WO2022150367A1 - Guide rna designs and complexes for tracr-less type v cas systems - Google Patents
Guide rna designs and complexes for tracr-less type v cas systems Download PDFInfo
- Publication number
- WO2022150367A1 WO2022150367A1 PCT/US2022/011289 US2022011289W WO2022150367A1 WO 2022150367 A1 WO2022150367 A1 WO 2022150367A1 US 2022011289 W US2022011289 W US 2022011289W WO 2022150367 A1 WO2022150367 A1 WO 2022150367A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- ligand binding
- grna
- complex
- binding complex
- linker
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0684—Cells of the urinary tract or kidneys
- C12N5/0686—Kidney cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/78—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y305/00—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
- C12Y305/04—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in cyclic amidines (3.5.4)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/16—Aptamers
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/31—Chemical structure of the backbone
- C12N2310/315—Phosphorothioates
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/34—Spatial arrangement of the modifications
- C12N2310/344—Position-specific modifications, e.g. on every purine, at the 3'-end
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/35—Nature of the modification
- C12N2310/351—Conjugate
- C12N2310/3519—Fusion with another nucleic acid
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/50—Physical structure
- C12N2310/53—Physical structure partially self-complementary or closed
- C12N2310/531—Stem-loop; Hairpin
Definitions
- a tracrRNA trans-activating CRISPR RNA
- a crRNA CRISPR RNA
- the complementary sequence within the DNA thus becomes a target site, and the Cas9 protein may, based on its functional domain, cause editing at this target site.
- Cas9 systems Among the limitations of Cas9 systems are that the functional domains upon which the Cas9 systems can act are defined by the functional domain of the Cas9 protein that one uses and that the use of both a tracrRNA and a crRNA can be cumbersome.
- Other Cas proteins are known. Among these other Cas proteins, the potential of which has not been fully explored, are those within the Type V family, particularly those that do not require the presence of a tracrRNA to function. Within these systems, one may use a single guide RNA (gRNA) that contains a crRNA sequence. This crRNA sequence can associate with the Cas protein of interest without needing to be associated with a tracrRNA.
- gRNA single guide RNA
- the present invention provides novel and non-obvious gRNA-ligand binding complexes, base editing complexes, and methods for base editing. Through the use of various embodiments of the present invention, one may be able to efficiently and effectively cause base editing ex vivo, in vitro, and in vivo. Further, some embodiments of the present invention provide modular designs that allow for the same Type V Cas protein to be directed to different targeting sites and optionally associated with different effector proteins at the same or different sites.
- the present invention provides a gRNA- ligand binding complex, wherein the gRNA-ligand binding complex comprises: (a) a gRNA, wherein the gRNA is 35 to 60 or 36 to 60 nucleotides long and the gRNA has a crRNA sequence, wherein the crRNA sequence is 35 to 60 or 36 to 60 nucleotides long and the crRNA sequence comprises a Cas association region, wherein the Cas association region is 14 to 37 or 18 to 30 nucleotides long and a targeting region, wherein the targeting region is 14 to 37 or 18 to 30 or 18 to 20 nucleotides long and the Cas association region is capable of retaining association with an RNA binding domain of a Type V Cas protein in the absence of a tracrRNA; and (b) a ligand binding moiety, wherein the ligand binding moiety is either (i) directly bound to the gRNA, or (ii) bound to the gRNA through a linker.
- the gRNA of the gRNA-ligand binding complex comprises or consists essentially of a chemically modified or unmodified sequence that is or encodes SEQ ID NO: 137.
- the present invention provides a base editing complex comprising: a gRNA-ligand binding complex of the present invention and a Type V Cas protein, wherein the Cas association region of the gRNA-ligand binding complex is associated with the Type V Cas protein.
- the ligand binding moiety is reversibly associated with a ligand that is attached to or a part of an effector molecule.
- the present invention provides a method for base editing.
- the method comprises exposing a base editing complex of the present invention to double stranded DNA (“dsDNA”) or single stranded DNA (“ssDNA”).
- the base editing complex may be exposed to the dsDNA or ssDNA under conditions that permit base editing.
- dsDNA double stranded DNA
- ssDNA single stranded DNA
- the base editing complex may be exposed to the dsDNA or ssDNA under conditions that permit base editing.
- the system has a modular design.
- the presence of the ligand binding moiety within the gRNA-ligand binding complex allows that complex to associate with the corresponding ligand associated with (or contained within) the effector.
- the ligand binding moiety is associated with the gRNA in a manner and orientation that allows it to be capable of associating with a ligand.
- the ligand is attached to or associated with the effector in a manner that renders it capable of reversibly associating with the ligand binding moiety.
- the effector that is associated with the ligand will become part of any base editing complex that contains the gRNA-ligand binding complex.
- the base editing complex also contains a Cas protein, that Cas protein and the effector can be retained in the same locality, e.g., at or near a target site of interest.
- Figures 1A to figure 1G are representations of examples of CasPhi guide RNAs that show direct repeat, spacer, and when present, MS2 ligand binding moiety locations. The gRNAs are shown bound to a DNA strand (SEQ ID NO: 66) at the spacer regions.
- Figure 2A and figure 2B are bar graphs that depict the effects of MS2 placement on dCasPhi base editing levels for two genomic target sites.
- Figure 2C and figure 2D are representations of the evaluation of the effects of MS2 placement on gene disruption levels with CasPhi.
- Figure 3A and figure 3B are bar graphs that depict base editing with guides for multiple sets of deactivated CasPhi mutants.
- Figure 4A and figure 4B are bar graphs that summarize dCasPhi base editing efficiency when different length spacers for expressed gRNAs are used.
- Figures 4C, 4D, 4E, and 4F are schematics of gRNAs with different spacer lengths.
- Figure 5A, figure 5B, and figure 5C are bar graphs that depict dCasPhi base editing at multiple sites in HEK293T cells with chemically synthesized and chemically modified guides.
- Figure 6 is a bar graph representation of two different codon optimized dCasPhi base editing at HEK Site2 site in HEK293T cells with chemically modified synthetic guides.
- Figure 7A and figure 7B are bar graph representations of the effects of synthetic guide chemical modifications on dCasPhi base editing levels at two different genomic target sites in HEK293T cells.
- Figure 8A is a bar graph representation of an assessment of the effects of linkers in gRNA sequences on dCasPhi base editing levels.
- Figure 8B is a schematic of a gRNA with no linkers.
- Figures 8C to 8K are schematics of gRNA sequences with different locations and combinations of linkers.
- Figure 9 is a bar graph representation of dCasPhi aptamer-recruitment base editing in T Lymphocytes.
- Figure 10 is a bar graph representation of dCas12a base editing at HEK Site2 site in HEK293T cells with chemically modified guides.
- Figure 11A and figure 11B are representation of the evaluation of the effects of dCas12i2 base editing at HEK Site2 site with multiple deaminases in HEK293T cells.
- Figure 12 is a representation of a base editing complex of the present invention.
- 2′ modification refers to a nucleotide unit having a sugar moiety that is modified at the 2′ position of the sugar moiety.
- An example of a 2′ modification is a 2′-O-alkyl modification that forms a 2'-O-alkyl modified nucleotide or a 2' halogen modification that forms a 2' halogen modified nucleotide.
- 2′-O-alkyl modified nucleotide refers to a nucleotide unit having a sugar moiety, for example a, deoxyribosyl or ribosyl, moiety that is modified at the 2′ position such that an oxygen atom is attached both to the carbon atom located at the 2′ position of the sugar and to an alkyl group.
- the alkyl moiety consists of or consists essentially of carbon(s) and hydrogens.
- O-alkyl group e.g., -O-methyl, -O-ethyl, -O-propyl, -O-isopropyl, -O-butyl, -O-isobutyl, -O-ethyl-O-methyl (-OCH 2 CH 2 OCH 3 ), and -O-ethyl-OH (-OCH 2 CH 2 OH).
- a 2′-O-alkyl modified nucleotide may be substituted or unsubstituted.
- halogen modified nucleotide refers to a nucleotide unit having a sugar moiety, for example a deoxyribosyl moiety that is modified at the 2′ position such that the carbon at that position is directly attached to a halogen species, e.g., Fl, Cl, or Br.
- a “ligand binding moiety” refers to a moiety such as an aptamer e.g., oligonucleotide or peptide or another compound that binds to a specific ligand and can reversibly or irreversibly be associated with that ligand.
- modified nucleotide refers to a nucleotide having at least one modification in the chemical structure of the base, sugar and/or phosphate, including, but not limited to, 5-position pyrimidine modifications, 8-position purine modifications, modifications at cytosine exocyclic amines, and substitution of 5- bromo-uracil or 5-iodouracil; and 2′- modifications, including but not limited to, sugar-modified ribonucleotides in which the 2′-OH is replaced by a group such as an H, OR, R, halo, SH, SR, NH 2 , NHR, NR 2 , or CN, wherein R is an alkyl.
- Modified bases refer to nucleotide bases such as, for example, adenine, guanine, cytosine, thymine, uracil, xanthine, inosine, and queuosine that have been modified by the replacement or addition of one or more atoms or groups.
- nucleotide bases such as, for example, adenine, guanine, cytosine, thymine, uracil, xanthine, inosine, and queuosine that have been modified by the replacement or addition of one or more atoms or groups.
- Some examples of these types of modifications include, but are not limited to, alkylated, halogenated, thiolated, aminated, amidated, or acetylated bases, alone and in various combinations.
- More specific modified bases include, for example, 5-propynyluridine, 5-propynylcytidine, 6-methyladenine, 6-methylguanine, N,N,-dimethyladenine, 2- propyladenine, 2-propylguanine, 2-aminoadenine, 1-methylinosine, 3-methyluridine, 5-methylcytidine, 5-methyluridine and other nucleotides having a modification at the 5 position, 5-(2-amino)propyluridine, 5-halocytidine, 5-halouridine, 4-acetylcytidine, 1-methyladenosine, 2-methyladenosine, 3-methylcytidine, 6-methyluridine, 2- methylguanosine, 7-methylguanosine, 2,2-dimethylguanosine, 5- methylaminoethyluridine, 5-methyloxyuridine, deazanucleotides such as 7-deaza- adenosine, 6-azouridine, 6-azocytidine
- Modified nucleotides also include those nucleotides that are modified with respect to the sugar moiety, as well as nucleotides having sugars or analogs thereof that are not ribosyl.
- the sugar moieties may be, or be based on, mannoses, arabinoses, glucopyranoses, galactopyranoses, 4- thioribose, and other sugars, heterocycles, or carbocycles.
- codes for and the term “encodes” mean that one sequence contains either a sequence that is identical to a referenced nucleotide sequence, a DNA or RNA equivalent of the referenced nucleotide sequence, or a DNA or RNA or a sequence that is a DNA or RNA complement of the referenced nucleotide sequence.
- nucleic acid refers to a sequence that codes for or encodes a recited DNA sequence
- sequence refers to a sequence that unless otherwise specified is any one of the following: the same DNA sequence, a complement of the DNA sequence, the RNA equivalent of that sequence, or the RNA complement of that sequence or any of the aforementioned in which one or more ribonucleotides is substituted for its deoxyribonucleotide counterpart or one or more deoxyribonucleotides is substituted for its ribonucleotide counterpart.
