S, Y123H, V82S, T166R, and/or Q154R, relative to TadA*7.10, the Tad
  • the adenosine deaminase variant is a heterodimer of a wild-type adenosine deaminase domain and an adenosine deaminase variant domain (e.g., TadA*8) comprising a combination of alterations selected from the group of: Y147T + Q154R; Y147T + Q154S; Y147R + Q154S; V82S + Q154S; V82S + Y147R; V82S + Q154R; V82S + Y123H; I76Y + V82S; V82S + Y123H + Y147T; V82S + Y123H + Y147R; V82S + Y123H + Q154R; Y147R + Q154R +Y123H; Y147R + Q154R + I76Y; Y147R + Q154R + T166R; Y123H + Y147R + Q154R + I76Y; V82R + T166
  • the adenosine deaminase variant is a heterodimer of a TadA*7.10 domain and an adenosine deaminase variant domain (e.g., TadA*8) comprising one or more of the following alterations Y147T, Y147R, Q154S, Y123H, V82S, T166R, and/or Q154R, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • TadA*8 adenosine deaminase variant domain comprising one or more of the following alterations Y147T, Y147R, Q154S, Y123H, V82S, T166R, and/or Q154R, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • the adenosine deaminase variant is a heterodimer of a TadA*7.10 domain and an adenosine deaminase variant domain (e.g ., TadA*8) comprising a combination of alterations selected from the group of: Y147T + Q154R; Y147T + Q154S; Y147R + Q154S; V82S + Q154S; V82S + Y147R; V82S + Q154R; V82S + Y123H; I76Y + V82S; V82S + Y123H + Y147T; V82S + Y123H + Y147R; V82S + Y123H + Q154R; Y147R + Q154R +Y123H; Y147R + Q154R + I76Y; Y147R + Q154R + T166R; Y123H + Y147R + Q154R + I76Y; V82S + Y123H +
  • an adenosine deaminase heterodimer comprises a Tad A* 8 domain and an adenosine deaminase domain selected from Staphylococcus aureus (S. aureus) TadA, Bacillus subtilis (B. subtilis) TadA, Salmonella typhimurium (S. typhimurium) TadA, Shewanella putrefaciens (S. putrefaciens) TadA, Haemophilus influenzae F3031 (H. influenzae) TadA, Caulobacter crescentus (C. crescentus) TadA, Geobacter sulfurreducens (G. sulfurreducens) TadA, orTadA*7.10.
  • an adenosine deaminase is a TadA*8.
  • an adenosine deaminase is a TadA*8 that comprises or consists essentially of the following sequence or a fragment thereof having adenosine deaminase activity:
  • the TadA*8 is truncated. In some embodiments, the truncated TadA*8 is missing 1, 2, 3, 4, 5 ,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 6, 17, 18, 19, or 20 N-terminal amino acid residues relative to the full length TadA*8. In some embodiments, the truncated TadA*8 is missing 1, 2, 3, 4, 5 ,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 6, 17, 18, 19, or 20 C-terminal amino acid residues relative to the full length TadA*8. In some embodiments the adenosine deaminase variant is a full-length TadA*8.
  • the TadA*8 is TadA*8.1 , TadA*8.2, TadA*8.3, TadA*8.4, TadA*8.5, TadA*8.6, TadA*8.7, TadA*8.8, TadA*8.9, TadA*8.10, TadA*8.11, TadA*8.12, TadA*8.13, TadA*8.14, TadA*8.15, TadA*8.16, TadA*8.17, TadA*8.18, TadA*8.19, TadA*8.20, TadA*8.21 , TadA*8.22, TadA*8.23, or TadA*8.24.
  • a base editor of the disclosure comprising an adenosine deaminase variant (e.g., TadA*8) monomer comprising one or more of the following alterations: R26C, V88A, A109S, T111R, D119N, H122N, Y147D, F149Y, T166I and/or D167N, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • an adenosine deaminase variant e.g., TadA*8 monomer comprising one or more of the following alterations: R26C, V88A, A109S, T111R, D119N, H122N, Y147D, F149Y, T166I and/or D167N, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • the adenosine deaminase variant (TadA*8) monomer comprises a combination of alterations selected from the group of: R26C + A109S + T111R + D119N + H122N + Y147D + F149Y + T166I + D167N; V88A + A109S + T111R + D119N + H122N + F149Y + T166I + D167N; R26C + A109S + T111R + D119N + H122N + F149Y + T166I + D167N; V88A + T111 R + D119N + F149Y; and A109S + T111R + D119N + H122N + Y147D + F149Y + T166I + D167N, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • a base editor comprises a heterodimer of a wild-type adenosine deaminase domain and an adenosine deaminase variant domain (e.g., TadA*8) comprising one or more of the following alterations R26C, V88A, A109S, T111R, D119N, H122N, Y147D, F149Y, T166I and/or D167N, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • TadA*8 a heterodimer of a wild-type adenosine deaminase domain and an adenosine deaminase variant domain
  • the base editor comprises a heterodimer of a wild-type adenosine deaminase domain and an adenosine deaminase variant domain (e.g., TadA*8) comprising a combination of alterations selected from the group of: R26C + A109S + T111R + D119N + H122N + Y147D + F149Y + T166I + D167N; V88A + A109S + T111R + D119N + H122N + F149Y + T166I + D167N; R26C + A109S + T111 R + D119N + H122N + F149Y + T166I + D167N; V88A + T111R + D119N + F149Y; and A109S + T111R + D119N + H122N + Y147D + F149Y + T166I + D167N, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • a base editor comprises a heterodimer of a TadA*7.10 domain and an adenosine deaminase variant domain (e.g., TadA*8) comprising one or more of the following alterations R26C, V88A, A109S, T111 R, D119N, H122N, Y147D, F149Y, T166I and/or D167N, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • TadA*8 adenosine deaminase variant domain
  • the base editor comprises a heterodimer of a TadA*7.10 domain and an adenosine deaminase variant domain (e.g., TadA*8) comprising a combination of alterations selected from the group of: R26C + A109S + T111R + D119N + H122N + Y147D + F149Y + T166I + D167N; V88A + A109S + T111R + D119N + H122N + F149Y + T166I + D167N; R26C + A109S + T111R + D119N + H122N + F149Y + T166I + D167N; V88A + T111 R + D119N + F149Y; and A109S + T111R + D119N + H122N + Y147D + F149Y + T166I + D167N, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • TadA*8 adenosine de
  • the TadA*8 is a variant as shown in Table 5.
  • Table 5 shows certain amino acid position numbers in the TadA amino acid sequence and the amino acids present in those positions in the TadA-7.10 adenosine deaminase.
  • Table 5 also shows amino acid changes in TadA variants relative to TadA-7.10 following phage-assisted non-continuous evolution (PANCE) and phage-assisted continuous evolution (PACE), as described in M. Richter et al., 2020, Nature Biotechnology, doi.org/10.1038/s41587-020-0453-z, the entire contents of which are incorporated by reference herein.
  • PANCE phage-assisted non-continuous evolution
  • PACE phage-assisted continuous evolution
  • the TadA*8 is TadA*8a, TadA*8b, TadA*8c, TadA*8d, or TadA*8e. In some embodiments, the TadA*8 is TadA*8e.
  • a fusion protein of the invention comprises a wild-type TadA is linked to an adenosine deaminase variant described herein (e.g ., TadA*8), which is linked to Cas9 nickase.
  • the fusion proteins comprise a single TadA*8 domain (e.g., provided as a monomer).
  • the fusion protein comprises TadA*8 and TadA(wt), which are capable of forming heterodimers.
  • the adenosine deaminase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the amino acid sequences set forth in any of the adenosine deaminases provided herein.
  • adenosine deaminases provided herein may include one or more mutations (e.g., any of the mutations provided herein).
  • the disclosure provides any deaminase domains with a certain percent identity plus any of the mutations or combinations thereof described herein.
  • the adenosine deaminase comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or more mutations compared to a reference sequence, or any of the adenosine deaminases provided herein.
  • the adenosine deaminase comprises an amino acid sequence that has at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, at least 160, or at least 170 identical contiguous amino acid residues as compared to any one of the amino acid sequences known in the art or described herein.
  • a Tad A* 8 comprises one or more mutations at any of the following positions shown in bold. In other embodiments, a Tad A* 8 comprises one or more mutations at any of the positions shown with underlining:
  • the TadA*8 comprises alterations at amino acid position 82 and/or 166 (e.g., V82S, T166R) alone or in combination with any one or more of the following Y147T, Y147R, Q154S, Y123H, and/or Q154R, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • alterations at amino acid position 82 and/or 166 e.g., V82S, T166R
  • any one or more of the following Y147T, Y147R, Q154S, Y123H, and/or Q154R relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • a combination of alterations is selected from the group of: Y147T + Q154R; Y147T + Q154S; Y147R + Q154S; V82S + Q154S; V82S + Y147R; V82S + Q154R; V82S + Y123H; I76Y + V82S; V82S + Y123H + Y147T; V82S + Y123H + Y147R; V82S + Y123H + Q154R; Y147R + Q154R +Y123H; Y147R + Q154R + I76Y; Y147R + Q154R + T166R; Y123H + Y147R + Q154R + I76Y; V82S + Y123H + Y147R + Q154R; and I76Y + V82S + Y123H + Y147R + Q154R, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • the TadA*8 is truncated. In some embodiments, the truncated TadA*8 is missing 1, 2, 3, 4, 5 ,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 6, 17, 18, 19, or 20 N-terminal amino acid residues relative to the full length TadA*8. In some embodiments, the truncated TadA*8 is missing 1, 2, 3, 4, 5 ,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 6, 17, 18, 19, or 20 C-terminal amino acid residues relative to the full length TadA*8. In some embodiments the adenosine deaminase variant is a full-length TadA*8.
  • a fusion protein of the invention comprises a wild-type TadA is linked to an adenosine deaminase variant described herein (e.g., TadA*8), which is linked to Cas9 nickase.
  • the fusion proteins comprise a single TadA*8 domain (e.g., provided as a monomer).
  • the base editor comprises TadA*8 and TadA(wt), which are capable of forming heterodimers.
  • the fusion proteins comprise a single (e.g., provided as a monomer) TadA*8.
  • the TadA*8 is linked to a Cas9 nickase.
  • the fusion proteins of the invention comprise as a heterodimer of a wild-type TadA (TadA(wt)) linked to a TadA*8.
  • the fusion proteins of the invention comprise as a heterodimer of a TadA*7.10 linked to a TadA*8.
  • the base editor is ABE8 comprising a TadA*8 variant monomer.
  • the base editor is ABE8 comprising a heterodimer of a TadA*8 and a TadA(wt). In some embodiments, the base editor is ABE8 comprising a heterodimer of a TadA*8 and TadA*7.10. In some embodiments, the base editor is ABE8 comprising a heterodimer of a TadA*8. In some embodiments, the TadA*8 is selected from Table 11, 13 or 14. In some embodiments, the ABE8 is selected from Table 13, 14 or 16.
  • the adenosine deaminase is a TadA*9 variant. In some embodiments, the adenosine deaminase is a TadA*9 variant selected from the variants described below and with reference to the following sequence (termed TadA*7.10):
  • an adenosine deaminase comprises one or more of the following alterations: R21 N, R23H, E25F, N38G, L51W, P54C, M70V, Q71M, N72K, Y73S, V82T, M94V, P124W, T133K, D139L, D139M, C146R, and A158K.
  • the one or more alternations are shown in the sequence above in underlining and bold font.
  • an adenosine deaminase comprises one or more of the following combinations of alterations: V82S + Q154R + Y147R; V82S + Q154R + Y123H; V82S + Q154R + Y147R+ Y123H; Q154R + Y147R + Y123H + I76Y+ V82S; V82S + I76Y; V82S + Y147R; V82S + Y147R + Y123H; V82S + Q154R + Y123H; Q154R + Y147R + Y123H + I76Y; V82S + Y147R; V82S + Y147R + Y123H; V82S + Q154R + Y147R; V82S + Q154R + Y147R; V82S + Q154R + Y147R; V82S + Q154R + Y147R; Q154R + Y147R; Q154R + Y147R; Q154R + Y147R
  • an adenosine deaminase comprises one or more of the following combinations of alterations: E25F + V82S + Y123H, T133K + Y147R + Q154R; E25F + V82S + Y123H + Y147R + Q154R; L51W + V82S + Y123H + C146R + Y147R + Q154R; Y73S + V82S + Y123H + Y147R + Q154R; P54C + V82S + Y123H + Y147R + Q154R; N38G + V82T + Y123H + Y147R + Q154R; N72K + V82S + Y123H + D139L + Y147R + Q154R; E25F + V82S + Y123H + D139M + Y147R + Q154R; Q71M + V82S + Y123H + Y147R + Q154R; E25F + V82S + Y123H + D
  • an adenosine deaminase comprises one or more of the following combinations of alterations: Q71M + V82S + Y123H + Y147R + Q154R; E25F + I76Y+ V82S + Y123H + Y147R + Q154R; I76Y + V82T + Y123H + Y147R + Q154R; N38G + I76Y + V82S + Y123H + Y147R + Q154R; R23H + I76Y + V82S + Y123H + Y147R + Q154R; P54C + I76Y + V82S + Y123H + Y147R + Q154R; R21N + I76Y + V82S + Y123H + Y147R + Q154R; I76Y + V82S + Y123H + D139M + Y147R + Q154R; Y73S + I76Y + V82S + Y123H + D139M + Y147R + Q154
  • the adenosine deaminase is expressed as a monomer. In other embodiments, the adenosine deaminase is expressed as a heterodimer. In some embodiments, the deaminase or other polypeptide sequence lacks a methionine, for example when included as a component of a fusion protein. This can alter the numbering of positions. However, the skilled person will understand that such corresponding mutations refer to the same mutation, e.g., Y73S and Y72S and D139M and D138M.
  • the TadA*9 variant comprises the alterations described in Table 17 as described herein.
  • the TadA*9 variant is a monomer.
  • the TadA*9 variant is a heterodimer with a wild-type TadA adenosine deaminase.
  • the TadA*9 variant is a heterodimer with another TadA variant (e.g., TadA*8, TadA*9). Additional details of TadA*9 adenosine deaminases are described in International PCT Application No. PCT/2020/049975, which is incorporated herein by reference for its entirety.
  • any of the mutations provided herein and any additional mutations can be introduced into any other adenosine deaminases.
  • Any of the mutations provided herein can be made individually or in any combination in TadA reference sequence or another adenosine deaminase (e.g., ecTadA).
  • a base editor disclosed herein comprises a fusion protein comprising cytidine deaminase capable of deaminating a target cytidine (C) base of a polynucleotide to produce uridine (U), which has the base pairing properties of thymine.
  • the uridine base can then be substituted with a thymidine base (e.g., by cellular repair machinery) to give rise to a C:G to a T:A transition.
  • deamination of a C to U in a nucleic acid by a base editor cannot be accompanied by substitution of the U to a T.
  • the deamination of a target C in a polynucleotide to give rise to a U is a non-limiting example of a type of base editing that can be executed by a base editor described herein.
  • a base editor comprising a cytidine deaminase domain can mediate conversion of a cytosine (C) base to a guanine (G) base.
  • a U of a polynucleotide produced by deamination of a cytidine by a cytidine deaminase domain of a base editor can be excised from the polynucleotide by a base excision repair mechanism (e.g., by a uracil DNA glycosylase (UDG) domain), producing an abasic site.
  • the nucleobase opposite the abasic site can then be substituted (e.g., by base repair machinery) with another base, such as a C, by for example a translesion polymerase.
  • base repair machinery e.g., by base repair machinery
  • substitutions e.g., A, G or T
  • substitutions e.g., A, G or T
  • a base editor described herein comprises a deamination domain (e.g., cytidine deaminase domain) capable of deaminating a target C to a U in a polynucleotide.
  • the base editor can comprise additional domains which facilitate conversion of the U resulting from deamination to, in some embodiments, a T or a G.
  • a base editor comprising a cytidine deaminase domain can further comprise a uracil glycosylase inhibitor (UGI) domain to mediate substitution of a U by a T, completing a C- to-T base editing event.
  • UMI uracil glycosylase inhibitor
  • a base editor can incorporate a translesion polymerase to improve the efficiency of C-to-G base editing, since a translesion polymerase can facilitate incorporation of a C opposite an abasic site (i.e., resulting in incorporation of a G at the abasic site, completing the C-to-G base editing event).
  • a base editor comprising a cytidine deaminase as a domain can deaminate a target C in any polynucleotide, including DNA, RNA and DNA-RNA hybrids.
  • a cytidine deaminase catalyzes a C nucleobase that is positioned in the context of a single-stranded portion of a polynucleotide.
  • the entire polynucleotide comprising a target C can be single-stranded.
  • a cytidine deaminase incorporated into the base editor can deaminate a target C in a single-stranded RNA polynucleotide.
  • a base editor comprising a cytidine deaminase domain can act on a double-stranded polynucleotide, but the target C can be positioned in a portion of the polynucleotide which at the time of the deamination reaction is in a single-stranded state.
  • the NAGPB domain comprises a Cas9 domain
  • several nucleotides can be left unpaired during formation of the Cas9-gRNA-target DNA complex, resulting in formation of a Cas9 “R-loop complex”.
  • These unpaired nucleotides can form a bubble of single-stranded DNA that can serve as a substrate for a single-strand specific nucleotide deaminase enzyme (e.g., cytidine deaminase).
  • a single-strand specific nucleotide deaminase enzyme e.g., cytidine deaminase
  • a cytidine deaminase of a base editor can comprise all or a portion of an apolipoprotein B mRNA editing complex (APOBEC) family deaminase.
  • APOBEC apolipoprotein B mRNA editing complex
  • APOBEC is a family of evolutionarily conserved cytidine deaminases. Members of this family are C-to-U editing enzymes.
  • the N-terminal domain of APOBEC like proteins is the catalytic domain, while the C- terminal domain is a pseudocatalytic domain. More specifically, the catalytic domain is a zinc dependent cytidine deaminase domain and is important for cytidine deamination.
  • APOBEC family members include APOBEC1, APOBEC2, APOBEC3A, APOBEC3B, APOBEC3C, APOBEC3D (“APOBEC3E” now refers to this), APOBEC3F, APOBEC3G, APOBEC3H, APOBEC4, and Activation-induced (cytidine) deaminase.
