WO2022147207A1 - Muscle targeting complexes and uses thereof for treating facioscapulohumeral muscular dystrophy - Google Patents
Muscle targeting complexes and uses thereof for treating facioscapulohumeral muscular dystrophy Download PDFInfo
- Publication number
- WO2022147207A1 WO2022147207A1 PCT/US2021/065624 US2021065624W WO2022147207A1 WO 2022147207 A1 WO2022147207 A1 WO 2022147207A1 US 2021065624 W US2021065624 W US 2021065624W WO 2022147207 A1 WO2022147207 A1 WO 2022147207A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antisense strand
- sense strand
- amino acid
- antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6889—Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/712—Nucleic acids or oligonucleotides having modified sugars, i.e. other than ribose or 2'-deoxyribose
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/7125—Nucleic acids or oligonucleotides having modified internucleoside linkage, i.e. other than 3'-5' phosphodiesters
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6807—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug or compound being a sugar, nucleoside, nucleotide, nucleic acid, e.g. RNA antisense
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2881—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD71
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
- C12N15/1137—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against enzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y204/00—Glycosyltransferases (2.4)
- C12Y204/02—Pentosyltransferases (2.4.2)
- C12Y204/02008—Hypoxanthine phosphoribosyltransferase (2.4.2.8)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/14—Type of nucleic acid interfering nucleic acids [NA]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/31—Chemical structure of the backbone
- C12N2310/315—Phosphorothioates
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/31—Chemical structure of the backbone
- C12N2310/317—Chemical structure of the backbone with an inverted bond, e.g. a cap structure
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/32—Chemical structure of the sugar
- C12N2310/321—2'-O-R Modification
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/32—Chemical structure of the sugar
- C12N2310/322—2'-R Modification
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/35—Nature of the modification
- C12N2310/351—Conjugate
- C12N2310/3513—Protein; Peptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/35—Nature of the modification
- C12N2310/352—Nature of the modification linked to the nucleic acid via a carbon atom
- C12N2310/3521—Methyl
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/35—Nature of the modification
- C12N2310/353—Nature of the modification linked to the nucleic acid via an atom other than carbon
- C12N2310/3533—Halogen
Definitions
- the present application relates to oligonucleotides designed to target DUX4 RNAs and targeting complexes for delivering molecular payloads (e.g., oligonucleotides) to cells and uses thereof, particularly uses relating to treatment of disease.
- molecular payloads e.g., oligonucleotides
- Facioscapulohumeral muscular dystrophy is a dominantly inherited type of MD which primarily affects muscles of the face, shoulder blades, and upper arms. Other symptoms of FSHD include abdominal muscle weakness, retinal abnormalities, hearing loss, and joint pain and inflammation. FSHD is the most prevalent of the nine types of MD affecting both adults and children, with a worldwide incidence of about 1 in 8,300 people. FSHD is caused by aberrant production of double homeobox 4 (DUX4), a protein whose function is unknown.
- DUX4 double homeobox 4
- the DUX4 gene which encodes the DUX4 protein, is located in the D4Z4 repeat region on chromosome 4 and is typically expressed only in fetal development, after which it is repressed by hypermethylation of the D4Z4 repeats which surround and compact the DUX4 gene.
- Two types of FSHD, Type 1 and Type 2 have been described.
- Type 1 which accounts for about 95% of cases, is associated with deletions of D4Z4 repeats on chromosome 4.
- Type 2 FSHD which accounts for about 5% of cases, is associated with mutations of the SMCHD1 gene on chromosome 18. Besides supportive care and treatments to address the symptoms of the disease, there are no effective therapies for FSHD.
- the disclosure provides oligonucleotides designed to target DUX4 RNAs.
- the disclosure provides oligonucleotides complementary with DUX4 RNA that are useful for reducing levels of DUX4 mRNA and/or protein associated with features of facioscapulohumeral muscular dystrophy (FSHD) pathology, including muscle atrophy, inflammation, and decreased differentiation potential and oxidative stress.
- FSHD facioscapulohumeral muscular dystrophy
- the oligonucleotides are designed to have desirable toxicity and/or immunogenicity profiles.
- the disclosure provides complexes that target muscle cells (e.g., primary myoblasts) for purposes of delivering molecular payloads (e.g., the DUX4-targeting oligonucleotides described herein) to those cells.
- molecular payloads e.g., the DUX4-targeting oligonucleotides described herein
- complexes provided herein are particularly useful for delivering molecular payloads that inhibit the expression or activity of DUX4, e.g., in a subject having or suspected of having Facioscapulohumeral muscular dystrophy (FSHD).
- FSHD Facioscapulohumeral muscular dystrophy
- the oligonucleotides are released by endosomal cleavage of covalent linkers connecting oligonucleotides and muscle-targeting agents of the complexes.
- a muscle- targeting agent covalently linked to an oligonucleotide targeting a double homeobox 4 (DUX4) mRNA
- the oligonucleotide comprises an antisense strand of 18-25 nucleotides in length and comprises a region of complementarity to a target sequence as set forth in SEQ ID NOs: 356, 501, 1398, 494, 509, 224, 1320, 561, 225, 226, 261, 265, 320, 341, 343, 388, 466, 483, 552, 560, 601, 921, 942, 953, 1294, 1296, 1301, 1321, 1322, 1323, 1324, 1325, 1373, 1394, 1395, 1523, 1531, 15
- one or more cytidines of the oligonucleotide is a 2’- modified 5-methyl-cytidine, optionally wherein the 2’-modified 5-methyl-cytidine is a 2’-O-Me modified 5-methyl-cytidine or a 2’-F modified 5-methyl-cytidine.
- the antisense strand is selected from the modified version of SEQ ID NOs: 3035, 3040, 3061, 3039, 3041, 3027, 3052, 3044, 3028, 3029, 3030, 3031, 3032, 3033, 3034, 3036, 3037, 3038, 3042, 3043, 3045, 3046, 3047, 3048, 3049, 3050, 3051, 3053, 3054, 3055, 3056, 3057, 3058, 3059, 3060, 3062, 3063, 3064, 3065, and 3066 listed in Table 8.
- the sense strand is selected from the modified version of SEQ ID NOs: 2995, 3000, 3021, 2999, 3001, 2987, 3012, 3004, 2988, 2989, 2990, 2991, 2992, 2993, 2994, 2996, 2997, 2998, 3002, 3003, 3005, 3006, 3007, 3008, 3009, 3010, 3011, 3013, 3014, 3015, 3016, 3017, 3018, 3019, 3020, 3022, 3023, 3024, 3025, and 3026 listed in Table 8.
- the oligonucleotide is a siRNA molecule selected from the siRNAs listed in Table 8.
- the antisense strand is selected from the modified version of SEQ ID NOs: 3040, 3061, 3027, 3037, 3039, 3041, 3044, and 3052 listed in Table 9.
- the sense strand is selected from the modified version of SEQ ID NOs: 3000, 3021, 2987, 2997, 2999, 3001, 3004, and 3012 listed in Table 9.
- the RNAi oligonucleotide is a siRNA molecule selected from the siRNAs listed in Table 9.
- the anti-TfR antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 76, and a VL comprising the amino acid sequence of SEQ ID NO: 75.
- the anti-TfR antibody is a Fab and comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 101 and a light chain comprising the amino acid sequence of SEQ ID NO: 90.
- the muscle targeting agent and the antisense oligonucleotide are covalently linked via a linker, optionally wherein the linker comprises a valine-citrulline sequence.
- Further provided herein are methods of reducing DUX4 expression in a muscle cell, the method comprising contacting the muscle cell with an effective amount of the complex described herein for promoting internalization of the oligonucleotide to the muscle cell.
- Antisense strand 5’- fCfUmCfUmCfAmUfUmCfUmGfAmAfAmCfCmAfAmAfUmC*fU*mG-3’ (SEQ ID NO: 3035)
- Sense strand 5'-mUmUfUmGfAmGfAmAfGmGfAmUfCmGfCmUfUmUfCmCfA-3' (SEQ ID NO: 3000);
- Antisense strand 5’- fGfCmGfAmUfGmCfCmUfGmGfAmAfAmGfCmGfAmUfCmC*fU*mU-3’ (SEQ ID NO: 3041)
- Sense strand 5’-mGmGfAmUfCmGfCmUfUmUfCmCfAmGfGmCfAmUfCmGfC-3’ (SEQ ID NO: 3001);
- Sense strand 5'-mGmCfGmAfCmGfGmAfGmAfCmUfCmGfUmUfUmGfGmAfC-3' (SEQ ID NO: 2987);
- Antisense strand 5'-fUfUmCfUmAfGmGfAmGfAmGfGmUfUmGfCmGfCmCfUmG*fC*mU- 3' (SEQ ID NO: 3052)
- Antisense strand 5'-fUfCmCfGmCfUmCfAmAfAmGfCmAfGmGfCmUfCmGfCmA*fG*mG- 3’ (SEQ ID NO: 3031)
- Antisense strand 5'-fAfCmCfAmAfAmUfCmUfGmGfAmCfCmCfUmGfGmGfCmU*fC*mC- 3’ (SEQ ID NO: 3034)
- Sense strand 5'-mGmGfCmCfCmAfGmGfCmCfAmUfCmGfGmCfAmUfUmCfC-3' (SEQ ID NO: 2992); Antisense strand: 5'-fCfAmAfAmUfCmUfGmGfAmCfCmCfUmGfGmGfCmUfCmC*fG*mG- 3’ (SEQ ID NO: 3033)
- Antisense strand 5'-fGfGmAfCmUfCmCfGmGfGmAfGmGfCmCfCmGfUmCfUmC*fU*mC- 3’ (SEQ ID NO: 3042)
- Antisense strand 5'-fCfUmCfAmAfAmGfCmAfGmGfCmUfCmGfCmAfGmGfGmC*fC*mU- 3’ (SEQ ID NO: 3030)
- Sense strand 5'-mGmCfCmCfUmGfCmGfAmGfCmCfUmGfCmUfUmUfGmAfG-3' (SEQ ID NO: 2990);
- Sense strand 5'-mUmGfAmGfGmCfAmGfCmAfCmCfGmGfCmGfGmGfAmAfU-3' (SEQ ID NO: 2996);
- Antisense strand 5'- fAfUmGfCmCfCmAfGmGfAmAfAmGfAmAfUmGfGmCfAmG*fU*mU-3' (SEQ ID NO:
- Antisense strand 5'- fGfUmUfUmCfUmAfGmGfAmGfAmGfGmUfUmGfCmGfCmC*fU*mG-3' (SEQ ID NO: 3054)
- Antisense strand 5'-fUfCmCfGmUfUmUfCmUfAmGfGmAfGmAfGmGfUmUfGmC*fG*mC- 3' (SEQ ID NO: 3057)
- Sense strand 5'-mGmCfAmAfCmCfUmCfUmCfCmUfAmGfAmAfAmCfGmGfA-3' (SEQ ID NO: 3017);
- Antisense strand 5'-fGfAmAfAmCfUmCfCmGfGmGfCmUfCmGfCmCfAmGfGmA*fG*mC- 3’ (SEQ ID NO: 3049)
- Antisense strand 5'-fCfGmUfUmUfCmUfAmGfGmAfGmAfGmGfUmUfGmCfGmC*fC*mU- 3' (SEQ ID NO: 3055)
- Sense strand 5'-mGmCfGmCfAmAfCmCfUmCfUmCfCmUfAmGfAmAfAmCfG-3' (SEQ ID NO: 3015);
- Antisense strand 5'-fGfCmGfGmUfGmUfGmUfGmGfAmGfUmCfUmCfUmCfAmCfCmG*fG*mG- 3’ (SEQ ID NO: 3063)
- Sense strand 5'-mCmGfGmUfGmAfGmAfGmAfGmAfCmUfCmCfAmCfAmCfCmGfC-3' (SEQ ID NO: 3023);
- Antisense strand 5'-fUfArnUfUrnCfUrnUfCrnCfUrnCfGrnCfUrnGfArnGfGmGfGmU*fG*mC- 3' (SEQ ID NO: 3059)
- Sense strand 5'-mAmCfCmCfCmUfCmAfGmCfGmAfGmGfAmAfGmAfAmUfA-3' (SEQ ID NO: 3019); Antisense strand: 5'-fGfGmGfUmCfCmAfAmAfCmGfAmGfUmCfUmCfCmGfUmC*fG*mC- 3' (SEQ ID NO: 3029) Sense strand: 5'-mGmAfCmGfGmAfGmAfCmUfCmGfUmUfUmGfGmAfCmCfC-3' (SEQ ID NO: 2989); Antisense strand: 5'-fUfUmUfCmUfAmGfGmAfGmAfGmAfGmGfUmUfGmCfGmCfCmU*fG*mC- 3' (SEQ ID NO:
- the antisense strand comprises the nucleotide sequence of any one of SEQ ID NOs: 1575-2986.
- FIG. 1 depicts a non-limiting schematic showing the effect of transfecting cells with an siRNA.
- FIG. 2 depicts a non-limiting schematic showing the activity of a muscle targeting complex comprising an siRNA.
- FIGs. 5A-5B show the activities of DUX4-targeting siRNAs listed in Table 8 in knocking down DUX4 mRNA expression in Hepa1-6 cells.
- FIG. 5A shows the activities of the siRNAs in knocking down DUX4 mRNA when the Hepa1-6 cells were treated with 2 nM or 10 nM of each indicated siRNA.
- FIG. 5B shows a dose response curve for siRNA 9, which yields an IC50 value of 176 pM.
- FIG. 6A-6H are dose response curves showing reduction of MBD3L2 mRNA following transfection of AB1080 immortalized FSHD patient-derived myotubes with certain DUX4-targeting siRNAs listed in Table 8 at various concentrations.
- the siRNAs tested are siRNA9 (FIG. 6A); siRNA14 (FIG. 6B); siRNA35 (FIG. 6C), siRNA13 (FIG. 6D), siRNA15 (FIG. 6E), siRNA1 (FIG. 6F), siRNA26 (FIG. 6G), and siRNA18 (FIG. 6H).
- FIG. 6A siRNA9
- FIG. 6A siRNA14
- FIG. 6C siRNA35
- FIG. 6C siRNA13
- FIG. 6E siRNA15
- FIG. 6E siRNA15
- FIG. 6F siRNA1
- FIG. 6G siRNA26
- siRNA18 FIG. 6H
- FIG. 7 shows a composite of the mRNA levels of three DUX4 transcriptome markers (MBD3L2, TRIM43, and ZSCAN4) in AB1080 immortalized FSHD patient-derived myotubes, following incubation with siRNA conjugates containing an anti-TfR Fab 3M12 VH4/V ⁇ 3 covalently linked siRNA9, siRNA14, or siRNA35 (corresponding to siRNA9, siRNA14, siRNA35 in Table 8).
- the anti-TfR Fab was covalently linked to the 3’ end of the sense strand of each siRNA via a linker, and the corresponding antisense strand was annealed to the sense strand.
- the oligonucleotides are designed to efficiently engage the RNA-induced silencing complex (RISC) for degradation of the DUX4 RNA but also have reduced off-target effect. In some embodiments, the oligonucleotides are designed to reduce levels of DUX4 RNA and/or protein. In some embodiments, the oligonucleotides are designed to have desirable bioavailability and/or serum-stability properties. In some embodiments, the oligonucleotides are designed to have desirable binding affinity properties. In some embodiments, the oligonucleotides are designed to have desirable toxicity and/or immunogenicity profiles.
- RISC RNA-induced silencing complex
- an antibody is a full- length antibody. In some embodiments, an antibody is a chimeric antibody. In some embodiments, an antibody is a humanized antibody. However, in some embodiments, an antibody is a Fab fragment, a Fab’ fragment, a F(ab’)2 fragment, a Fv fragment or a scFv fragment. In some embodiments, an antibody is a nanobody derived from a camelid antibody or a nanobody derived from shark antibody. In some embodiments, an antibody is a diabody. In some embodiments, an antibody comprises a framework having a human germline sequence.
- an antibody comprises a heavy chain constant domain selected from the group consisting of IgG, IgG1, IgG2, IgG2A, IgG2B, IgG2C, IgG3, IgG4, IgA1, IgA2, IgD, IgM, and IgE constant domains.
- an antibody comprises a heavy (H) chain variable region (abbreviated herein as VH), and/or (e.g., and) a light (L) chain variable region (abbreviated herein as VL).
- an antibody comprises a constant domain, e.g., an Fc region.
- An immunoglobulin constant domain refers to a heavy or light chain constant domain.
- the heavy chain of an antibody described herein can be an alpha ( ⁇ ), delta ( ⁇ ), epsilon ( ⁇ ), gamma ( ⁇ ) or mu ( ⁇ ) heavy chain.
- the heavy chain of an antibody described herein can comprise a human alpha ( ⁇ ), delta ( ⁇ ), epsilon ( ⁇ ), gamma ( ⁇ ) or mu ( ⁇ ) heavy chain.
- an antibody described herein comprises a human gamma 1 CH1, CH2, and/or (e.g., and) CH3 domain.
- an antibody may be part of a larger immunoadhesion molecule, formed by covalent or noncovalent association of the antibody or antibody portion with one or more other proteins or peptides.
- immunoadhesion molecules include use of the streptavidin core region to make a tetrameric scFv molecule (Kipriyanov, S. M., et al. (1995) Human Antibodies and Hybridomas 6:93-101) and use of a cysteine residue, a marker peptide and a C-terminal polyhistidine tag to make bivalent and biotinylated scFv molecules (Kipriyanov, S. M., et al. (1994) Mol. Immunol.
- a CDR may refer to the CDR defined by any method known in the art.
- Two antibodies having the same CDR means that the two antibodies have the same amino acid sequence of that CDR as determined by the same method, for example, the IMGT definition.
- CDR set refers to a group of three CDRs that occur in a single variable region capable of binding the antigen. The exact boundaries of these CDRs have been defined differently according to different systems.
- CDR-grafted antibody refers to antibodies which comprise heavy and light chain variable region sequences from one species but in which the sequences of one or more of the CDR regions of VH and/or (e.g., and) VL are replaced with CDR sequences of another species, such as antibodies having murine heavy and light chain variable regions in which one or more of the murine CDRs (e.g., CDR3) has been replaced with human CDR sequences.
- CDR-grafted antibody refers to antibodies which comprise heavy and light chain variable region sequences from one species but in which the sequences of one or more of the CDR regions of VH and/or (e.g., and) VL are replaced with CDR sequences of another species, such as antibodies having murine heavy and light chain variable regions in which one or more of the murine CDRs (e.g., CDR3) has been replaced with human CDR sequences.
- Chimeric antibody refers to antibodies which comprise heavy and light chain variable region sequences from one species and constant region sequences from another species, such as antibodies having murine heavy and light chain variable regions linked to human constant regions.
- Complementary refers to the capacity for precise pairing between two nucleotides or two sets of nucleotides. In particular, complementary is a term that characterizes an extent of hydrogen bond pairing that brings about binding between two nucleotides or two sets of nucleotides. The term “complementary” may also refer to the capacity for precise pairing between two nucleosides or two sets of nucleosides.
- adenosine-type bases are complementary to thymidine-type bases (T) or uracil-type bases (U), that cytosine-type bases (C) are complementary to guanosine-type bases (G), and that universal bases such as 3-nitropyrrole or 5-nitroindole can hybridize to and are considered complementary to any A, C, U, or T.
- Inosine (I) has also been considered in the art to be a universal base and is considered complementary to any A, C, U or T.
- Covalently linked refers to a characteristic of two or more molecules being linked together via at least one covalent bond.
- two molecules can be covalently linked together by a single bond, e.g., a disulfide bond or disulfide bridge, that serves as a linker between the molecules.