- complementarity refers to the ability of a nucleic acid to form one or more hydrogen bonds with another nucleic acid sequence by either traditional Watson-Crick base-pairing or other non-traditional types.
- a percent complementarity indicates the percentage of residues in a nucleic acid molecule that can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%, 60%, 70%, 80%, 90%, and 100% complementary, respectively).
- Perfectly complementary means that all the contiguous residues of a nucleic acid sequence will hydrogen bond with the same number of contiguous residues in a second nucleic acid sequence.
- substantially complementary refers to a degree of complementarity that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, or at least 99%, over a region of for example, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, or more consecutive nucleotides, or refers to two nucleic acids that hybridize under stringent conditions.
- hybridization and “hybridizing” refer to a process in which completely, substantially, or partially complementary nucleic acid strands come together under specified hybridization conditions to form a double-stranded structure or region in which the two constituent strands are joined by hydrogen bonds. Unless otherwise stated, the hybridization conditions are naturally occurring or lab designed conditions. Although hydrogen bonds typically form between adenine and thymine or uracil (A and T or U) or between cytidine and guanine (C and G), other base pairs may form (see e.g., Adams et al., The Biochemistry of the Nucleic Acids, 11th ed., 1992).
- nucleotide refers to a ribonucleotide or a deoxyribonucleotide or modified form thereof, as well as an analog thereof.
- Nucleotides include species that comprise purines, e.g., adenine, hypoxanthine, guanine, and their derivatives and analogs, as well as pyrimidines, e.g., cytosine, uracil, thymine, and their derivatives and analogs.
- a nucleotide comprises a cytosine, uracil, thymine, adenine, or guanine moiety.
- nucleotide also includes those species that have a detectable label, such as for example a radioactive or fluorescent moiety, or mass label attached to the nucleotide.
- nucleotide also includes what are known in the art as universal bases.
- universal bases include but are not limited to 3-nitropyrrole, 5-nitroindole, or nebularine.
- Nucleotide analogs are, for example, meant to include nucleotides with bases such as inosine, queuosine, xanthine, sugars such as 2′-methyl ribose, and non-natural phosphodiester internucleotide linkages such as methylphosphonates, phosphorothioates, phosphoroacetates and peptides.
- bases such as inosine, queuosine, xanthine
- sugars such as 2′-methyl ribose
- non-natural phosphodiester internucleotide linkages such as methylphosphonates, phosphorothioates, phosphoroacetates and peptides.
- subject and “patient” are used interchangeably herein to refer to an organism. e.g., a vertebrate, preferably a mammal, more preferably a human. Mammals include, but are not limited to, murines, simians, humans, farm animals, sport animals,
- tissue, cells and their progeny of an organism or other biological entity obtained in vivo or cultured in vitro are also encompassed within the terms subject and patient.
- a subject may be an invertebrate animal, for example, an insect or a nematode; while in others, a subject may be a plant or a fungus.
- treatment As used herein, "treatment,” “treating,” “palliating,” and “ameliorating” are used interchangeably. These terms refer to an approach for obtaining beneficial or desired results including, but not limited to, a therapeutic benefit and/or a prophylactic benefit.
- therapeutic benefit is meant any therapeutically relevant improvement in or effect on one or more diseases, conditions, or symptoms under treatment.
- the complexes of the present invention may be administered to a subject, or a subject’s cells or tissues, or those of another subject extracorporeally before re-administration, at risk of developing a particular disease, condition, or symptom, or to a subject reporting one or more of the physiological symptoms of a disease, condition, or symptom, even though the disease, condition, or symptom might not have yet been manifested.
- a number of ranges of values are provided. It is understood that each intervening value, to the tenth of the unit of the lower limit, unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed.
- the present invention comprises a gRNA- ligand binding complex that comprises, consists essentially of, or consists of both a gRNA and a ligand binding moiety.
- This complex has the ability to retain association with a Type V Cas protein in the absence of a tracrRNA.
- the gRNA may be covalently bound directly to the ligand binding moiety or bound to the ligand binding moiety through a linker.
- the gRNA of the gRNA-ligand binding complex is single strand of nucleotides.
- the nucleotides may be entirely RNA or a combination of ribonucleotides and other nucleotides such as deoxyribonucleotides.
- Each nucleotide may be unmodified, or one or more nucleotides may be modified, e.g., with one of the following modifications: 2'-O-methyl, 2' fluoro or 2'aminopurine.
- nucleotides there are consecutively modified nucleotides or a modification pattern of every second, or every third or every fourth nucleotide being modified at its 2' position with all other nucleotides being unmodified. Additionally or alternatively, between one or more pairs or every pair of consecutive nucleotides, there may be modified or unmodified internucleotide linkages.
- the gRNA is 35 to 60 or 36 to 60 nucleotides long or 40 to 55 nucleotides long.
- the gRNA has a sequence that may consist of, consist essentially of or comprise a crRNA sequence.
- a Cas association region which also may be referred to as the repeat region, that is 14 to 37 or 18 to 30 nucleotides long or 18 to 30 nucleotides long or 20 to 25 nucleotides long
- a targeting region which also may be referred to as a spacer region, that is 14 to 37 or 18 to 30 nucleotides long or 20 to 25 nucleotides long.
- the targeting region contains the targeting sequence, which is a variable sequence that may be selected based on where one wishes for the Cas protein and/or effector to cause base editing.
- the targeting region may be designed to include a region that is complementary and capable of hybridization to a pre-selected target site of interest.
- the region of complementarity between the targeting region and the corresponding target site sequence may be about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more than 25 consecutive nucleotides in length or it may be at least 80%, at least 85%, at least 90%, or at least 95% complementary to a region of DNA over 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more than 25 consecutive nucleotides.
- the Cas association region of the gRNA is designed such that it is capable of retaining association with an RNA binding domain of a Type V Cas protein in the absence of a tracrRNA.
- the gRNA has or encodes one of the following sequences: SEQ ID NO: 1: UUAAUUUCUACUCUUGUAGAUN 14-30 ; or SEQ ID NO: 2: UGCUCGAUUAGUCGACACN 14-30 ; or SEQ ID NO: 3: GGAGAGAUCUCAAACGAUUGCUCGAUUAGUCGAGACN 14-30 ; or SEQ ID NO: 4: GUCGGAACGCUCAACGAUUGCCCCUCACGAGGGGACN 14-30 or SEQ ID NO: 5: ACCAAAACGACUAUUGAUUGCCCAGUACGCUGGGACN 14-30 or SEQ ID NO: 6: AUGGCAACAGACUCUCAUUGCGCGGUACGCCGCGACN 14-30 or SEQ ID NO: 7: GUCCCAACGAAUUGGGCAAU
- N 16-30 in SEQ ID NO: 1 to SEQ ID NO: 12 or SEQ ID NO: 67 to SEQ ID NO: 71 corresponds to the targeting region and the sequence upstream of that sequence corresponds to the Cas association region.
- N refers to any modified or unmodified nucleotide.
- N14-30 means that there can be 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides.
- 14 to 40 N nucleotides are 14 to 37 nucleotides.
- N is 16 to 30.
- the Cas association region has a sequence that is at least 80%, at least 85%, at least 90%, at least 95% similar to or the same as the Cas association region (the region upstream of the Ns) of SEQ ID NO: 1 to SEQ ID NO: 12 or SEQ ID NO: 67 to SEQ ID NO: 71 or of a wildtype crRNA in a naturally occurring condition or endogenous to a naturally occurring or genetically modified organism.
- the ligand binding moiety is an element that is capable of reversibly associating with a ligand by for example, forming non-covalent interactions.
- the ligand binding moiety is an aptamer.
- the ligand binding moiety may be bound to the gRNA directly, e.g., through a covalent bond, or through a linker.
- the association of the ligand binding moiety with the gRNA, regardless of whether directly through a covalent bond or through a linker, may be at any of a number of locations.
- a ligand binding moiety is bound directly to a gRNA if it is bound to a nucleotide within the gRNA, e.g., to the backbone phosphate of a unit or to a sugar moiety or to a nitrogenous base of a nucleotide.
- the ligand binding moiety may be bound directly (through e.g., a covalent bond) to the 3' end of the gRNA or to the 5' end of the gRNA.
- the ligand binding moiety may be bound to the first or last nucleotide in the gRNA.
- the ligand binding moiety is a nucleotide sequence and it is bound directly to the 5' end or the 3' end of the gRNA, it may be in the same 5' to 3' orientation as the gRNA.
- nucleotides that contains both the ligand binding moiety and the gRNA either • 5' –[gRNA]-[ligand binding moiety]-3' or • 5' –[ligand binding moiety]-[ gRNA]-3'.
- the ligand binding moiety may be directly attached to the gRNA in an opposite orientation and thus is either • 5' –[gRNA]- 3'- 3' -[ligand binding moiety]-5' or • 3' –[ligand binding moiety]- 5' - 5'-[ gRNA]-3'.
- the ligand binding moiety When the ligand binding moiety is not a nucleotide sequence, it may be attached at either the 5' or 3' end of the gRNA to the phosphorous moiety, the sugar at e.g., the 2', 3' or 5' position or the nitrogenous base. [0060] The ligand binding moiety may also be attached to the gRNA at a position other than the 5' end or the 3'.
- the ligand binding moiety is a nucleotide sequence it may be inserted in the gRNA, and thus there may for example be a first section of the gRNA that is 5' of the ligand binding moiety and a second section of the gRNA that is 3' of the ligand binding moiety such that there is one oligonucleotide sequence: • 5' –[first section of gRNA]-[ligand binding moiety]-[second section of gRNA]-3'.
- the first section of the gRNA contains the entire Cas association region and the second section of the gRNA contains the entire targeting region.
- the first section of the gRNA contains the entire Cas association region and a portion of the targeting region, while the second section of the gRNA contains the remainder of the targeting region. In other embodiments, the first section of the gRNA contains a portion of the Cas association region, while the second section of the gRNA contains the remainder of the Cas association and the entire targeting region. Relative to a gRNA that does not contain the ligand binding moiety, in the complex that contains the gRNA, and the ligand binding moiety inserted therein, there may be no deletion of nucleotides from either the Cas association region or the targeting region.
- nucleotides e.g., 1 to 10 nucleotides
- there may be a deletion of one or more nucleotides e.g., 1 to 10 nucleotides
- the ligand binding moiety when it is not a nucleotide sequence and it may be attached at either the 5' or 3' end of the gRNA to the phosphorous moiety, the sugar at e.g., the 2', 3' or 5' position or the nitrogenous base.
- the ligand binding moiety when it is not a nucleotide sequence, it may be bound to the gRNA at a location other than the 5' or 3' end of the gRNA, for example, it may be bound between two consecutive nucleotides as follows: • 5' –[first section of gRNA]-[ligand binding moiety]-[second section of gRNA]-3'. [0062]
- one or more linkers binds the ligand binding moiety to the gRNA.
- the linker and the ligand binding moiety each may independently comprise, consist essentially of, or consist of nucleotides.
- each of the linker and the ligand binding moiety may independently comprise, consist essentially of, or consist of a moiety other than nucleotides.