  • a deaminase incorporated into a base editor comprises all or a portion of an APOBEC1 deaminase.
  • a deaminase incorporated into a base editor comprises all or a portion of APOBEC2 deaminase.
  • a deaminase incorporated into a base editor comprises all or a portion of is an APOBEC3 deaminase. In some embodiments, a deaminase incorporated into a base editor comprises all or a portion of an APOBEC3A deaminase. In some embodiments, a deaminase incorporated into a base editor comprises all or a portion of APOBEC3B deaminase. In some embodiments, a deaminase incorporated into a base editor comprises all or a portion of APOBEC3C deaminase.
  • a deaminase incorporated into a base editor comprises all or a portion of APOBEC3D deaminase. In some embodiments, a deaminase incorporated into a base editor comprises all or a portion of APOBEC3E deaminase. In some embodiments, a deaminase incorporated into a base editor comprises all or a portion of APOBEC3F deaminase. In some embodiments, a deaminase incorporated into a base editor comprises all or a portion of APOBEC3G deaminase.
  • a deaminase incorporated into a base editor comprises all or a portion of APOBEC3H deaminase. In some embodiments, a deaminase incorporated into a base editor comprises all or a portion of APOBEC4 deaminase. In some embodiments, a deaminase incorporated into a base editor comprises all or a portion of activation-induced deaminase (AID). In some embodiments a deaminase incorporated into a base editor comprises all or a portion of cytidine deaminase 1 (CDA1 ).
  • CDA1 cytidine deaminase 1
  • a base editor can comprise a deaminase from any suitable organism (e.g., a human or a rat).
  • a deaminase domain of a base editor is from a human, chimpanzee, gorilla, monkey, cow, dog, rat, or mouse.
  • the deaminase domain of the base editor is derived from rat (e.g., rat APOBEC1).
  • the deaminase domain of the base editor is human APOBEC1.
  • the deaminase domain of the base editor is pmCDAI.
  • the deaminases are activation-induced deaminases (AID).
  • AID activation-induced deaminases
  • the active domain of the respective sequence can be used, e.g., the domain without a localizing signal (nuclear localization sequence, without nuclear export signal, cytoplasmic localizing signal).
  • Some aspects of the present disclosure are based on the recognition that modulating the deaminase domain catalytic activity of any of the fusion proteins described herein, for example by making point mutations in the deaminase domain, affect the processivity of the fusion proteins (e.g., base editors). For example, mutations that reduce, but do not eliminate, the catalytic activity of a deaminase domain within a base editing fusion protein can make it less likely that the deaminase domain will catalyze the deamination of a residue adjacent to a target residue, thereby narrowing the deamination window. The ability to narrow the deamination window can prevent unwanted deamination of residues adjacent to specific target residues, which can decrease or prevent off-target effects.
  • an APOBEC deaminase incorporated into a base editor can comprise one or more mutations selected from the group consisting of H121X, H122X, R126X, R126X, R118X, W90X, W90X, and R132X of rAPOBECI , or one or more corresponding mutations in another APOBEC deaminase, wherein X is any amino acid.
  • an APOBEC deaminase incorporated into a base editor can comprise one or more mutations selected from the group consisting of H 121 R, H122R, R126A, R126E, R118A, W90A, W90Y, and R132E of rAPOBECI, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise one or more mutations selected from the group consisting of D316X, D317X, R320X, R320X, R313X, W285X, W285X, R326X of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase, wherein X is any amino acid.
  • any of the fusion proteins provided herein comprise an APOBEC deaminase comprising one or more mutations selected from the group consisting of D316R, D317R, R320A, R320E, R313A, W285A, W285Y, R326E of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise a H121 Rand a H122R mutation of rAPOBECI, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R126A mutation of rAPOBECI, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R126E mutation of rAPOBECI , or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R118A mutation of rAPOBECI, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W90A mutation of rAPOBECI , or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W90Y mutation of rAPOBECI, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R132E mutation of rAPOBECI , or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W90Y and a R126E mutation of rAPOBECI , or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R126E and a R132E mutation of rAPOBECI, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W90Y and a R132E mutation of rAPOBECI , or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W90Y, R126E, and R132E mutation of rAPOBECI, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a D316R and a D317R mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • any of the fusion proteins provided herein comprise an APOBEC deaminase comprising a R320A mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R320E mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R313A mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W285A mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W285Y mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R326E mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W285Y and a R320E mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R320E and a R326E mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W285Y and a R326E mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W285Y, R320E, and R326E mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • a number of modified cytidine deaminases are commercially available, including, but not limited to, SaBE3, SaKKH-BE3, VQR-BE3, EQR-BE3, VRER-BE3, YE1-BE3, EE-BE3, YE2-BE3, and YEE-BE3, which are available from Addgene (plasmids 85169, 85170, 85171 , 85172, 85173, 85174, 85175, 85176, 85177).
  • a deaminase incorporated into a base editor comprises all or a portion of an APOBEC1 deaminase.
  • the fusion proteins of the invention comprise one or more cytidine deaminase domains.
  • the cytidine deaminases provided herein are capable of deaminating cytosine or 5-methylcytosine to uracil or thymine.
  • the cytidine deaminases provided herein are capable of deaminating cytosine in DNA.
  • the cytidine deaminase may be derived from any suitable organism.
  • the cytidine deaminase is a naturally-occurring cytidine deaminase that includes one or more mutations corresponding to any of the mutations provided herein.
  • the cytidine deaminase is from a prokaryote. In some embodiments, the cytidine deaminase is from a bacterium. In some embodiments, the cytidine deaminase is from a mammal (e.g., human).
  • the cytidine deaminase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the cytidine deaminase amino acid sequences set forth herein. It should be appreciated that cytidine deaminases provided herein may include one or more mutations (e.g., any of the mutations provided herein).
  • Some embodiments provide a polynucleotide molecule encoding the cytidine deaminase nucleobase editor polypeptide of any previous aspect or as delineated herein.
  • the polynucleotide is codon optimized.
  • the disclosure provides any deaminase domains with a certain percent identity plus any of the mutations or combinations thereof described herein.
  • the cytidine deaminase comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, 50, or more mutations compared to a reference sequence, or any of the cytidine deaminases provided herein.
  • the cytidine deaminase comprises an amino acid sequence that has at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, at least 160, or at least 170 identical contiguous amino acid residues as compared to any one of the amino acid sequences known in the art or described herein.
  • a fusion protein of the invention second protein comprises two or more nucleic acid editing domains.
  • a polynucleotide programmable nucleotide binding domain when in conjunction with a bound guide polynucleotide (e.g., gRNA), can specifically bind to a target polynucleotide sequence (i.e ., via complementary base pairing between bases of the bound guide nucleic acid and bases of the target polynucleotide sequence) and thereby localize the base editor to the target nucleic acid sequence desired to be edited.
  • the target polynucleotide sequence comprises single-stranded DNA or double-stranded DNA.
  • the target polynucleotide sequence comprises RNA.
  • the target polynucleotide sequence comprises a DNA-RNA hybrid.
  • CRISPR is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids).
  • CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids.
  • CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA).
  • crRNA CRISPR RNA
  • type II CRISPR systems correct processing of pre-crRNA requires a trans-encoded small RNA (tracrRNA), endogenous ribonuclease 3 (rnc) and a Cas9 protein.
  • tracrRNA trans-encoded small RNA
  • rnc endogenous ribonuclease 3
  • Cas9 protein The tracrRNA serves as a guide for ribonuclease 3-aided processing of pre-crRNA.
  • Cas9/crRNA/tracrRNA endonucleolytically cleaves linear or circular dsDNA target complementary to the spacer.
  • the target strand not complementary to crRNA is first cut endonucleolytically, and then trimmed 3'-5' exonucleolytically.
  • DNA-binding and cleavage typically requires protein and both RNAs.
  • single guide RNAs (“sgRNA”, or simply “gRNA”) can be engineered so as to incorporate aspects of both the crRNA and tracrRNA into a single RNA species. See, e.g., Jinek M., Chylinski K., Fonfara I., Hauer M., Doudna J. A., Charpentier E.
  • Cas9 recognizes a short motif in the CRISPR repeat sequences (the PAM or protospacer adjacent motif) to help distinguish self versus non-self. See e.g., “Complete genome sequence of an M1 strain of Streptococcus pyogenes.” Ferretti, J.J. et a!., Natl. Acad. Sci. U.S.A. 98:4658-4663(2001); “CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III.” Deltcheva E.
  • the PAM sequence can be any PAM sequence known in the art. Suitable PAM sequences include, but are not limited to, NGG, NGA, NGC, NGN, NGT, NGCG, NGAG, NGAN, NGNG, NGCN, NGCG, NGTN, NNGRRT, NNNRRT, NNGRR(N), TTTV, TYCV, TYCV, TATV, NNNNGATT, NNAGAAW, or NAAAAC.
  • Y is a pyrimidine; N is any nucleotide base; W is A or T.
  • a guide polynucleotide described herein can be RNA or DNA.
  • the guide polynucleotide is a gRNA.
  • An RNA/Cas complex can assist in “guiding” a Cas protein to a target DNA.
  • Cas9/crRNA/tracrRNA endonucleolytically cleaves linear or circular dsDNA target complementary to the spacer.
  • the target strand not complementary to crRNA is first cut endonucleolytically, then trimmed 3'-5' exonucleolytically.
  • DNA- binding and cleavage typically requires protein and both RNAs.
  • single guide RNAs can be engineered so as to incorporate aspects of both the crRNA and tracrRNA into a single RNA species. See, e.g., Jinek M. etal., Science 337:816-821(2012), the entire contents of which is hereby incorporated by reference.
  • the guide polynucleotide is at least one single guide RNA (“sgRNA” or “gRNA”).
  • a guide polynucleotide comprises two or more individual polynucleotides, which can interact with one another via for example complementary base pairing (e.g., a dual guide polynucleotide, dual gRNA).
  • a guide polynucleotide can comprise a CRISPR RNA (crRNA) and a trans-activating CRISPR RNA (tracrRNA) or can comprise one or more trans-activating CRISPR RNA (tracrRNA).
  • the guide polynucleotide is at least one tracrRNA. In some embodiments, the guide polynucleotide does not require PAM sequence to guide the polynucleotide-programmable DNA-binding domain (e.g., Cas9 or Cpf1) to the target nucleotide sequence.
  • the polynucleotide-programmable DNA-binding domain e.g., Cas9 or Cpf1
  • a guide polynucleotide may include natural or non-natural (or unnatural) nucleotides (e.g., peptide nucleic acid or nucleotide analogs).
  • the targeting region of a guide nucleic acid sequence can be at least 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides in length.
  • a targeting region of a guide nucleic acid can be between 10-30 nucleotides in length, or between 15-25 nucleotides in length, or between 15-20 nucleotides in length.
  • the base editor provided herein utilizes one or more guide polynucleotide (e.g., multiple gRNA).
  • a single guide polynucleotide is utilized for different base editors described herein.
  • a single guide polynucleotide can be utilized for a cytidine base editor and an adenosine base editor.
  • a guide RNA is a short synthetic RNA composed of a scaffold sequence necessary for Cas-binding and a user-defined ⁇ 20 nucleotide spacer that defines the genomic target to be modified.
  • Exemplary gRNA scaffold sequences are provided in the sequence listing as SEQ ID NOs: 224-230, 223, 3000, and 243-245.
  • a guide polynucleotide can comprise both the polynucleotide targeting portion of the nucleic acid and the scaffold portion of the nucleic acid in a single molecule (i.e., a single-molecule guide nucleic acid).
  • a single-molecule guide polynucleotide can be a single guide RNA (sgRNA or gRNA).
  • sgRNA or gRNA single guide RNA
  • guide polynucleotide sequence contemplates any single, dual or multi-molecule nucleic acid capable of interacting with and directing a base editor to a target polynucleotide sequence.
  • a guide polynucleotide (e.g., crRNA/trRNA complex or a gRNA) comprises a “polynucleotide-targeting segment” that includes a sequence capable of recognizing and binding to a target polynucleotide sequence, and a “protein-binding segment” that stabilizes the guide polynucleotide within a polynucleotide programmable nucleotide binding domain component of a base editor.
  • the polynucleotide targeting segment of the guide polynucleotide recognizes and binds to a DNA polynucleotide, thereby facilitating the editing of a base in DNA.
  • the polynucleotide targeting segment of the guide polynucleotide recognizes and binds to an RNA polynucleotide, thereby facilitating the editing of a base in RNA.
  • a “segment” refers to a section or region of a molecule, e.g., a contiguous stretch of nucleotides in the guide polynucleotide.
  • a segment can also refer to a region/section of a complex such that a segment can comprise regions of more than one molecule.
  • a protein-binding segment of a DNA- targeting RNA that comprises two separate molecules can comprise (i) base pairs 40-75 of a first RNA molecule that is 100 base pairs in length; and (ii) base pairs 10-25 of a second RNA molecule that is 50 base pairs in length.
  • segment unless otherwise specifically defined in a particular context, is not limited to a specific number of total base pairs, is not limited to any particular number of base pairs from a given RNA molecule, is not limited to a particular number of separate molecules within a complex, and can include regions of RNA molecules that are of any total length and can include regions with complementarity to other molecules.
  • the guide polynucleotides can be synthesized chemically, synthesized enzymatically, or a combination thereof.
  • the gRNA can be synthesized using standard phosphoramidite-based solid-phase synthesis methods.
  • the gRNA can be synthesized in vitro by operably linking DNA encoding the gRNA to a promoter control sequence that is recognized by a phage RNA polymerase.
  • suitable phage promoter sequences include T7, T3, SP6 promoter sequences, or variations thereof.
  • the crRNA can be chemically synthesized and the tracrRNA can be enzymatically synthesized.
  • a gRNA molecule can be transcribed in vitro.
  • a guide polynucleotide may be expressed, for example, by a DNA that encodes the gRNA, e.g., a DNA vector comprising a sequence encoding the gRNA.
  • the gRNA may be encoded alone or together with an encoded base editor.
  • Such DNA sequences may be introduced into an expression system, e.g., a cell, together or separately.
  • DNA sequences encoding a polynucleotide programmable nucleotide binding domain and a gRNA may be introduced into a cell, each DNA sequence can be part of a separate molecule (e.g., one vector containing the polynucleotide programmable nucleotide binding domain coding sequence and a second vector containing the gRNA coding sequence) or both can be part of a same molecule (e.g., one vector containing coding (and regulatory) sequence for both the polynucleotide programmable nucleotide binding domain and the gRNA).
  • An RNA can be transcribed from a synthetic DNA molecule, e.g., a g Blocks® gene fragment.
  • a gRNA or a guide polynucleotide can comprise three regions: a first region at the 5' end that can be complementary to a target site in a chromosomal sequence, a second internal region that can form a stem loop structure, and a third 3' region that can be single-stranded.
  • a first region of each gRNA can also be different such that each gRNA guides a fusion protein to a specific target site.
  • second and third regions of each gRNA can be identical in all gRNAs.
  • a first region of a gRNA or a guide polynucleotide can be complementary to sequence at a target site in a chromosomal sequence such that the first region of the gRNA can base pair with the target site.
  • a first region of a gRNA can comprise from or from about 10 nucleotides to 25 nucleotides (i.e., from 10 nucleotides to nucleotides; or from about 10 nucleotides to about 25 nucleotides; or from 10 nucleotides to about 25 nucleotides; or from about 10 nucleotides to 25 nucleotides) or more.
  • a region of base pairing between a first region of a gRNA and a target site in a chromosomal sequence can be or can be about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 23, 24, 25, or more nucleotides in length.