- an antibody that is cross-reactive against human and non-human primate antigens of a similar type or class is capable of binding to the human antigen and non-human primate antigens with a similar affinity or avidity.
- an antibody is cross-reactive against a human antigen and a rodent antigen of a similar type or class.
- an antibody is cross-reactive against a rodent antigen and a non-human primate antigen of a similar type or class.
- an antibody is cross-reactive against a human antigen, a non-human primate antigen, and a rodent antigen of a similar type or class.
- DUX4 refers to a gene that encodes double homeobox 4, a protein which is generally expressed during fetal development and in the testes of adult males.
- DUX4 may be a human (Gene ID: 100288687), non- human primate (e.g., Gene ID: 750891, Gene ID: 100405864), or rodent gene (e.g., Gene ID: 306226).
- Facioscapulohumeral muscular dystrophy As used herein, the term “facioscapulohumeral muscular dystrophy (FSHD)” refers to a genetic disease caused by mutations in the DUX4 gene or SMCHD1 gene that is characterized by muscle mass loss and muscle atrophy, primarily in the muscles of the face, shoulder blades, and upper arms. Two types of the disease, Type 1 and Type 2, have been described. Type 1 is associated with deletions in D4Z4 repeat regions on chromosome 4 which contains the DUX4 gene. In some embodiments, Type 1 is associated with deletions in D4Z4 repeat regions on chromosome 4 allelic variant 4qA which contains the DUX4 gene.
- Type 2 is associated with mutations in the SMCHD1 gene. Both Type 1 and Type 2 FSHD are characterized by aberrant production of the DUX4 protein after fetal development outside of the testes. Facioscapulohumeral dystrophy, the genetic basis for the disease, and related symptoms are described in the art (see, e.g. Campbell, A.E., et al., “Facioscapulohumeral dystrophy: Activating an early embryonic transcriptional program in human skeletal muscle” Human Mol Genet. (2018); and Tawil, R. “Facioscapulohumeral muscular dystrophy” Handbook Clin. Neurol.
- FSHD Type 1 is associated with Online Mendelian Inheritance in Man (OMIM) Entry # 158900.
- FSHD Type 2 is associated with OMIM Entry # 158901.
- Framework As used herein, the term “framework” or “framework sequence” refers to the remaining sequences of a variable region minus the CDRs. Because the exact definition of a CDR sequence can be determined by different systems, the meaning of a framework sequence is subject to correspondingly different interpretations.
- the six CDRs also divide the framework regions on the light chain and the heavy chain into four sub-regions (FR1, FR2, FR3 and FR4) on each chain, in which CDR1 is positioned between FR1 and FR2, CDR2 between FR2 and FR3, and CDR3 between FR3 and FR4.
- a framework region represents the combined FRs within the variable region of a single, naturally occurring immunoglobulin chain.
- a FR represents one of the four sub-regions, and FRs represents two or more of the four sub-regions constituting a framework region.
- Human heavy chain and light chain acceptor sequences are known in the art. In one embodiment, the acceptor sequences known in the art may be used in the antibodies disclosed herein.
- Human antibody The term “human antibody”, as used herein, is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences.
- the human antibodies of the disclosure may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3.
- human antibody is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- Humanized antibody refers to antibodies which comprise heavy and light chain variable region sequences from a non-human species (e.g., a mouse) but in which at least a portion of the VH and/or (e.g., and) VL sequence has been altered to be more “human-like”, i.e., more similar to human germline variable sequences.
- Internalizing cell surface receptor refers to a cell surface receptor that is internalized by cells, e.g., upon external stimulation, e.g., ligand binding to the receptor.
- an internalizing cell surface receptor is internalized by endocytosis.
- an internalizing cell surface receptor is internalized by clathrin-mediated endocytosis.
- an internalizing cell surface receptor is internalized by a clathrin- independent pathway, such as, for example, phagocytosis, macropinocytosis, caveolae- and raft-mediated uptake or constitutive clathrin-independent endocytosis.
- the internalizing cell surface receptor comprises an intracellular domain, a transmembrane domain, and/or (e.g., and) an extracellular domain, which may optionally further comprise a ligand-binding domain.
- a cell surface receptor becomes internalized by a cell after ligand binding.
- a ligand may be a muscle-targeting agent or a muscle-targeting antibody.
- an internalizing cell surface receptor is a transferrin receptor.
- Isolated antibody An “isolated antibody”, as used herein, is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds transferrin receptor is substantially free of antibodies that specifically bind antigens other than transferrin receptor).
- An isolated antibody that specifically binds transferrin receptor complex may, however, have cross-reactivity to other antigens, such as transferrin receptor molecules from other species.
- an isolated antibody may be substantially free of other cellular material and/or (e.g., and) chemicals.
- Kabat numbering The terms “Kabat numbering”, “Kabat definitions and “Kabat labeling” are used interchangeably herein.
- the hypervariable region ranges from amino acid positions 24 to 34 for CDR1, amino acid positions 50 to 56 for CDR2, and amino acid positions 89 to 97 for CDR3.
- Molecular payload refers to a molecule or species that functions to modulate a biological outcome.
- a molecular payload is linked to, or otherwise associated with a muscle-targeting agent.
- the molecular payload is a small molecule, a protein, a peptide, a nucleic acid, or an oligonucleotide.
- the molecular payload functions to modulate the transcription of a DNA sequence, to modulate the expression of a protein, or to modulate the activity of a protein.
- the molecular payload is an oligonucleotide that comprises a strand having a region of complementarity to a target gene.
- Muscle-targeting agent refers to a molecule that specifically binds to an antigen expressed on muscle cells.
- the antigen in or on muscle cells may be a membrane protein, for example an integral membrane protein or a peripheral membrane protein.
- a muscle-targeting agent specifically binds to an antigen on muscle cells that facilitates internalization of the muscle-targeting agent (and any associated molecular payload) into the muscle cells.
- a muscle-targeting agent specifically binds to an internalizing, cell surface receptor on muscles and is capable of being internalized into muscle cells through receptor mediated internalization.
- the muscle-targeting agent is a small molecule, a protein, a peptide, a nucleic acid (e.g., an aptamer), or an antibody.
- the muscle-targeting agent is linked to a molecular payload.
- Oligonucleotide refers to an oligomeric nucleic acid compound of up to 200 nucleotides in length.
- oligonucleotides include, but are not limited to, RNAi oligonucleotides (e.g., siRNAs, shRNAs), microRNAs, gapmers, mixmers, phosphorodiamidate morpholinos, peptide nucleic acids, aptamers, guide nucleic acids (e.g., Cas9 guide RNAs), etc.
- Oligonucleotides may be single-stranded or double-stranded.
- an oligonucleotide may comprise one or more phosphorothioate linkages, which may be in the Rp or Sp stereochemical conformation.
- Recombinant antibody The term “recombinant human antibody”, as used herein, is intended to include all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies expressed using a recombinant expression vector transfected into a host cell (described in more details in this disclosure), antibodies isolated from a recombinant, combinatorial human antibody library (Hoogenboom H. R., (1997) TIB Tech. 15:62-70; Azzazy H., and Highsmith W. E., (2002) Clin. Biochem.
- such recombinant human antibodies are subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.
- One embodiment of the disclosure provides fully human antibodies capable of binding human transferrin receptor which can be generated using techniques well known in the art, such as, but not limited to, using human Ig phage libraries such as those disclosed in Jermutus et al., PCT publication No. WO 2005/007699 A2.
- the term, “specifically binds”, refers to the ability of the antibody to bind to a specific antigen with a degree of affinity or avidity, compared with an appropriate reference antigen or antigens, that enables the antibody to be used to distinguish the specific antigen from others, e.g., to an extent that permits preferential targeting to certain cells, e.g., muscle cells, through binding to the antigen, as described herein.
- an antibody specifically binds to a target if the antibody has a K D for binding the target of at least about 10 -4 M, 10 -5 M, 10 -6 M, 10 -7 M, 10 -8 M, 10 -9 M, 10 -10 M, 10 -11 M, 10 -12 M, 10 -13 M, or less.
- an antibody specifically binds to the transferrin receptor, e.g., an epitope of the apical domain of transferrin receptor.
- a subject is a patient, e.g., a human patient that has or is suspected of having a disease. In some embodiments, the subject is a human patient who has or is suspected of having FSHD.
- Transferrin receptor As used herein, the term, “transferrin receptor” (also known as TFRC, CD71, p90, TFR, or TFR1) refers to an internalizing cell surface receptor that binds transferrin to facilitate iron uptake by endocytosis.
- a transferrin receptor may be of human (NCBI Gene ID 7037), non-human primate (e.g., NCBI Gene ID 711568 or NCBI Gene ID 102136007), or rodent (e.g., NCBI Gene ID 22042) origin.
- non-human primate e.g., NCBI Gene ID 711568 or NCBI Gene ID 102136007
- rodent e.g., NCBI Gene ID 22042
- multiple human transcript variants have been characterized that encoded different isoforms of the receptor (e.g., as annotated under GenBank RefSeq Accession Numbers: NP_001121620.1, NP_003225.2, NP_001300894.1, and NP_001300895.1).
- 2’-modified nucleoside As used herein, the terms “2’-modified nucleoside” and “2’-modified ribonucleoside” are used interchangeably and refer to a nucleoside having a sugar moiety modified at the 2’ position. In some embodiments, the 2’-modified nucleoside is a 2’-4’ bicyclic nucleoside, where the 2’ and 4’ positions of the sugar are bridged (e.g., via a methylene, an ethylene, or a (S)-constrained ethyl bridge).
- the 2’-modified nucleosides described herein are high-affinity modified nucleosides and oligonucleotides comprising the 2’-modified nucleosides have increased affinity to a target sequence, relative to an unmodified oligonucleotide.
- Examples of structures of 2’-modified nucleosides are provided below: linkages are contemplated between 2’-modified nucleosides.
- II. Complexes [00075] Provided herein are complexes that comprise a targeting agent, e.g. an antibody, covalently linked to a molecular payload.
- a complex comprises a muscle-targeting antibody covalently linked to an oligonucleotide.
- a complex may comprise an antibody that specifically binds a single antigenic site or that binds to at least two antigenic sites that may exist on the same or different antigens.
- a complex may be used to modulate the activity or function of at least one gene, protein, and/or (e.g., and) nucleic acid.
- the molecular payload present with a complex is responsible for the modulation of a gene, protein, and/or (e.g., and) nucleic acids.
- a molecular payload may be a small molecule, protein, nucleic acid, oligonucleotide, or any molecular entity capable of modulating the activity or function of a gene, protein, and/or (e.g., and) nucleic acid in a cell.
- a molecular payload is an oligonucleotide that targets a DUX4 in muscle cells.
- a complex comprises a muscle-targeting agent, e.g. an anti-transferrin receptor antibody, covalently linked to a molecular payload, e.g. an antisense oligonucleotide that targets a DUX4.
- Muscle-Targeting Agents e.g., for delivering a molecular payload to a muscle cell.
- muscle-targeting agents are capable of binding to a muscle cell, e.g., via specifically binding to an antigen on the muscle cell, and delivering an associated molecular payload to the muscle cell.
- the molecular payload is bound (e.g., covalently bound) to the muscle targeting agent and is internalized into the muscle cell upon binding of the muscle targeting agent to an antigen on the muscle cell, e.g., via endocytosis. It should be appreciated that various types of muscle-targeting agents may be used in accordance with the disclosure.
- any muscle targets can be targeted by any type of muscle-targeting agent described herein.
- the muscle-targeting agent may comprise, or consist of, a nucleic acid (e.g., DNA or RNA), a peptide (e.g., an antibody), a lipid (e.g., a microvesicle), or a sugar moiety (e.g., a polysaccharide).
- the muscle-targeting agent may comprise, or consist of, a small molecule. Exemplary muscle- targeting agents are described in further detail herein, however, it should be appreciated that the exemplary muscle-targeting agents provided herein are not meant to be limiting.
- muscle-targeting agents that specifically bind to an antigen on muscle, such as skeletal muscle, smooth muscle, or cardiac muscle.
- any of the muscle-targeting agents provided herein bind to (e.g., specifically bind to) an antigen on a skeletal muscle cell, a smooth muscle cell, and/or (e.g., and) a cardiac muscle cell.
- muscle-specific cell surface recognition elements e.g., cell membrane proteins
- both tissue localization and selective uptake into muscle cells can be achieved.
- molecules that are substrates for muscle uptake transporters are useful for delivering a molecular payload into muscle tissue.
- muscle-targeting agents may be useful for concentrating a molecular payload (e.g., oligonucleotide) in muscle while reducing toxicity associated with effects in other tissues.
- the muscle-targeting agent concentrates a bound molecular payload in muscle cells as compared to another cell type within a subject.
- the muscle-targeting agent concentrates a bound molecular payload in muscle cells (e.g., skeletal, smooth, or cardiac muscle cells) in an amount that is at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, or 100 times greater than an amount in non- muscle cells (e.g., liver, neuronal, blood, or fat cells).
- muscle cells e.g., skeletal, smooth, or cardiac muscle cells
- non- muscle cells e.g., liver, neuronal, blood, or fat cells.
- a toxicity of the molecular payload in a subject is reduced by at least 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, or 95% when it is delivered to the subject when bound to the muscle-targeting agent.
- a muscle recognition element e.g., a muscle cell antigen
- a muscle-targeting agent may be a small molecule that is a substrate for a muscle-specific uptake transporter.
- a muscle-targeting agent may be an antibody that enters a muscle cell via transporter-mediated endocytosis.
- a muscle targeting agent may be a ligand that binds to cell surface receptor on a muscle cell. It should be appreciated that while transporter-based approaches provide a direct path for cellular entry, receptor-based targeting may involve stimulated endocytosis to reach the desired site of action.
- the muscle-targeting agent is an antibody.
- the high specificity of antibodies for their target antigen provides the potential for selectively targeting muscle cells (e.g., skeletal, smooth, and/or (e.g., and) cardiac muscle cells).
- This specificity may also limit off-target toxicity.
- antibodies that are capable of targeting a surface antigen of muscle cells have been reported and are within the scope of the disclosure.
- antibodies that target the surface of muscle cells are described in Arahata K., et al. “Immunostaining of skeletal and cardiac muscle surface membrane with antibody against Duchenne muscular dystrophy peptide” Nature 1988; 333: 861-3; Song K.S., et al. “Expression of caveolin-3 in skeletal, cardiac, and smooth muscle cells.
- Caveolin-3 is a component of the sarcolemma and co-fractionates with dystrophin and dystrophin-associated glycoproteins” J Biol Chem 1996; 271: 15160-5; and Weisbart R.H. et al., “Cell type specific targeted intracellular delivery into muscle of a monoclonal antibody that binds myosin IIb” Mol Immunol. 2003 Mar, 39(13):783-9; the entire contents of each of which are incorporated herein by reference. a.
- Transferrin receptors are internalizing cell surface receptors that transport transferrin across the cellular membrane and participate in the regulation and homeostasis of intracellular iron levels.
- transferrin receptor binding proteins which are capable of binding to transferrin receptor.
- binding proteins e.g., antibodies
- binding proteins that bind to transferrin receptor are internalized, along with any bound molecular payload, into a muscle cell.
- an antibody that binds to a transferrin receptor may be referred to interchangeably as a transferrin receptor antibody, an anti-transferrin receptor antibody, or an anti-TfR antibody.
- Antibodies that bind, e.g. specifically bind, to a transferrin receptor may be internalized into the cell, e.g. through receptor-mediated endocytosis, upon binding to a transferrin receptor.
- anti-TfR antibodies may be produced, synthesized, and/or (e.g., and) derivatized using several known methodologies, e.g. library design using phage display. Exemplary methodologies have been characterized in the art and are incorporated by reference (D ⁇ ez, P.
- an anti-TfR antibody has been previously characterized or disclosed. Antibodies that specifically bind to transferrin receptor are known in the art (see, e.g. US Patent. No.
- the anti-TfR antibody described herein binds to transferrin receptor with high specificity and affinity. In some embodiments, the anti-TfR antibody described herein specifically binds to any extracellular epitope of a transferrin receptor or an epitope that becomes exposed to an antibody.
- the anti-TfR1 antibodies described herein bind an epitope in TfR1, wherein the epitope comprises residues in amino acids 214-241 and/or amino acids 354-381 of SEQ ID NO: 105.
- the anti-TfR1 antibodies described herein bind an epitope comprising residues in amino acids 214-241 and amino acids 354-381 of SEQ ID NO: 105.
- the anti-TfR1 antibodies described herein bind an epitope comprising one or more of residues Y222, T227, K231, H234, T367, S368, S370, T376, and S378 of human TfR1 as set forth in SEQ ID NO: 105. In some embodiments, the anti-TfR1 antibodies described herein bind an epitope comprising residues Y222, T227, K231, H234, T367, S368, S370, T376, and S378 of human TfR1 as set forth in SEQ ID NO: 105.
- the anti-TfR1 antibody described herein (e.g., 3M12 in Table 2 below and its variants) bind an epitope in TfR1, wherein the epitope comprises residues in amino acids 258-291 and/or amino acids 358-381 of SEQ ID NO: 105.
- the anti-TfR1 antibodies (e.g., 3M12 in Table 2 below and its variants) described herein bind an epitope comprising residues in amino acids amino acids 258-291 and amino acids 358-381 of SEQ ID NO: 105.
- the anti-TfR1 antibodies described herein bind an epitope comprising one or more of residues K261, S273, Y282, T362, S368, S370, and K371 of human TfR1 as set forth in SEQ ID NO: 105.
- the anti-TfR1 antibodies described herein bind an epitope comprising residues K261, S273, Y282, T362, S368, S370, and K371 of human TfR1 as set forth in SEQ ID NO: 105.
- An example human transferrin receptor amino acid sequence corresponding to NCBI sequence NP_003225.2 (transferrin receptor protein 1 isoform 1, homo sapiens) is as follows: [00090] An example non-human primate transferrin receptor amino acid sequence, corresponding to NCBI sequence NP_001244232.1(transferrin receptor protein 1, Macaca mulatta) is as follows:
- NCBI sequence XP_005545315.1 (transferrin receptor protein 1, Macaca fascicularis) is as follows:
- NCBI sequence NP_001344227.1 (transferrin receptor protein 1, Mus musculus) is as follows:
- an anti-TfR antibody binds to an amino acid segment of the receptor as follows: FVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDF EDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFFGHAH LGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTDS TCRMVTSESKNVKLTVSNVLKE (SEQ ID NO: 109) and does not inhibit the binding interactions between transferrin receptors and transferrin and/or (e.g., and) human hemochromatosis protein (also known as HFE).
- transferrin receptors and transferrin and/or e.g., and) human hemochromatosis protein (also known as HFE).
- the anti-TfR antibody described herein does not bind an epitope in SEQ ID NO: 109.
- Appropriate methodologies may be used to obtain and/or (e.g., and) produce antibodies, antibody fragments, or antigen-binding agents, e.g., through the use of recombinant DNA protocols.
- an antibody may also be produced through the generation of hybridomas (see, e.g., Kohler, G and Milstein, C. “Continuous cultures of fused cells secreting antibody of predefined specificity” Nature, 1975, 256: 495-497).
- the antigen- of-interest may be used as the immunogen in any form or entity, e.g., recombinant or a naturally occurring form or entity.
- Hybridomas are screened using standard methods, e.g., ELISA screening, to find at least one hybridoma that produces an antibody that targets a particular antigen.
- Antibodies may also be produced through screening of protein expression libraries that express antibodies, e.g., phage display libraries. Phage display library design may also be used, in some embodiments, (see, e.g. U.S.
- an antigen-of-interest may be used to immunize a non-human animal, e.g., a rodent or a goat.