- one of the linker and the ligand binding moiety comprises, consists essentially of, or consists of a moiety other than nucleotides, while the other of the linker and the ligand binding moiety comprises, consists essentially of, or consists of nucleotides.
- each of the gRNA, the linker and ligand binding moiety may be in the same 5' to 3' orientation.
- the ligand binding moiety and/or the linker can be directly attached to the gRNA in an opposite orientation and thus is • 5' –[gRNA]- 3'- 3' –[linker]-5'-3'-[ligand binding moiety]-5' or • 5' –[gRNA]- 3'- 5' –[linker]-3'-3'-[ligand binding moiety]-5' or • 3' –[ ligand binding moiety]- 5'- 3' –[linker]-5'-5'-[ligand binding moiety]-3' or • 3' -[ligand binding moiety]-5' - 5' –[linker]-3'-5'-[gRNA]-3'.
- the ligand binding moiety may also be attached to the gRNA through a linker or two linkers at a position other than the 5' end or the 3'.
- the ligand binding moiety and the linker(s) are nucleotide sequences, they may be inserted in the gRNA, and thus there may, for example, be a first section of the gRNA that is 5' of the ligand binding moiety and a second section of the gRNA that is 3' of the ligand binding moiety. There may also be one or two linker sequences.
- linker sequence When there is only one linker sequence it may be either 5' or 3' of the ligand binding moiety such that the complex is • 5' –[first section of gRNA]-[linker]-[ligand binding moiety]-[second section of gRNA]-3', or • 5' –[first section of gRNA]- [ligand binding moiety]-[linker]- [second section of gRNA]-3'.
- a first linker may be 5' of the ligand binding moiety and the second linker may be 3' of the ligand binding moiety such that the complex is • 5' –[first section of gRNA]-[first linker]-[ligand binding moiety]-[second linker]-[second section of gRNA]-3'.
- each of the first section of gRNA, the first linker, the ligand binding moiety, the second linker, and the second section of gRNA are nucleotide sequences in the same orientation.
- one or more of the first linker, ligand binding moiety and the second linker are in the opposite orientation to that of the first section of gRNA and the second section of gRNA, which are in the same orientation.
- the ligand binding moiety is between the first section of the gRNA and the second section of the gRNA (and if one or two linkers are present they are also between the first section of the gRNA and the second section of the gRNA)
- the first section of the gRNA contains the entire Cas association region and the second section of the gRNA contains the entire targeting region.
- the first section of the gRNA contains the entire Cas association region and a portion of the targeting region, while the second section of the gRNA contains the remainder of the targeting region. In other embodiments, the first section of the gRNA contains a portion of the Cas association region, while the second section of the gRNA contains the remainder of the Cas association and the entire targeting region. Relative to a gRNA that does not contain the ligand binding moiety, in a complex that contains the gRNA and the ligand binding moiety inserted, there may be no deletion of nucleotides from either the Cas association region or the targeting region.
- each linker may be 1 to 20 nucleotides long and the linkers may be at least 80%, at least 85%, at least 90%, at least 95% at least 98% or 100% complementary and have no bulges or one or more bulges.
- the linker When the linker is not a nucleotide sequence, it may be bound to the 5' most nucleotide within the gRNA, the 3' most nucleotides within the gRNA or a nucleotide other than the 5 'most nucleotide or the 3' most nucleotide within the gRNA. Further, a linker that is not a nucleotide or oligonucleotide may be attached at any position of a sugar or nitrogenous base or be attached to or replace an internucleotide linkage. Additionally, in some embodiments, there are two non-nucleotide linkers or one nucleotide linker and one non-nucleotide linker.
- the gRNA forms a loop and the ligand binding moiety or the linker if present is bound to the loop.
- the bonding may, for example, be at the first nucleotide in the loop, the second nucleotide in the loop, the third nucleotide in the loop, the fourth nucleotide in the loop, the center nucleotide in the loop if the loop has an odd number of nucleotides or one of the two center most nucleotides in the loop if the loop has an even number of nucleotides, or the last nucleotide in the loop.
- any one or more of the aforementioned nucleotides and/or the 5' and/or 3' internucleotide linkage corresponding to them may be modified. These modifications may, for example, occur where the ligand binding moiety is bound to the gRNA (directly or through a linker) or only at locations other than where the ligand binding moiety is bound to the gRNA (directly or through a linker).
- the ligand binding moiety can be attached to a 2’ position of a sugar or attached to a nitrogenous base in the gRNA oligonucleotide sequence.
- the ligand binding moiety comprises, consists essentially of, or consists of an oligonucleotide sequence that is unmodified or comprises one or more modified nucleotides.
- the ligand binding moiety may be 10 to 50 or 18 to 50 nucleotides long.
- the ligand binding moiety comprises, consists essentially of, or consists of SEQ ID NO: 13 (ACAUGAGGAUCACCCAUGU) or a sequence that is substantially similar to SEQ ID NO: 13.
- the ligand binding moiety forms a stem-loop structure.
- the ligand binding moiety may appear as an extension of the gRNA sequence immediately 5' or 3' of the gRNA or as an insert in the gRNA.
- the ligand binding moiety comprises, consists essentially of, or consists of biotin or streptavidin.
- the ligand binding moiety can attach covalently or non- covalently.
- the ligand binding moiety is selected from the group consisting of moieties that associate with the following ligands: MS2 coat protein (MCP), Ku, PP7 coat protein (PCP), Com RNA binding protein or the binding domain thereof, SfMu, Sm7, Tat, Glutathione S-transferase (GST), CSY4, Qbeta, COM, pumilio, Anti-His Tag (6H7), SNAP-Tag, lambdaN22, a lectin (in which case ligand binding moiety may be carbohydrate or glycan or oligosaccharide), and PDGF beta- chain.
- MCP MS2 coat protein
- PCP PP7 coat protein
- Com RNA binding protein or the binding domain thereof SfMu, Sm7, Tat, Glutathione S-transferase (GST), CSY4, Qbeta, COM, pumilio, Anti-His Tag (6H7), SNAP-Tag, lambdaN22
- the ligand binding moiety is an aptamer that comprises deoxyribonucleotides, ribonucleotides or a combination of both. Therefore, as non- limiting examples, one may use DNA aptamers, RNA aptamers, DNA aptamers with modified nucleosides in the backbones, RNA aptamers with modified nucleosides in the backbones and combinations thereof. [0076] In some embodiments, a naturally occurring MS2 aptamer is used as the ligand binding moiety.
- the 2-amino purine may, for example, be 2-amino purine is 2' deoxy-2-aminopurine or 2' ribose 2-aminopurine.
- the modification at any one position or may be in addition to a modification at another position or to the exclusion of a modification at any or all of the other positions.
- the ligand binding moiety is an aptamer that comprises a 5' modified nucleotide, wherein the 5' modified nucleotide comprises at least one of a 2' modification, a 5' PO4 group, or a modification of the nitrogenous base.
- the ligand binding moiety is an aptamer that is or comprises one part of an aptamer-ligand pair, and as discussed below, and the effector is linked to or comprises the other part of the aptamer-ligand pair.
- the aptamer may comprise a MS2 operator motif that specifically binds to an MS2 coat protein, MCP.
- the aptamer can comprise the MCP moiety (or other ligand) in which case the effector would comprise or be linked to the MS2 operator motif (or other corresponding ligand binding moiety).
- Linkers when present, may be a species that connects the ligand binding moiety to the gRNA. It may be attached to each of the ligand binding moiety and the gRNA at one location or it may be attached to either or both of the gRNA and the ligand binding moiety at a plurality of locations. Attachments at a plurality of locations may allow for greater control in three dimensional space of the ligand binding moiety and in turn the effector to be used.
- a linker may attach to the gRNA at one location and to the ligand binding moiety at two or more locations; or the linker may attach to the ligand binding moiety at one location and to the gRNA at two or more locations.
- the linker may be attached to the gRNA exclusively in the targeting region or exclusively in the Cas association region or in both regions.
- the linker comprises, consists essentially of, or consists of an oligonucleotide sequence and optionally the linker comprises at least one or a plurality of 2’ modifications, e.g., all nucleotides are 2' modified nucleotides within the linker.
- the nucleotide sequence may be random or intentionally designed not to be undesirably complementary to sequence within the aptamer, the gRNA or the target site of the DNA.
- the two linkers flank the ligand binding moiety.
- the linker comprises, consists essentially of, or consists of at least one phosphorothioate linkage.
- the linker comprises, consists essentially of, or consists of a levulinyl moiety. [0085] In some embodiments, the linker comprises, consists essentially of, or consists of an ethylene glycol moiety. [0086] In some embodiments, the linker comprises or is selected from the group consisting of 18S, 9S or C3. [0087] In some embodiments, the linker is a nucleotide sequence that is one to sixty or one to twenty-four or two to twenty or five to fifteen nucleotides long.
- the linker is GC rich, e.g., having at least 50%, at least 60%, at least 70%, at least 80% or at least 90% GC nucleotides.
- a linker comprises nucleotides, it may, for example, be single stranded or double stranded or partially single stranded and partially double stranded.
- the linker may be exclusively RNA, exclusively DNA or a combination thereof.
- the linker is a nucleotide sequence that is upstream or downstream of the ligand binding moiety.
- linker When the linker is upstream of a ligand binding moiety and the gRNA is upstream of the linker, there may be another sequence that is complementary to the linker that is downstream of the ligand binding moiety. Similarly, when the linker is downstream of a ligand binding moiety and the gRNA is downstream of the linker, there may be another sequence that is complementary to the linker that is upstream of the ligand binding moiety. As persons of ordinary skill in the art will recognize, complementarity is determined when the oligonucleotide self-folds and the strands align with each relevant section in a 5' to 3' direction.
- the ligand binding moiety e.g., MS2 has an upstream sequence that is 1 to 12 nucleotides long and a downstream sequence that is 1 to 12 nucleotides long, wherein the upstream and downstream sequences immediately flank the ligand binding moiety (i.e., there are no other nucleotides between the ligand binding moiety and each of the upstream and downstream sequences) and the upstream sequence is complementary to the downstream sequence.
- each of the upstream sequence and the downstream sequence is 1 nucleotide long, 2 nucleotides long, 3 nucleotides long, 4 nucleotides long, 5 nucleotides long, 6 nucleotides long, 7 nucleotides long, 8 nucleotides long, 9 nucleotides long, 10 nucleotides long, 11 nucleotides long, or 12 nucleotides long.
- each of the upstream sequence and the downstream sequence comprises or is GC. When there are both upstream and downstream sequences, they may also be referred to as extension sequences.
- both the upstream and downstream sequence is two nucleotides long or three nucleotides long or four nucleotides long. In some embodiments, one of the upstream and downstream sequence is two nucleotides long and the other of the upstream sequence and the downstream sequence is four nucleotides long. In some embodiments, one or both of the linker sequences is or encodes GC or GCGC. In some embodiments, one of the upstream or downstream linker is GC and the other of the upstream or downstream linker is GCGC.
- At least one of the gRNA or the ligand binding moiety is modified, or if a linker is present, at least one of the gRNA, the ligand binding moiety or the linker is modified.