  • a first region of a gRNA can be or can be about 19, 20, or 21 nucleotides in length.
  • a gRNA or a guide polynucleotide can also comprise a second region that forms a secondary structure.
  • a secondary structure formed by a gRNA can comprise a stem (or hairpin) and a loop.
  • a length of a loop and a stem can vary.
  • a loop can range from or from about 3 to 10 nucleotides in length
  • a stem can range from or from about 6 to 20 base pairs in length.
  • a stem can comprise one or more bulges of 1 to 10 or about 10 nucleotides.
  • the overall length of a second region can range from or from about 16 to 60 nucleotides in length.
  • a loop can be or can be about 4 nucleotides in length and a stem can be or can be about 12 base pairs.
  • a gRNA or a guide polynucleotide can also comprise a third region at the 3' end that can be essentially single-stranded.
  • a third region is sometimes not complementarity to any chromosomal sequence in a cell of interest and is sometimes not complementarity to the rest of a gRNA.
  • the length of a third region can vary.
  • a third region can be more than or more than about 4 nucleotides in length.
  • the length of a third region can range from or from about 5 to 60 nucleotides in length.
  • a gRNA or a guide polynucleotide can target any exon or intron of a gene target.
  • a guide can target exon 1 or 2 of a gene, in other cases; a guide can target exon 3 or 4 of a gene.
  • a composition comprises multiple gRNAs that all target the same exon or multiple gRNAs that target different exons. An exon and/or an intron of a gene can be targeted.
  • a gRNA or a guide polynucleotide can target a nucleic acid sequence of about 20 nucleotides or less than about 20 nucleotides (e.g., at least about 5, 10, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30 nucleotides), or anywhere between about 1-100 nucleotides (e.g., 5, 10, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 40, 50, 60, 70, 80, 90, 100).
  • a target nucleic acid sequence can be or can be about 20 bases immediately 5' of the first nucleotide of the PAM.
  • a gRNA can target a nucleic acid sequence.
  • a target nucleic acid can be at least or at least about 1-10, 1-20, 1-30, 1-40, 1-50, 1-60, 1-70, 1-80, 1-90, or 1-100 nucleotides.
  • gRNAs and targeting sequences are described herein and known to those skilled in the art.
  • the number of residues that could unintentionally be targeted for deamination e.g., off-target C residues that could potentially reside on single strand DNA within the target nucleic acid locus
  • software tools can be used to optimize the gRNAs corresponding to a target nucleic acid sequence, e.g., to minimize total off-target activity across the genome.
  • all off-target sequences may be identified across the genome that contain up to certain number (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10) of mismatched base-pairs.
  • First regions of gRNAs complementary to a target site can be identified, and all first regions (e.g., crRNAs) can be ranked according to its total predicted off- target score; the top-ranked targeting domains represent those that are likely to have the greatest on-target and the least off-target activity.
  • Candidate targeting gRNAs can be functionally evaluated by using methods known in the art and/or as set forth herein.
  • target DNA hybridizing sequences in crRNAs of a gRNA for use with Cas9s may be identified using a DNA sequence searching algorithm.
  • gRNA design is carried out using custom gRNA design software based on the public tool cas-offinder as described in Bae S., Park J., & Kim J.-S. Cas-OFFinder: A fast and versatile algorithm that searches for potential off-target sites of Cas9 RNA-guided endonucleases. Bioinformatics 30, 1473-1475 (2014). This software scores guides after calculating their genome-wide off-target propensity. Typically matches ranging from perfect matches to 7 mismatches are considered for guides ranging in length from 17 to 24.
  • an aggregate score is calculated for each guide and summarized in a tabular output using a web- interface.
  • the software also identifies all PAM adjacent sequences that differ by 1 , 2, 3 or more than 3 nucleotides from the selected target sites.
  • Genomic DNA sequences for a target nucleic acid sequence e.g., a target gene may be obtained and repeat elements may be screened using publicly available tools, for example, the RepeatMasker program. RepeatMasker searches input DNA sequences for repeated elements and regions of low complexity. The output is a detailed annotation of the repeats present in a given query sequence.
  • first regions of gRNAs are ranked into tiers based on their distance to the target site, their orthogonality and presence of 5' nucleotides for close matches with relevant PAM sequences (for example, a 5' G based on identification of close matches in the human genome containing a relevant PAM e.g., NGG PAM for S. pyogenes, NNGRRT or NNGRRV PAM for S. aureus).
  • relevant PAM for example, a 5' G based on identification of close matches in the human genome containing a relevant PAM e.g., NGG PAM for S. pyogenes, NNGRRT or NNGRRV PAM for S. aureus.
  • orthogonality refers to the number of sequences in the human genome that contain a minimum number of mismatches to the target sequence.
  • a “high level of orthogonality” or “good orthogonality” may, for example, refer to 20- mer targeting domains that have no identical sequences in the human genome besides the intended target, nor any sequences that contain one or two mismatches in the target sequence. Targeting domains with good orthogonality may be selected to minimize off-target DNA cleavage.
  • a gRNA can then be introduced into a cell or embryo as an RNA molecule or a non-RNA nucleic acid molecule, e.g., DNA molecule.
  • a DNA encoding a gRNA is operably linked to promoter control sequence for expression of the gRNA in a cell or embryo of interest.
  • a RNA coding sequence can be operably linked to a promoter sequence that is recognized by RNA polymerase III (Pol III).
  • Plasmid vectors that can be used to express gRNA include, but are not limited to, px330 vectors and px333 vectors.
  • a plasmid vector (e.g., px333 vector) can comprise at least two gRNA-encoding DNA sequences.
  • a vector can comprise additional expression control sequences (e.g., enhancer sequences, Kozak sequences, polyadenylation sequences, transcriptional termination sequences, etc.), selectable marker sequences (e.g., GFP or antibiotic resistance genes such as puromycin), origins of replication, and the like.
  • a DNA molecule encoding a gRNA can also be linear.
  • a DNA molecule encoding a gRNA or a guide polynucleotide can also be circular.
  • a reporter system is used for detecting base-editing activity and testing candidate guide polynucleotides.
  • a reporter system comprises a reporter gene based assay where base editing activity leads to expression of the reporter gene.
  • a reporter system may include a reporter gene comprising a deactivated start codon, e.g., a mutation on the template strand from 3'-TAC-5' to 3'-CAC-5'. Upon successful deamination of the target C, the corresponding mRNA will be transcribed as 5'-AUG-3' instead of 5'-GUG-3', enabling the translation of the reporter gene.
  • Suitable reporter genes will be apparent to those of skill in the art.
  • Non-limiting examples of reporter genes include gene encoding green fluorescence protein (GFP), red fluorescence protein (RFP), luciferase, secreted alkaline phosphatase (SEAP), or any other gene whose expression are detectable and apparent to those skilled in the art.
  • the reporter system can be used to test many different gRNAs, e.g., in order to determine which residue(s) with respect to the target DNA sequence the respective deaminase will target.
  • sgRNAs that target non-template strand can also be tested in order to assess off-target effects of a specific base editing protein, e.g., a Cas9 deaminase fusion protein.
  • such gRNAs can be designed such that the mutated start codon will not be base-paired with the gRNA.
  • the guide polynucleotides can comprise standard ribonucleotides, modified ribonucleotides (e.g., pseudouridine), ribonucleotide isomers, and/or ribonucleotide analogs.
  • the guide polynucleotide can comprise at least one detectable label.
  • the detectable label can be a fluorophore (e.g., FAM, TMR, Cy3, Cy5, Texas Red, Oregon Green, Alexa Fluors, Halo tags, or suitable fluorescent dye), a detection tag (e.g., biotin, digoxigenin, and the like), quantum dots, or gold particles.
  • fluorophore e.g., FAM, TMR, Cy3, Cy5, Texas Red, Oregon Green, Alexa Fluors, Halo tags, or suitable fluorescent dye
  • detection tag e.g., biotin, digoxigenin, and the like
  • quantum dots e.g., gold particles.
  • a base editor system may comprise multiple guide polynucleotides, e.g., gRNAs.
  • the gRNAs may target to one or more target loci (e.g., at least 1 gRNA, at least 2 gRNA, at least 5 gRNA, at least 10 gRNA, at least 20 gRNA, at least 30 g RNA, at least 50 gRNA) comprised in a base editor system.
  • the multiple gRNA sequences can be tandemly arranged and are preferably separated by a direct repeat.
  • a guide polynucleotide can comprise one or more modifications to provide a nucleic acid with a new or enhanced feature.
  • a guide polynucleotide can comprise a nucleic acid affinity tag.
  • a guide polynucleotide can comprise synthetic nucleotide, synthetic nucleotide analog, nucleotide derivatives, and/or modified nucleotides.
  • a gRNA or a guide polynucleotide can comprise modifications.
  • a modification can be made at any location of a gRNA or a guide polynucleotide. More than one modification can be made to a single gRNA or a guide polynucleotide.
  • a gRNA or a guide polynucleotide can undergo quality control after a modification. In some cases, quality control can include PAGE, HPLC, MS, or any combination thereof.
  • a modification of a gRNA or a guide polynucleotide can be a substitution, insertion, deletion, chemical modification, physical modification, stabilization, purification, or any combination thereof.
  • a gRNA or a guide polynucleotide can also be modified by 5' adenylate, 5' guanosine- triphosphate cap, 5' N7-Methylguanosine-triphosphate cap, 5' triphosphate cap, 3' phosphate, 3' thiophosphate, 5' phosphate, 5' thiophosphate, Cis-Syn thymidine dimer, trimers, C12 spacer, C3 spacer, C6 spacer, dSpacer, PC spacer, rSpacer, Spacer 18, Spacer 9, 3'-3' modifications, 5'-5' modifications, abasic, acridine, azobenzene, biotin, biotin BB, biotin TEG, cholesteryl TEG, desthiobiotin TEG, DNP TEG, DNP-X, DOTA, dT-Biotin, dual biotin, PC biotin, psoralen C2, psoralen C6, T
  • a modification is permanent. In other cases, a modification is transient. In some cases, multiple modifications are made to a gRNA or a guide polynucleotide.
  • a gRNA or a guide polynucleotide modification can alter physiochemical properties of a nucleotide, such as their conformation, polarity, hydrophobicity, chemical reactivity, base-pairing interactions, or any combination thereof.
  • a guide polynucleotide can be transferred into a cell by transfecting the cell with an isolated gRNA or a plasmid DNA comprising a sequence coding for the guide RNA and a promoter.
  • a gRNAor a guide polynucleotide can also be transferred into a cell in other way, such as using virus-mediated gene delivery.
  • a gRNAor a guide polynucleotide can be isolated.
  • a gRNA can be transfected in the form of an isolated RNA into a cell or organism.
  • a gRNA can be prepared by in vitro transcription using any in vitro transcription system known in the art.
  • a modification can also be a phosphorothioate substitute.
  • a natural phosphodiester bond can be susceptible to rapid degradation by cellular nucleases and; a modification of internucleotide linkage using phosphorothioate (PS) bond substitutes can be more stable towards hydrolysis by cellular degradation.
  • PS phosphorothioate
  • a modification can increase stability in a gRNA or a guide polynucleotide.
  • a modification can also enhance biological activity.
  • a phosphorothioate enhanced RNA gRNA can inhibit RNase A, RNase T1, calf serum nucleases, or any combinations thereof.
  • PS-RNA gRNAs can be used in applications where exposure to nucleases is of high probability in vivo or in vitro.
  • phosphorothioate (PS) bonds can be introduced between the last 3-5 nucleotides at the 5'- or "- end of a gRNA which can inhibit exonuclease degradation.
  • phosphorothioate bonds can be added throughout an entire gRNA to reduce attack by endonucleases.
  • the guide RNA is designed to disrupt a splice site (/.e., a splice acceptor (SA) or a splice donor (SD). In some embodiments, the guide RNA is designed such that the base editing results in a premature STOP codon.
  • SA splice acceptor
  • SD splice donor
  • PAM protospacer adjacent motif
  • PAM-like motif refers to a 2-6 base pair DNA sequence immediately following the DNA sequence targeted by the Cas9 nuclease in the CRISPR bacterial adaptive immune system.
  • the PAM can be a 5' PAM (/.e., located upstream of the 5' end of the protospacer).
  • the PAM can be a 3' PAM (/.e., located downstream of the 5' end of the protospacer).
  • the PAM sequence is essential for target binding, but the exact sequence depends on a type of Cas protein.
  • the PAM sequence can be any PAM sequence known in the art.
  • Suitable PAM sequences include, but are not limited to, NGG, NGA, NGC, NGN, NGT, NGTT, NGCG, NGAG, NGAN, NGNG, NGCN, NGCG, NGTN, NNGRRT, NNNRRT, NNGRR(N), TTTV, TYCV, TYCV, TATV, NNNNGATT, NNAGAAW, or NAAAAC.
  • Y is a pyrimidine; N is any nucleotide base; W is A or T.
  • a base editor provided herein can comprise a CRISPR protein-derived domain that is capable of binding a nucleotide sequence that contains a canonical or non-canonical protospacer adjacent motif (PAM) sequence.
  • a PAM site is a nucleotide sequence in proximity to a target polynucleotide sequence.
  • Cas9 proteins such as Cas9 from S. pyogenes (spCas9)
  • spCas9 require a canonical NGG PAM sequence to bind a particular nucleic acid region, where the “N” in “NGG” is adenine (A), thymine (T), guanine (G), or cytosine (C), and the G is guanine.
  • a PAM can be CRISPR protein-specific and can be different between different base editors comprising different CRISPR protein-derived domains.
  • a PAM can be 5' or 3' of a target sequence.
  • a PAM can be upstream or downstream of a target sequence.
  • a PAM can be 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more nucleotides in length. Often, a PAM is between 2-6 nucleotides in length.
  • the PAM is an “NRN” PAM where the “N” in “NRN” is adenine (A), thymine (T), guanine (G), or cytosine (C), and the R is adenine (A) or guanine (G); or the PAM is an “NYN” PAM, wherein the “N” in NYN is adenine (A), thymine (T), guanine (G), or cytosine (C), and the Y is cytidine (C) or thymine (T), for example, as described in R.T. Walton et a!., 2020, Science, 10.1126/science.aba8853 (2020), the entire contents of which are incorporated herein by reference.
  • the PAM is NGC. In some embodiments, the NGC PAM is recognized by a Cas9 variant. In some embodiments, the NGC PAM variant includes one or more amino acid substitutions selected from D1135M, S1136Q, G1218K, E1219F, A1322R, D1332A, R1335E, and T1337R (collectively termed “MQKFRAER”). In some embodiments, the PAM is NGT. In some embodiments, the NGT PAM is recognized by a Cas9 variant.
  • the NGT PAM variant is generated through targeted mutations at one or more residues 1335, 1337, 1135, 1136, 1218, and/or 1219. In some embodiments, the NGT PAM variant is created through targeted mutations at one or more residues 1219, 1335, 1337, 1218. In some embodiments, the NGT PAM variant is created through targeted mutations at one or more residues 1135, 1136, 1218, 1219, and 1335. In some embodiments, the NGT PAM variant is selected from the set of targeted mutations provided in Tables 7A and 7B below.
  • Table 7A NGT PAM Variant Mutations at residues 1219, 1335, 1337, 1218
  • Table 7B NGT PAM Variant Mutations at residues 1135, 1136, 1218, 1219, and 1335
  • the NGT PAM variant is selected from variant 5, 7, 28, 31, or 36 in Table 7A and Table 7B. In some embodiments, the variants have improved NGT PAM recognition. In some embodiments, the NGT PAM variants have mutations at residues 1219, 1335,
  • the NGT PAM variant is selected with mutations for improved recognition from the variants provided in Table 8 below.
  • NGT PAM Variant Mutations at residues 1219, 1335, 1337, and 1218 are selected from the variants provided in Table 9 below.
  • the NGTN variant is variant 1. In some embodiments, the NGTN variant is variant 2. In some embodiments, the NGTN variant is variant 3. In some embodiments, the NGTN variant is variant 4. In some embodiments, the NGTN variant is variant 5. In some embodiments, the NGTN variant is variant 6.
  • the Cas9 domain is a Cas9 domain from Streptococcus pyogenes (SpCas9).
  • the SpCas9 domain is a nuclease active SpCas9, a nuclease inactive SpCas9 (SpCas9d), or a SpCas9 nickase (SpCas9n).
  • the SpCas9 comprises a D9X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid except for D.
  • the SpCas9 comprises a D9A mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SpCas9 domain, the SpCas9d domain, or the SpCas9n domain can bind to a nucleic acid sequence having a non-canonical PAM.
  • the SpCas9 domain, the SpCas9d domain, or the SpCas9n domain can bind to a nucleic acid sequence having an NGG, a NGA, or a NGCG PAM sequence.
  • the SpCas9 domain comprises one or more of a D1135X, a R1335X, and a T1337X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
  • the SpCas9 domain comprises one or more of a D1135E, R1335Q, and T1337R mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises a D1135E, a R1335Q, and a T1337R mutation, or corresponding mutations in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises one or more of a D1135X, a R1335X, and a T1337X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