- an antibody is then obtained from the non-human animal, and may be optionally modified using a number of methodologies, e.g., using recombinant DNA techniques. Additional examples of antibody production and methodologies are known in the art (see, e.g. Harlow et al. “Antibodies: A Laboratory Manual”, Cold Spring Harbor Laboratory, 1988.). [00095] In some embodiments, an antibody is modified, e.g., modified via glycosylation, phosphorylation, sumoylation, and/or (e.g., and) methylation. In some embodiments, an antibody is a glycosylated antibody, which is conjugated to one or more sugar or carbohydrate molecules.
- the one or more sugar or carbohydrate molecule includes a mannose unit, a glucose unit, an N- acetylglucosamine unit, an N-acetylgalactosamine unit, a galactose unit, a fucose unit, or a phospholipid unit. In some embodiments, there are about 1-10, about 1-5, about 5-10, about 1- 4, about 1-3, or about 2 sugar molecules. In some embodiments, a glycosylated antibody is fully or partially glycosylated. In some embodiments, an antibody is glycosylated by chemical reactions or by enzymatic means.
- an antibody is glycosylated in vitro or inside a cell, which may optionally be deficient in an enzyme in the N- or O- glycosylation pathway, e.g. a glycosyltransferase.
- an antibody is functionalized with sugar or carbohydrate molecules as described in International Patent Application Publication WO2014065661, published on May 1, 2014, entitled, “Modified antibody, antibody-conjugate and process for the preparation thereof”.
- agents binding to transferrin receptor are capable of targeting muscle cell and/or (e.g., and) mediate the transportation of an agent across the blood brain barrier.
- Transferrin receptors are internalizing cell surface receptors that transport transferrin across the cellular membrane and participate in the regulation and homeostasis of intracellular iron levels.
- a transferrin receptor specifically binds, to a transferrin receptor may be internalized into the cell, e.g. through receptor-mediated endocytosis, upon binding to a transferrin receptor.
- antibodies that bind to transferrin receptor with high specificity and affinity specifically binds to any extracellular epitope of a transferrin receptor or an epitope that becomes exposed to an antibody.
- the anti-TfR antibodies provided herein bind specifically to transferrin receptor from human, non-human primates, mouse, rat, etc.
- the anti-TfR antibodies provided herein bind to human transferrin receptor.
- the anti-TfR antibody described herein binds to an amino acid segment of a human or non-human primate transferrin receptor, as provided in SEQ ID NOs: 105-108. In some embodiments, the anti-TfR antibody described herein binds to an amino acid segment corresponding to amino acids 90-96 of a human transferrin receptor as set forth in SEQ ID NO: 105, which is not in the apical domain of the transferrin receptor. In some embodiments, the anti-TfR antibodies described herein binds to TfR1 but does not bind to TfR2.
- the anti-TfR antibodies described herein selectively binds to transferrin receptor 1 (TfR1) but do not bind to transferrin receptor 2 (TfR2).
- the anti-TfR antibodies described herein binds to human TfR1 and cyno TfR1 (e.g., with a Kd of 10 -7 M, 10 -8 M, 10 -9 M, 10 -10 M, 10 -11 M, 10 -12 M, 10 -13 M, or less), but does not bind to a mouse TfR1.
- the affinity and binding kinetics of the anti-TfR antibody can be tested using any suitable method including but not limited to biosensor technology (e.g., OCTET or BIACORE).
- binding of any one of the anti-TfR antibody described herein does not complete with or inhibit transferrin binding to the TfR1. In some embodiments, binding of any one of the anti-TfR antibody described herein does not complete with or inhibit HFE-beta-2-microglobulin binding to the TfR1.
- binding of any one of the anti-TfR antibody described herein does not complete with or inhibit HFE-beta-2-microglobulin binding to the TfR1.
- the anti-TfR antibody of the present disclosure comprises a VL comprising the CDR-L1, CDR-L2, and CDR-L3 of any one of the anti-TfR antibodies provided in Table 3 and comprises one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more) amino acid variations in the framework regions as compared with the respective VL provided in Table 3.
- the anti-TfR antibody of the present disclosure comprises a VH comprising the CDR-H1, CDR-H2, and CDR-H3 of any one of the anti-TfR antibodies provided in Table 3 and comprising an amino acid sequence that is at least 70% (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%) identical in the framework regions as compared with the respective VH provided in Table 3.
- the anti-TfR antibody of the present disclosure comprises a VL comprising the CDR-L1, CDR-L2, and CDR-L3 of any one of the anti-TfR antibodies provided in Table 3 and comprising an amino acid sequence that is at least 70% (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%) identical compared with the respective VL provided in Table 3.
- the anti-TfR antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 69 and a VL comprising the amino acid sequence of SEQ ID NO: 70.
- the anti-TfR antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 71 and a VL comprising the amino acid sequence of SEQ ID NO: 70.
- the anti-TfR antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 72 and a VL comprising the amino acid sequence of SEQ ID NO: 70.
- the anti-TfR antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 73 and a VL comprising the amino acid sequence of SEQ ID NO: 74.
- the anti-TfR antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 77 and a VL comprising the amino acid sequence of SEQ ID NO: 78.
- the anti-TfR antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 79 and a VL comprising the amino acid sequence of SEQ ID NO: 80.
- the anti-TfR antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 77 and a VL comprising the amino acid sequence of SEQ ID NO: 80.
- the anti-TfR antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 154 and a VL comprising the amino acid sequence of SEQ ID NO: 155.
- the anti-TfR antibody described herein is a full-length IgG, which can include a heavy constant region and a light constant region from a human antibody.
- the heavy chain of any of the anti-TfR antibodies as described herein may comprises a heavy chain constant region (CH) or a portion thereof (e.g., CH1, CH2, CH3, or a combination thereof).
- CH heavy chain constant region
- the heavy chain constant region can of any suitable origin, e.g., human, mouse, rat, or rabbit.
- the mutant human IgG1 constant region is provided below (mutations bonded and underlined): described herein may further comprise a light chain constant region (CL), which can be any CL known in the art.
- CL is a kappa light chain.
- the CL is a lambda light chain.
- the CL is a kappa light chain, the sequence of which is provided below: e.g., those provided in the IMGT database (www.imgt.org) or at www.vbase2.org/vbstat.php., both of which are incorporated by reference herein.
- the anti-TfR antibody described herein comprises a heavy chain comprising any one of the VH as listed in Table 3 or any variants thereof and a heavy chain constant region that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to SEQ ID NO: 81 or SEQ ID NO: 82.
- the anti-TfR antibody described herein comprises a heavy chain comprising any one of the VH as listed in Table 3 or any variants thereof and a heavy chain constant region that contains no more than 25 amino acid variations (e.g., no more than 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with SEQ ID NO: 81 or SEQ ID NO: 82.
- the anti-TfR antibody described herein comprises a heavy chain comprising any one of the VH as listed in Table 3 or any variants thereof and a heavy chain constant region as set forth in SEQ ID NO: 81.
- the anti- TfR antibody described herein comprises heavy chain comprising any one of the VH as listed in Table 3 or any variants thereof and a heavy chain constant region as set forth in SEQ ID NO: 82.
- the anti-TfR antibody described herein comprises a light chain comprising any one of the VL as listed in Table 3 or any variants thereof and a light chain constant region that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to SEQ ID NO: 83.
- the anti-TfR antibody described herein comprises a light chain comprising any one of the VL as listed in Table 3 or any variants thereof and a light chain constant region contains no more than 25 amino acid variations (e.g., no more than 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with SEQ ID NO: 83.
- the anti-TfR antibody described herein comprises a light chain comprising any one of the VL as listed in Table 3 or any variants thereof and a light chain constant region set forth in SEQ ID NO: 83.
- Examples of IgG heavy chain and light chain amino acid sequences of the anti- TfR antibodies described are provided in Table 4 below. Table 4. Heavy chain and light chain sequences of examples of anti-TfR IgGs
- the anti-TfR antibody of the present disclosure comprises a heavy chain containing no more than 25 amino acid variations (e.g., no more than 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in any one of SEQ ID NOs: 84, 86, 87, 88, 91, 92, 94, and 156.
- the anti-TfR antibody of the present disclosure comprises a light chain containing no more than 25 amino acid variations (e.g., no more than 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in any one of SEQ ID NOs: 85, 89, 90, 93, 95, and 157.
- 25 amino acid variations e.g., no more than 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation
- the anti-TfR antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 75% (e.g., 75%, 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 84, 86, 87, 88, 91, 92, 94, and 156.
- the anti-TfR antibody described herein comprises a light chain comprising an amino acid sequence that is at least 75% (e.g., 75%, 80%, 85%, 90%, 95%, 98%, or 99%) identical to any one of SEQ ID NOs: 85, 89, 90, 93, 95, and 157.
- the anti-TfR antibody described herein comprises a heavy chain comprising the amino acid sequence of any one of SEQ ID NOs: 84, 86, 87, 88, 91, 92, 94, and 156.
- the anti-TfR antibody of the present disclosure comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 91 and a light chain comprising the amino acid sequence of SEQ ID NO: 89.
- the anti-TfR antibody of the present disclosure comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 91 and a light chain comprising the amino acid sequence of SEQ ID NO: 90.
- the anti-TfR antibody of the present disclosure comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 92 and a light chain comprising the amino acid sequence of SEQ ID NO: 93.
- the anti-TfR antibody is a Fab fragment, Fab’ fragment, or F(ab’) 2 fragment of an intact antibody (full-length antibody).
- Antigen binding fragment of an intact antibody (full-length antibody) can be prepared via routine methods (e.g., recombinantly or by digesting the heavy chain constant region of a full length IgG using an enzyme such as papain).
- F(ab’) 2 fragments can be produced by pepsin or papain digestion of an antibody molecule, and Fab fragments that can be generated by reducing the disulfide bridges of F(ab’) 2 fragments.
- the anti-TfR antibody described herein comprises a light chain comprising any one of the VL as listed in Table 3 or any variants thereof and a light chain constant region set forth in SEQ ID NO: 83.
- Examples of Fab heavy chain and light chain amino acid sequences of the anti- TfR antibodies described are provided in Table 5 below. Table 5. Heavy chain and light chain sequences of examples of anti-TfR Fabs
- the anti-TfR antibody of the present disclosure comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 102 and a light chain comprising the amino acid sequence of SEQ ID NO: 93.
- the anti-TfR antibody of the present disclosure comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 103 and a light chain comprising the amino acid sequence of SEQ ID NO: 95.
- the anti-TfR antibody of the present disclosure comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 102 and a light chain comprising the amino acid sequence of SEQ ID NO: 95.
- the anti-TfR Fab described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 136. Alternatively or in addition (e.g., in addition), the anti-TfR Fab described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 133. In some embodiments, the anti-TfR Fab described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 137. Alternatively or in addition (e.g., in addition), the anti-TfR Fab described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 135.
- the anti-TfR antibodies described herein can be in any antibody form, including, but not limited to, intact (i.e., full-length) antibodies, antigen-binding fragments thereof (such as Fab, Fab’, F(ab’)2, Fv), single chain antibodies, bi-specific antibodies, or nanobodies.
- the anti-TfR antibody described herein is a scFv.
- the anti-TfR antibody described herein is a scFv-Fab (e.g., scFv fused to a portion of a constant region).
- the anti-TfR antibody described herein is a scFv fused to a constant region (e.g., human IgG1 constant region as set forth in SEQ ID NO: 81).
- a constant region e.g., human IgG1 constant region as set forth in SEQ ID NO: 81.
- conservative mutations can be introduced into antibody sequences (e.g., CDRs or framework sequences) at positions where the residues are not likely to be involved in interacting with a target antigen (e.g., transferrin receptor), for example, as determined based on a crystal structure.
- one, two or more mutations are introduced into the Fc region of an anti-TfR antibody described herein (e.g., in a CH2 domain (residues 231-340 of human IgG1) and/or (e.g., and) CH3 domain (residues 341-447 of human IgG1) and/or (e.g., and) the hinge region, with numbering according to the Kabat numbering system (e.g., the EU index in Kabat)) to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding and/or (e.g., and) antigen-dependent cellular cytotoxicity.
- Kabat numbering system e.g., the EU index in Kabat
- one, two or more mutations are introduced into the hinge region of the Fc region (CH1 domain) such that the number of cysteine residues in the hinge region are altered (e.g., increased or decreased) as described in, e.g., U.S. Pat. No. 5,677,425.
- the number of cysteine residues in the hinge region of the CH1 domain can be altered to, e.g., facilitate assembly of the light and heavy chains, or to alter (e.g., increase or decrease) the stability of the antibody or to facilitate linker conjugation.
- one, two or more mutations are introduced into the Fc region of a muscle-targeting antibody described herein (e.g., in a CH2 domain (residues 231-340 of human IgG1) and/or (e.g., and) CH3 domain (residues 341-447 of human IgG1) and/or (e.g., and) the hinge region, with numbering according to the Kabat numbering system (e.g., the EU index in Kabat)) to increase or decrease the affinity of the antibody for an Fc receptor (e.g., an activated Fc receptor) on the surface of an effector cell.
- an Fc receptor e.g., an activated Fc receptor
- an antibody comprises an IgG constant domain comprising one, two, three or more amino acid substitutions of amino acid residues at positions 251-257, 285-290, 308-314, 385-389, and 428-436, numbered according to the EU index as in Kabat. [000177] In some embodiments, one, two or more amino acid substitutions are introduced into an IgG constant domain Fc region to alter the effector function(s) of the anti-TfR antibody.
- the effector ligand to which affinity is altered can be, for example, an Fc receptor or the C1 component of complement. This approach is described in further detail in U.S. Pat. Nos. 5,624,821 and 5,648,260.
- the deletion or inactivation (through point mutations or other means) of a constant region domain can reduce Fc receptor binding of the circulating antibody thereby increasing tumor localization. See, e.g., U.S. Pat. Nos. 5,585,097 and 8,591,886 for a description of mutations that delete or inactivate the constant domain and thereby increase tumor localization.
- the antibodies provided herein may comprise a stabilizing ‘Adair’ mutation (Angal S., et al., “A single amino acid substitution abolishes the heterogeneity of chimeric mouse/human (IgG4) antibody,” Mol Immunol 30, 105-108; 1993), where serine 228 (EU numbering; residue 241 Kabat numbering) is converted to proline resulting in an IgG1-like hinge sequence. Accordingly, any of the antibodies may include a stabilizing ‘Adair’ mutation.
- an antibody is modified, e.g., modified via glycosylation, phosphorylation, sumoylation, and/or (e.g., and) methylation.
- an antibody is a glycosylated antibody, which is conjugated to one or more sugar or carbohydrate molecules.
- the one or more sugar or carbohydrate molecule are conjugated to the antibody via N-glycosylation, O-glycosylation, C-glycosylation, glypiation (GPI anchor attachment), and/or (e.g., and) phosphoglycosylation.
- the anti-TfR1 antibody described herein comprises any one of the VH and VL sequences, any one of the IgG heavy chain and light chain sequences, or any one of the Fab’ heavy chain and light chain sequences described herein, and further comprises a signal peptide (e.g., a N-terminal signal peptide).
- the signal peptide comprises the amino acid sequence of MGWSCIILFLVATATGVHS (SEQ ID NO: 104).
- an antibody provided herein may have one or more post- translational modifications.
- the muscle-targeting antibody is an antibody that specifically binds hemojuvelin, caveolin-3, Duchenne muscular dystrophy peptide, myosin IIb, or CD63.
- the muscle-targeting antibody is an antibody that specifically binds a myogenic precursor protein.
- myogenic precursor proteins include, without limitation, ABCG2, M-Cadherin/Cadherin-15, Caveolin-1, CD34, FoxK1, Integrin alpha 7, Integrin alpha 7 beta 1, MYF-5, MyoD, Myogenin, NCAM-1/CD56, Pax3, Pax7, and Pax9.
- the muscle-targeting antibody is an antibody that specifically binds a skeletal muscle protein.
- skeletal muscle proteins include, without limitation, alpha- Sarcoglycan, beta-Sarcoglycan, Calpain Inhibitors, Creatine Kinase MM/CKMM, eIF5A, Enolase 2/Neuron-specific Enolase, epsilon-Sarcoglycan, FABP3/H-FABP, GDF-8/Myostatin, GDF-11/GDF-8, Integrin alpha 7, Integrin alpha 7 beta 1, Integrin beta 1/CD29, MCAM/CD146, MyoD, Myogenin, Myosin Light Chain Kinase Inhibitors, NCAM-1/CD56, and Troponin I.
- one, two or more amino acid mutations are introduced into an IgG constant domain, or FcRn- binding fragment thereof (preferably an Fc or hinge-Fc domain fragment) to alter (e.g., decrease or increase) half-life of the antibody in vivo.
- an IgG constant domain, or FcRn- binding fragment thereof preferably an Fc or hinge-Fc domain fragment
- one, two or more amino acid mutations are introduced into an IgG constant domain, or FcRn- binding fragment thereof (preferably an Fc or hinge-Fc domain fragment) to decrease the half- life of the anti-transferrin receptor antibody in vivo.
- the constant region of the IgG1 of an antibody described herein comprises a methionine (M) to tyrosine (Y) substitution in position 252, a serine (S) to threonine (T) substitution in position 254, and a threonine (T) to glutamic acid (E) substitution in position 256, numbered according to the EU index as in Kabat. See U.S. Pat. No. 7,658,921, which is incorporated herein by reference.
- an antibody comprises an IgG constant domain comprising one, two, three or more amino acid substitutions of amino acid residues at positions 251-257, 285-290, 308-314, 385-389, and 428-436, numbered according to the EU index as in Kabat. [000190] In some embodiments, one, two or more amino acid substitutions are introduced into an IgG constant domain Fc region to alter the effector function(s) of the anti-transferrin receptor antibody.
- the effector ligand to which affinity is altered can be, for example, an Fc receptor or the C1 component of complement. This approach is described in further detail in U.S. Pat. Nos. 5,624,821 and 5,648,260.
- the deletion or inactivation (through point mutations or other means) of a constant region domain can reduce Fc receptor binding of the circulating antibody thereby increasing tumor localization. See, e.g., U.S. Pat. Nos. 5,585,097 and 8,591,886 for a description of mutations that delete or inactivate the constant domain and thereby increase tumor localization.
- one or more amino acid substitutions may be introduced into the Fc region of an antibody described herein to remove potential glycosylation sites on Fc region, which may reduce Fc receptor binding (see, e.g., Shields R L et al., (2001) J Biol Chem 276: 6591-604).
- one or more amino in the constant region of a muscle- targeting antibody described herein can be replaced with a different amino acid residue such that the antibody has altered Clq binding and/or (e.g., and) reduced or abolished complement dependent cytotoxicity (CDC). This approach is described in further detail in U.S. Pat. No. 6,194,551 (Idusogie et al).
- one or more amino acid residues in the N- terminal region of the CH2 domain of an antibody described herein are altered to thereby alter the ability of the antibody to fix complement.
- This approach is described further in International Publication No. WO 94/29351.
- the Fc region of an antibody described herein is modified to increase the ability of the antibody to mediate antibody dependent cellular cytotoxicity (ADCC) and/or (e.g., and) to increase the affinity of the antibody for an Fc ⁇ receptor. This approach is described further in International Publication No. WO 00/42072.
- the heavy and/or (e.g., and) light chain variable domain(s) sequence(s) of the antibodies provided herein can be used to generate, for example, CDR-grafted, chimeric, humanized, or composite human antibodies or antigen-binding fragments, as described elsewhere herein.