- the modification refers to the introduction of a moiety or species that does not occur under naturally occurring conditions. Modifications may be used to increase one or both of stability and specificity. In some embodiments, stability is improved with respect to resistance to one or both of the active domain of the Cas protein (e.g., RuvC domain) and the active domain of one or more other enzymes within the system into which a complex of the present invention is introduced, including but not limited to any effector.
- the resistance may, in some embodiments, be caused by steric hindrance.
- the modification(s) is/are located within and/or between one or more if not all of the nucleotides within the targeting region. [0093] Specificity is improved when a modification reduces the likelihood of an off- target effect and/or increases the likelihood that a base editing complex of the present invention will reach its target site.
- Nucleotides may be modified at the ribose, phosphate linkage, and/or base moiety.
- a phosphorothioate backbone may be used, at one, a plurality or all positions within the gRNA, the targeting region or the Cas association region and/or the ligand binding moiety and/or linker if present.
- the modification is the presence of one or more 2' modified nucleotides (e.g., 2'-O-methyl or 2'-fluoro) and/or the presence of a phosphorothioate internucleotide linkage or the introduction of a 5'-PO4 group of the gRNA and/or ligand binding moiety.
- 2' modified nucleotides e.g., 2'-O-methyl or 2'-fluoro
- the modifications may, for example, all be in the targeting region; all be in the Cas association region; all be in the ligand binding moiety; all be in the linker if present; be in both the targeting region and the Cas association region; be in both the Cas association region and the ligand binding moiety; be in both the Cas association region and the linker if present; be in both the targeting region and the ligand binding moiety; be in both the targeting region and the linker if present; be in both the ligand binding moiety and the linker if present; be in all three of the Cas association region, the targeting region and the ligand binding moiety; be in the Cas association region, the targeting region and the linker if present; be in the Cas association region, the ligand binding moiety and the linker if present; be in the targeting region, the ligand binding moiety and the linker if present; or be in each of the Cas association region, the targeting region, the ligand binding
- the set of 2' modifications may be located in the targeting region; the set of 2' modifications may be located in the ligand binding moiety if the ligand binding moiety is or comprises an oligonucleotide sequence; or the set of 2' modifications may be located in the Cas association region.
- the modifications may be on consecutive nucleotides or there may be one or more pairs of unmodified nucleotides between modified nucleotides in regular or irregular patterns.
- any one or more of positions 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or 18 comprises a 2'- O-alkyl group, wherein the positions are measure from the 5' end or the 3' end of the gRNA.
- 2' modified nucleotides there are modified internucleotide linkages such as a phosphorothioate linkage.
- modifications to the backbones of the gRNA, the aptamer (in an oligonucleotide), and the linker (if present and an oligonucleotide), include but are not limited to phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphotriesters, aminoalkylphosphotriesters, methyl and other alkyl phosphonates including 3'-alkylene phosphonates, 5'-alkylene phosphonates and chiral phosphonates, phosphinates, phosphoramidates including 3'-amino phosphoramidate and aminoalkylphosphoramidates, phosphorodiamidates, thionophosphoramidates, thionoalkylphosphonates, thionoalkylphosphotriesters, selenophosphates and boranophosphates having normal 3'-5' linkages, 2'-5' linked analogs of these, and those having inverted polarity wherein one
- Suitable oligonucleotides having inverted polarity comprise a single 3' to 3' linkage at the 3'-most internucleotide linkage i.e., a single inverted nucleoside residue that may be abasic (the nucleobase is missing or has a hydroxyl group in place thereof).
- Various salts such as, for example, potassium or sodium
- mixed salts and free acid forms of the aforementioned internucleotide linkages are also included within the scope of the present invention.
- polynucleotide backbones that do not include a phosphorus atom therein and instead have backbones that are formed by short chain alkyl or cycloalkyl internucleoside linkages, mixed heteroatom and alkyl or cycloalkyl internucleoside linkages, or one or more short chain heteroatomic or heterocyclic internucleoside linkages.
- modifications include those having morpholino linkages (formed in part from the sugar portion of a nucleoside); siloxane backbones; sulfide, sulfoxide and sulfone backbones; formacetyl and thioformacetyl backbones; methylene formacetyl and thioformacetyl backbones; riboacetyl backbones; alkene containing backbones; sulfamate backbones; methyleneimino and methylenehydrazino backbones; sulfonate and sulfonamide backbones; amide backbones; and others having mixed N, O, S and CH 2 component parts.
- one or more of the parts of a complex has one to sixty or one to twenty or one to ten or ten to twenty or twenty to thirty or thirty to forty or forty to fifty or fifty to sixty phosphorothioate linkages.
- These phosphorothioate linkages may: all be in the Cas association region; all be in the ligand binding moiety; all be in the linker; be in both the targeting region and the Cas association region; be in both the Cas association region and the ligand binding moiety; be in both the Cas association region and the linker if present; be in both the targeting region and the ligand binding moiety; be in both the targeting region and the linker if present; be in both the ligand binding moiety and the linker if present; be in all three of the Cas association region, the targeting region and the ligand binding moiety; be in the Cas association region, the targeting region and the linker if present; be in the Cas association region, the ligand binding moiety and the link
- nucleotide within a complex of the present invention may include one or more substituted sugar moieties.
- These nucleotides may comprise a sugar substituent group selected from: OH; H; F; O-, S-, or N-alkyl; O-, S-, or N-alkenyl; O-, S- or N-alkynyl; or O-alkyl-Co-alkyl, wherein the alkyl, alkenyl and alkynyl may be substituted or unsubstituted C1 to C10 alkyl or C2 to C10 alkenyl and alkynyl.
- nucleotides comprise a sugar substituent group selected from: C1 to C10 lower alkyl, substituted lower alkyl, alkenyl, alkynyl, alkaryl, aralkyl, O-alkaryl or O-aralkyl, SH, SCH 3 , OCN, Cl, Br, CN, CF 3 , OCF 3 , SOCH 3 , SO 2 CH 3 , ONO 2 , NO 2 , N 3 , NH 2 , heterocycloalkyl, heterocycloalkaryl, aminoalkylamino, polyalkylamino, substituted silyl, an RNA cleaving group, a reporter group, an intercalator, a group for improving the pharmacokinetic properties of an oligonucleotide, or a group for improving the pharmacodynamic properties of an oligonucleotide, and other substituents having similar properties.
- a sugar substituent group selected from: C1 to C10 lower alkyl, substituted lower al
- a suitable modification includes 2'-methoxyethoxy (2'-O- CH 2 CH 2 OCH 3 , also known as 2'-O-(2-methoxyethyl) or 2'-MOE) (Martin et al., Helv. Chim. Acta, 1995, 78, 486-504) or another alkoxyalkoxy group.
- a further suitable modification includes 2'-dimethylaminooxyethoxy, i.e., a O(CH 2 ) 2 ON(CH 3 ) 2 group, also known as 2'-DMAOE, and 2'-dimethylaminoethoxyethoxy (also known in the art as 2'-O-dimethyl-amino-ethoxy-ethyl or 2'-DMAEOE), i.e., 2'-O-CH 2 -O-CH 2 - N(CH 3 ) 2 .
- Suitable sugar substituent groups include methoxy (-O-CH 3 ), aminopropoxy (-OCH 2 CH 2 CH2NH 2 ), allyl (-CH 2 -CH ⁇ CH 2 ), -O-allyl CH 2 -CH ⁇ CH 2 ) and fluoro (F).
- 2'-sugar substituent groups may be in the arabino (up) position or ribo (down) position.
- a suitable 2'-arabino modification is 2' -F.
- Similar modifications may also be made at other positions on the oligomeric compound, particularly the 3′ position of the sugar on the 3' terminal nucleoside or in 2' -5' linked oligonucleotides and the 5' position of 5' terminal nucleotide.
- nucleobases within a complex of the present invention may also include nucleobase (often referred to in the art simply as “base”) modifications or substitutions.
- Modified nucleobases include, but are not limited to other synthetic and natural nucleobases such as 5-methylcytosine (5-me-C), 5-hydroxymethyl cytosine, xanthine, hypoxanthine, 2-aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2- thiouracil, 2-thiothymine and 2-thiocytosine, 5-halouracil and cytosine, 5-propynyl (- C ⁇ C-CH 3 ) uracil and cytosine and other alkynyl derivatives of pyrimidine bases, 6- azo uracil, cytosine and thymine, 5-uracil (pseudouracil),
- nucleobases include, but are not limited to tricyclic pyrimidines such as phenoxazine cytidine (1H-pyrimido(5,4- b)(1,4)benzoxazin-2(3H)-one), phenothiazine cytidine (1H-pyrimido(5,4- b)(1,4)benzothiazin-2(3H)-one), G-clamps such as a substituted phenoxazine cytidine (e.g.9-(2-aminoethoxy)-H-pyrimido(5,4-(b) (1,4)benzoxazin-2(3H)-one), carbazole cytidine (2H-pyrimido(4,5-b)indol-2-one), pyridoindole cytidine (H- pyrido(3',2′:4,5)pyrrolo(2,3-d)pyrimidin-2-one) and 5-methoxy
- Heterocyclic base moieties may also include, but are not limited to, those in which the purine or pyrimidine base is replaced with other heterocycles, for example, 7-deaza-adenine, 7-deazaguanosine, 2-aminopyridine and 2-pyridone.
- examples of other nucleobases include those disclosed in U.S. Pat. No.3,687,808, those disclosed in The Concise Encyclopedia Of Polymer Science And Engineering, pages 858-859, Kroschwitz, J. I., ed. John Wiley & Sons, 1990, those disclosed by Englisch et al., Angewandte Chemie, International Edition, 1991, 30, 613, and those disclosed by Sanghvi, Y.
- nucleobases are useful for increasing the binding affinity of an oligomeric compound: 5-substituted pyrimidines, 6-azapyrimidines and N-2, N-6 and O-6 substituted purines, including 2-aminopropyladenine, 5-propynyluracil and 5-propynylcytosine. Additionally, 5-methylcytosine substitutions may be advantageous when combined with 2'-O-methoxyethyl sugar modifications.
- ligand binding moieties associated with a gRNA there are two ligand binding moieties associated with a gRNA: a first ligand binding moiety and a second ligand binding moiety.
- the first linker and the second linker may each be attached to the Cas association region; or the first linker and the second linker may each be attached to the targeting region; or one of the first linker and the second linker may be attached to the Cas association region and the other of the first linker and the second linker may be attached to the targeting region.
- Base editing complexes there is a base editing complex.
- the base editing complex comprises, consists essentially of, or consists of a gRNA-ligand binding complex of the present invention; and a Type V Cas protein, wherein the Cas association region of the gRNA-ligand binding complex is associated with the Type V Cas protein.
- the gRNA is capable of associating the gRNA with the Cas protein and delivering the Cas protein to the target nucleic acid without the need of a tracrRNA.
- An example of a base editing complex of the presentation invention is shown in figure 12.
- a gRNA 310 is associated with a Cas protein 340.
- the ligand binding moiety 320 is attached to the 5' end of the gRNA.
- the effector 350 which may, for example, be a deaminase has been recruited by RNA-ligand binding interaction with the ligand 330 at 360.