  • the SpCas9 domain comprises one or more of a D1135V, a R1335Q, and a T1337R mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises a D1135V, a R1335Q, and a T1337R mutation, or corresponding mutations in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises one or more of a D1135X, a G1218X, a R1335X, and a T1337X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
  • the SpCas9 domain comprises one or more of a D1135V, a G1218R, a R1335Q, and a T1337R mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises a D1135V, a G1218R, a R1335Q, and a T1337R mutation, or corresponding mutations in any of the amino acid sequences provided herein.
  • a PAM recognized by a CRISPR protein-derived domain of a base editor disclosed herein can be provided to a cell on a separate oligonucleotide to an insert (e.g., an AAV insert) encoding the base editor.
  • an insert e.g., an AAV insert
  • providing PAM on a separate oligonucleotide can allow cleavage of a target sequence that otherwise would not be able to be cleaved, because no adjacent PAM is present on the same polynucleotide as the target sequence.
  • S. pyogenes Cas9 can be used as a CRISPR endonuclease for genome engineering. However, others can be used. In some embodiments, a different endonuclease can be used to target certain genomic targets. In some embodiments, synthetic SpCas9-derived variants with non-NGG PAM sequences can be used. Additionally, other Cas9 orthologues from various species have been identified and these “non-SpCas9s” can bind a variety of PAM sequences that can also be useful for the present disclosure.
  • the relatively large size of SpCas9 can lead to plasmids carrying the SpCas9 cDNA that cannot be efficiently expressed in a cell.
  • the coding sequence for Staphylococcus aureus Cas9 (SaCas9) is approximately 1 kilobase shorter than SpCas9, possibly allowing it to be efficiently expressed in a cell.
  • the SaCas9 endonuclease is capable of modifying target genes in mammalian cells in vitro and in mice in vivo.
  • a Cas protein can target a different PAM sequence.
  • a target gene can be adjacent to a Cas9 PAM, 5'-NGG, for example.
  • Cas9 orthologs can have different PAM requirements.
  • other PAMs such as those of S. thermophiius (5'-NNAGAA for CRISPR1 and 5'-NGGNG for CRISPR3) and Neisseria meningitidis (5'-NNNNGATT) can also be found adjacent to a target gene.
  • a target gene sequence can precede (/. e. , be 5' to) a 5'-NGG PAM, and a 20-nt guide RNA sequence can base pair with an opposite strand to mediate a Cas9 cleavage adjacent to a PAM.
  • an adjacent cut can be or can be about 3 base pairs upstream of a PAM. In some embodiments, an adjacent cut can be or can be about 10 base pairs upstream of a PAM. In some embodiments, an adjacent cut can be or can be about 0-20 base pairs upstream of a PAM.
  • an adjacent cut can be next to, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 base pairs upstream of a PAM.
  • An adjacent cut can also be downstream of a PAM by 1 to 30 base pairs.
  • engineered SpCas9 variants are capable of recognizing protospacer adjacent motif (PAM) sequences flanked by a 3' H (non-G PAM) (see Tables 2A- 2D).
  • the SpCas9 variants recognize NRNH PAMs (where R is A or G and H is A, C or T).
  • the non-G PAM is NRRH, NRTH, or NRCH (see e.g., Miller, S.M., et al. Continuous evolution of SpCas9 variants compatible with non-G PAMs, Nat. Biotechnol. (2020), the contents of which is incorporated herein by reference in its entirety).
  • the Cas9 domain is a recombinant Cas9 domain. In some embodiments, the recombinant Cas9 domain is a SpyMacCas9 domain. In some embodiments, the SpyMacCas9 domain is a nuclease active SpyMacCas9, a nuclease inactive SpyMacCas9 (SpyMacCas9d), or a SpyMacCas9 nickase (SpyMacCas9n). In some embodiments, the SaCas9 domain, the SaCas9d domain, or the SaCas9n domain can bind to a nucleic acid sequence having a non-canonical PAM. In some embodiments, the SpyMacCas9 domain, the SpCas9d domain, or the SpCas9n domain can bind to a nucleic acid sequence having a NAA PAM sequence.
  • a variant Cas9 protein harbors H840A, P475A, W476A, N477A, D1125A, W1126A, and D1218A mutations such that the polypeptide has a reduced ability to cleave a target DNA or RNA.
  • a variant Cas9 protein harbors H840A, P475A, W476A, N477A, D1125A, W1126A, and D1218A mutations relative to SEQ ID NO: 234.
  • Such a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors D10A, H840A, P475A, W476A, N477A, D1125A, W1126A, and D1218A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • Such a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors D10A, H840A, P475A, W476A, N477A, D1125A, W1126A, and D1218A mutations relative to SEQ ID NO: 234.
  • the variant Cas9 protein when a variant Cas9 protein harbors W476A and W1126A mutations or when the variant Cas9 protein harbors P475A, W476A, N477A, D1125A, W1126A, and D1218A mutations, the variant Cas9 protein does not bind efficiently to a PAM sequence. Thus, in some such cases, when such a variant Cas9 protein is used in a method of binding, the method does not require a PAM sequence.
  • the method when such a variant Cas9 protein is used in a method of binding, can include a guide RNA, but the method can be performed in the absence of a PAM sequence (and the specificity of binding is therefore provided by the targeting segment of the guide RNA).
  • Other residues can be mutated to achieve the above effects (i.e., inactivate one or the other nuclease portions).
  • residues D10, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and/or A987 can be altered (i.e., substituted).
  • mutations other than alanine substitutions are suitable.
  • a CRISPR protein-derived domain of a base editor can comprise all or a portion of a Cas9 protein with a canonical PAM sequence (NGG).
  • a Cas9-derived domain of a base editor can employ a non-canonical PAM sequence.
  • Such sequences have been described in the art and would be apparent to the skilled artisan.
  • Cas9 domains that bind non-canonical PAM sequences have been described in Kleinstiver, B. P., et al., “Engineered CRISPR-Cas9 nucleases with altered PAM specificities” Nature 523, 481-485 (2015); and Kleinstiver, B.
  • Fusion Proteins Comprising a NapDNAbp and a Cytidine Deaminase and/or Adenosine Deaminase
  • fusion proteins comprising a Cas9 domain or other nucleic acid programmable DNA binding protein (e.g., Cas12) and one or more cytidine deaminase or adenosine deaminase domains.
  • Cas9 domain may be any of the Cas9 domains or Cas9 proteins (e.g., dCas9 or nCas9) provided herein.
  • any of the Cas9 domains or Cas9 proteins may be fused with any of the cytidine deaminases and/or adenosine deaminases provided herein.
  • the domains of the base editors disclosed herein can be arranged in any order.
  • the fusion protein comprises the following domains A-C, A-D, or
  • a and C or A, C, and E each comprises one or more of the following: an adenosine deaminase domain or an active fragment thereof, a cytidine deaminase domain or an active fragment thereof, and wherein B or B and D, each comprises one or more domains having nucleic acid sequence specific binding activity.
  • the fusion protein comprises the following structure: NH 2 -[An-B 0 -Cn]-COOH;
  • a and C or A, C, and E each comprises one or more of the following: an adenosine deaminase domain or an active fragment thereof, a cytidine deaminase domain or an active fragment thereof, and wherein n is an integer: 1 , 2, 3, 4, or 5, wherein p is an integer: 0, 1 , 2, 3, 4, or 5; wherein q is an integer 0, 1 , 2, 3, 4, or 5; and wherein B or B and D each comprises a domain having nucleic acid sequence specific binding activity; and wherein o is an integer: 1 , 2, 3, 4, or 5.
  • the fusion protein comprises the structure:
  • any of the Cas12 domains or Cas12 proteins provided herein may be fused with any of the cytidine or adenosine deaminases provided herein.
  • the fusion protein comprises the structure: NH2-[adenosine deaminase]-[Cas12 domain]-COOH;
  • the adenosine deaminase is a TadA*8.
  • Exemplary fusion protein structures include the following:
  • the adenosine deaminase of the fusion protein comprises a TadA*8 and a cytidine deaminase and/or an adenosine deaminase.
  • the TadA*8 is TadA*8.1, TadA*8.2, TadA*8.3, TadA*8.4, TadA*8.5, TadA*8.6, TadA*8.7, TadA*8.8, TadA*8.9, TadA*8.10, TadA*8.11, TadA*8.12, TadA*8.13, TadA*8.14, TadA*8.15, TadA*8.16, TadA*8.17, TadA*8.18, TadA*8.19, TadA*8.20, TadA*8.21 , TadA*8.22, TadA*8.23, or TadA*8.24.
  • Exemplary fusion protein structures include the following: NH2-[TadA*8]-[Cas9/Cas12]-[adenosine deaminase]-COOH;
  • the adenosine deaminase of the fusion protein comprises a TadA*9 and a cytidine deaminase and/or an adenosine deaminase.
  • Exemplary fusion protein structures include the following:
  • the fusion protein can comprise a deaminase flanked by an N- terminal fragment and a C-terminal fragment of a Cas9 or Cas12 polypeptide. In some embodiments, the fusion protein comprises a cytidine deaminase flanked by an N- terminal fragment and a C-terminal fragment of a Cas9 or Cas12 polypeptide. In some embodiments, the fusion protein comprises an adenosine deaminase flanked by an N- terminal fragment and a C- terminal fragment of a Cas9 or Cas 12 polypeptide.
  • the fusion proteins comprising a cytidine deaminase or adenosine deaminase and a napDNAbp do not include a linker sequence.
  • a linker is present between the cytidine or adenosine deaminase and the napDNAbp.
  • the used in the general architecture above indicates the presence of an optional linker.
  • cytidine or adenosine deaminase and the napDNAbp are fused via any of the linkers provided herein.
  • the cytidine or adenosine deaminase and the napDNAbp are fused via any of the linkers provided herein.
  • the fusion proteins of the present disclosure may comprise one or more additional features.
  • the fusion protein may comprise inhibitors, cytoplasmic localization sequences, export sequences, such as nuclear export sequences, or other localization sequences, as well as sequence tags that are useful for solubilization, purification, or detection of the fusion proteins.
  • Suitable protein tags include, but are not limited to, biotin carboxylase carrier protein (BCCP) tags, myc-tags, calmodulin-tags, FLAG-tags, hemagglutinin (HA)-tags, polyhistidine tags, also referred to as histidine tags or His-tags, maltose binding protein (MBP)-tags, nus-tags, glutathione-S- transferase (GST)-tags, green fluorescent protein (GFP)-tags, thioredoxin-tags, S-tags, Softags (e.g., Softag 1, Softag 3), strep-tags , biotin ligase tags, FIAsH tags, V5 tags, and SBP-tags. Additional suitable sequences will be apparent to those of skill in the art.
  • the fusion protein comprises one or more His tags.
  • fusion proteins are described in International PCT Application Nos. PCT/2017/044935, PCT/US2019/044935, and PCT/US2020/016288, each of which is incorporated herein by reference for its entirety.
  • the fusion proteins provided herein further comprise one or more (e.g., 2, 3, 4, 5) nuclear targeting sequences, for example a nuclear localization sequence (NLS).
  • NLS nuclear localization sequence
  • a bipartite NLS is used.
  • a NLS comprises an amino acid sequence that facilitates the importation of a protein, that comprises an NLS, into the cell nucleus (e.g., by nuclear transport).
  • the NLS is fused to the N-terminus or the C-terminus of the fusion protein.
  • the NLS is fused to the C-terminus or N-terminus of an nCas9 domain or a dCas9 domain.
  • the NLS is fused to the N-terminus or C-terminus of the Cas12 domain. In some embodiments, the NLS is fused to the N-terminus or C-terminus of the cytidine or adenosine deaminase. In some embodiments, the NLS is fused to the fusion protein via one or more linkers. In some embodiments, the NLS is fused to the fusion protein without a linker. In some embodiments, the NLS comprises an amino acid sequence of any one of the NLS sequences provided or referenced herein. Additional nuclear localization sequences are known in the art and would be apparent to the skilled artisan.
  • an NLS comprises the amino acid sequence PKKKRKVEGADKRTADGSEFESPKKKRKV (SEQ ID NO: 83), KRTADGSEFESPKKKRKV (SEQ ID NO: 84), KRPAATKKAGQAKKKK (SEQ ID NO: 85), KKTELQTTNAENKTKKL (SEQ ID NO: 86), KRGINDRNFWRGENGRKTR (SEQ ID NO: 87), RKSGKIAAIWKRPRKPKKKRKV (SEQ ID NO: 1424), or MDSLLMNRRKFLYQFKNVRWAKGRRETYLC (SEQ ID NO: 90).
  • the fusion proteins comprising a cytidine or adenosine deaminase, a Cas9 domain, and an NLS do not comprise a linker sequence.
  • linker sequences between one or more of the domains or proteins e.g., cytidine or adenosine deaminase, Cas9 domain or NLS
  • a linker is present between the cytidine deaminase and adenosine deaminase domains and the napDNAbp.
  • the used in the general architecture below indicates the presence of an optional linker.
  • the cytidine deaminase and adenosine deaminase and the napDNAbp are fused via any of the linkers provided herein.
  • the cytidine deaminase and adenosine deaminase and the napDNAbp are fused via any of the linkers provided herein.
  • the general architecture of exemplary napDNAbp (e.g., Cas9 or Cas12) fusion proteins with a cytidine or adenosine deaminase and a napDNAbp (e.g., Cas9 or Cas12) domain comprises any one of the following structures, where NLS is a nuclear localization sequence (e.g., any NLS provided herein), NH2 is the N-terminus of the fusion protein, and COOH is the C-terminus of the fusion protein:
  • a bipartite NLS comprises two basic amino acid clusters, which are separated by a relatively short spacer sequence (hence bipartite - 2 parts, while monopartite NLSs are not).
  • the NLS of nucleoplasmin, KR[PAATKKAGQA] KKKK (SEQ ID NO: 85), is the prototype of the ubiquitous bipartite signal: two clusters of basic amino acids, separated by a spacer of about 10 amino acids.
  • the sequence of an exemplary bipartite NLS follows: PKKKRKVEGADKRTADGSEFESPKKKRKV (SEQ ID NO: 83)
  • a vector that encodes a CRISPR enzyme comprising one or more nuclear localization sequences can be used.
  • NLSs nuclear localization sequences
  • a CRISPR enzyme can comprise the NLSs at or near the amino-terminus, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 NLSs at or near the carboxy-terminus, or any combination thereof ( e.g ., one or more NLS at the amino-terminus and one or more NLS at the carboxy terminus).
  • each can be selected independently of others, such that a single NLS can be present in more than one copy and/or in combination with one or more other NLSs present in one or more copies.
  • CRISPR enzymes used in the methods can comprise about 6 NLSs.
  • An NLS is considered near the N- or C-terminus when the nearest amino acid to the NLS is within about 50 amino acids along a polypeptide chain from the N- or C-terminus, e.g., within 1 , 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, or 50 amino acids.
  • a base editor described herein can include any domain which helps to facilitate the nucleobase editing, modification or altering of a nucleobase of a polynucleotide.
  • a base editor comprises a polynucleotide programmable nucleotide binding domain (e.g., Cas9), a nucleobase editing domain (e.g., deaminase domain), and one or more additional domains.
  • the additional domain can facilitate enzymatic or catalytic functions of the base editor, binding functions of the base editor, or be inhibitors of cellular machinery (e.g., enzymes) that could interfere with the desired base editing result.
  • a base editor can comprise a nuclease, a nickase, a recombinase, a deaminase, a methyltransferase, a methylase, an acetylase, an acetyltransferase, a transcriptional activator, or a transcriptional repressor domain.
  • a base editor can comprise an uracil glycosylase inhibitor (UGI) domain.
  • U: G heteroduplex DNA can be responsible for a decrease in nucleobase editing efficiency in cells.
  • uracil DNA glycosylase (UDG) can catalyze removal of U from DNA in cells, which can initiate base excision repair (BER), mostly resulting in reversion of the U:G pair to a C:G pair.
  • BER can be inhibited in base editors comprising one or more domains that bind the single strand, block the edited base, inhibit UGI, inhibit BER, protect the edited base, and /or promote repairing of the non-edited strand.
  • this disclosure contemplates a base editor fusion protein comprising a UGI domain.
  • a base editor comprises as a domain all or a portion of a doublestrand break (DSB) binding protein.
  • a DSB binding protein can include a Gam protein of bacteriophage Mu that can bind to the ends of DSBs and can protect them from degradation. See Komor, A.C., etal., “Improved base excision repair inhibition and bacteriophage Mu Gam protein yields C:G-to-T:A base editors with higher efficiency and product purity” Science Advances 3:eaao4774 (2017), the entire content of which is hereby incorporated by reference.
  • a Gam protein can be fused to an N terminus of a base editor.
  • a Gam protein can be fused to a C terminus of a base editor.
  • the Gam protein of bacteriophage Mu can bind to the ends of double strand breaks (DSBs) and protect them from degradation.
  • using Gam to bind the free ends of DSB can reduce indel formation during the process of base editing.
  • 174- residue Gam protein is fused to the N terminus of the base editors.
  • a mutation or mutations can change the length of a base editor domain relative to a wild type domain. For example, a deletion of at least one amino acid in at least one domain can reduce the length of the base editor. In another case, a mutation or mutations do not change the length of a domain relative to a wild type domain. For example, substitutions in any domain does not change the length of the base editor.
  • Non-limiting examples of such base editors, where the length of all the domains is the same as the wild type domains, can include:

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Medicinal Chemistry (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Virology (AREA)
  • Mycology (AREA)
  • Cell Biology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Apparatus Associated With Microorganisms And Enzymes (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/US2022/017075 2021-02-19 2022-02-18 Recombinant rabies viruses for gene therapy Ceased WO2022178307A1 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
AU2022224054A AU2022224054A1 (en) 2021-02-19 2022-02-18 Recombinant rabies viruses for gene therapy
CN202280028643.XA CN117321198A (zh) 2021-02-19 2022-02-18 用于基因疗法的重组狂犬病病毒
CA3208612A CA3208612A1 (en) 2021-02-19 2022-02-18 Recombinant rabies viruses for gene therapy
EP22713480.6A EP4263825A1 (en) 2021-02-19 2022-02-18 Recombinant rabies viruses for gene therapy
JP2023550277A JP2024507533A (ja) 2021-02-19 2022-02-18 遺伝子治療のための組み換え狂犬病ウイルス
KR1020237029781A KR20230158476A (ko) 2021-02-19 2022-02-18 유전자 요법을 위한 재조합 광견병 바이러스

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202163151542P 2021-02-19 2021-02-19
US63/151,542 2021-02-19
US202163241989P 2021-09-08 2021-09-08
US63/241,989 2021-09-08