- any variant, CDR-grafted, chimeric, humanized, or composite antibodies derived from any of the antibodies provided herein may be useful in the compositions and methods described herein and will maintain the ability to specifically bind transferrin receptor, such that the variant, CDR-grafted, chimeric, humanized, or composite antibody has at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% or more binding to transferrin receptor relative to the original antibody from which it is derived.
- the antibodies provided herein comprise mutations that confer desirable properties to the antibodies.
- the antibodies provided herein may comprise a stabilizing ‘Adair’ mutation (Angal S., et al., “A single amino acid substitution abolishes the heterogeneity of chimeric mouse/human (IgG4) antibody,” Mol Immunol 30, 105-108; 1993), where serine 228 (EU numbering; residue 241 Kabat numbering) is converted to proline resulting in an IgG1-like hinge sequence. Accordingly, any of the antibodies may include a stabilizing ‘Adair’ mutation. [000194] As provided herein, antibodies of this disclosure may optionally comprise constant regions or parts thereof.
- muscle-specific peptides were identified using phage display library presenting surface heptapeptides.
- the muscle-targeting agent comprises the amino acid sequence ASSLNIA (SEQ ID NO: 3071).
- This peptide displayed improved specificity for binding to heart and skeletal muscle tissue after intravenous injection in mice with reduced binding to liver, kidney, and brain. Additional muscle-specific peptides have been identified using phage display.
- the muscle-targeting agent comprises the amino acid sequence TARGEHKEEELI (SEQ ID NO: 3073).
- a muscle-targeting agent may an amino acid-containing molecule or peptide.
- a muscle-targeting peptide may correspond to a sequence of a protein that preferentially binds to a protein receptor found in muscle cells.
- a muscle-targeting peptide contains a high propensity of hydrophobic amino acids, e.g. valine, such that the peptide preferentially targets muscle cells.
- a muscle-targeting peptide has not been previously characterized or disclosed.
- peptides may be conceived of, produced, synthesized, and/or (e.g., and) derivatized using any of several methodologies, e.g. phage displayed peptide libraries, one-bead one-compound peptide libraries, or positional scanning synthetic peptide combinatorial libraries.
- phage displayed peptide libraries e.g. phage displayed peptide libraries
- one-bead one-compound peptide libraries e.g. phage displayed peptide libraries
- positional scanning synthetic peptide combinatorial libraries e.g. phage displayed peptide libraries, one-bead one-compound peptide libraries, or positional scanning synthetic peptide combinatorial libraries.
- Exemplary methodologies have been characterized in the art and are incorporated by reference (Gray, B.P. and Brown, K.C. “Combinatorial Peptide Libraries: Mining for Cell-Binding Peptides” Chem Rev.2014, 114:2, 1020–1081.
- a muscle-targeting peptide has been previously disclosed (see, e.g. Writer M.J. et al. “Targeted gene delivery to human airway epithelial cells with synthetic vectors incorporating novel targeting peptides selected by phage display.” J. Drug Targeting. 2004;12:185; Cai, D. “BDNF-mediated enhancement of inflammation and injury in the aging heart.” Physiol Genomics. 2006, 24:3, 191-7.; Zhang, L.
- Exemplary muscle-targeting peptides comprise an amino acid sequence of the following group: CQAQGQLVC (SEQ ID NO: 3074), CSERSMNFC (SEQ ID NO: 3075), CPKTRRVPC (SEQ ID NO: 130), WLSEAGPVVTVRALRGTGSW (SEQ ID NO: 3076), ASSLNIA (SEQ ID NO: 3071), CMQHSMRVC (SEQ ID NO: 3077), and DDTRHWG (SEQ ID NO: 131).
- a muscle-targeting peptide may comprise about 2-25 amino acids, about 2-20 amino acids, about 2-15 amino acids, about 2-10 amino acids, or about 2-5 amino acids.
- Muscle-targeting peptides may comprise naturally-occurring amino acids, e.g. cysteine, alanine, or non-naturally-occurring or modified amino acids.
- Non-naturally occurring amino acids include ⁇ -amino acids, homo-amino acids, proline derivatives, 3-substituted alanine derivatives, linear core amino acids, N-methyl amino acids, and others known in the art.
- a muscle-targeting peptide may be linear; in other embodiments, a muscle- targeting peptide may be cyclic, e.g. bicyclic (see, e.g. Silvana, M.G. et al. Mol. Therapy, 2018, 26:1, 132–147.).
- a muscle-targeting agent may be a ligand, e.g. a ligand that binds to a receptor protein.
- a muscle-targeting ligand may be a protein, e.g. transferrin, which binds to an internalizing cell surface receptor expressed by a muscle cell. Accordingly, in some embodiments, the muscle-targeting agent is transferrin, or a derivative thereof that binds to a transferrin receptor.
- a muscle-targeting ligand may alternatively be a small molecule, e.g. a lipophilic small molecule that preferentially targets muscle cells relative to other cell types.
- aptamers may be conceived of, produced, synthesized, and/or (e.g., and) derivatized using any of several methodologies, e.g. Systematic Evolution of Ligands by Exponential Enrichment. Exemplary methodologies have been characterized in the art and are incorporated by reference (Yan, A.C. and Levy, M. “Aptamers and aptamer targeted delivery” RNA biology, 2009, 6:3, 316-20.; Germer, K. et al. “RNA aptamers and their therapeutic and diagnostic applications.” Int. J. Biochem. Mol. Biol. 2013; 4: 27–40.). In some embodiments, a muscle-targeting aptamer has been previously disclosed (see, e.g.
- an aptamer is a nucleic acid-based aptamer, an oligonucleotide aptamer or a peptide aptamer.
- an aptamer may be about 5-15 kDa, about 5-10 kDa, about 10-15 kDa, about 1-5 Da, about 1-3 kDa, or smaller.
- a muscle transporter protein such as a transporter protein expressed on the sarcolemma.
- the muscle-targeting agent is a substrate of an influx transporter that is specific to muscle tissue.
- the influx transporter is specific to skeletal muscle tissue.
- the muscle-targeting agent is a substrate that binds to an ABC superfamily or an SLC superfamily of transporters.
- the substrate that binds to the ABC or SLC superfamily of transporters is a naturally-occurring substrate.
- Exemplary SLC transporters that have high skeletal muscle expression include, without limitation, the SATT transporter (ASCT1; SLC1A4), GLUT4 transporter (SLC2A4), GLUT7 transporter (GLUT7; SLC2A7), ATRC2 transporter (CAT-2; SLC7A2), LAT3 transporter (KIAA0245; SLC7A6), PHT1 transporter (PTR4; SLC15A4), OATP-J transporter (OATP5A1; SLC21A15), OCT3 transporter (EMT; SLC22A3), OCTN2 transporter (FLJ46769; SLC22A5), ENT transporters (ENT1; SLC29A1 and ENT2; SLC29A2), PAT2 transporter (SLC36A2), and SAT2 transporter (KIAA1382; SLC38A2).
- ASCT1 SATT transporter
- SLC2A4 GLUT4 transporter
- GLUT7 transporter GLUT7; S
- the muscle-targeting agent is a substrate of an equilibrative nucleoside transporter 2 (ENT2) transporter.
- ENT2 equilibrative nucleoside transporter 2
- ENT2 has one of the highest mRNA expressions in skeletal muscle.
- human ENT2 hENT2
- Human ENT2 facilitates the uptake of its substrates depending on their concentration gradient.
- ENT2 plays a role in maintaining nucleoside homeostasis by transporting a wide range of purine and pyrimidine nucleobases.
- the hENT2 transporter has a low affinity for all nucleosides (adenosine, guanosine, uridine, thymidine, and cytidine) except for inosine.
- the muscle- targeting agent is an ENT2 substrate.
- Exemplary ENT2 substrates include, without limitation, inosine, 2′,3′-dideoxyinosine, and calofarabine.
- any of the muscle- targeting agents provided herein are associated with a molecular payload (e.g., oligonucleotide payload).
- the muscle-targeting agent is covalently linked to the molecular payload.
- the muscle-targeting agent is non-covalently linked to the molecular payload.
- the muscle-targeting agent is a substrate of an organic cation/carnitine transporter (OCTN2), which is a sodium ion-dependent, high affinity carnitine transporter.
- OCTN2 organic cation/carnitine transporter
- the muscle-targeting agent is carnitine, mildronate, acetylcarnitine, or any derivative thereof that binds to OCTN2.
- a muscle-targeting agent may be a protein that is protein that exists in at least one soluble form that targets muscle cells.
- a muscle-targeting protein may be hemojuvelin (also known as repulsive guidance molecule C or hemochromatosis type 2 protein), a protein involved in iron overload and homeostasis.
- hemojuvelin may be full length or a fragment, or a mutant with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to a functional hemojuvelin protein.
- a hemojuvelin mutant may be a soluble fragment, may lack a N-terminal signaling, and/or (e.g., and) lack a C-terminal anchoring domain.
- hemojuvelin may be annotated under GenBank RefSeq Accession Numbers NM_001316767.1, NM_145277.4, NM_202004.3, NM_213652.3, or NM_213653.3.
- a hemojuvelin may be of human, non-human primate, or rodent origin.
- Some aspects of the disclosure provide molecular payloads, e.g., oligonucleotides designed to target DUX4 RNAs to modulate the expression or the activity of DUX4.
- the disclosure provides oligonucleotides complementary with DUX4 RNA that are useful for reducing levels of DUX4 mRNA and/or protein associated with features of facioscapulohumeral muscular dystrophy (FSHD) pathology, including muscle atrophy, inflammation, and decreased differentiation potential and oxidative stress.
- FSHD facioscapulohumeral muscular dystrophy
- the oligonucleotides provided herein are designed to direct RNAi mediated degradation of DUX4 RNA.
- the oligonucleotides are designed to efficiently engage the RNA-induced silencing complex (RISC) for degradation of the DUX4 RNA but also have reduced off-target effect.
- the oligonucleotides are designed to have desirable bioavailability and/or serum-stability properties.
- the oligonucleotides are designed to have desirable binding affinity properties.
- the oligonucleotides are designed to have desirable toxicity and/or immunogenicity profiles.
- the DUX4-targeting oligonucleotide comprises a strand having a region of complementarity to a DUX4 RNA.
- Exemplary oligonucleotides are described in further detail herein, however, it should be appreciated that the exemplary oligonucleotides provided herein are not meant to be limiting.
- Oligonucleotides [000209] In some embodiments, the DUX4-targeting oligonucleotides provided herein are designed to cause RNAi mediated degradation of DUX4 mRNA.
- the DUX4-targeting oligonucleotide provided herein comprises an antisense strand that is complementary to a DUX4 mRNA.
- the oligonucleotide provided herein further comprises a sense strand that forms a double-stranded oligonucleotide (e.g., siRNA).
- siRNA double-stranded oligonucleotide
- any suitable oligonucleotide may be used as a molecular payload, as described herein.
- oligonucleotides useful for targeting DUX4 are provided in US Patent Number 9,988,628, published on February 2, 2017, entitled “AGENTS USEFUL IN TREATING FACIOSCAPULOHUMERAL MUSCULAR DYSTROPHY”; US Patent Number 9,469,851, published October 30, 2014, entitled “RECOMBINANT VIRUS PRODUCTS AND METHODS FOR INHIBITING EXPRESSION OF DUX4”; US Patent Application Publication 20120225034, published on September 6, 2012, entitled “AGENTS USEFUL IN TREATING FACIOSCAPULOHUMERAL MUSCULAR DYSTROPHY”; PCT Patent Application Publication Number WO 2013/120038, published on August 15, 2013, entitled “MORPHOLINO TARGETING DUX4 FOR TREATING FSHD”; Chen et al., “Morpholino-mediated Knock
- the oligonucleotide is an antisense oligonucleotide, a morpholino, a siRNA, a shRNA, or another oligonucleotide which hybridizes with the target DUX4 gene or mRNA.
- the oligonucleotides described herein have a region of complementarity to a sequence as set forth as: Human DUX4, corresponding to NCBI sequence NM_001293798.2 (SEQ ID NO: 160) or NCBI Sequence: NM_001306068.3 (SEQ ID NO: 161) as below and/or (e.g., and) Mouse DUX4, corresponding to NCBI sequence NM_001081954.1 (SEQ ID NO: 162), as below.
- the oligonucleotide may have a region of complementarity to a hypomethylated, contracted D4Z4 repeat, as in Daxinger, et al., “Genetic and Epigenetic Contributors to FSHD,” published in Curr Opin Genet Dev in 2015, Lim J-W, et al., DICER/AGO-dependent epigenetic silencing of D4Z4 repeats enhanced by exogenous siRNA suggests mechanisms and therapies for FSHD Hum Mol Genet. 2015 Sep 1; 24(17): 4817–4828, the contents of each of which are incorporated in their entireties. [000212]
- oligonucleotides may have a region of complementarity to a sequence set forth as follows, which is an example human DUX4 gene sequence
- oligonucleotides may have a region of complementarity to a sequence set forth as follows, which is an example human DUX4 gene sequence (NM_001306068.3) (SEQ ID NO: 161):
- oligonucleotides may have a region of complementarity to a sequence set forth as follows, which is an example mouse DUX4 gene sequence (SEQ ID NO: 162) (NM_001081954.1):
- an oligonucleotide may have a region of complementarity to DUX4 gene sequences of multiple species, e.g., selected from human, mouse and non-human species.
- the non-human species is a cynomolgus monkey.
- Oligonucleotide Size/Sequence Oligonucleotides may be of a variety of different lengths, e.g., depending on the format. In some embodiments, an oligonucleotide is 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 75, or more nucleotides in length.
- the oligonucleotide is 8 to 50 nucleotides in length, 8 to 40 nucleotides in length, 8 to 32 nucleotides in length, 10 to 15 nucleotides in length, 10 to 20 nucleotides in length, 15 to 25 nucleotides in length, 21 to 23 nucleotides in lengths, etc.
- the oligonucleotide is 8 to 32 nucleotides, 15 to 29 nucleotides, 15 to 27 nucleotides, 15 to 20 nucleotides, 20 to 25 nucleotides, 21 to 27 nucleotides, 23 to 27 nucleotides, 25 to 30 nucleotides, or 25-32 nucleotides in length.
- a complementary nucleic acid sequence of an oligonucleotide for purposes of the present disclosure is specifically hybridizable or specific for the target nucleic acid when binding of the sequence to the target molecule (e.g., mRNA) interferes with the normal function of the target (e.g., mRNA) to cause a loss of activity (e.g., inhibiting translation) or expression (e.g., degrading a target mRNA) and there is a sufficient degree of complementarity to avoid non-specific binding of the sequence to non-target sequences under conditions in which avoidance of non-specific binding is desired, e.g., under physiological conditions in the case of in vivo assays or therapeutic treatment, and in the case of in vitro assays, under conditions in which the assays are performed under suitable conditions of stringency.
- the target molecule e.g., mRNA
- a loss of activity e.g., inhibiting translation
- expression e.g., degrading a target m
- an oligonucleotide may be at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% complementary to the consecutive nucleotides of a target nucleic acid.
- a complementary nucleotide sequence need not be 100% complementary to that of its target to be specifically hybridizable or specific for a target nucleic acid.
- oligonucleotides comprise one or more mismatched nucleobases relative to the target nucleic acid.
- an oligonucleotide comprises region of complementarity to a target nucleic acid that is in the range of 8 to 15, 8 to 30, 8 to 40, or 10 to 50, or 5 to 50, or 5 to 40 nucleotides in length.
- an oligonucleotide comprises region of complementarity to a target nucleic acid that is in the range of 8-32, 15-29, 15-27, 21-27, 23-27 nucleotides in length. In some embodiments, an oligonucleotide comprises a region of complementarity to a target nucleic acid that is in the range of 15-29, 15-27, 15 to 20, 20 to 25, 21-27, 23-27, 25-27, or 25-32 nucleotides in length.
- a region of complementarity of an oligonucleotide to a target nucleic acid is 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 nucleotides in length.
- the region of complementarity is complementary with at least 8 consecutive nucleotides of a target nucleic acid.
- an oligonucleotide may contain 1, 2 or 3 base mismatches compared to the portion of the consecutive nucleotides of target nucleic acid.
- the oligonucleotide may have up to 3 mismatches over 15 bases, or up to 2 mismatches over 10 bases.
- an oligonucleotide comprises at least 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 consecutive nucleotides of a sequence comprising any one of SEQ ID NOs: 1575-2986 and 3027-3066.
- an oligonucleotide comprises a sequence comprising any one of SEQ ID NOs: 1575-2986 and 3027-3066.
- an oligonucleotide comprises a sequence that shares at least 70%, 75%, 80%, 85%, 90%, 95%, or 97% sequence identity with at least 12 or at least 15 consecutive nucleotides of any one of SEQ ID NOs: 1575-2986 and 3027-3066. In some embodiments, an oligonucleotide comprises at least 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 consecutive nucleotides of a sequence comprising any one of SEQ ID NOs: 3027-3066. In some embodiments, an oligonucleotide comprises a sequence comprising any one of SEQ ID NOs: 3027-3066.
- an oligonucleotide comprises a sequence that shares at least 70%, 75%, 80%, 85%, 90%, 95%, or 97% sequence identity with at least 12 or at least 15 consecutive nucleotides of any one of SEQ ID NOs: 3027-3066. [000220] In some embodiments, an oligonucleotide comprises a region of complementarity to a target sequence as set forth in any one of SEQ ID NO: 163-1574. In some embodiments, an oligonucleotide comprises a region of complementarity to a target sequence as set forth in any one of SEQ ID NO: 2987-3026.
- an oligonucleotide comprises region of complementarity that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%; 99%, or 100% complementary with at least 12 or at least 15 consecutive nucleotides of a target sequence as set forth of any one of SEQ ID NO: 163-1574. In some embodiments, an oligonucleotide comprises region of complementarity that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%; 99%, or 100% complementary with at least 12 or at least 15 consecutive nucleotides of a target sequence as set forth of any one of SEQ ID NO: 2987-3026.
- the region of complementarity is at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 19 or at least 20 nucleotides in length. In some embodiments, the region of complementarity is 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 nucleotides in length. In some embodiments, the region of complementarity is in the range of 8 to 20, 10 to 20 or 15 to 20 nucleotides in length. In some embodiments, the region of complementarity is fully complementary with all or a portion of its target sequence. In some embodiments, the region of complementarity includes 1, 2, 3 or more mismatches.
- the oligonucleotide is complementary (e.g., at least 85% at least 90%, at least 95%, or 100%) to a target sequence of any one of the oligonucleotides provided herein (e.g., the oligonucleotides listed in Table 8). In some embodiments, such target sequence is 100% complementary to the oligonucleotide listed in Table 8. In some embodiments, the oligonucleotide is complementary (e.g., at least 85% at least 90%, at least 95%, or 100%) to a target sequence of any one of the oligonucleotides provided herein (e.g., the oligonucleotides listed in Table 9).
- such target sequence is 100% complementary to the oligonucleotide listed in Table 9.
- the oligonucleotide is complementary (e.g., at least 85% at least 90%, at least 95%, or 100%) to a target sequence of any one of the oligonucleotides provided herein (e.g., the oligonucleotides comprising any one of SEQ ID NOs: 1575-2986 and 3027-3066).
- such target sequence is 100% complementary to the oligonucleotide described herein (e.g., the oligonucleotides comprising any one of SEQ ID NOs: 1575-2986 and 3027-3066).
- a nucleotide or nucleoside having a C5 methylated uracil may be equivalently identified as a thymine nucleotide or nucleoside.
- one or more of the thymine bases (T’s) in any one of the oligonucleotides provided herein may independently and optionally be uracil bases (U’s), and/or any one or more of the U’s may independently and optionally be T’s.