- Type V Cas protein [00109]
- a Cas protein includes at least one RNA binding domain.
- the RNA binding domain interacts with the gRNA at the Cas association region.
- the Type V Cas protein that is of use in the present invention is one with which the gRNA-ligand binding complex can associate without there being a tracrRNA present.
- the Type V Cas protein is an endonuclese that contains a RuvC domain. This RuvC domain may be mutated such that the endonuclease activity is deactivated.
- the protein is a nickase that contains an active or deactivated RuvC domain.
- Type V Cas proteins that may be of use in connection with the present invention include, but are not limited to, Cas12a, MAD7 (an engineered variant of ErCas12a), Cas12h, Cas12i, and Cas12j (CasPhi, also known as Cas ⁇ ) in active or deactivated form.
- the Type V Cas proteins comprise a fusion protein having: (a) an active, partially deactivated or deactivated Type V Cas protein; and (b) a uracil DNA glycosylase (UNG) inhibitor peptide (UGI).
- UNG uracil DNA glycosylase
- the UGI peptide can be fused directly to the Type V Cas protein or through a linker peptide comprised of 1 to 100 hundred amino acid residues.
- the UGI comprises the wild type UGI sequence from the Bacillus phage PBS2 (https://www.ncbi.nlm.nih.gov/protein/P14739): MTNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENV MLLTSDAPEYKPWALVIQDSNGENKIKML (SEQ ID NO: 140).
- the UGI comprises variants of SEQ ID NO: 140 that comprises a fragment of the wild type UGI peptide or a homologous amino acid sequence to SEQ ID NO: 28.
- the UGI fragment of homologous sequence comprises at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 99%, or at least 99.5% homology to the wild type UGI peptide sequence (SEQ ID NO: 140).
- the active or deactivated Type V Cas protein comprises a fusion with two or more UGI peptides or variants.
- the UGI peptides, or variants of the UGI peptide can be connected directly to another UGI peptide or Type V Cas protein or via a linker of 1 to 100 amino acid residues to another UGI peptide or Type V Cas protein.
- the Cas protein or Cas protein fusion may be provided in purified or isolated form or can be part of a composition or complex.
- the protein is first purified to some extent, more preferably to a high level of purity (e.g., about 80%, 90%, 95%, or 99% or higher).
- compositions in which the complexes and components of the present invention may be stored and transported may be any type of composition desired, e.g., aqueous compositions suitable for use as, or inclusion in, a composition for RNA-guided targeting.
- Effectors [00115]
- the base editing complexes of the present invention may contain an effector that is attached to a ligand.
- the ligand is capable of reversibly or irreversibly associating with the ligand binding moiety.
- the ligand binding moiety recruits an effector, e.g. base editing enzyme that is fused to or otherwise associated with the ligand, because the ligand binding moiety is capable of retaining association with the ligand.
- This design may be particularly advantageous because it provides a modular design in which the nucleic acid sequence targeting function of the gRNA and effector function reside in different molecules. For example, to introduce modifications serially at the same site, one may use different effectors that are associated with the same ligand. Conversely, to introduce the same modifications at different sites, one may use the same ligand binding moiety with different gRNAs while using the same effector-ligand. Thus, this design allows one to multiplex a system without an undesirable burden of fusing effectors to either gRNAs or Cas proteins.
- effectors that may be of use in connection with the present invention are deaminases such as those that have cytidine deamination or adenine deamination activity, as well as transcriptional regulators, repair enzymes, epigenetic modifiers, histone acetylases, deacetylases, methylases (of histones ad nucleotides), and demethylases (of histones and nucleotides).
- deaminases such as those that have cytidine deamination or adenine deamination activity, as well as transcriptional regulators, repair enzymes, epigenetic modifiers, histone acetylases, deacetylases, methylases (of histones ad nucleotides), and demethylases (of histones and nucleotides).
- the effector is selected from the group consisting of AID, CDA, APOBEC1, APOBEC3A, APOBEC3B, APOBEC3C, APOBEC3D, APOBEC3F, ADA, ADAR and tRNA adenosine deaminase.
- AID activation induced cytidine deaminase
- APOBEC1 apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 1.
- APOBEC3A apolipoprotein B mRNA editing enzyme
- APOBEC3B apolipoprotein B mRNA editing enzyme
- APOBEC3C apolipoprotein B mRNA editing enzyme
- APOBEC3D apolipoprotein B mRNA editing enzyme
- APOBEC3F apolipoprotein B mRNA editing enzyme
- APOBEC3G apolipoprotein B mRNA editing enzyme
- APOBEC3H apolipoprotein B mRNA editing enzyme
- catalytic polypeptide-like 3H ADA adenosine deaminase ADAR1: adenosine deaminase acting on RNA 1 ADAR2
- effectors When there are two effectors they may be referred to as: a first effector and a second effector. Each effector may be attached to a different ligand binding moiety through a different ligand. Alternatively, when there are two effectors present, one is attached to a ligand and associated with the gRNA through the ligand binding moiety and another is attached directly to the Cas protein.
- sequences of deaminases that may be incorporated into the present invention include but are not limited to: • hA3A (SEQ ID NO: 149): ATGGAGGCATCTCCAGCATCCGGTCCAAGGCATCTCATGGATCCCC ATATCTTCACCTCCAATTTTAATAACGGAATCGGGCGCCACAAGAC ATACTTGTGCTATGAGGTGGAACGACTGGACAACGGTACCTCCGTG AAAATGGACCAACATCGCGGATTTCTGCATAATCAGGCTAAAAACC TTCTGTGTGGATTTTATGGGAGACACGCTGAGCTGAGATTTCTTGA CCTGGTCCCGAGCTTACAGCTGGACCCAGCCCAAATCTATCGCGTA ACTTGGTTCATCAGCTGGAGCCCCTGCTTTTCCGCCGGGTGCGCTG GAGAAGTGCGGGCGTTCCTGCAGGAAAACACCCACGTCAGACTGA GGATTTTTGCAGCACGCATCTACGACTATGATTATCTTTACAAGGA GGCATTACAGATGTTGCGCGATG
- Ligands As noted above, the effector is bound to a ligand, e.g., by one or more covalent bonds.
- a ligand binding moiety-ligand pairs that may be used in various embodiments of the present invention is provided in Table 2. Both unmodified and chemically modified versions or the ligand binding moieties and ligands are within the scope of the present invention. [00120] Table 2. Some of the sequences for the above binding pairs are listed below. 1. Telomerase Ku binding motif / Ku heterodimer a.
- Telomerase Sm7 binding motif / Sm7 homoheptamer a Sm consensus site (single stranded) 5’-AAUUUUUGGA-3’ (SEQ ID No: 17) b. Monomeric Sm – like protein (archaea) GSVIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAE ELEDGEVTRRLGTVLIRGDNIVYISP(SEQ ID No: 18) 3.
- MS2 phage operator stem loop 5’- ACAUGAGGAUCACCCAUGU -3’ SEQ ID No:19
- PP7 phage operator stem loop / PP7 coat protein a.
- PP7 phage operator stem loop 5’-AUAAGGAGUUUAUAUGGAAACCCUUA -3’ SEQ ID No:21
- the base-editing complexes of the present invention are combined with additional chemistry technologies.
- a base editing complex further comprises a cysteine/selenocysteine tag.
- the base editing complex comprises or is associated with elements for cycloaddition via click chemistry.
- Methods for base-editing [00125] In another embodiment, the present invention provides methods for base editing.
- a base editing complex of the present invention to double-stranded DNA or to a solution that contains dsDNA or to a cell that contains dsDNA or to a subject.
- the method may occur in vitro or be conducted in vivo or ex vivo and may comprise delivering the base editing complex to a subject as part of a medicament for treatment.
- These methods may, for example, be used to modify an immune cell selected from a T cell (including a primary T cell), Natural Killer (NK cell), B cell, or CD34+ hematopoietic stem progenitor cell (HSPC).
- the immune cell may be an engineered immune cell, such as T-cell comprising a CAR or TCR.
- Suitable stem cells include, but are not limited to, mammalian stem cells such as human stem cells, including, but not limited to, hematopoietic, neural, embryonic, induced pluripotent stem cells (iPSC), mesenchymal, mesodermal, liver, pancreatic, muscle, and retinal stem cells.
- stems cells include, but are not limited to, mammalian stem cells such as mouse stem cells, e.g., mouse embryonic stem cells.
- mammalian stem cells such as mouse stem cells, e.g., mouse embryonic stem cells.
- methods for genome engineering e.g., altering or manipulating the expression of one or more genes or one or more gene products
- prokaryotic or eukaryotic cells in vitro, in vivo, or ex vivo.
- the methods provided herein may be useful for targeted base editing disruption in mammalian cells including primary human T cells, natural killer (NK) cells, CD34+ hematopoietic stem and progenitor cells (HSPCs), such as HSPCs isolated from umbilical cord blood or bone marrow and cells differentiated from them, as well as HSPCs isolated from mobilized peripheral blood.
- HSPCs hematopoietic stem and progenitor cells
- Also provided herein are genetically engineered cells arising from haematopoietic stem cells, such as T cells, that have been modified according to the methods described herein.
- the methods are configured to produce genetically engineered T cells arising from HSCs or iPSCs, that are suitable as “universally acceptable” cells for therapeutic application.
- HSCs Haemopoietic stem cells arise from hemangioblasts, which can give rise to HSCs, vascular smooth muscle cells and angioblasts, which differentiate into vascular endothelial cells. HSCs can give rise to common myeloid and common lymphoid progenitors from which arise T cells, Natural Killer (NK) cells, B cells, myeloblasts, erythroblasts and other cells involved in the production of cells of blood, bone marrow, spleen, lymph nodes, and thymus.
- T cells Natural Killer (NK) cells
- B cells Natural Killer
- myeloblasts myeloblasts
- erythroblasts and other cells involved in the production of cells of blood, bone marrow, spleen, lymph nodes, and thymus.
- NK natural killer
- HSPCs CD34+ hematopoietic stem and progenitor cells
- the target sequence can be any disease- associated polynucleotide or gene.
- Examples of useful applications of mutation or correction of an endogenous gene sequence according to the present invention include but are not limited to: alterations of disease-associated gene mutations, alterations in sequences encoding splice sites, alterations in regulatory sequences, alterations in sequences to cause a gain-of-function mutation, and/or alterations in sequences to cause a loss-of-function mutation, and targeted alterations of sequences encoding structural characteristics of a protein.
- Delivery of components into cells may be delivered to target cells and organisms via various methods and various formats (DNA, RNA or protein) or combination of these different formats.
- the base editing components may be delivered as: (a) DNA polynucleotides that encode the relevant sequence for the protein effectors or the guide RNAs; (b) synthetic RNA encoding the sequence for the protein effectors (messenger RNA) or the guide RNAs; (c) purified protein for the effector.
- the Type V Cas protein can be assembled with the guide RNAs to form a ribonucleoprotein complex (RNP) for delivery into target cells and organisms.