Publications (1)

Publication Number Publication Date
WO2022178307A1 true WO2022178307A1 (en) 2022-08-25

Family

ID=80953580

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/017075 Ceased WO2022178307A1 (en) 2021-02-19 2022-02-18 Recombinant rabies viruses for gene therapy

Country Status (7)

Country Link
US (1) US20220290164A1 (cg-RX-API-DMAC7.html)
EP (1) EP4263825A1 (cg-RX-API-DMAC7.html)
JP (1) JP2024507533A (cg-RX-API-DMAC7.html)
KR (1) KR20230158476A (cg-RX-API-DMAC7.html)
AU (1) AU2022224054A1 (cg-RX-API-DMAC7.html)
CA (1) CA3208612A1 (cg-RX-API-DMAC7.html)
WO (1) WO2022178307A1 (cg-RX-API-DMAC7.html)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023039468A1 (en) * 2021-09-08 2023-03-16 Beam Therapeutics Inc. Viral guide rna delivery
WO2024163603A1 (en) * 2023-02-01 2024-08-08 Beam Therapeutics Inc. Chimeric pseudotyped recombinant rabies virus

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020051562A2 (en) 2018-09-07 2020-03-12 Beam Therapeutics Inc. Compositions and methods for improving base editing
EP3847254A4 (en) 2018-09-07 2022-08-10 Beam Therapeutics Inc. COMPOSITIONS AND METHODS FOR DELIVERING A NUCLEOBASE EDITING SYSTEM
AU2020215730A1 (en) 2019-01-31 2021-07-29 Beam Therapeutics Inc. Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors
CN120174005A (zh) 2019-02-13 2025-06-20 比姆医疗股份有限公司 具有用于修饰靶标序列中核碱基的腺苷脱氨酶碱基编辑器的经修饰的免疫细胞
EP4034138A4 (en) 2019-09-27 2024-07-31 Beam Therapeutics, Inc. COMPOSITIONS AND METHODS FOR THE TREATMENT OF LIQUID CANCERS
CA3196831A1 (en) 2020-09-25 2022-03-31 Beam Therapeutics Inc. Fratricide resistant modified immune cells and methods of using the same
WO2025111384A1 (en) * 2023-11-20 2025-05-30 Beam Therapeutics Inc. Compositions and methods for altering complement activation
CN119033805B (zh) * 2024-08-12 2025-07-22 华南农业大学 靶向抑制狂犬病病毒G基因和/或L基因的siRNA在制备抑制狂犬病的药物中的应用