- oligonucleotides may exhibit one or more of the following properties: do not mediate alternative splicing; are not immune stimulatory; are nuclease resistant; have improved cell uptake compared to unmodified oligonucleotides; are not toxic to cells or mammals; have improved endosomal exit internally in a cell; minimizes TLR stimulation; or avoid pattern recognition receptors.
- Any of the modified chemistries or formats of oligonucleotides described herein can be combined with each other. For example, one, two, three, four, five, or more different types of modifications can be included within the same oligonucleotide.
- modified oligonucleotide may be used that make an oligonucleotide into which they are incorporated more resistant to nuclease digestion than the native oligodeoxynucleotide or oligoribonucleotide molecules; these modified oligonucleotides survive intact for a longer time than unmodified oligonucleotides.
- modified oligonucleotides include those comprising modified backbones, for example, modified internucleoside linkages such as phosphorothioates, phosphotriesters, methyl phosphonates, short chain alkyl or cycloalkyl intersugar linkages or short chain heteroatomic or heterocyclic intersugar linkages.
- oligonucleotides of the disclosure can be stabilized against nucleolytic degradation such as by the incorporation of a modification, e.g., a nucleotide modification.
- a modification e.g., a nucleotide modification.
- an oligonucleotide may be of up to 50 or up to 100 nucleotides in length in which 2 to 10, 2 to 15 2 ⁇ to 16, 2 to 17, 2 to 18, 2 to 19, 2 to 20, 2 to 25, 2 to 30, 2 to 40, 2 to 45, or more nucleotides of the oligonucleotide are modified nucleotides.
- the oligonucleotide may be of 8 to 30 nucleotides in length in which 2 to 10, 2 to 15 2 ⁇ to 16, 2 to 17, 2 to 18, 2 to 19, 2 to 20, 2 to 25, 2 to 30 nucleotides of the oligonucleotide are modified nucleotides.
- the oligonucleotide may be of 8 to 15 nucleotides in length in which 2 to 4, 2 to 5, 2 to 6, 2 to 7, 2 to 8, 2 to 9, 2 to 10, 2 to 11, 2 to 12, 2 to 13, 2 to 14 nucleotides of the oligonucleotide are modified nucleotides.
- the oligonucleotides may have every nucleotide except 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides modified. Oligonucleotide modifications are described further herein.
- c. Modified Nucleosides [000227]
- the oligonucleotide described herein comprises at least one nucleoside modified at the 2’ position of the sugar.
- an oligonucleotide comprises at least one 2’-modified nucleoside.
- all of the nucleosides in the oligonucleotide are 2’-modified nucleosides.
- the oligonucleotide described herein comprises one or more non-bicyclic 2’-modified nucleosides, e.g., 2’-deoxy, 2’-fluoro (2’-F), 2’-O-methyl (2’- O-Me), 2’-O-methoxyethyl (2’-MOE), 2’-O-aminopropyl (2’-O-AP), 2’-O- dimethylaminoethyl (2’-O-DMAOE), 2’-O-dimethylaminopropyl (2’-O-DMAP), 2’-O- dimethylaminoethyloxyethyl (2’-O-DMAEOE), or 2’-O-N-methylacetamido (2’-O-NMA) modified nucleoside.
- the oligonucleotide described herein comprises one or more 2’-4’ bicyclic nucleosides in which the ribose ring comprises a bridge moiety connecting two atoms in the ring, e.g., connecting the 2’-O atom to the 4’-C atom via a methylene (LNA) bridge, an ethylene (ENA) bridge, or a (S)-constrained ethyl (cEt) bridge.
- LNA methylene
- ENA ethylene
- cEt a (S)-constrained ethyl
- ENAs examples are provided in International Patent Publication No. WO 2005/042777, published on May 12, 2005, and entitled “APP/ENA Antisense”; Morita et al., Nucleic Acid Res., Suppl 1:241-242, 2001; Surono et al., Hum. Gene Ther., 15:749-757, 2004; Koizumi, Curr. Opin. Mol. Ther., 8:144-149, 2006 and Horie et al., Nucleic Acids Symp. Ser (Oxf), 49:171-172, 2005; the disclosures of which are incorporated herein by reference in their entireties.
- the oligonucleotide comprises a modified nucleoside disclosed in one of the following United States Patent or Patent Application Publications: US Patent 7,399,845, issued on July 15, 2008, and entitled “6-Modified Bicyclic Nucleic Acid Analogs”; US Patent 7,741,457, issued on June 22, 2010, and entitled “6-Modified Bicyclic Nucleic Acid Analogs”; US Patent 8,022,193, issued on September 20, 2011, and entitled “6- Modified Bicyclic Nucleic Acid Analogs”; US Patent 7,569,686, issued on August 4, 2009, and entitled “Compounds And Methods For Synthesis Of Bicyclic Nucleic Acid Analogs”; US Patent 7,335,765, issued on February 26, 2008, and entitled “Novel Nucleoside And Oligonucleotide Analogues”
- the oligonucleotide comprises at least one modified nucleoside that results in an increase in Tm of the oligonucleotide in a range of 1°C, 2 °C, 3°C, 4 °C, or 5°C compared with an oligonucleotide that does not have the at least one modified nucleoside .
- the oligonucleotide may have a plurality of modified nucleosides that result in a total increase in Tm of the oligonucleotide in a range of 2 °C, 3 °C, 4 °C, 5 °C, 6 °C, 7 °C, 8 °C, 9 °C, 10 °C, 15 °C, 20 °C, 25 °C, 30 °C, 35 °C, 40 °C, 45 °C or more compared with an oligonucleotide that does not have the modified nucleoside.
- the oligonucleotide may comprise a mix of nucleosides of different kinds.
- an oligonucleotide may comprise a mix of 2’-deoxyribonucleosides or ribonucleosides and 2’-fluoro modified nucleosides.
- An oligonucleotide may comprise a mix of deoxyribonucleosides or ribonucleosides and 2’-O-Me modified nucleosides.
- An oligonucleotide may comprise a mix of 2’-fluoro modified nucleosides and 2’-O-methyl modified nucleosides.
- An oligonucleotide may comprise a mix of bridged nucleosides and 2’- fluoro or 2’-O-methyl modified nucleosides.
- An oligonucleotide may comprise a mix of non- bicyclic 2’-modified nucleosides (e.g., 2’-O-MOE) and 2’-4’ bicyclic nucleosides (e.g., LNA, ENA, cEt).
- An oligonucleotide may comprise a mix of 2’-fluoro modified nucleosides and 2’- O-Me modified nucleosides.
- An oligonucleotide may comprise a mix of 2’-4’ bicyclic nucleosides and 2’-MOE, 2’-fluoro, or 2’-O-Me modified nucleosides.
- each nucleoside in the 5’wing region of the gapmer is a high-affinity modified nucleoside and each nucleoside in the 3’wing region of the gapmer (Z in the 5’-X-Y-Z-3′ formula) is high-affinity modified nucleoside.
- the 5’wing region of a gapmer (X in the 5’-X-Y-Z-3′ formula) comprises the same high affinity nucleosides as the 3’wing region of the gapmer (Z in the 5’-X-Y-Z-3′ formula).
- the gapmer comprises a 5’-X-Y-Z-3′ configuration, wherein X and Z are independently 2-7 (e.g., 2, 3, 4, 5, 6, or 7) nucleosides in length and Y is 6-10 (e.g., 6, 7, 8, 9, or 10) nucleosides in length, wherein at least one but not all (e.g., 1, 2, 3, 4, 5, or 6) of positions 1, 2, 3, 4, 5, 6, or 7 in X and at least one of positions but not all (e.g., 1, 2, 3, 4, 5, or 6) of positions 1, 2, 3, 4, 5, 6, or 7 in Z (the 5’ most position is position 1) is a non-bicyclic 2’-modified nucleoside (e.g., 2’-MOE or 2’-O-Me), wherein the rest of the nucleosides in both X and Z are 2’-4’ bicyclic nucleosides (e.g., LNA or cEt), and wherein each nucleoside in Y is
- a nucleosides comprise a 2′-modified nucleoside; “B” represents a 2’-4’ bicyclic nucleoside; “K” represents a constrained ethyl nucleoside (cEt); “L” represents an LNA nucleoside; and “E” represents a 2′- MOE modified ribonucleoside; “D” represents a 2’-deoxyribonucleoside; “n” represents the length of the gap segment (Y in the 5’-X-Y-Z-3′ configuration) and is an integer between 1-20.
- the sense strand of the siRNA molecule is 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, or more nucleotides in length.
- the sense strand is 8 to 50 nucleotides in length, 8 to 40 nucleotides in length, 8 to 30 nucleotides in length, 10 to 15 nucleotides in length, 10 to 20 nucleotides in length, 15 to 25 nucleotides in length, 19 to 21 nucleotides in length, 21 to 23 nucleotides in lengths.
- the sense strand is 8 to 32 nucleotides in length, 8 to 29 nucleotides in length, 8 to 27 nucleotides in length, 15 to 32 nucleotides in length, 15 to 29 nucleotides in length, 15 to 27 nucleotides in length, 21 to 31 nucleotides in length, 21 to 29 nucleotides in length, 21 to 27 nucleotides in length, 21-23 nucleotides in length, 23 to 32 nucleotides in length, 23 to 29 nucleotides in length, or 23 to 27 nucleotides in length.
- a complementary nucleotide sequence need not be 100% complementary to that of its target to be specifically hybridizable or specific for a target RNA sequence.
- siRNA molecules comprise an antisense strand that comprises a region of complementarity to a DUX4 mRNA sequence and the region of complementarity is in the range of 8 to 15, 8 to 30, 8 to 40, or 10 to 50, or 5 to 50, or 5 to 40 nucleotides in length.
- the region of complementarity comprises a nucleotide sequence that contains no more than 1, 2, 3, 4, or 5 base mismatches compared to the complementary portion of a DUX4 mRNA sequence. In some embodiments, the region of complementarity comprises a nucleotide sequence that has up to 3 mismatches over 15 bases, or up to 2 mismatches over 10 bases.
- siRNA molecules comprise an antisense strand comprising a nucleotide sequence that is complementary (e.g., at least 85%, at least 90%, at least 95%, or 100%) to a target RNA sequence as set forth in any one of SEQ ID NOs: 163- 1574.
- siRNA molecules comprise an antisense strand of 18-25 nucleotides in length and comprising at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, or at least 19 consecutive nucleotides of the oligonucleotides as set forth in any one of SEQ ID NOs: 1575-2986 and 3027-3066.
- siRNA molecules comprise an antisense strand comprising a nucleotide sequence that is at least 85%, at least 90%, at least 95%, or 100% identical to the oligonucleotides as set forth in any one of SEQ ID NOs: 3027-3066.
- Double-stranded siRNA molecules can also be assembled from a single oligonucleotide in a stem-loop structure, wherein self-complementary sense and antisense regions of the siRNA molecule are linked by means of a nucleic acid based or non-nucleic acid-based linker(s), as well as circular single-stranded RNA having two or more loop structures and a stem comprising self-complementary sense and antisense strands, wherein the circular RNA can be processed either in vivo or in vitro to generate an active siRNA molecule capable of mediating RNAi.
- Small hairpin RNA (shRNA) molecules thus are also contemplated herein.
- These molecules comprise a specific antisense sequence in addition to the reverse complement (sense) sequence, typically separated by a spacer or loop sequence. Cleavage of the spacer or loop provides a single-stranded RNA molecule and its reverse complement, such that they may anneal to form a dsRNA molecule (optionally with additional processing steps that may result in addition or removal of one, two, three or more nucleotides from the 3’ end and/or (e.g., and) the 5’ end of either or both strands).
- the overall length of the siRNA molecules can vary from about 14 to about 100 nucleotides depending on the type of siRNA molecule being designed. Generally between about 14 and about 50 of these nucleotides are complementary to the RNA target sequence, i.e. constitute the specific antisense sequence of the siRNA molecule. For example, when the siRNA is a double- or single-stranded siRNA, the length can vary from about 14 to about 50 nucleotides, whereas when the siRNA is a shRNA or circular molecule, the length can vary from about 40 nucleotides to about 100 nucleotides. [000270] An siRNA molecule may comprise a 3’ overhang at one end of the molecule.
- the siRNA molecule comprises 3’ overhangs of about 1 to about 3 (e.g., 1, 2, 3) nucleotides on both the sense strand and the antisense strand.
- the siRNA molecule comprises one or more modified nucleotides (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more).
- the siRNA molecule comprises one or more modified nucleotides and/or (e.g., and) one or more modified internucleoside linkages.
- the modified nucleotide is a modified sugar moiety (e.g. a 2’ modified nucleotide).
- the siRNA molecule comprises one or more 2’ modified nucleotides, e.g., a 2’-deoxy, 2’-fluoro (2’-F), 2’-O-methyl (2’-O- Me), 2’-O-methoxyethyl (2’-MOE), 2’-O-aminopropyl (2’-O-AP), 2’-O-dimethylaminoethyl (2’-O-DMAOE), 2’-O-dimethylaminopropyl (2’-O-DMAP), 2’-O- dimethylaminoethyloxyethyl (2’-O-DMAEOE), or 2’-O–N-methylacetamido (2’-O–NMA).
- 2’-deoxy, 2’-fluoro (2’-F 2’-O-methyl (2’-O- Me), 2’-O-methoxyethyl (2’-MOE
- 2’-O-aminopropyl (2’-O-
- the antisense strand comprises phosphorothioate internucleoside linkages. In some embodiments, the antisense strand comprises phosphorothioate internucleoside linkages between at least two nucleotides. In some embodiments, the antisense strand comprises phosphorothioate internucleoside linkages between all nucleotides. For example, in some embodiments, the antisense strand comprises modified internucleotide linkages at the first, second, and/or (e.g., and) third internucleoside linkage at the 5’ or 3’ end of the siRNA molecule.
- the sense strand comprises one or more modified nucleotides (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more).
- the sense strand comprises one or more modified nucleotides and/or (e.g., and) one or more modified internucleotide linkages.
- the modified nucleotide comprises a modified sugar moiety (e.g. a 2’ modified nucleotide).
- the sense strand comprises one or more 2’ modified nucleotides, e.g., a 2’-deoxy, 2’-fluoro (2’-F), 2’-O-methyl (2’-O- Me), 2’-O-methoxyethyl (2’-MOE), 2’-O-aminopropyl (2’-O-AP), 2’-O-dimethylaminoethyl (2’-O-DMAOE), 2’-O-dimethylaminopropyl (2’-O-DMAP), 2’-O- dimethylaminoethyloxyethyl (2’-O-DMAEOE), or 2’-O–N-methylacetamido (2’-O–NMA).
- 2’-deoxy, 2’-fluoro (2’-F 2’-O-methyl (2’-O- Me), 2’-O-methoxyethyl (2’-MOE
- 2’-O-aminopropyl (2’-O-AP
- each nucleotide of the sense strand is a modified nucleotide (e.g., a 2’- modified nucleotide).
- the sense strand comprises one or more phosphorodiamidate morpholinos.
- the sense strand is a phosphorodiamidate morpholino oligomer (PMO).
- the sense strand comprises one or more 2’-O-methyl modified nucleotides.
- the sense strand comprises one or more 2’-F modified nucleotides.
- the sense strand comprises one or more 2’-O-methyl and 2’-F modified nucleotides.
- the sense strand contains a phosphorothioate or other modified internucleotide linkage. In some embodiments, the sense strand comprises phosphorothioate internucleoside linkages. In some embodiments, the sense strand comprises phosphorothioate internucleoside linkages between at least two nucleotides. In some embodiments, the sense strand comprises phosphorothioate internucleoside linkages between all nucleotides. For example, in some embodiments, the sense strand comprises modified internucleotide linkages at the first, second, and/or (e.g., and) third internucleoside linkage at the 5’ or 3’ end of the sense strand.
- the sense strand comprises phosphodiester internucleoside linkage. In some embodiments, the sense strand does not comprise phosphorothioate internucleoside linkage. In some embodiments, the modified internucleotide linkages are phosphorus-containing linkages.
- phosphorus-containing linkages that may be used include, but are not limited to, phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphotriesters, aminoalkylphosphotriesters, methyl and other alkyl phosphonates comprising 3’alkylene phosphonates and chiral phosphonates, phosphinates, phosphoramidates comprising 3’-amino phosphoramidate and aminoalkylphosphoramidates, thionophosphoramidates, thionoalkylphosphonates, thionoalkylphosphotriesters, and boranophosphates having normal 3’-5’ linkages, 2’-5’ linked analogs of these, and those having inverted polarity wherein the adjacent pairs of nucleoside units are linked 3’-5’ to 5’-3’ or 2’-5’ to 5’-2’; see US patent nos.
- the antisense or sense strand of the siRNA molecule comprises modifications that enhance or reduce RNA-induced silencing complex (RISC) loading.
- the antisense strand of the siRNA molecule comprises modifications that enhance RISC loading.
- the sense strand of the siRNA molecule comprises modifications that reduce RISC loading and reduce off-target effects.
- the antisense strand of the siRNA molecule comprises a 2′-O- methoxyethyl (2’-MOE) modification.
- the addition of the 2′-O-methoxyethyl (2’-MOE) group at the cleavage site improves both the specificity and silencing activity of siRNAs by facilitating the oriented RNA-induced silencing complex (RISC) loading of the modified strand, as described in Song et al., (2017) Mol Ther Nucleic Acids 9:242-250, incorporated herein by reference in its entirety.
- the antisense strand of the siRNA molecule comprises a 2′-Ome-phosphorodithioate modification, which increases RISC loading as described in Wu et al., (2014) Nat Commun 5:3459, incorporated herein by reference in its entirety.
- the sense strand of the siRNA molecule comprises a 5’- morpholino, which reduces RISC loading of the sense strand and improves antisense strand selection and RNAi activity, as described in Kumar et al., (2019) Chem Commun (Camb) 55(35):5139-5142, incorporated herein by reference in its entirety.
- the sense strand of the siRNA molecule is modified with a synthetic RNA-like high affinity nucleotide analogue, Locked Nucleic Acid (LNA), which reduces RISC loading of the sense strand and further enhances antisense strand incorporation into RISC, as described in Elman et al., (2005) Nucleic Acids Res. 33(1): 439-447, incorporated herein by reference in its entirety.
- LNA Locked Nucleic Acid
- the sense strand of the siRNA molecule comprises a 5′ unlocked nucleic acic (UNA) modification, which reduce RISC loading of the sense strand and improve silencing potentcy of the antisense strand, as described in Snead et al., (2013) Mol Ther Nucleic Acids 2(7):e103, incorporated herein by reference in its entirety.
- the sense strand of the siRNA molecule comprises a 5-nitroindole modification, which descresed the RNAi potency of the sense strand and reduces off-target effects as described in Zhang et al., (2012) Chembiochem 13(13):1940-1945, incorporated herein by reference in its entirety.
- the sense strand comprises a 2’-O’methyl (2’- O-Me) modification, which reduces RISC loading and the off-target effects of the sense strand, as described in Zheng et al., FASEB (2013) 27(10): 4017-4026, incorporated herein by reference in its entirety.
- the sense strand of the siRNA molecule is fully substituted with morpholino, 2’-MOE or 2’-O-Me residues, and are not recognized by RISC as described in Kole et al., (2012) Nature reviews. Drug Discovery 11(2):125-140, incorporated herein by reference in its entirety.
- the antisense strand of the siRNA molecule comprises a 2’-MOE modification and the sense strand comprises a 2’-O-Me modification (see e.g., Song et al., (2017) Mol Ther Nucleic Acids 9:242-250).
- at least one (e.g., at least 2, at least 3, at least 4, at least 5, at least 10) siRNA molecule is linked (e.g., covalently) to a muscle-targeting agent.