- RNP ribonucleoprotein complex
- the components or complexes as assembled may be delivered together or separately by electroporation, by nucleofection, by transfection, via nanoparticles, via viral mediated RNA delivery, via non-viral mediated delivery, via extracellular vesicles (for example, exosome and microvesicles), via eukaryotic cell transfer (for example, by recombinant yeast) and other methods that can package molecules such that they can be delivered to a target viable cell without changes to the genomic landscape.
- electroporation by nucleofection, by transfection, via nanoparticles, via viral mediated RNA delivery, via non-viral mediated delivery, via extracellular vesicles (for example, exosome and microvesicles), via eukaryotic cell transfer (for example, by recombinant yeast) and other methods that can package molecules such that they can be delivered to a target viable cell without changes to the genomic landscape.
- Other methods include, but are not limited to, non-integrative transient transfer of DNA polynucleotides that include the relevant sequence for the protein recruitment so that the molecule can be transcribed into the desired RNA molecule and for amino acid containing components translated into a protein or protein fragment.
- DNA-only vehicles for example, plasmids, MiniCircles, MiniVectors, MiniStrings, Protelomerase generated DNA molecules (for example Doggybones), artificial chromosome (for example HAC), and cosmids
- DNA vehicles by nanoparticles, extracellular vesicles (for example, exosome and microvesicles), via eukaryotic cell transfer (for example, by recombinant yeast), transient viral transfer by AAV, non-integrating viral particles (for example, lentivirus and retrovirus based systems), cell penetrating peptides and other technology that can mediate the introduction of DNA into a cell without direct integration into the genomic landscape.
- RNA components include the use of integrative gene transfer technology for stable introduction of the machinery for RNA transcription into the genome of the target cells, this can be controls via constitutive or promoter inducible systems to attenuate the RNA expression and this can also be designed so that the system can be removed after the utility has been met (for example, introducing a Cre-Lox recombination system), such technology for stable gene transfer includes, but is not limited to, integrating viral particles (for example, lentivirus, adenovirus and retrovirus based systems), transposase mediate transfer (for example Sleeping Beauty and Piggybac), exploitation of the non-homologous repair pathways introduced by DNA breaks (for example, utilizing CRISPR and TALEN) technology and a surrogate DNA molecule, and other technology that encourages integration of the target DNA into a cell of interest.
- integrative gene transfer technology for stable introduction of the machinery for RNA transcription into the genome of the target cells, this can be controls via constitutive or promoter inducible systems to attenuate
- the various components of the complexes of the present invention may be created chemically or, if naturally occurring, isolated and purified from naturally occurring sources. Methods for chemically and enzymatically synthesizing the various embodiments of the present invention are well known to persons of ordinary skill in the art. Similarly, methods for ligating or introducing covalent bonds between components of the present invention are also well known to persons of ordinary skill in the art. [00136] Applications [00137] By way of a non-limiting example, the complexes of the present invention may be used to recruit transcriptional activators such as p65 and V64, as well as moieties that introduce epigenetic modifications or affect HDR.
- the complexes of the present invention can also be used for the following applications; base editing, genome editing, genome screening, generation of therapeutic cells, genome tagging, epigenome editing, karyotype engineering, chromatin imaging, transcriptome and metabolic pathway engineering, genetic circuits engineering, cell signaling sensing, cellular events recording, lineage information reconstruction, gene drive, DNA genotyping, miRNA quantification, in vivo cloning, site-directed mutagenesis, genomic diversification, and proteomic analysis in situ.
- a cell or a population of cells are exposed to a base editing complex of the present invention and the cell or cells are introduced to a subject by infusion.
- [00138] Applications also include research of human diseases such as cancer immunotherapy, antiviral therapy, bacteriophage therapy, cancer diagnosis, pathogen screening, microbiota remodeling, stem-cell reprogramming, immunogenomic engineering, vaccine development, and antibody production.
- Examples [00140] Example 1: Transfection of plasmid components for dCasPhi base editing: [00141] Vector construction: [00142] The coding sequence for a deactivated version of CasPhi and 2xUGI fusion (dCasPhi-2xUGI) was obtained and cloned into an expression vector under the control of the mouse CMV promoter in a T2A polycistronic cassette with a red fluorescent protein-puromycin fusion.
- the coding sequence for MS2 coat protein lizard Anolis Apobec fusion (“AnoA1) (“AnoA1”) is: ATGGCCCCCAAGAAGAAGCGGAAAGTGATGGAGCCGGAGGCTTTT CAGCGCAACTTTGACCCTCGGGAATTTGCCGCCTGTACACTCCTCT TGTATGAGATCCACTGGGACAATAACACATCTAGAAATTGGTGTAC GAATAAGCCTGGGCTCCACGCTGAGGAGAATTTCTTGCAGATATTT AATGAGAAAATTGACATTAAACAGGATACGCCGTGCTCTATAACA TGGTTCCTTTCTTGGAGCCCCTGTTACCCTTGTAGCCAAGCAATAAT AAAATTCTTGGAGGCACACCCGAATGTCAGTCTGGAGATTAAGGCT GCGCGGCTGTATATGCATCAAATAGACTGTAACAAGGAGGGACTC AGAAATCTGGGCCGGAATCGAGTGTCAATAATGAACCTGATT ATAGGCATTGCTGGACTACGTTTGTTGTGTGTGAA
- HEK 293T cells ATCC, #CRL-11268 were seeded at 20,000 cells per well in a 96-well plate one day prior to transfection. Cells were co-transfected using DharmaFECT Duo Transfection Reagent (Horizon Discovery, #T-2010) and 200ng dCasPhi-2xUGI plasmid, 100ng AnoA1 plasmid, and 100ng crRNA plasmid.
- the plasmid crRNA consisted of a direct repeat length of e.g., 35 nucleotides and different spacer sequences of 18 or 20 nucleotides targeting transcripts within Site2 or B2M gene targets. Additionally, they have the MS2 ligand binding moiety at the 5’ terminus, the 3’ terminus, internally not at either the 5’ or 3’ terminus, or combinations therein. See SEQ ID NO: 35 to 58 in Table 3 below.
- Cell processing [00145] Cells were lysed in 100 ⁇ L of a buffer containing proteinase K (Thermo Scientific, #FEREO0492), RNase A (Thermo Scientific, #FEREN0531), and Phusion HF buffer (Thermo Scientific, #F-518L) for 30 min at 56 °C, followed by a 5 min heat inactivation at 95 °C. This cell lysate was used to generate PCR amplicons spanning the region containing the base editing site(s). PCR amplicons between 400-1000 bp in length were sequenced by Sanger sequencing. [00146] Editing analysis [00147] Base editing efficiencies were calculated using the Chimera analysis tool, an adaptation of the open source tool BEAT.
- Chimera determines editing efficiency by first subtracting the background noise to define the expected variability in a sample. This allows the estimation of editing efficiency without the need to normalize to control samples. Following this, Chimera filters out any outliers from the noise using the Median Absolute Deviation (MAD) method and then assesses the editing efficiency of the base editor over the span of the 18-20bp input guide sequence.
- MAD Median Absolute Deviation
- Figures 1A to 1G provide guide RNA folds predictions using Geneious software of a CasPhi guide RNA, with the following parameters: • without MS2 aptamer, SEQ ID NO: 59, figure 1A; • with MS2 aptamer 5’ of the pre-cr, SEQ ID NO: 60, figure 1B; • with MS2 aptamer embedded in the pre-cr, SEQ ID NO: 61, figure 1C; • with MS2 aptamer in the loop, SEQ ID NO: 62, figure 1D; • with MS2 aptamer at the 3’ end of the guide, SEQ ID NO: 63, figure 1E; • without MS2 sequence and without pre-cr, SEQ ID NO: 64, figure 1F; and • with MS2 sequence 5’ of the crRNA, SEQ ID NO: 65, figure 1G.
- spacer sequences are shown bound to an oligonucleotide that does not make up the gRNA: TAAAGGAAACTGGAACAC (SEQ ID NO: 66).
- the inventors used sequences from Table 3 to evaluate the effects of MS2 placement on base editing levels at two genomic target sites shown. Editing results are shown for eleven target C residues, which are identified in figure 2A and figure 2B by the location of the C residue.
- guide RNAs targeting (A) Site2 gRNA4, SEQ ID NO:s 35, 37, 39, 45, 47, and 49 (see figure 2A); and (B) Site2 gRNA5, SEQ ID NO:s 36, 38, 40, 46, 48, and 50 (see figure 2B) with different placement of MS2 aptamers were compared for C>T base editing efficiency.
- the aforementioned guide RNA plasmids, dCasPhi plasmid and deaminase plasmid (liz AnoA1) were co- transfected in HEK293T cells. Cells were analyzed for base editing using Chimera software.
- a gRNA may encode SEQ ID NO 137 and/or SEQ ID NO 138 (see figure 4E and figure 4F).
- Example 2 Transfection of plasmid components for CasPhi (Cas12j) DNA cutting
- Vector construction [00156] The coding sequence for CasPhi was obtained and cloned into an expression vector under the control of the mouse CMV promoter in a T2A polycistronic cassette with a red fluorescent protein-puromycin fusion. The sequence for crRNA and unique spacer regions were cloned into an expression vector under control of the hU6 promoter.
- HEK 293T cells ATCC, #CRL-11268) were seeded at 20,000 cells per well in a 96-well plate one day prior to transfection.
- Cells were co-transfected using DharmaFECT Duo Transfection Reagent (Horizon Discovery, #T-2010) and 200ng CasPhi plasmid, and 100ng crRNA plasmid.
- the plasmid crRNA consisted of a direct repeat length of 35 nucleotides.
- Cell processing [00159] Cells were lysed in 100 ⁇ L of a buffer containing proteinase K (Thermo Scientific, #FEREO0492), RNase A (Thermo Scientific, #FEREN0531), and Phusion HF buffer (Thermo Scientific, #F-518L) for 30 min at 56 °C, followed by a 5 min heat inactivation at 95 °C.
- This cell lysate may be used to generate PCR amplicons spanning the region containing the base editing site(s).
- PCR amplicons between 400- 1000 bp in length may be digested with T7 endonuclease I (T7EI) enzyme (NEB, M0302S) in the presence of NEB buffer 2 (NEB, B7002S) for 25 minutes.
- T7EI T7 endonuclease I
- NEB buffer 2 NEB buffer 2
- the digested PCR product may be run on 2% agarose gel for 90 minutes at 80 volts, imaged, and analyzed using Horizon Discovery’s online T7EI calculator (https://horizondiscovery.com/en/ordering-and-calculation-tools/t7ei-calculator).
- SEQ ID NO: 36, 38, 40, 42, 44, and 46 from table 3 were used in this example.
- the percentages of editing from C to T are shown in figure 2C and figure 2D. These figures demonstrate that inclusion of MS2 at the 5' pre-cr, embedded 5' pre-cr and 3' positions of Site2 gRNA5 does not affect the ability of the CasPhi to cause indel formation.
- Example 3 Base editing with guides for multiple sets of deactivated CasPhi mutants
- Different deactivating mutations of CasPhi were compared for base editing efficiency – D369A, E566A, and D369A/E566A/D658A.