Citations (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4880635A (en) 1984-08-08 1989-11-14 The Liposome Company, Inc. Dehydrated liposomes
US4906477A (en) 1987-02-09 1990-03-06 Kabushiki Kaisha Vitamin Kenkyusyo Antineoplastic agent-entrapping liposomes
US4911928A (en) 1987-03-13 1990-03-27 Micro-Pak, Inc. Paucilamellar lipid vesicles
US4917951A (en) 1987-07-28 1990-04-17 Micro-Pak, Inc. Lipid vesicles formed of surfactants and steroids
US4920016A (en) 1986-12-24 1990-04-24 Linear Technology, Inc. Liposomes with enhanced circulation time
US4921757A (en) 1985-04-26 1990-05-01 Massachusetts Institute Of Technology System for delayed and pulsed release of biologically active substances
WO2001038547A2 (en) 1999-11-24 2001-05-31 Mcs Micro Carrier Systems Gmbh Polypeptides comprising multimers of nuclear localization signals or of protein transduction domains and their use for transferring molecules into cells
US6453242B1 (en) 1999-01-12 2002-09-17 Sangamo Biosciences, Inc. Selection of sites for targeting by zinc finger proteins and methods of designing zinc finger proteins to bind to preselected sites
US6503717B2 (en) 1999-12-06 2003-01-07 Sangamo Biosciences, Inc. Methods of using randomized libraries of zinc finger proteins for the identification of gene function
US6534261B1 (en) 1999-01-12 2003-03-18 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6599692B1 (en) 1999-09-14 2003-07-29 Sangamo Bioscience, Inc. Functional genomics using zinc finger proteins
US6689558B2 (en) 2000-02-08 2004-02-10 Sangamo Biosciences, Inc. Cells for drug discovery
US6794498B2 (en) 1992-03-27 2004-09-21 The United States Of America As Represented By The Department Of Health And Human Services Method of eliminating inhibitory/instability regions of mRNA
US7013219B2 (en) 1999-01-12 2006-03-14 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
WO2011053982A2 (en) 2009-11-02 2011-05-05 University Of Washington Therapeutic nuclease compositions and methods
WO2012106490A1 (en) * 2011-02-03 2012-08-09 The Government Of The U.S.A., As Represented By The Secretary, Department Of Health & Human Services Multivalent vaccines for rabies virus and filoviruses
WO2017044935A1 (en) 2015-09-11 2017-03-16 Wm. Wrigley Jr. Company Synergistic antibacterial effects of magnolia bark extract and l-arginine, n-alpha-lauroyl ethyl ester on salivary bacteria
WO2017045381A1 (zh) 2015-09-18 2017-03-23 京东方科技集团股份有限公司 一种拼接屏
WO2017070632A2 (en) 2015-10-23 2017-04-27 President And Fellows Of Harvard College Nucleobase editors and uses thereof
WO2018027078A1 (en) 2016-08-03 2018-02-08 President And Fellows Of Harard College Adenosine nucleobase editors and uses thereof
WO2018203049A1 (en) * 2017-05-02 2018-11-08 United Kingdom Research And Innovation Self-inactivating viral vector
WO2019013258A1 (ja) * 2017-07-11 2019-01-17 国立大学法人 東京大学 光制御性のウイルスタンパク質、その遺伝子、及びその遺伝子を含むウイルスベクター
US20200071723A1 (en) * 2018-08-30 2020-03-05 California Institute Of Technology Rna-based delivery systems with levels of control
EP3730616A1 (en) * 2017-12-18 2020-10-28 East China Normal University Split single-base gene editing systems and application thereof

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
HUP0500722A2 (hu) * 2001-07-20 2005-11-28 The University of Georgia Research Foundation, Inc@Á Attenuált veszettség vírus, a veszettség elleni vakcináláshoz és a központi idegrendszer génterápiájához egy nukleoprotein mutációval a foszforilezés helyén
EP2585598B1 (en) * 2010-06-24 2015-12-30 THE GOVERNMENT OF THE UNITED STATES OF AMERICA, as represented by the Secretary, Department of Health and Human Services Pan-lyssavirus vaccines against rabies
US11155885B2 (en) * 2016-05-20 2021-10-26 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Real-time reverse transcriptase-polymerase chain reaction assay with modified probe for the diagnosis of rabies viruses and other lyssaviruses

Patent Citations (30)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4880635B1 (en) 1984-08-08 1996-07-02 Liposome Company Dehydrated liposomes
US4880635A (en) 1984-08-08 1989-11-14 The Liposome Company, Inc. Dehydrated liposomes
US4921757A (en) 1985-04-26 1990-05-01 Massachusetts Institute Of Technology System for delayed and pulsed release of biologically active substances
US4920016A (en) 1986-12-24 1990-04-24 Linear Technology, Inc. Liposomes with enhanced circulation time
US4906477A (en) 1987-02-09 1990-03-06 Kabushiki Kaisha Vitamin Kenkyusyo Antineoplastic agent-entrapping liposomes
US4911928A (en) 1987-03-13 1990-03-27 Micro-Pak, Inc. Paucilamellar lipid vesicles
US4917951A (en) 1987-07-28 1990-04-17 Micro-Pak, Inc. Lipid vesicles formed of surfactants and steroids
US6794498B2 (en) 1992-03-27 2004-09-21 The United States Of America As Represented By The Department Of Health And Human Services Method of eliminating inhibitory/instability regions of mRNA
US6453242B1 (en) 1999-01-12 2002-09-17 Sangamo Biosciences, Inc. Selection of sites for targeting by zinc finger proteins and methods of designing zinc finger proteins to bind to preselected sites
US7163824B2 (en) 1999-01-12 2007-01-16 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6534261B1 (en) 1999-01-12 2003-03-18 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6607882B1 (en) 1999-01-12 2003-08-19 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US7013219B2 (en) 1999-01-12 2006-03-14 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6979539B2 (en) 1999-01-12 2005-12-27 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6824978B1 (en) 1999-01-12 2004-11-30 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6933113B2 (en) 1999-01-12 2005-08-23 Sangamo Biosciences, Inc. Modulation of endogenous gene expression in cells
US6599692B1 (en) 1999-09-14 2003-07-29 Sangamo Bioscience, Inc. Functional genomics using zinc finger proteins
WO2001038547A2 (en) 1999-11-24 2001-05-31 Mcs Micro Carrier Systems Gmbh Polypeptides comprising multimers of nuclear localization signals or of protein transduction domains and their use for transferring molecules into cells
US6503717B2 (en) 1999-12-06 2003-01-07 Sangamo Biosciences, Inc. Methods of using randomized libraries of zinc finger proteins for the identification of gene function
US6689558B2 (en) 2000-02-08 2004-02-10 Sangamo Biosciences, Inc. Cells for drug discovery
WO2011053982A2 (en) 2009-11-02 2011-05-05 University Of Washington Therapeutic nuclease compositions and methods
WO2012106490A1 (en) * 2011-02-03 2012-08-09 The Government Of The U.S.A., As Represented By The Secretary, Department Of Health & Human Services Multivalent vaccines for rabies virus and filoviruses
WO2017044935A1 (en) 2015-09-11 2017-03-16 Wm. Wrigley Jr. Company Synergistic antibacterial effects of magnolia bark extract and l-arginine, n-alpha-lauroyl ethyl ester on salivary bacteria
WO2017045381A1 (zh) 2015-09-18 2017-03-23 京东方科技集团股份有限公司 一种拼接屏
WO2017070632A2 (en) 2015-10-23 2017-04-27 President And Fellows Of Harvard College Nucleobase editors and uses thereof
WO2018027078A1 (en) 2016-08-03 2018-02-08 President And Fellows Of Harard College Adenosine nucleobase editors and uses thereof
WO2018203049A1 (en) * 2017-05-02 2018-11-08 United Kingdom Research And Innovation Self-inactivating viral vector
WO2019013258A1 (ja) * 2017-07-11 2019-01-17 国立大学法人 東京大学 光制御性のウイルスタンパク質、その遺伝子、及びその遺伝子を含むウイルスベクター
EP3730616A1 (en) * 2017-12-18 2020-10-28 East China Normal University Split single-base gene editing systems and application thereof
US20200071723A1 (en) * 2018-08-30 2020-03-05 California Institute Of Technology Rna-based delivery systems with levels of control

Non-Patent Citations (94)