- the muscle-targeting agent may comprise, or consist of, a nucleic acid (e.g., DNA or RNA), a peptide (e.g., an antibody), a lipid (e.g., a microvesicle), or a sugar moiety (e.g., a polysaccharide).
- the muscle-targeting agent is an antibody.
- the muscle-targeting agent is an anti-transferrin receptor antibody (e.g., any one of the anti-TfR antibodies provided in Tables 2-7).
- the muscle- targeting agent may be linked to the 5’ end of the sense strand of the siRNA molecule.
- the muscle-targeting agent may be linked to the 3’ end of the sense strand of the siRNA molecule. In some embodiments, the muscle-targeting agent may be linked internally to the sense strand of the siRNA molecule. In some embodiments, the muscle-targeting agent may be linked to the 5’ end of the antisense strand of the siRNA molecule. In some embodiments, the muscle-targeting agent may be linked to the 3’ end of the antisense strand of the siRNA molecule. In some embodiments, the muscle-targeting agent may be linked internally to the antisense strand of the siRNA molecule. [000284]
- Non limiting examples of DUX4-targeting siRNAs are provided in Table 8. Table 8. DUX4-targeting oligonucleotides ⁇
- Each uracil base (U) in any one of the oligonucleotides and/or target sequences provided in Table 8 may independently and optionally be replaced with a thymine base (T), and/or each T may independently and optionally be replaced with a U.
- Target sequences listed in Table 8 contain T’s, but binding of a DUX4-targeting oligonucleotide to RNA and/or DNA is contemplated.
- ⁇ Target sequence start position is in NM_001293798.2 (SEQ ID NO: 160)
- Additional non-limiting examples of further modified DUX4-targeting siRNAs are provided in Table 9.
- m indicates a 2’-O-methyl (2’-O-Me) modified nucleoside
- f indicates a 2’-fluoro (2’-F) modified nucleoside
- mxC indicates 2’-O-Me modified 5-methyl-cytidine
- fxC indicates 2’-F modified 5-methyl- cytidine
- * indicates phosphorothioate internucleoside linkage
- the absence of “*” between two nucleosides indicate phosphodiester internucleoside linkage.
- Each uracil base (U) in any one of the oligonucleotides and/or target sequences provided in Table 8 may independently and optionally be replaced with a thymine base (T), and/or each T may independently and optionally be replaced with a U.
- Target sequences listed in Table 9 contain T’s, but binding of a DUX4-targeting oligonucleotide to RNA and/or DNA is contemplated.
- a DUX4-targeting oligonucleotide comprises an antisense strand that is 18-25 nucleosides (e.g., 18, 19, 20, 21, 22, 23, 24, or 25 nucleosides) in length and comprises a region of complementarity to a target sequence as set forth in any one of SEQ ID NOs: 224-226, 261, 265, 320, 341, 343, 356, 388, 466, 483, 494, 501, 509, 552, 560, 561, 601, 921, 942, 953, 1294, 1296, 1301, 1320-1325, 1373, 1394, 1395, 1398, 1523, 1531, 1548, 1558, and 1561, wherein the region of complementarity is at least 16 nucleotides (e.g., 16, 17, 18, or 19 nucleotides) in length.
- the region of complementarity is at least 16 nucleotides (e.g., 16, 17, 18, or 19 nucleotides) in length.
- the antisense strand is 21 nucleotides in length and comprises a region of complementarity to a target sequence as set forth in any one of SEQ ID NOs: 224-226, 261, 265, 320, 341, 343, 356, 388, 466, 483, 494, 501, 509, 552, 560, 561, 601, 921, 942, 953, 1294, 1296, 1301, 1320-1325, 1373, 1394, 1395, 1398, 1523, 1531, 1548, 1558, and 1561, wherein the region of complementarity is 19 nucleotides in length.
- the region of complementarity is fully complementarity with all or a portion of its target sequence.
- a DUX4-targeting oligonucleotide comprises an antisense strand that comprises at least 15 consecutive nucleosides of (e.g., at least 15, at least 16, at least 17, at least 18, at least 19, or at least 20) the nucleotide sequence of any one of SEQ ID NOs: 3027-3066.
- a DUX4 targeting oligonucleotide further comprises a sense strand that comprises at least 15 consecutive nucleosides of (e.g., at least 15, at least 16, at least 17, at least 18, at least 19, or at least 20) the nucleotide sequence of any one of SEQ ID NOs: 2987-3026.
- a DUX4-targeting oligonucleotide comprises an antisense strand that comprises the nucleotide sequence of any one of SEQ ID NOs: 3027- 3066.
- a DUX4 targeting oligonucleotide further comprises a sense strand that comprises the nucleotide sequence of any one of SEQ ID NOs: 2987-3026.
- a DUX4-targeting oligonucleotide is a double stranded oligonucleotide (e.g., an siRNA) comprising an antisense strand that comprises the nucleotide sequence of any one of SEQ ID NOs: 3027-3066 and a sense strand that hybridizes to the antisense strand and comprises the nucleotide sequence of any one of SEQ ID NOs: 2987- 3026, wherein the antisense strand and/or (e.g., and) comprises one or more modified nucleosides (e.g., 2’-modified nucleosides).
- a DUX4-targeting oligonucleotide is a double stranded oligonucleotide (e.g., an siRNA) comprising an antisense strand that comprises the nucleotide sequence of any one of SEQ ID NOs: 3027-3066 and a sense strand that hybridizes to the antisense strand and comprises the nucleotide sequence of any one of SEQ ID NOs: 2987- 3026, wherein each nucleoside in the antisense strand and/or (e.g., and) each nucleoside in the sense strand is a 2’-modified nucleoside selected from 2’-O-Me and 2’-F modified nucleosides.
- siRNA double stranded oligonucleotide
- a DUX4-targeing oligonucleotide is a double stranded oligonucleotide (e.g., an siRNA) comprising an antisense strand that comprises the nucleotide sequence of any one of SEQ ID NOs: 3027-3066 and a sense strand that hybridizes to the antisense strand and comprises the nucleotide sequence of any one of SEQ ID NOs: 2987- 3026, wherein each nucleoside in the antisense strand and each nucleoside in the sense strand is a 2’-modified nucleoside selected from 2’-O-Me and 2’-F modified nucleosides, and wherein the antisense strand and/or (e.g., and) the sense strand each comprises one or more phosphorothioate internucleoside linkages.
- siRNA double stranded oligonucleotide
- the antisense strand of the DUX4-targeting oligonucleotide comprises a structure of (5’ to 3’): fNfNmNfNmNfNmNfNmNfNmNfNmNfNmNfNmNfNmNfNmNfNmNfNmNfNmNfNmN*fN*mN, wherein “mN” indicates 2’-O-methyl (2’-O-Me) modified nucleosides; “fN” indicates 2’-fluoro (2’-F) modified nucleosides; “*” indicates phosphorothioate internucleoside linkage; and the absence of “*” between two nucleosides indicate phosphodiester internucleoside linkage.
- one or more (e.g., 1, 2, 3, 4, 5, 6, 7 or more) of cytidines (Cs) of the sense strand and the antisense strand is a 2’-modified 5-methyl-cytidine (e.g., 2’-O-Me modified 5-methyl- cytidine or 2’-F modified 5-methyl-cytidine).
- a cytidine a CG motif of the sense and/or antisense strand is a 2’-modified 5-methyl-cytidine (e.g., 2’-O-Me modified 5-methyl-cytidine or 2’-F modified 5-methyl-cytidine).
- a cytidines of one or more (e.g., 1, 2, 3, 4) CG motifs of the sense strand is a 2’-modified 5-methyl-cytidine (e.g., 2’-O-Me modified 5- methyl-cytidine or 2’-F modified 5-methyl-cytidine).
- a cytidine of one or more (e.g., 1, 2, 3, 4) CG motifs of the antisense strand is a 2’-modified 5-methyl-cytidine (e.g., 2’-O-Me modified 5-methyl-cytidine or 2’-F modified 5-methyl-cytidine).
- a cytidine of one or more (e.g., 1, 2, 3, 4) CG motifs of the sense strand is a 2’- modified 5-methyl-cytidine (e.g., 2’-O-Me modified 5-methyl-cytidine or 2’-F modified 5- methyl-cytidine); and a cytidine of one or more (e.g., 1, 2, 3, 4) CG motifs of the antisense strand is a 2’-modified 5-methyl-cytidine (e.g., 2’-O-Me modified 5-methyl-cytidine or 2’-F modified 5-methyl-cytidine).
- the antisense strand of the DUX4-targeting oligonucleotide is selected from the modified version of SEQ ID NOs: 3027-3066 listed in Table 8. In some embodiments, the sense strand of the DUX4-targeting oligonucleotide is selected from the modified version of SEQ ID NOs: 2987-3026 listed in Table 8. In some embodiments, the DUX4-targeting oligonucleotide is a siRNA selected from the siRNAs listed in Table 8.
- the antisense strand of the DUX4-targeting oligonucleotide is selected from the modified version of any one of SEQ ID NOs: 3027, 3037, 3039, 3040, 3041, 3044, 3052, and 3061listed in Table 9.
- the sense strand of the DUX4-targeting oligonucleotide is selected from the modified version of any one of SEQ ID NOs: 2987, 2997, 2999, 3000, 3001, 3004, 3012, and 3021listed in Table 9.
- the DUX4-targeting oligonucleotide is a siRNA selected from the siRNAs listed in Table 9.
- any one of the DUX4-targeting oligonucleotides can be in salt form, e.g., as sodium, potassium, magnesium salts.
- any one of the DUX4-targeting oligonucleotides e.g., DUX4-targeting siRNAs selected from the siRNAs in Table 9 can be in salt form, e.g., as sodium, potassium, magnesium salts.
- the 5’ or 3’ nucleoside (e.g., terminal nucleoside) of any one of the oligonucleotides described herein is conjugated to an amine group, optionally via a spacer.
- the 5’ or 3’ nucleoside (e.g., terminal nucleoside) of any one of the oligonucleotides described herein is conjugated to an amine group, optionally via a spacer.
- the spacer comprises an aliphatic moiety.
- the spacer comprises a polyethylene glycol moiety.
- a phosphodiester linkage is present between the spacer and the 5’ or 3’ nucleoside of the oligonucleotide.
- the 5’ or 3’ nucleoside e.g., terminal nucleoside
- the 5’ or 3’ nucleoside of any one of the oligonucleotides described herein e.g., the oligonucleotides listed in Table 8, sense or antisense strand
- n is an integer from 1 to 12.
- the 5’ or 3’ nucleoside of any one of the oligonucleotides described herein is conjugated to a compound of the formula -NH 2 -(CH 2 ) n -, wherein n is an integer from 1 to 12. In some embodiments, n is 6, 7, 8, 9, 10, 11, or 12.
- a phosphodiester linkage is present between the compound of the formula NH 2 -(CH 2 ) n - and the 5’ or 3’ nucleoside of the oligonucleotide (e.g., the oligonucleotides listed in Table 8, sense or antisense strand). In some embodiments, a phosphodiester linkage is present between the compound of the formula NH 2 - (CH 2 ) n - and the 5’ or 3’ nucleoside of the oligonucleotide (e.g., the oligonucleotides listed in Table 9, sense or antisense strand).
- the val-cit linker after conjugation, has a structure of: [000309] In some embodiments, the Val-cit linker is attached to a reactive chemical moiety (e.g., SPAAC for click chemistry conjugation). In some embodiments, before click chemistry conjugation, the val-cit linker attached to a reactive chemical moiety (e.g., SPAAC for click chemistry conjugation) has the structure of: wherein n is any number from 0-10. In some embodiments, n is 3.
- the val-cit linker attached to a reactive chemical moiety is conjugated (e.g., via a different chemical moiety) to a molecular payload (e.g., an oligonucleotide).
- a reactive chemical moiety e.g., SPAAC for click chemistry conjugation
- conjugated to a molecular payload e.g., an oligonucleotide
- a linker is connected to an anti-TfR antibody, through a lysine or cysteine residue present on the anti-TfR antibody.
- a linker is connected to an anti-TfR antibody and/or (e.g., and) molecular payload by a cycloaddition reaction between an azide and an alkyne to form a triazole, wherein the azide and the alkyne may be located on the anti-TfR antibody, molecular payload, or the linker.
- an alkyne may be a cyclic alkyne, e.g., a cyclooctyne.
- an alkyne may be bicyclononyne (also known as bicyclo[6.1.0]nonyne or BCN) or substituted bicyclononyne.
- a cyclooctane is as described in International Patent Application Publication WO2011136645, published on November 3, 2011, entitled, “Fused Cyclooctyne Compounds And Their Use In Metal-free Click Reactions”.
- an azide may be a sugar or carbohydrate molecule that comprises an azide.
- an azide may be 6-azido-6- deoxygalactose or 6-azido-N-acetylgalactosamine.
- a sugar or carbohydrate molecule that comprises an azide is as described in International Patent Application Publication WO2016170186, published on October 27, 2016, entitled, “Process For The Modification Of A Glycoprotein Using A Glycosyltransferase That Is Or Is Derived From A ⁇ (1,4)-N-Acetylgalactosaminyltransferase”.
- a cycloaddition reaction between an azide and an alkyne to form a triazole wherein the azide and the alkyne may be located on the anti-TfR antibody, molecular payload, or the linker is as described in International Patent Application Publication WO2014065661, published on May 1, 2014, entitled, “Modified antibody, antibody-conjugate and process for the preparation thereof”; or International Patent Application Publication WO2016170186, published on October 27, 2016, entitled, “Process For The Modification Of A Glycoprotein Using A Glycosyltransferase That Is Or Is Derived From A ⁇ (1,4)-N-Acetylgalactosaminyltransferase”.
- a linker further comprises a spacer, e.g., a polyethylene glycol spacer or an acyl/carbomoyl sulfamide spacer, e.g., a HydraSpace TM spacer.
- a spacer is as described in Verkade, J.M.M. et al., “A Polar Sulfamide Spacer Significantly Enhances the Manufacturability, Stability, and Therapeutic Index of Antibody- Drug Conjugates”, Antibodies, 2018, 7, 12.
- a linker is connected to an anti-TfR antibody and/or (e.g., and) molecular payload by the Diels-Alder reaction between a dienophile and a diene/hetero-diene, wherein the dienophile and the diene/hetero-diene may be located on the anti-TfR antibody, molecular payload, or the linker.
- a linker is connected to an anti-TfR antibody and/or (e.g., and) molecular payload by other pericyclic reactions, e.g. ene reaction.
- a linker is connected to an anti-TfR antibody and/or (e.g., and) molecular payload by an amide, thioamide, or sulfonamide bond reaction.
- a linker is connected to an anti-TfR antibody and/or (e.g., and) molecular payload by a condensation reaction to form an oxime, hydrazone, or semicarbazide group existing between the linker and the anti-TfR antibody and/or (e.g., and) molecular payload.
- a linker is connected to an anti-TfR antibody and/or (e.g., and) molecular payload by a conjugate addition reactions between a nucleophile, e.g. an amine or a hydroxyl group, and an electrophile, e.g. a carboxylic acid, carbonate, or an aldehyde.
- a nucleophile e.g. an amine or a hydroxyl group
- an electrophile e.g. a carboxylic acid, carbonate, or an aldehyde.
- a nucleophile may exist on a linker and an electrophile may exist on an anti-TfR antibody or molecular payload prior to a reaction between a linker and an anti-TfR antibody or molecular payload.
- an electrophile may exist on a linker and a nucleophile may exist on an anti-TfR antibody or molecular payload prior to a reaction between a linker and an anti-TfR antibody or molecular payload.
- an electrophile may be an azide, pentafluorophenyl, a silicon centers, a carbonyl, a carboxylic acid, an anhydride, an isocyanate, a thioisocyanate, a succinimidyl ester, a sulfosuccinimidyl ester, a maleimide, an alkyl halide, an alkyl pseudohalide, an epoxide, an episulfide, an aziridine, an aryl, an activated phosphorus center, and/or (e.g., and) an activated sulfur center.
- a nucleophile may be an optionally substituted alkene, an optionally substituted alkyne, an optionally substituted aryl, an optionally substituted heterocyclyl, a hydroxyl group, an amino group, an alkylamino group, an anilido group, or a thiol group.
- the val-cit linker attached to a reactive chemical moiety e.g., SPAAC for click chemistry conjugation
- m is any number from 0-10. In some embodiments, m is 4.
- the val-cit linker attached to a reactive chemical moiety is conjugated to an anti-TfR antibody having a structure of formula (G): wherein m is any number from 0-10. In some embodiments, m is 4. It should be understood that the amide shown adjacent the anti-TfR1 antibody in Formula (G) results from a reaction with an amine of the anti-TfR1 antibody, such as a lysine epsilon amine.
- the val-cit linker attached to a reactive chemical moiety e.g., SPAAC for click chemistry conjugation
- conjugated to an anti-TfR antibody has a structure of formula (F):
- the val-cit linker that links the antibody and the molecular payload has a structure of formula (C): wherein n is any number from 0-10, wherein m is any number from 0-10. In some embodiments, n is 3 and/or (e.g., and) m is 4. In some embodiments, n is 3 and/or (e.g., and) m is 4.
- X is NH (e.g., NH from an amine group of a lysine), S (e.g., S from a thiol group of a cysteine), or O (e.g., O from a hydroxyl group of a serine, threonine, or tyrosine) of the antibody.
- the complex described herein has a structure of formula (D):
- the linkage of L1 to a 3’ phosphate of the oligonucleotide forms a phosphodiester bond between L1 and the oligonucleotide.
- L1 is optional (e.g., need not be present).
- any one of the complexes described herein has a structure of formula (E): wherein n is 0-15 (e.g., 3) and m is 0-15 (e.g., 4). C.
- Antibody-Molecular Payload Complexes comprising any one the anti-TfR antibodies described herein covalently linked to any of the molecular payloads (e.g., an oligonucleotide) described herein.
- the anti-TfR antibody (e.g., any one of the anti-TfR antibodies provided in Tables 2-7) is covalently linked to a molecular payload (e.g., an oligonucleotide comprising at least 12 (e.g., at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, or at least 19) consecutive nucleotides of the nucleotide sequence of any one of SEQ ID NOs: 163-3066) via a linker.
- a molecular payload e.g., an oligonucleotide comprising at least 12 (e.g., at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, or at least 19) consecutive nucleotides of the nucleotide sequence of any one of SEQ ID NOs: 163-3066
- the linker is linked to the 5 ⁇ end, the 3 ⁇ end, or internally of the sense strand or antisense strand.
- the molecular payload is an siRNA
- the linker is linked to the 5 ⁇ end of the sense strand.
- the linker is linked to the anti-TfR antibody via a thiol-reactive linkage (e.g., via a cysteine in the anti-TfR antibody).
- the linker e.g., a Val-cit linker
- the linker is linked to the antibody (e.g., an anti-TfR antibody described herein) via an amine group (e.g., via a lysine in the antibody).
- the molecular payload is a DUX4-targeting oligonucleotide (e.g., a DUX4-targeting oligonucleotide listed in Table 8).
- the molecular payload is a DUX4-targeting oligonucleotide (e.g., a DUX4- targeting oligonucleotide listed in Table 9).
- the molecular payload is the sense strand of a DUX4 targeting siRNA. In some embodiments, the molecular payload is the antisense strand of a DUX4 targeting siRNA. In some embodiments, the molecular payload is a DUX4 targeting siRNA comprising a sense strand and an antisense strand.
- a structure of a complex comprising an anti-TfR antibody covalently linked to a molecular payload via a Val-cit linker is provided below: wherein the linker is linked to the antibody via a thiol-reactive linkage (e.g., via a cysteine in the antibody).