- HEK293T cells were transfected with dCasPhi-2xUGI plasmid + AnoA1 plasmid + the indicated plasmid gRNAs, 35, 37, 39, and 45 for Site2 gRNA4 ( Figure 3A), and 36, 38, 40, and 46 for Site2 gRNA5 ( Figure 3B)
- the cells were harvested, and base editing levels were analyzed using Chimera software.
- the data which are summarized in figure 3A and figure 3B, show % C>T conversion at the indicated cytosine positions along the spacers.
- Example 4 Base editing with different spacer lengths
- HEK293T cells were electroporated with dCasPhi- 2xUGI mRNA + AnoA1 mRNA + the indicated extended length spacer synthetic gRNAs for Site2 gRNA5. SEQ ID NO: 101 and 102 (see Table 5).
- HEK 293T cells were transfected with dCasPhi-2xUGI plasmid + AnoA1 plasmid + the indicated gRNA plasmids for Site2 gRNA5.
- SEQ ID NO: 36, 38, 54, and 57 see Table 3
- the cells were harvested, and base editing levels were analyzed using Chimera software.
- gRNAs used in this example may more generally be represented by the schematics of figures 4C to 4F: • Figure 4C is a schematic of synthetic gRNA with 18nt spacer with a spacer represented by Ns. (SEQ ID NO 135) • Figure 4D is a schematic of synthetic gRNA with a 20nt spacer represented by Ns. (SEQ ID NO 136) • Figure 4E is a schematic of plasmid gRNA with 18nt spacer.
- RNA synthesis [00174] All crRNA were synthesized by Horizon Discovery using either 2'- acetoxy ethyl orthoester (2’-ACE) or 2’-tert-butyldimethylsilyl (2’-TBDMS) protection chemistries or by Agilent. Chemical modifications were included where noted. RNA oligos were 2’-depotected/desalted and purified by either high- performance liquid chromatography (HPLC) or polyacrylamide gel electrophoresis (PAGE). Oligos were resuspended in 10mM Tris pH7.5 buffer prior to electroporation.
- HPLC high- performance liquid chromatography
- PAGE polyacrylamide gel electrophoresis
- HEK 293T cells (ATCC, #CRL-11268) were electroporated using the InvitrogenTM NeonTM Transfection System, 10 ⁇ l Kit. A mixture of 50,000 cells, 650 ng of dCasPhi-2xUGI mRNA and 200 ng AnoA1 mRNA, and 6 ⁇ M of synthetic crRNA may be electroporated at 1150V for 20 ms and for 2 pulses.
- the chemically synthesized crRNA consisted of different direct repeat lengths of 21 or 35 nucleotides, different spacer sequences targeting transcripts within Site2 or B2M gene targets, and the MS2 ligand binding moiety at the 5’ terminus, the 3’ terminus, internally not at either the 5’ or 3’ terminus, or combinations therein. Each sequence optionally contained chemical modifications at one or more bases and within one or more linkages.
- Cells were plated in a 96-well plate with full serum media and harvested after 48-72 hours for further processing [00176]
- Cell processing [00177] Cells were lysed in 100 ⁇ L of a buffer containing proteinase K (Thermo Scientific, #FEREO0492), RNase A (Thermo Scientific, #FEREN0531), and Phusion HF buffer (Thermo Scientific, #F-518L) for 30 min at 56 °C, followed by a 5 min heat inactivation at 95 °C. This cell lysate was used to generate PCR amplicons spanning the region containing the base editing site(s). PCR amplicons between 400-1000 bp in length may be sequenced by Sanger sequencing.
- PCR amplicons may be purified (Qiagen, #28181) and submitted for NGS sequencing.
- Editing analysis [00179] Base editing efficiencies were calculated using the Chimera analysis tool, an adaptation of the open source tool BEAT. Chimera determines editing efficiency by first subtracting the background noise to define the expected variability in a sample. This allows the estimation of editing efficiency without the need to normalize to control samples. Following this, Chimera filters out any outliers from the noise using the Median Absolute Deviation (MAD) method and then assesses the editing efficiency of the base editor over the span of the 18-20bp input guide sequence.
- MAD Median Absolute Deviation
- High throughput sequencing data analysis specifically frequency of single nucleotide polymorphisms (SNPs) and insertions/deletions (indels), was performed as follows: barcoded samples were demultiplexed and the demultiplexed, paired-end reads were merged using a custom Python script, which filters out any reads with mismatches in the overlapping region and keeps the higher Phred score for each overlapping base. The non-overlapping portions of the reads were then trimmed off and merged reads containing any base with a Phred score ⁇ 30 were filtered out. The resulting reads were aligned using Bowtie2 and a mpileup file was generated using SAMtools.
- SNPs single nucleotide polymorphisms
- indels insertions/deletions
- Example 6 dCasPhi base editing at multiple sites in HEK293T cells with chemically synthesized and chemically modified guides
- HEK293T cells were electroporated with dCasPhi-2xUGI mRNA + AnoA1 mRNA + the indicated synthetic gRNAs for (figure 5A) B2M_gRNA4, (figure 5B) B2M_gRNA6 and (figure 5C) Site2_gRNA5.
- Example 7 dCasPhi base editing at HEK Site2 sites in HEK293T cells with chemically synthesized and modified synthetic guides
- HEK293T cells were electroporated with dCasPhi-2xUGI mRNA + AnoA1 mRNA + the indicated synthetic gRNAs.
- SEQ ID NO: 75 The dCasPhi mRNAs with different codon optimizations are noted in table 6 below.
- the cells were harvested, and base editing levels were analyzed using Chimera software.
- the data, which is summarized in figure 6, show % C>T conversion at the indicated cytosine positions along the spacers.
- Example 8 The effects of synthetic guide chemical modifications on base editing levels.
- Guide RNAs for Site2 gRNA5, SEQ ID NOs: 107, 108, 109, 110, 111, and 112 (table 5), and B2M gRNA6 SEQ ID NO: 113, 114, 115, 86, 116, 117 and 118 (table 5), were synthesized with different combinations of chemical modifications on 5’ and 3’ ends (see table of sequences for details).
- HEK293T cells were electroporated with dCasPhi-2xUGI mRNA + AnoA1 mRNA + synthetic gRNAs.
- RNAs were designed with (UC) linkers on the 5’end, and/or between the MS2 and the spacer, and/or on the 3’end of the guide. SEQ ID NO: 73, 75, 79, 92, 93, 94, 95, 96, 97, and 98 (table 5). RNAs were synthesized by the same method with the same chemical modifications. HEK293T cells were electroporated with dCasPhi-2xUGI mRNA + AnoA1 deaminase mRNA + synthetic gRNA. Base editing levels were measured by Chimera or NGS and compared to the gRNA without linkers.
- FIG. 8A shows a template gRNA with chemical modifications in the absence of a ligand binding moiety.
- Figures 8C to 8K show templates with different modification patterns and one or two linkers.
- Example 10 CasPhi Aptamer-Recruitment Base Editing in T Lymphocytes
- PBMCs were isolated from blood sources (e.g., CPD Blood bags, apheresis cones, leukopaks, etc.) by layering on Lymphoprep using SepMap columns (STEMCELL Technologies). Then total CD3+ T cells were isolated using negative selection with the EasySep Human T Cell Isolation Kit (STEMCELL Technologies).
- T Cells were checked by flow cytometry and then cultured in Immunocult XT media (STEMCELL Technologies) with 1x Penicillin/Streptomycin (Thermofisher) at 37C and 5% CO2.
- T Cell Electroporation After 48-72 post-activation T cells were electroporated with using the Neon Electroporator (Thermofisher). Neon Electroporator conditions were 1600v/10ms/3 pulses with a 10ul tip with 250k cells, combined total mRNA concentration of 100ng/ul, for both the Deaminase-MCP and nCasPhi-UGI-UGI (synthesized by Trilink), and the crRNA was a final concentration of 2uM.
- T cells were activated by using 1:1 bead:cell ratio of Dynabeads Human T Activator CD3/CD28 beads (Thermofisher) cultured in Immunocult XT media (STEMCELL Technologies) in the presence of 100U/ml IL-2 (STEMCELL Technologies) and 1x Penicillin/Streptomycin (Thermofisher) at 37C and 5% CO2 for 48-72 hours.
- T lymphocytes were stimulated and then electroporated in the presence of a different aptamer designs with the same deaminase.
- the data summarized in figure 9, shows that tracrless Type V family can be utilized with specific aptamer- based recruitment base editing in T lymphocytes.
- Example 11 Electroporation of mRNA and synthetic guides for dCas12a-UGI base editing
- mRNA preparation [00204] Messenger mRNA are prepared from DNA vectors carrying the T7 promoter and the coding sequences for dCas12a-UGI and AnoA1 following the standard protocols for mRNA in vitro transcription.
- RNA synthesis [00206] All crRNA were synthesized by Horizon Discovery using either 2'- acetoxy ethyl orthoester (2’-ACE) or 2’-tert-butyldimethylsilyl (2’-TBDMS) protection chemistries or by Agilent. Chemical modifications were included where noted. RNA oligos were 2’-depotected/desalted and purified by either high- performance liquid chromatography (HPLC) or polyacrylamide gel electrophoresis (PAGE). Oligos were resuspended in 10mM Tris pH7.5 buffer prior to electroporation.
- HPLC high- performance liquid chromatography
- PAGE polyacrylamide gel electrophoresis
- HEK 293T cells (ATCC, #CRL-11268) were electroporated using the InvitrogenTM NeonTM Transfection System, 10 ⁇ L Kit. A mixture of 50,000 cells, 1 ⁇ g of mRNA, and 6 ⁇ M of synthetic crRNA were electroporated at 1150V for 20 ms and for 2 pulses. mRNA was mixed at a 3:1 molar ratio of dCas12a-2xUGI to AnoAl. Cells were plated in a 96-well plate with full serum growth media and harvested after 72 hours for further processing.
- Cell processing may be lysed in 100 ⁇ L of a buffer containing proteinase K (Thermo Scientific, #FEREO0492), RNase A (Thermo Scientific, #FEREN0531), and Phusion HF buffer (Thermo Scientific, #F-518L) for 30 min at 56 °C, followed by a 5 min heat inactivation at 95 °C.
- This cell lysate may be used to generate PCR amplicons spanning the region containing the base editing site(s). PCR amplicons between 400-1000 bp in length may be sequenced by Sanger sequencing.
- Base editing efficiencies may be calculated using the Chimera analysis tool, an adaptation of the open source tool BEAT.
- Chimera determines editing efficiency by first subtracting the background noise to define the expected variability in a sample. This allows the estimation of editing efficiency without the need to normalize to control samples. Following this, Chimera filters out any outliers from the noise using the Median Absolute Deviation (MAD) method and then assesses the editing efficiency of the base editor over the span of the 23nt input guide sequence.
- Table 7 provides chemically synthesized gRNA for use with Cas 12a and the gRNA used in this example Chemically modified synthetic guides SEQ ID NO: 142 -144 demonstrated desirable levels of base editing. Spacer region sequences are in bold.
- Example 12 dCas12a base editing at HEK Site2 with chemically modified guides
- HEK293T cells were electroporated with dCas12a-2xUGI mRNA + AnoA1 mRNA + the indicated synthetic gRNAs. The cells were harvested, and base editing levels were analyzed by NGS. The data, summarized in figure 10, show % C>T conversion at the indicated cytosine positions along the spacers. This data demonstrates that Cas12a and corresponding guides are effective at base editing.