* Cited by examiner, † Cited by third party
Title
"Drug Product Design and Performance", 1984, WILEY, article "Controlled Drug Bioavailability"
"Journal of Experiments in Molecular Genetics", 1972, COLD SPRING HARBOR LABORATORY, pages: 431 - 433
"Medical Applications of Controlled Release", 1974, CRC PRESS
"New Cell Engineering Experiment Protocol", 1995, SHUJUNSHA, pages: 263 - 267
ALBERTINI ET AL., ADV. VIRUS. RES., vol. 79, 2011, pages 1 - 22
AUSUBEL, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, 1987
BAE S.PARK J.KIM J.-S: "Cas-OFFinder: A fast and versatile algorithm that searches for potential off-target sites of Cas9 RNA-guided endonucleases", BIOINFORMATICS, vol. 30, 2014, pages 1473 - 1475, XP055196964, DOI: 10.1093/bioinformatics/btu048
BENTONDAVIS, SCIENCE, vol. 196, 1977, pages 180
BIO/TECHNOLOGY, vol. 6, 1988, pages 47 - 55
BRINER ET AL., GUIDE RNA FUNCTIONAL MODULES DIRECT CAS9 ACTIVITY AND ORTHOGONALITY MOL CELL, vol. 56, no. 2, 23 October 2014 (2014-10-23), pages 333 - 339
BUCHWALD ET AL., SURGERY, vol. 88, 1980, pages 507
CHATTERJEE ET AL., NAT. NEUROSCI., vol. 21, no. 4, 2018, pages 638 - 646
CHYLINSKIRHUNCHARPENTIER: "The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems", RNA BIOLOGY, vol. 10, no. 5, 2013, pages 726 - 737, XP055116068, DOI: 10.4161/rna.24321
COLIGAN, CURRENT PROTOCOLS IN IMMUNOLOGY, 1991
DAVIDSON ET AL., COLD SPRING HARB PROTOC, vol. 4, no. 8, 2009, pages 1018 - 1023
DELTCHEVA E. ET AL.: "CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III", NATURE, vol. 471, 2011, pages 602 - 607, XP055619637, DOI: 10.1038/nature09886
DHUNGEL ET AL., MOLECULES, vol. 23, no. 7, 2018, pages 1500
DURING ET AL., ANN. NEUROL., vol. 25, 1989, pages 351
FERRETTI ET AL.: "Complete genome sequence of an MI strain of Streptococcus pyogenes", PROC. NATL. ACAD. SCI. U.S.A., vol. 98, 2001, pages 4658 - 4663, XP002344854, DOI: 10.1073/pnas.071559398
FERRETTI, J.J. ET AL.: "Complete genome sequence of an M1 strain of Streptococcus pyogenes", NATL. ACAD. SCI. U.S.A., vol. 98, 2001, pages 4658 - 4663, XP002344854, DOI: 10.1073/pnas.071559398
FRESHNEY, ANIMAL CELL CULTURE, 1987
GAIT, OLIGONUCLEOTIDE SYNTHESIS, 1984
GAUDELLI, N.M. ET AL.: "Programmable base editing of A T to G-C in genomic DNA without DNA cleavage", NATURE, vol. 551, 2017, pages 464 - 471, XP037336615, DOI: 10.1038/nature24644
GAUDELLI, N.M. ET AL.: "Programmable base editing of A*T to G-C in genomic DNA without DNA cleavage", NATURE, vol. 551, 2017, pages 464 - 471
GAUDELLI, N.M. ET AL.: "Programmable base editing of A»T to G-C in genomic DNA without DNA cleavage", NATURE, vol. 551, 2017, pages 464 - 471
GAUDELLI, N.M. ET AL.: "Programmable base editing of A-T to G-C in genomic DNA without DNA cleavage", NATURE, vol. 551, 2017, pages 464 - 471, XP037336615, DOI: 10.1038/nature24644
GENE, vol. 17, 1982, pages 107
GHANEM ET AL., EUR. J. CELL BIOL., vol. 91, 2012, pages 10 - 16
GRUNSTEINHOGNESS, PROC. NATL. ACAD. SCI., USA, vol. 72, 1975, pages 3961
GUILINGER JP ET AL.: "Fusion of catalytically inactive Cas9 to Fokl nuclease improves the specificity of genome modification", NAT. BIOTECHNOL., vol. 32, no. 6, 2014, pages 577 - 82, XP055157221, DOI: 10.1038/nbt.2909
HALEMARHAM, THE HARPER COLLINS DICTIONARY OF BIOLOGY, 1991
HOWARD, J. NEUROSURG., vol. 71, 1989, pages 105
HU ET AL.: "Evolved Cas9 variants with broad PAM compatibility and high DNA specificity", NATURE, vol. 556, no. 7699, 5 April 2018 (2018-04-05), pages 57 - 63, XP055490065, DOI: 10.1038/nature26155
HUANG, Y.-H. ET AL.: "DNA epigenome editing using CRISPR-Cas SunTag-directed DNMT3A", GENOME BIOL, vol. 18, 2017, pages 176
JINEK ET AL., SCIENCE, vol. 337, no. 6096, 17 August 2012 (2012-08-17), pages 816 - 21
JINEK M ET AL., SCIENCE, vol. 337, 2012, pages 816 - 821
JINEK M. ET AL.: "A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity", SCIENCE, vol. 337, 2012, pages 816 - 821, XP055229606, DOI: 10.1126/science.1225829
JINEK M.CHYLINSKI K.FONFARA I.HAUER M.DOUDNA J. A.CHARPENTIER E.: "Programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity", SCIENCE, vol. 337, 2012, pages 816 - 821, XP055229606, DOI: 10.1126/science.1225829
KLEINSTIVER, B. P. ET AL.: "Broadening the targeting range of Staphylococcus aureus CRISPR-Cas9 by modifying PAM recognition", NATURE BIOTECHNOLOGY, vol. 33, 2015, pages 1293 - 1298, XP055832821, DOI: 10.1038/nbt.3404
KLEINSTIVER, B. P. ET AL.: "Engineered CRISPR-Cas9 nucleases with altered PAM specificities", NATURE, vol. 523, 2015, pages 481 - 485, XP055293257, DOI: 10.1038/nature14592
KLEINSTIVER, B.P. ET AL.: "High-fidelity CRISPR-Cas9 nucleases with no detectable genome-wide off-target effects", NATURE, vol. 529, 2016, pages 490 - 495, XP055650074, DOI: 10.1038/nature16526
KOBLAN ET AL., NATURE BIOTECH, 2018
KOMOR, A.C. ET AL.: "Improved base excision repair inhibition and bacteriophage Mu Gam protein yields C:G-to-T:A base editors with higher efficiency and product purity", SCIENCE ADVANCES, vol. 3, 2017, pages eaao4774, XP055453964, DOI: 10.1126/sciadv.aao4774
KOMOR, A.C. ET AL.: "Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage", NATURE, vol. 533, 2016, pages 420 - 424, XP055551781, DOI: 10.1038/nature17946
LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533
LEVY ET AL., SCIENCE, vol. 228, 1985, pages 190
LIU ET AL.: "C2c1-sgRNA Complex Structure Reveals RNA-Guided DNA Cleavage Mechanism", MOL. CELL, vol. 65, no. 2, 19 January 2017 (2017-01-19), pages 310 - 322, XP029890333, DOI: 10.1016/j.molcel.2016.11.040
M. RICHTER ET AL., NATURE BIOTECHNOLOGY, 2020
MAKAROVA ET AL.: "Classification and Nomenclature of CRISPR-Cas Systems: Where from Here?", CRISPR J, vol. 1, October 2018 (2018-10-01), pages 325 - 336, XP055619311, DOI: 10.1089/crispr.2018.0033
MCCANN, J. ET AL.: "MagnEdit - interacting factors that recruit DNA-editing enzymes to single base targets", LIFE-SCIENCE-ALLIANCE, vol. 3, no. 4, 2020, pages e201900606, XP055904646, DOI: 10.26508/lsa.201900606
METHODS IN ENZYMOLOGY, vol. 194, 1991, pages 182 - 187
MILLER ET AL.: "Continuous evolution of SpCas9 variants compatible with non-G PAMs", NAT. BIOTECHNOL., vol. 38, no. 4, April 2020 (2020-04-01), pages 471 - 481, XP037086854, DOI: 10.1038/s41587-020-0412-8
MILLER, S.M. ET AL.: "Continuous evolution of SpCas9 variants compatible with non-G PAMs", NAT. BIOTECHNOL., 2020
MILLER, S.M.: "G PAMs", NAT. BIOTECHNOL., 2020
MILLERCALOS, GENE TRANSFER VECTORS FOR MAMMALIAN CELLS, 1987
MOLECULAR & GENERAL GENETICS, vol. 168, 1979, pages 111
MULLIS, PCR: THE POLYMERASE CHAIN REACTION, 1994
OGINO ET AL., NUCL. ACIDS. RES., vol. 47, no. 1, 2019, pages 299 - 309
OGINOGREEN, FRONT. MICROBIOL., vol. 10, 2019, pages 1490
OGINOGREEN, VIRUSES, vol. 11, no. 6, 2019, pages 504
OSAKADAWICKERSHAM, NATURE PROTOC, vol. 8, no. 8, 2013, pages 1583 - 1601
PAUSCH ET AL.: "CRISPR-CasO from huge phages is a hypercompact genome editor", SCIENCE, vol. 369, 17 July 2020 (2020-07-17), pages 333 - 337, XP055862891, DOI: 10.1126/science.abb1400
PRASHANT ET AL.: "CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering", NATURE BIOTECHNOLOGY, vol. 31, no. 9, 2013, pages 833 - 838, XP055693153, DOI: 10.1038/nbt.2675
PROC. NATL. ACAD. SCI. USA, vol. 69, 1972, pages 2110
PROC. NATL. ACAD. SCI. USA, vol. 75, 1978, pages 1929
QI ET AL.: "Repurposing CRISPR as an RNA-guided platform for sequence-specific control of gene expression", CELL, vol. 152, no. 5, 2013, pages 1173 - 83, XP055346792, DOI: 10.1016/j.cell.2013.02.022
R.T. WALTON ET AL.: "Unconstrained genome targeting with near-PAMiess engineered CRISPR-Cas9 variants", SCIENCE, 2020
RAN ET AL., NAT PROTOC, vol. 8, no. 11, November 2013 (2013-11-01), pages 2281 - 2308
RAN, CELL, vol. 154, no. 6, 12 September 2013 (2013-09-12), pages 1380 - 9
RANGERPEPPAS, MACROMOL. SCI. REV. MACROMOL. CHEM., vol. 23, 1983, pages 61
RASTALLAMALFITANO, APPL. CLIN. GENET., vol. 8, 2015, pages 157 - 169
REMINGTON: "The Science and Practice of Pharmacy", 2006, LIPPINCOTT, WILLIAMS & WILKINS
SAMBROOK, MOLECULAR CLONING: A LABORATORY MANUAL, 1989
SATO SHO ET AL: "Effects of G-gene Deletion and Replacement on Rabies Virus Vector Gene Expression", PLOS ONE, vol. 10, no. 5, 29 May 2015 (2015-05-29), pages e0128020, XP055934372, Retrieved from the Internet <URL:https://journals.plos.org/plosone/article/file?id=10.1371/journal.pone.0128020&type=printable> DOI: 10.1371/journal.pone.0128020 *
SAUDEK ET AL., N. ENGL. J. MED., vol. 321, 1989, pages 574
SEFTON, CRC CRIT. REF. BIOMED. ENG., vol. 14, 1989, pages 201
SHMAKOV ET AL.: "Discovery and Functional Characterization of Diverse Class 2 CRISPR Cas Systems", MOL. CELL, vol. 60, no. 3, 5 November 2015 (2015-11-05), pages 385 - 397, XP055785070, DOI: 10.1016/j.molcel.2015.10.008
SINGLETON ET AL., DICTIONARY OF MICROBIOLOGY AND MOLECULAR BIOLOGY, 1994
SLAYMAKER, I.M. ET AL.: "Rationally engineered Cas9 nucleases with improved specificity", SCIENCE, vol. 351, 2015, pages 84 - 88, XP055551663, DOI: 10.1126/science.aad5227
SULLIVANWICKERSHAM, COLD SPRING HARB PROTOC, vol. 4, 2015, pages 386 - 91
SUZUKI TOSHIAKI ET AL: "Multiplex Neural Circuit Tracing With G-Deleted Rabies Viral Vectors", FRONTIERS IN NEURAL CIRCUITS, vol. 13, 10 January 2020 (2020-01-10), XP055934387, DOI: 10.3389/fncir.2019.00077 *
TAN JZHANG FKARCHER DBOCK R: "Engineering of high-precision base editors for site-specific single nucleotide replacement", NAT COMMUN, vol. 10, no. 1, 25 January 2019 (2019-01-25), pages 439
TANDON ET AL., BIO PROTOC, vol. 8, no. 21, 2018, pages e3073
TANENBAUM, M.E. ET AL.: "A protein tagging system for signal amplification in gene expression and fluorescence imaging", CELL, vol. 159, no. 3, 23 October 2014 (2014-10-23), pages 635 - 646, XP029084861, DOI: 10.1016/j.cell.2014.09.039
THE CAMBRIDGE DICTIONARY OF SCIENCE AND TECHNOLOGY, 1988
TRABELSI ET AL., VACCINE, vol. 37, no. 47, 2019, pages 7052 - 7060
VIROLOGY, vol. 52, 1973, pages 456
WAHL, G. M.S. L. BERGER, METHODS ENZYMOL, vol. 152, 1987, pages 507
WEIR, HANDBOOK OF EXPERIMENTAL IMMUNOLOGY, 1996
WICKERSHAM ET AL., NATURE PROTOC, vol. 5, no. 3, 2010, pages 595 - 606
YAN ET AL.: "Functionally Diverse Type V CRISPR-Cas Systems", SCIENCE, vol. 363, 4 January 2019 (2019-01-04), pages 88 - 91, XP055594948, DOI: 10.1126/science.aav7271
YAN ET AL.: "Functionally diverse type V CRISPR-Cas systems", SCIENCE, vol. 363, no. 6422, 4 January 2019 (2019-01-04), pages 88 - 91, XP055594948, DOI: 10.1126/science.aav7271
YANG ET AL.: "PAM-dependent Target DNA Recognition and Cleavage by C2C1 CRISPR-Cas endonuclease", CELL, vol. 167, no. 7, 15 December 2016 (2016-12-15), pages 1814 - 1828, XP029850724, DOI: 10.1016/j.cell.2016.11.053
ZHANG Y. P. ET AL., GENE THER, vol. 6, 1999, pages 1438 - 47

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023039468A1 (en) * 2021-09-08 2023-03-16 Beam Therapeutics Inc. Viral guide rna delivery
WO2024163603A1 (en) * 2023-02-01 2024-08-08 Beam Therapeutics Inc. Chimeric pseudotyped recombinant rabies virus

Also Published As

Publication number Publication date
EP4263825A1 (en) 2023-10-25
US20220290164A1 (en) 2022-09-15
CA3208612A1 (en) 2022-08-25
KR20230158476A (ko) 2023-11-20
JP2024507533A (ja) 2024-02-20
AU2022224054A1 (en) 2023-09-28

Similar Documents

Publication Publication Date Title
JP7717684B2 (ja) 新規核酸塩基エディター及びその使用方法
US12016908B2 (en) Compositions and methods for treating hemoglobinopathies
JP7646554B2 (ja) アルファ-1アンチトリプシン不全を治療するための組成物および方法
JP7679311B2 (ja) プログラム可能塩基エディターシステムを用いた一塩基多型編集法
US12133884B2 (en) Methods of substituting pathogenic amino acids using programmable base editor systems
US20220290164A1 (en) Recombinant rabies viruses for gene therapy
CN114072509A (zh) 脱氨反应脱靶减低的核碱基编辑器和使用其修饰核碱基靶序列的方法
WO2021041885A2 (en) Compositions and methods for editing a mutation to permit transcription or expression
WO2020231863A1 (en) Compositions and methods for treating hepatitis b
WO2023086953A1 (en) Compositions and methods for the treatment of hereditary angioedema (hae)
US20230270840A1 (en) Viral guide rna delivery
WO2023049935A1 (en) Compositions and methods for treating hepatitis b virus infection
US20230110201A1 (en) Pseudotyped recombinant lyssaviruses for gene therapy
CN117321198A (zh) 用于基因疗法的重组狂犬病病毒

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22713480

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3208612

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022713480

Country of ref document: EP

Effective date: 20230717

WWE Wipo information: entry into national phase

Ref document number: 2023550277

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 202317058387

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2022224054

Country of ref document: AU

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022224054

Country of ref document: AU

Date of ref document: 20220218

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202280028643.X

Country of ref document: CN