- the molecular payload is an oligonucleotide comprising at least 12 (e.g., at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, or at least 19) consecutive nucleotides of the nucleotide sequence of any one of SEQ ID NOs: 163-3066. In some embodiments, the molecular payload is an oligonucleotide comprising the nucleotide sequence of any one of SEQ ID NOs: 163-3066.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 8), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 8, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 9), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 9, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- n is a number between 0-10
- m is a number between 0-10
- the linker is linked to the antibody via an amine group (e.g., on a lysine residue), and/or (e.g., and) wherein the linker is linked to the sense strand or the antisense strand (e.g., at the 5’ end, 3’ end, or internally).
- the linker is linked to the antibody via a lysine, the linker is linked to the oligonucleotide at the 5’ end, n is 3, and m is 4.
- the molecular payload is an oligonucleotide comprising at least 12 (e.g., at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, or at least 19) nucleotides of the nucleotide sequence of any one of SEQ ID NOs: 163-3066.
- the molecular payload is an oligonucleotide comprising the nucleotide sequence of any one of SEQ ID NOs: 163-3066.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 8), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 8, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 9), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 9, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- L1 is any one of the spacers described herein.
- antibodies can be linked to molecular payloads with different stochiometries, a property that may be referred to as a drug to antibody ratios (DAR) with the “drug” being the molecular payload.
- DAR drug to antibody ratios
- three molecular payloads 3).
- the complex described herein comprises an anti- TfR antibody described herein (e.g., the antibodies provided in Tables 2-7) covalently linked to molecular payload via a linker (e.g., a Val-cit linker).
- a linker e.g., a Val-cit linker
- the linker is linked to the antibody (e.g., an anti-TfR antibody described herein) via a thiol-reactive linkage (e.g., via a cysteine in the antibody).
- the molecular payload is an oligonucleotide comprising the nucleotide sequence of any one of SEQ ID NOs: 163- 3066.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence as set forth in any one of SEQ ID NOs: 163-1574), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences as set forth in any one of SEQ ID NOs: 1575-1986, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 8), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 8, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4- targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 9), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 9, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the complex described herein comprises an anti-TfR antibody covalently linked to a molecular payload, wherein the anti-TfR antibody comprises a CDR-H1, a CDR-H2, a CDR-H3, a CDR-L1, a CDR-L2, and a CDR-L3 of any one of the antibodies listed in Table 2.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence as set forth in any one of SEQ ID NOs: 163-1574), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences as set forth in any one of SEQ ID NOs: 1575-1986, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 8), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 8, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 9), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 9, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the complex described herein comprises an anti-TfR antibody covalently linked to a molecular payload, wherein the anti-TfR antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 69, SEQ ID NO: 71, or SEQ ID NO: 72, and a VL comprising the amino acid sequence of SEQ ID NO: 70.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence as set forth in any one of SEQ ID NOs: 163-1574), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences as set forth in any one of SEQ ID NOs: 1575-1986, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 8), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 8, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 9), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 9, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the complex described herein comprises an anti-TfR antibody covalently linked to a molecular payload, wherein the anti-TfR antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 73 or SEQ ID NO: 76, and a VL comprising the amino acid sequence of SEQ ID NO: 74.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 8), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 8, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 9), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 9, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the complex described herein comprises an anti-TfR antibody covalently linked to a molecular payload, wherein the anti-TfR antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 73 or SEQ ID NO: 76, and a VL comprising the amino acid sequence of SEQ ID NO: 75.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence as set forth in any one of SEQ ID NOs: 163-1574), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences as set forth in any one of SEQ ID NOs: 1575-1986, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 9), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 9, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the complex described herein comprises an anti-TfR antibody covalently linked to a molecular payload, wherein the anti-TfR antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 154, and a VL comprising the amino acid sequence of SEQ ID NO: 155.
- the molecular payload is a DUX4- targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence as set forth in any one of SEQ ID NOs: 163-1574), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences as set forth in any one of SEQ ID NOs: 1575-1986, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide (e.g., a DUX4-targeting oligonucleotide listed in Table 8). In some embodiments, the molecular payload is a DUX4-targeting oligonucleotide (e.g., a DUX4- targeting oligonucleotide listed in Table 9).
- the complex described herein comprises an anti-TfR antibody covalently linked to a molecular payload, wherein the anti-TfR antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 84, SEQ ID NO: 86 or SEQ ID NO: 87 and a light chain comprising the amino acid sequence of SEQ ID NO: 85.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence as set forth in any one of SEQ ID NOs: 163- 1574), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences as set forth in any one of SEQ ID NOs: 1575-1986, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the complex described herein comprises an anti-TfR antibody covalently linked to a molecular payload, wherein the anti-TfR antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 88 or SEQ ID NO: 91, and a light chain comprising the amino acid sequence of SEQ ID NO: 89.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence as set forth in any one of SEQ ID NOs: 163-1574), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences as set forth in any one of SEQ ID NOs: 1575-1986, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 8), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 8, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 9), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 9, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence as set forth in any one of SEQ ID NOs: 163-1574), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences as set forth in any one of SEQ ID NOs: 1575-1986, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 8), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 8, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 9), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 9, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence as set forth in any one of SEQ ID NOs: 163-1574), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences as set forth in any one of SEQ ID NOs: 1575-1986, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 8), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 8, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the complex described herein comprises an anti-TfR antibody covalently linked to a molecular payload, wherein the anti-TfR antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 156, and a light chain comprising the amino acid sequence of SEQ ID NO: 157.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence as set forth in any one of SEQ ID NOs: 163-1574), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences as set forth in any one of SEQ ID NOs: 1575-1986, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 8), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 8, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 9), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 9, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the complex described herein comprises an anti-TfR antibody covalently linked to a molecular payload, wherein the anti-TfR antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 97, SEQ ID NO: 98, or SEQ ID NO: 99 and a VL comprising the amino acid sequence of SEQ ID NO: 85.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence as set forth in any one of SEQ ID NOs: 163- 1574), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences as set forth in any one of SEQ ID NOs: 1575-1986, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4- targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 8), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 8, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 9), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 9, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the complex described herein comprises an anti-TfR antibody covalently linked to a molecular payload, wherein the anti-TfR antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 100 or SEQ ID NO: 101 and a light chain comprising the amino acid sequence of SEQ ID NO: 89.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence as set forth in any one of SEQ ID NOs: 163-1574), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences as set forth in any one of SEQ ID NOs: 1575-1986, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 8), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 8, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the complex described herein comprises an anti-TfR antibody covalently linked to a molecular payload, wherein the anti-TfR antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 100 or SEQ ID NO: 101 and a light chain comprising the amino acid sequence of SEQ ID NO: 90.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence as set forth in any one of SEQ ID NOs: 163-1574), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences as set forth in any one of SEQ ID NOs: 1575-1986, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 9), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 9, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the complex described herein comprises an anti-TfR antibody covalently linked to a molecular payload, wherein the anti-TfR antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 102 and a light chain comprising the amino acid sequence of SEQ ID NO: 93.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 8), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 8, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the complex described herein comprises an anti-TfR antibody covalently linked to a molecular payload, wherein the anti-TfR antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 102 or SEQ ID NO: 103 and a light chain comprising the amino acid sequence of SEQ ID NO: 95.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence as set forth in any one of SEQ ID NOs: 163-1574), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences as set forth in any one of SEQ ID NOs: 1575-1986, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the molecular payload is a DUX4-targeting oligonucleotide comprising an antisense strand comprising a region of complementarity of at least 16 nucleotides to a target sequence in DUX4 mRNA (e.g., a target sequence listed in Table 8), optionally wherein the antisense strand comprising at least 16 consecutive nucleotides of any one of the antisense sequences listed in Table 8, optionally wherein the DUX4 targeting oligonucleotide further comprises a sense strand that hybridizes to the antisense strand.
- the anti-TfR antibody is linked to the molecular payload having a structure of formula (C): wherein n is 3, m is 4, X is NH (e.g., NH from an amine group of a lysine), and L1 is any one of the spacers described herein.
- the complex described herein comprises an anti-TfR antibody covalently linked to the 3’ or 5’ end of a DUX4-targeting oligonucleotide (e.g., the sense or antisense strand of a DUX4-targeting oligonucleotide listed in Table 8) via a lysine in the anti-TfR antibody, wherein the anti-TfR antibody comprises a CDR-H1, a CDR-H2, a CDR-H3, a CDR-L1, a CDR-L2, and a CDR-L3 of any one of the antibodies listed in Table 2, wherein the complex has a structure of formula (D): wherein n is 3 and m is 4, and wherein L1 is any one of the spacers described herein.
- D structure of formula (D): wherein n is 3 and m is 4, and wherein L1 is any one of the spacers described herein.
- L1 is [000364]
- the complex described herein comprises an anti-TfR antibody that is a Fab covalently linked to the 3’ or 5’ end of a DUX4-targeting oligonucleotide (e.g., the sense or antisense strand of a DUX4-targeting oligonucleotide listed in Table 8) via a lysine in the anti-TfR Fab, wherein the anti-TfR Fab comprises a heavy chain and light chain of any one of the antibodies listed in Table 5, wherein the complex has a structure of formula (D):
- the anti-TfR antibody is covalently linked to the 5’ end of the sense strand of a DUX4-targeting oligonucleotide. In some embodiments, the anti-TfR antibody is covalently linked to the 3’ end of the sense strand of a DUX4-targeting oligonucleotide. In some embodiments, [000365] In some embodiments, L1 is linked to a 3’ phosphate of the oligonucleotide.
- the complex described herein comprises an anti-TfR antibody covalently linked to the 3’ or 5’ end of a DUX4-targeting oligonucleotide (e.g., the sense or antisense strand of a DUX4-targeting oligonucleotide listed in Table 9) via a lysine in the anti-TfR antibody, wherein the anti-TfR antibody comprises a CDR-H1, a CDR-H2, a CDR-H3, a CDR-L1, a CDR-L2, and a CDR-L3 of any one of the antibodies listed in Table 2, wherein the complex has a structure of formula (D): wherein n is 3 and m is 4, and wherein L1 is any one of the spacers described herein.
- D structure of formula (D): wherein n is 3 and m is 4, and wherein L1 is any one of the spacers described herein.
- the complex described herein comprises an anti-TfR antibody covalently linked to the 3’ or 5’ end of a DUX4-targeting oligonucleotide (e.g., the sense or antisense strand of a DUX4-targeting oligonucleotide listed in Table 9) via a lysine in the anti-TfR antibody, wherein the anti-TfR antibody comprises a VH and VL of any one of the antibodies listed in Table 3, wherein the complex has a structure of formula (D): wherein n is 3 and m is 4, and wherein L1 is any one of the spacers described herein.
- D structure of formula (D): wherein n is 3 and m is 4, and wherein L1 is any one of the spacers described herein.
- the anti-TfR antibody is covalently linked to the 5’ end of the sense strand of a DUX4-targeting oligonucleotide. In some embodiments, the anti-TfR antibody is covalently linked to the 3’ end of the sense strand of a DUX4-targeting oligonucleotide.
- the complex described herein comprises an anti-TfR antibody covalently linked to the 3’ or 5’ end of a DUX4-targeting oligonucleotide (e.g., the sense or antisense strand of a DUX4-targeting oligonucleotide listed in Table 9) via a lysine in the anti-TfR antibody, wherein the anti-TfR antibody comprises a heavy chain and light chain of any one of the antibodies listed in Table 4, wherein the complex has a structure of formula (D):
- the complex described herein comprises an anti-TfR antibody that is a Fab covalently linked to the 3’ or 5’ end of a DUX4-targeting oligonucleotide (e.g., the sense or antisense strand of a DUX4-targeting oligonucleotide listed in Table 9) via a lysine in the anti-TfR Fab, wherein the anti-TfR Fab comprises a heavy chain and light chain of any one of the antibodies listed in Table 5, wherein the complex has a structure of formula (D): wherein n is 3 and m is 4, and wherein L1 is any one of the spacers described herein.
- D structure of formula (D): wherein n is 3 and m is 4, and wherein L1 is any one of the spacers described herein.
- the anti-TfR antibody is covalently linked to the 5’ end of the sense strand of a DUX4-targeting oligonucleotide. In some embodiments, the anti-TfR antibody is covalently linked to the 3’ end of the sense strand of a DUX4-targeting oligonucleotide.
- the complex described herein comprises an anti-TfR antibody covalently linked to the 3’ or 5’ end of a DUX4-targeting oligonucleotide (e.g., the sense or antisense strand of a DUX4-targeting oligonucleotide listed in Table 8 or Table 9) via a lysine in the anti-TfR antibody, wherein the anti-TfR antibody comprises: (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 27, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 28, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 29, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 30, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 31, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 32; (ii) a CDR-H1 comprising the amino acid sequence of S
- the anti-TfR antibody is covalently linked to the 5’ end of the sense strand of a DUX4-targeting oligonucleotide. In some embodiments, the anti-TfR antibody is covalently linked to the 3’ end of the sense strand of a DUX4-targeting oligonucleotide.
- the complex described herein comprises an anti-TfR antibody covalently linked to the 3’ or 5’ end of a DUX4-targeting oligonucleotide (e.g., the sense or antisense strand of a DUX4-targeting oligonucleotide listed in Table 8 or Table 9) via a lysine in the anti-TfR antibody, wherein the anti-TfR antibody a VH comprising the amino acid sequence of SEQ ID NO: 76, and a VL comprising the amino acid sequence of SEQ ID NO: 75, wherein the complex has a structure of formula (D): wherein n is 3 and m is 4, and wherein L1 is any one of the spacers described herein.
- D formula
- the anti-TfR antibody is covalently linked to the 5’ end of the sense strand of a DUX4-targeting oligonucleotide. In some embodiments, the anti-TfR antibody is covalently linked to the 3’ end of the sense strand of a DUX4-targeting oligonucleotide.
- the complex described herein comprises an anti-TfR antibody that is a Fab covalently linked to the 3’ or 5’ end of a DUX4-targeting oligonucleotide (e.g., the sense or antisense strand of a DUX4-targeting oligonucleotide listed in Table 8 or Table 9) via a lysine in the anti-TfR Fab, wherein the anti-TfR Fab comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 101 and a light chain comprising the amino acid sequence of SEQ ID NO: 90, wherein the complex has a structure of formula (D):
- the linkage of L1 to a 5’ phosphate of the oligonucleotide forms a phosphodiester bond between L1 and the oligonucleotide.
- L1 is linked to a 3’ phosphate of the oligonucleotide.
- the linkage of L1 to a 3’ phosphate of the oligonucleotide forms a phosphodiester bond between L1 and the oligonucleotide.
- complexes can be delivered to a subject using a formulation that minimizes degradation, facilitates delivery and/or (e.g., and) uptake, or provides another beneficial property to the complexes in the formulation.
- compositions comprising complexes and pharmaceutically acceptable carriers. Such compositions can be suitably formulated such that when administered to a subject, either into the immediate environment of a target cell or systemically, a sufficient amount of the complexes enter target muscle cells.
- complexes are formulated in buffer solutions such as phosphate-buffered saline solutions, liposomes, micellar structures, and capsids.
- compositions may include separately one or more components of complexes provided herein (e.g., muscle-targeting agents, linkers, molecular payloads, or precursor molecules of any one of them).
- complexes are formulated in water or in an aqueous solution (e.g., water with pH adjustments).
- complexes are formulated in basic buffered aqueous solutions (e.g., PBS).
- formulations as disclosed herein comprise an excipient.
- an excipient confers to a composition improved stability, improved absorption, improved solubility and/or (e.g., and) therapeutic enhancement of the active ingredient.
- an excipient in a composition comprising a complex, or component thereof, described herein may be a lyoprotectant (e.g., mannitol, lactose, polyethylene glycol, or polyvinyl pyrolidone), or a collapse temperature modifier (e.g., dextran, ficoll, or gelatin).
- a pharmaceutical composition is formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous administration. Typically, the route of administration is intravenous or subcutaneous.
- compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
- formulations include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, and sodium chloride in the composition.
- Sterile injectable solutions can be prepared by incorporating the complexes in a required amount in a selected solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
- a composition may contain at least about 0.1% of the complex, or component thereof, or more, although the percentage of the active ingredient(s) may be between about 1% and about 80% or more of the weight or volume of the total composition.
- Factors such as solubility, bioavailability, biological half-life, route of administration, product shelf life, as well as other pharmacological considerations will be contemplated by one skilled in the art of preparing such pharmaceutical formulations, and as such, a variety of dosages and treatment regimens may be desirable.
- an effective amount of a pharmaceutical composition that comprises a complex comprising a muscle-targeting agent covalently linked to a molecular payload can be administered to a subject in need of treatment.
- a pharmaceutical composition comprising a complex as described herein may be administered by a suitable route, which may include intravenous administration, e.g., as a bolus or by continuous infusion over a period of time.
- intravenous administration may be performed by intramuscular, intraperitoneal, intracerebrospinal, subcutaneous, intra-articular, intrasynovial, or intrathecal routes.
- a pharmaceutical composition may be in solid form, aqueous form, or a liquid form.
- an aqueous or liquid form may be nebulized or lyophilized.
- a nebulized or lyophilized form may be reconstituted with an aqueous or liquid solution.
- Compositions for intravenous administration may contain various carriers such as vegetable oils, dimethylactamide, dimethyformamide, ethyl lactate, ethyl carbonate, isopropyl myristate, ethanol, and polyols (glycerol, propylene glycol, liquid polyethylene glycol, and the like).
- water soluble antibodies can be administered by the drip method, whereby a pharmaceutical formulation containing the antibody and a physiologically acceptable excipients is infused.
- Physiologically acceptable excipients may include, for example, 5% dextrose, 0.9% saline, Ringer’s solution or other suitable excipients.
- Intramuscular preparations e.g., a sterile formulation of a suitable soluble salt form of the antibody, can be dissolved and administered in a pharmaceutical excipient such as Water-for- Injection, 0.9% saline, or 5% glucose solution.
- a pharmaceutical composition that comprises a complex comprising a muscle-targeting agent covalently linked to a molecular payload is administered via site-specific or local delivery techniques. Examples of these techniques include implantable depot sources of the complex, local delivery catheters, site specific carriers, direct injection, or direct application.
- a pharmaceutical composition that comprises a complex comprising a muscle-targeting agent covalently linked to a molecular payload is administered at an effective concentration that confers therapeutic effect on a subject.
- Effective amounts vary, as recognized by those skilled in the art, depending on the severity of the disease, unique characteristics of the subject being treated, e.g. age, physical conditions, health, or weight, the duration of the treatment, the nature of any concurrent therapies, the route of administration and related factors. These related factors are known to those in the art and may be addressed with no more than routine experimentation.
- an effective concentration is the maximum dose that is considered to be safe for the patient. In some embodiments, an effective concentration will be the lowest possible concentration that provides maximum efficacy.
- Empirical considerations e.g. the half-life of the complex in a subject, generally will contribute to determination of the concentration of pharmaceutical composition that is used for treatment.
- the frequency of administration may be empirically determined and adjusted to maximize the efficacy of the treatment.
- an initial candidate dosage may be about 1 to 100 mg/kg, or more, depending on the factors described above, e.g. safety or efficacy.
- a treatment will be administered once.
- a treatment will be administered daily, biweekly, weekly, bimonthly, monthly, or at any time interval that provide maximum efficacy while minimizing safety risks to the subject.
- the efficacy and the treatment and safety risks may be monitored throughout the course of treatment.
- the efficacy of treatment may be assessed using any suitable methods.
- the efficacy of treatment may be assessed by evaluation of observation of symptoms associated with FSHD including muscle mass loss and muscle atrophy, primarily in the muscles of the face, shoulder blades, and upper arms.