- Example 13 Transfection of plasmid components for dCas12i2 base editing
- the coding sequence for a deactivated version of Cas12i2 and 2xUGI fusion (dCas12i2-UGI) was obtained and cloned into an expression vector under the control of the mouse CMV promoter in a T2A polycistronic cassette with a red fluorescent protein-puromycin fusion.
- the coding sequence for MS2 coat protein lizard Anolis Apobec fusion (AnoA1) was obtained and cloned into an expression vector under control of the mouse CMV promoter.
- HEK 293T cells ATCC, #CRL-11268, were seeded at 20,000 cells per well in a 96-well plate one day prior to transfection.
- plasmid crRNA consisted of a direct repeat length of 31 nucleotides, different spacer sequences of 31 nucleotides targeting transcripts within Site2 or B2M gene targets, and have the MS2 ligand binding moiety at the 5’ terminus, the 3’ terminus, internally not at either the 5’ or 3’ terminus, or combinations therein. Sequences are provided in Table 8 below.
- Cells were grown for 72 hours post-transfection and harvested for further processing.
- Cell processing [00221] Cells were lysed in 100 ⁇ L of a buffer containing proteinase K (Thermo Scientific, #FEREO0492), RNase A (Thermo Scientific, #FEREN0531), and Phusion HF buffer (Thermo Scientific, #F-518L) for 30 min at 56 °C, followed by a 5 min heat inactivation at 95 °C. This cell lysate was used to generate PCR amplicons spanning the region containing the base editing site(s). PCR amplicons between 400-1000 bp in length were sequenced by Sanger sequencing.
- Example 14 Transfection of plasmid components for dCas12i2 base editing at HEK Site2 with multiple deaminases
- SEQ ID NO: 128, 129, and 130 from table 8 were used in this example
- HEK293T cells were transfected with plasmids for: dCas12i2-2xUGI + AnoA1 or hA3A + the indicated gRNAs. The cells were harvested and base editing levels analyzed by Chimera. The data, summarized in figure 11, show % C>T conversion at the indicated cytosine positions along the spacers.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Medicinal Chemistry (AREA)
- Urology & Nephrology (AREA)
- Cell Biology (AREA)
- Mycology (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Saccharide Compounds (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202280019316.8A CN117222743A (zh) | 2021-01-05 | 2022-01-05 | 向导RNA设计和用于无Tracr V型Cas系统的复合物 |
| EP22737034.3A EP4274902A4 (en) | 2021-01-05 | 2022-01-05 | Guide RNA designs and complexes for tracless V-CAS systems |
| US18/270,740 US20240067983A1 (en) | 2021-01-05 | 2022-01-05 | Guide RNA Designs and Complexes for Tracr-less Type V Cas Systems |
| JP2023541024A JP2024502348A (ja) | 2021-01-05 | 2022-01-05 | Tracr不含 V型Casシステム用のガイドRNAデザインおよび複合体 |
| CA3207138A CA3207138A1 (en) | 2021-01-05 | 2022-01-05 | Guide rna designs and complexes for tracr-less type v cas systems |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163133942P | 2021-01-05 | 2021-01-05 | |
| US63/133,942 | 2021-01-05 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022150367A1 true WO2022150367A1 (en) | 2022-07-14 |
Family
ID=82358156
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/011289 Ceased WO2022150367A1 (en) | 2021-01-05 | 2022-01-05 | Guide rna designs and complexes for tracr-less type v cas systems |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US20240067983A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4274902A4 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2024502348A (cg-RX-API-DMAC7.html) |
| CN (1) | CN117222743A (cg-RX-API-DMAC7.html) |
| CA (1) | CA3207138A1 (cg-RX-API-DMAC7.html) |
| WO (1) | WO2022150367A1 (cg-RX-API-DMAC7.html) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025212120A1 (en) * | 2024-04-05 | 2025-10-09 | Arbor Biotechnologies, Inc. | Chemical modifications of guide rnas for crispr nucleases |
| US12454694B2 (en) | 2018-09-07 | 2025-10-28 | Beam Therapeutics Inc. | Compositions and methods for improving base editing |
| US12529041B2 (en) | 2018-09-07 | 2026-01-20 | Beam Therapeutics Inc. | Compositions and methods for delivering a nucleobase editing system |
| US12576151B2 (en) | 2020-09-25 | 2026-03-17 | Beam Therapeutics Inc. | Fratricide resistant modified immune cells and methods of using the same |
| US12594301B2 (en) | 2019-09-27 | 2026-04-07 | Beam Therapeutics Inc. | Compositions and methods for treatment of liquid cancers |
| US12600971B2 (en) | 2019-02-13 | 2026-04-14 | Beam Therapeutics Inc. | Modified immune cells having adenosine deaminase base editors for modifying a nucleobase in a target sequence |
| US12612618B2 (en) | 2019-01-31 | 2026-04-28 | Beam Therapeutics Inc. | Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20180327784A1 (en) * | 2015-07-15 | 2018-11-15 | Rutgers, The State University Of New Jersey | Nuclease-Independent Targeted Gene Editing Platform and Uses Thereof |
| WO2020181101A1 (en) * | 2019-03-07 | 2020-09-10 | The Regents Of The University Of California | Crispr-cas effector polypeptides and methods of use thereof |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4485466A3 (en) * | 2016-08-17 | 2025-04-02 | The Broad Institute Inc. | Novel crispr enzymes and systems |
| AU2019265019B2 (en) * | 2018-05-11 | 2025-11-06 | Beam Therapeutics Inc. | Methods of substituting pathogenic amino acids using programmable base editor systems |
| US12286633B2 (en) * | 2019-12-17 | 2025-04-29 | University Of Maryland, College Park | Compositions and methods for genome editing in plants |
-
2022
- 2022-01-05 JP JP2023541024A patent/JP2024502348A/ja active Pending
- 2022-01-05 CN CN202280019316.8A patent/CN117222743A/zh active Pending
- 2022-01-05 WO PCT/US2022/011289 patent/WO2022150367A1/en not_active Ceased
- 2022-01-05 EP EP22737034.3A patent/EP4274902A4/en active Pending
- 2022-01-05 CA CA3207138A patent/CA3207138A1/en active Pending
- 2022-01-05 US US18/270,740 patent/US20240067983A1/en active Pending
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20180327784A1 (en) * | 2015-07-15 | 2018-11-15 | Rutgers, The State University Of New Jersey | Nuclease-Independent Targeted Gene Editing Platform and Uses Thereof |
| WO2020181101A1 (en) * | 2019-03-07 | 2020-09-10 | The Regents Of The University Of California | Crispr-cas effector polypeptides and methods of use thereof |
Non-Patent Citations (2)
| Title |
|---|
| PAUSCH PATRICK, AL-SHAYEB BASEM, BISOM-RAPP EZRA, TSUCHIDA CONNOR A., LI ZHENG, CRESS BRADY F., KNOTT GAVIN J., JACOBSEN STEVEN E.: "CRISPR-CasΦ from huge phages is a hypercompact genome editor", SCIENCE, AMERICAN ASSOCIATION FOR THE ADVANCEMENT OF SCIENCE, US, vol. 369, no. 6501, 17 July 2020 (2020-07-17), US , pages 333 - 337, XP055862891, ISSN: 0036-8075, DOI: 10.1126/science.abb1400 * |
| See also references of EP4274902A4 * |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12454694B2 (en) | 2018-09-07 | 2025-10-28 | Beam Therapeutics Inc. | Compositions and methods for improving base editing |
| US12529041B2 (en) | 2018-09-07 | 2026-01-20 | Beam Therapeutics Inc. | Compositions and methods for delivering a nucleobase editing system |
| US12612618B2 (en) | 2019-01-31 | 2026-04-28 | Beam Therapeutics Inc. | Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors |
| US12600971B2 (en) | 2019-02-13 | 2026-04-14 | Beam Therapeutics Inc. | Modified immune cells having adenosine deaminase base editors for modifying a nucleobase in a target sequence |
| US12594301B2 (en) | 2019-09-27 | 2026-04-07 | Beam Therapeutics Inc. | Compositions and methods for treatment of liquid cancers |
| US12576151B2 (en) | 2020-09-25 | 2026-03-17 | Beam Therapeutics Inc. | Fratricide resistant modified immune cells and methods of using the same |
| WO2025212120A1 (en) * | 2024-04-05 | 2025-10-09 | Arbor Biotechnologies, Inc. | Chemical modifications of guide rnas for crispr nucleases |
Also Published As
| Publication number | Publication date |
|---|---|
| US20240067983A1 (en) | 2024-02-29 |
| CN117222743A (zh) | 2023-12-12 |
| EP4274902A1 (en) | 2023-11-15 |
| EP4274902A4 (en) | 2025-04-16 |
| JP2024502348A (ja) | 2024-01-18 |
| CA3207138A1 (en) | 2022-07-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240060088A1 (en) | Guide RNA Designs and Complexes for Type V Cas Systems | |
| US20240067983A1 (en) | Guide RNA Designs and Complexes for Tracr-less Type V Cas Systems | |
| CN115651927B (zh) | 编辑rna的方法和组合物 | |
| JP7844400B2 (ja) | 異常ヘモグロビン症の治療用組成物および方法 | |
| JP7101419B2 (ja) | 内因性t細胞受容体の標的置換 | |
| KR102351329B1 (ko) | 혈색소병증의 치료를 위한 물질 및 방법 | |
| CN113939591A (zh) | 编辑rna的方法和组合物 | |
| US20100240732A1 (en) | Aptamer-targeted sirna to prevent attenuation or suppression of a t cell function | |
| WO2017191503A1 (en) | Materials and methods for treatment of hemoglobinopathies | |
| EP3129484A1 (en) | Crispr/cas-related methods and compositions for treating hiv infection and aids | |
| Park et al. | Enhancing genome editing in hPSCs through dual inhibition of DNA damage response and repair pathways | |
| US11566236B2 (en) | Materials and methods for treatment of hemoglobinopathies | |
| CN116507629B (zh) | Rna支架 | |
| US20240309347A1 (en) | Fusion Proteins for CRISPR-based Transcriptional Repression | |
| HK40081918B (en) | Methods and compositions for editing rna | |
| Jung et al. | Establishment and rescue of fibroblast cell lines carrying a nonsense mutation of RB1 by CRISPR-based base editing | |
| HK40081918A (en) | Methods and compositions for editing rna | |
| WO2026019837A1 (en) | Compositions and methods for overcoming t-cell exhaustion | |
| TW202334421A (zh) | 包含靶向ciita之rna引導之組合物及其用途 | |
| HK40061041A (en) | Methods and compositions for editing rnas | |
| HK40056042A (en) | Methods and compositions for editing rnas | |
| HK40056042B (en) | Methods and compositions for editing rnas |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22737034 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3207138 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 18270740 Country of ref document: US |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023541024 Country of ref document: JP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022737034 Country of ref document: EP Effective date: 20230807 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280019316.8 Country of ref document: CN |