- a pharmaceutical composition that comprises a complex comprising a muscle-targeting agent covalently linked to a molecular payload described herein is administered to a subject at an effective concentration sufficient to inhibit activity or expression of a target gene by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or at least 95% relative to a control, e.g. baseline level of gene expression prior to treatment.
- a single dose or administration of a pharmaceutical composition that comprises a complex comprising a muscle-targeting agent covalently linked to a molecular payload described herein to a subject is sufficient to inhibit activity or expression of a target gene for at least 1-5, 1-10, 5-15, 10-20, 15-30, 20-40, 25-50, or more days.
- a single dose or administration of a pharmaceutical composition that comprises a complex comprising a muscle-targeting agent covalently linked to a molecular payload described herein to a subject is sufficient to inhibit activity or expression of a target gene for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 weeks.
- the other therapeutic agents may function to treat a different symptom or disease than the complexes described herein.
- Example 1 Targeting gene expression with transfected antisense oligonucleotides
- a siRNA that targets hypoxanthine phosphoribosyltransferase (HPRT) was tested in vitro for its ability to reduce expression levels of HPRT in an immortalized cell line. Briefly, Hepa 1-6 cells were transfected with either a control siRNA (siCTRL; 100 nM) or the siRNA that targets HPRT (siHPRT; 100 nM), formulated with lipofectamine 2000. HPRT expression levels were evaluated 48 hours following transfection.
- siCTRL hypoxanthine phosphoribosyltransferase
- DTX-A-002 is RI7217 anti-TfR1 Fab.
- the GMBS linker was dissolved in dry DMSO and coupled to the 3’ end of the sense strand of siHPRT through amide bond formation under aqueous conditions. Completion of the reaction was verified by Kaiser test. Excess linker and organic solvents were removed by gel permeation chromatography. The purified, maleimide functionalized sense strand of siHPRT was then coupled to DTX-A-002 antibody using a Michael addition reaction.
- the product of the antibody coupling reaction was then subjected to hydrophobic interaction chromatography (HIC-HPLC).
- antiTfR-siHPRT complexes comprising one or two siHPRT molecules covalently attached to DTX-A-002 antibody were purified. Densitometry confirmed that the purified sample of complexes had an average siHPRT to antibody ratio of 1.46. SDS-PAGE analysis demonstrated that >90% of the purified sample of complexes comprised DTX-A-002 linked to either one or two siHPRT molecules. [000398] Using the same methods as described above, a control IgG2a-siHPRT complex was generated comprising the HPRT siRNA used in Example 1 (siHPRT) covalently linked via the GMBS linker to an IgG2a (Fab) antibody (DTX-A-003).
- Hepa 1-6 cells which have relatively high expression levels of transferrin receptor, were incubated in the presence of vehicle (phosphate-buffered saline), IgG2a-siHPRT (100 nM), antiTfR-siCTRL (100 nM), or antiTfR-siHPRT (100 nM), for 72 hours. After the 72 hour incubation, the cells were isolated and assayed for expression levels of HPRT (FIG. 2). Cells treated with the antiTfR-siHPRT demonstrated a reduction in HPRT expression by ⁇ 50% relative to the cells treated with the vehicle control and to those treated with the IgG2a-siHPRT complex.
- vehicle phosphate-buffered saline
- IgG2a-siHPRT 100 nM
- antiTfR-siCTRL 100 nM
- antiTfR-siHPRT 100 nM
- Example 3 Targeting HPRT in mouse muscle tissues with a muscle-targeting complex [000400] The muscle-targeting complex described in Example 2, antiTfR-siHPRT, was tested for inhibition of HPRT in mouse tissues.
- Example 4 DUX4 Targeting siRNAs
- siRNAs targeting DUX4 reference mRNA were designed.
- the reference DUX4 mRNA is NM_001293798.2 (SEQ ID NO: 160).
- the target regions include 19 consecutive nucleotides of the reference DUX4 mRNA.
- the target sequences are set forth in SEQ ID NOs: 163-1574 and the antisense sequences targeting these target sequences are set forth in SEQ ID NOs: 1575-2986.
- SEQ ID NOs: 163-1574 The target sequences are set forth in SEQ ID NOs: 163-1574 and the antisense sequences targeting these target sequences are set forth in SEQ ID NOs: 1575-2986.
- In silico analysis was performed on the designed sequences and various parameters were applied to select the candidate target and antisense sequences for subsequent siRNA design. Forty siRNAs were designed for subsequent studies and are listed in Table 8. The forty synthesized siRNAs contain 2’-O-methyl (2’-O-Me) and 2’-fluoro (2’-F) modifications with phosphorothioate internucleoside linkages.
- a DualGlo reporter-plasmid was designed for screening the siRNAs.
- the plasmid contains coding sequence for the human DUX4 mRNA in the 3’-UTR of a reporter luciferase.
- a reporter luciferase The plasmid contains coding sequence for the human DUX4 mRNA in the 3’-UTR of a reporter luciferase.
- Each of the 40 siRNAs (at a concentration of 2 nM or 10 nM) and the DualGlo reporter plasmid were cotransfected into Hepa1-6 cells. All transfections were conducted in quadruplicate for each data point. Twenty-four hours post transfection, Renilla luciferase and Firefly luciferase (to normalize for transfection efficacy) activity were determined. siRNAs activities were calculated relative to the cells treated with control siRNAs. The knockdown activity of each siRNA is shown in FIG. 5A. The siRNA numbers in FIG.
- siRNA No. 9 correspond to the siRNA numbers in Table 8.
- siRNA No. 9 corresponding to siRNA9 in Table 8 using the same assay described above but using 10 different siRNA concentrations (0.38 pM, 1.52 pM, 6.10 pM, 24.41 pM, 97.65 pM, 0.39 nM, 1.56 nM, 6.25 nM, 25 nM, 100 nM).
- siRNA9 has an IC50 value of 176 pM. (FIG. 5B).
- Example 5 Activities of DUX4-targeting siRNAs in FSHD Patient Myotubes [000409] DUX4-targeting siRNAs were tested for their activities in knocking down MBD3L2 mRNA in FSHD patient myotubes. MBD3L2 is a DUX4 transcriptome marker.
- cDNA was obtained from cells with the TaqMan Fast Advanced Cells-to-Ct Kit (Thermo Fisher Scientific), and levels of three DUX4 transcriptome markers MBD3L2 (Hs00544743_m1), TRIM43 (Hs00299174_m1), ZSCAN4 (Hs00537549_m1), and RPL13A (Hs04194366_g1) were analyzed via qPCR with specific TaqMan assays (Thermo Fisher Scientific). Two-step amplification reactions and fluorescence measurements for determination of cycle threshold (Ct) were conducted on a QuantStudio 7 instrument (Thermo Fisher Scientific).
- siRNA and antibody conjugation protocol for Example 6 [000412] The following protocol was used to make the siRNA conjugates tested in Example 6. Conjugates containing siRNA9, siRNA14, siRNA35 (corresponding to the siRNA9, siRNA14, and siRNA35 in Table 8) covalently linked to an anti-TfR Fab 3M12 VH4/V ⁇ 3 were generated. The conjugates may be generated by a 1-step reaction or a 2-step reaction as shown below.
- the antibody-BCN intermediate was then purified using NAP TM columns and eluted into PBS.
- the sense strand of each tested siRNA was dissolved in water to a concentration of 50 mg/ml (concentration confirmed with UV absorbance).
- 4x azide-linker (20 mg/ml in DMA), 50x Tributylamine (4.2M), and 70% DMA were added into the sense strand solution and incubated at room temperature overnight to generate the azido-sense strand intermediate. After incubation, 1/10 volume of 3M NaCl and 3 volume of cold isopropanol alcohol (IPA) were added into the reaction mixtures.
- IPA cold isopropanol alcohol
- the reaction mixtures were placed in a -80 °C freezer for 30 minutes, followed by spinning at 4500 rpm for 25 minutes.
- Pellets containing the azido- sense strand intermediate were washed two times with 70% ethanol (pellets were lifted with pipette tips during washing), dissolved in PBS to a final concentration of about 40 mg/ml (concentration confirmed with UV absorbance).
- the antisense strand of each tested siRNA was dissolved in PBS to a concentration of 50 mg/ml (concentration confirmed with UV absorbance.
- the azide-sense strand intermediate and the corresponding antisense strand were mixed at a 1:1 ratio.
- annealing For annealing, 300-500 ml of water were heated to boiling in a glass beaker and the tubes containing the azide-sense strand intermediate and antisense strand mixture were placed into the boiling water bath for 5 minutes, and left in the water bath as it cooled down on the bench to room temperature. The annealing efficiencies for each siRNA were measured with a UPLC SEC column.
- the anti-TfR Fab 3M12 VH4/V ⁇ 3-BCN intermediate (at a concentration of 4-5 mg/ml in PBS as measured by UV-Vis) was mixed with 1.5x (targeting DAR1) of the azide-siRNA duplex intermediate, and incubated at room temperature overnight to generate the anti-TfR Fab-siRNA conjugates.
- the sense strand of each tested siRNA was dissolved in water to a concentration of 50 mg/ml (concentration confirmed with UV absorbance).
- 4x azide-linker (20 mg/ml in DMA), 50x Tributylamine (4.2M), and 70% DMA were added into the sense strand solution and incubated at room temperature overnight to generate the azido-sense strand intermediate. After incubation, 1/10 volume of 3M NaCl and 3 volume of cold isopropanol alcohol (IPA) were added into the reaction mixtures.
- the reaction mixtures were placed in a -80 °C freezer for 30 minutes, followed by spinning at 4500 rpm for 25 minutes.
- annealing For annealing, 300-500 ml of water were heated to boiling in a glass beaker and the tubes containing the azide-sense strand intermediate and antisense strand mixture were placed into the boiling water bath for 5 minutes, and left in the water bath as it cooled down on the bench to room temperature. The annealing efficiencies for each siRNA were measured with an UPLC SEC column. [000420] To generate the BCN-azide-siRNA duplex intermediate, azide-siRNA duplex intermediate solution in 30 mM MES, pH 5.0 was slowly added into the same volume of DMA on ice.
- the pellets containing the BCN-azide-siRNA duplex intermediate were washed two times with 70% ethanol (pellets were lifted with pipette tips during washing), dissolved in 20 mM MES, pH 5.0, to a concentration of about 20 mg/ml (concentration confirmed by UV absorbance).
- the anti-TfR Fab 3M12 VH4/V ⁇ 3 was mixed with 1x (targeting DAR1) of the BCN-azide-siRNA duplex intermediate and incubated at room temperature overnight to generate the anti-TfR Fab-siRNA conjugates.
- TSKgel superQ-5PW column [000423] The anti-TfR Fab-siRNA conjugates generated using either the two-step reaction or the one-step reaction were purified using the methods below. [000424] The crude conjugation reaction products in 50 mM EPPS, pH of 8.0 were diluted with 5 column volume (cv) of 10 mM Tris, pH of 8.0. The sample was loaded at 0.5 ml/minute onto a 1 ml TSKgel superQ-5PW column at less than 10 mg of conjugate per ml of resin. The column was washed with Buffer A (20mM Tris, pH8.0) for 5-6 cv at 1 ml/minute.
- Buffer A (20mM Tris, pH8.0
- the conjugates were then eluted with 15-20 cv of an elution buffer containing 79% of Buffer A (20 mM Tris, pH8.0) and 21% Buffer B (20mM Tris, pH8.0 + 1.5M NaCl) at 1 ml/minute.
- Buffer A (20 mM Tris, pH8.0
- Buffer B (20mM Tris, pH8.0 + 1.5M NaCl)
- the complex of embodiment 1 or embodiment 2, wherein the antisense strand comprises the nucleotide sequence of any one of SEQ ID NOs: 1575-2986 and 3027-3066. 4. The complex of embodiment 1 or embodiment 2, wherein the antisense strand comprises the nucleotide sequence of any one of SEQ ID NOs: 3027-3066. 5. The complex of any one of embodiments 1-4, wherein the RNAi oligonucleotide further comprises a sense strand which comprises at least 18 consecutive nucleosides complementary to the antisense strand. 6. The complex of any one of embodiment 1-5, wherein the RNAi oligonucleotide comprises one or more modified nucleosides. 7.
- each 2’ modified nucleotide is 2′-O-methyl or 2’-fluoro (2′-F).
- the RNAi oligonucleotide comprises one or more phosphorothioate internucleoside linkages.
- the one or more phosphorothioate internucleoside linkage are present on the antisense strand of the RNAi oligonucleotide.
- the two internucleoside linkages at the 3’ end of the antisense strands are phosphorothioate internucleoside linkages. 12.
- RNAi oligonucleotide is a siRNA molecule selected from the siRNAs listed in Table 8.
- the anti-TfR antibody comprises a heavy chain complementarity determining region 1 (CDR-H1), a heavy chain complementarity determining region 2 (CDR-H2), a heavy chain complementarity determining region 3 (CDR-H3), a light chain complementarity determining region 1 (CDR-L1), a light chain complementarity determining region 2 (CDR-L2), a light chain complementarity determining region 3 (CDR-L3) of any of the anti-TfR antibodies listed in Table 2.
- CDR-H1 heavy chain complementarity determining region 1
- CDR-H2 heavy chain complementarity determining region 2
- CDR-H3 heavy chain complementarity determining region 3
- the complex of any one of embodiments 1-17, wherein the muscle targeting agent and the antisense oligonucleotide are covalently linked via a linker, optionally wherein the linker comprises a valine-citrulline dipeptide. 19.
- siRNA oligonucleotide selected from: Antisense strand: 5’-fUfCmCfGmCfUmCfAmAfAmGfCmAfGmGfCmUfCmGfCmA*fG*mG- 3’ (SEQ ID NO: 3031) Sense strand: 5’-mUmGfCmGfAmGfCmCfUmGfCmUfUmUfGmAfGmCfGmGfA-3’ (SEQ ID NO: 2991); Antisense strand: 5’-fAfCmCfAmAfAmUfCmUfGmGfAmCfCmCfUmGfGmGfCmU*fC*mC- 3’ (SEQ ID NO: 3034) Sense strand: 5’-mAmGfCmCfCmAfGmGfGmUfCmCfAmGfAmUfUmUfGmGfU-3
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Biochemistry (AREA)
- Epidemiology (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Biophysics (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Neurology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Physical Education & Sports Medicine (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Virology (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Saccharide Compounds (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202180092208.9A CN116916938A (zh) | 2020-12-31 | 2021-12-30 | 肌肉靶向复合物及其用于治疗面肩肱型肌营养不良的用途 |
| EP21916465.4A EP4271478A4 (en) | 2020-12-31 | 2021-12-30 | MUSCLE TARGETING COMPLEXES AND THEIR USES FOR TREATING FACIOSCAPULOHUMERAL MYOPATHY |
| JP2023540488A JP2024501872A (ja) | 2020-12-31 | 2021-12-30 | 顔面肩甲上腕筋ジストロフィーを処置するための筋標的化複合体およびそれらの使用 |
| IL304049A IL304049A (en) | 2020-12-31 | 2021-12-30 | Muscle targeting complexes and their uses for the treatment of FACIOSCAPULOHUMERAL muscular dystrophy |
| US18/270,284 US20240110184A1 (en) | 2020-12-31 | 2021-12-30 | Muscle targeting complexes and uses thereof for treating facioscapulohumeral muscular dystrophy |
| CA3202826A CA3202826A1 (en) | 2020-12-31 | 2021-12-30 | Muscle targeting complexes and uses thereof for treating facioscapulohumeral muscular dystrophy |
| KR1020237025561A KR20230128314A (ko) | 2020-12-31 | 2021-12-30 | 근육 표적화 복합체 및 안면견갑상완 근육 이영양증을치료하기 위한 그의 용도 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202063133156P | 2020-12-31 | 2020-12-31 | |
| US63/133,156 | 2020-12-31 | ||
| US202163181439P | 2021-04-29 | 2021-04-29 | |
| US63/181,439 | 2021-04-29 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022147207A1 true WO2022147207A1 (en) | 2022-07-07 |
Family
ID=82261078
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/065624 Ceased WO2022147207A1 (en) | 2020-12-31 | 2021-12-30 | Muscle targeting complexes and uses thereof for treating facioscapulohumeral muscular dystrophy |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US20240110184A1 (https=) |
| EP (1) | EP4271478A4 (https=) |
| JP (1) | JP2024501872A (https=) |
| KR (1) | KR20230128314A (https=) |
| CA (1) | CA3202826A1 (https=) |
| IL (1) | IL304049A (https=) |
| WO (1) | WO2022147207A1 (https=) |
Cited By (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11497815B2 (en) | 2018-08-02 | 2022-11-15 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating dystrophinopathies |
| US11518816B2 (en) | 2018-08-02 | 2022-12-06 | Dyne Therapeutics, Inc. | Methods of delivering an oligonucleotide to a subject having facioscapulohumeral muscular dystrophy |
| US11633498B2 (en) | 2021-07-09 | 2023-04-25 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating myotonic dystrophy |
| US11638761B2 (en) | 2021-07-09 | 2023-05-02 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating Facioscapulohumeral muscular dystrophy |
| US11648318B2 (en) | 2021-07-09 | 2023-05-16 | Dyne Therapeutics, Inc. | Anti-transferrin receptor (TFR) antibody and uses thereof |
| US11771776B2 (en) | 2021-07-09 | 2023-10-03 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating dystrophinopathies |
| US11911484B2 (en) | 2018-08-02 | 2024-02-27 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating myotonic dystrophy |
| US11931421B2 (en) | 2022-04-15 | 2024-03-19 | Dyne Therapeutics, Inc. | Muscle targeting complexes and formulations for treating myotonic dystrophy |
| US11969475B2 (en) | 2021-07-09 | 2024-04-30 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating facioscapulohumeral muscular dystrophy |
| US12018087B2 (en) | 2018-08-02 | 2024-06-25 | Dyne Therapeutics, Inc. | Muscle-targeting complexes comprising an anti-transferrin receptor antibody linked to an oligonucleotide and methods of delivering oligonucleotide to a subject |
| US12097263B2 (en) | 2018-08-02 | 2024-09-24 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating myotonic dystrophy |
| US12128109B2 (en) | 2021-07-09 | 2024-10-29 | Dyne Therapeutics, Inc. | Muscle targeting complexes and formulations for treating dystrophinopathies |
| US12329825B1 (en) | 2018-08-02 | 2025-06-17 | Dyne Therapeutics, Inc. | Muscle targeting complexes comprising an anti-transferrin receptor antibody linked to an oligonucleotide and method of use thereof to induce exon skipping of exon 44 of dystrophin in a subject |
| US12370264B1 (en) | 2018-08-02 | 2025-07-29 | Dyne Therapeutics, Inc. | Complexes comprising an anti-transferrin receptor antibody linked to an oligonucleotide and method of delivering oligonucleotide to a subject |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20200248179A1 (en) * | 2017-10-02 | 2020-08-06 | Research Institute At Nationwide Children's Hospital | MiRNA Detargeting System for Tissue Specific Interference |
| WO2020247738A1 (en) * | 2019-06-07 | 2020-12-10 | Dyne Therapeutics, Inc. | Methods of preparing protein-oligonucleotide complexes |
| US11286305B2 (en) * | 2018-08-02 | 2022-03-29 | Dyne Therapeutics, Inc. | Complex comprising anti-transferrin receptor antibody covalently linked to an oligonucleotide that targets DUX4 RNA |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DK3473270T5 (da) * | 2016-06-20 | 2024-09-09 | Genahead Bio Inc | Konjugat af antistof-lægemiddel |
-
2021
- 2021-12-30 EP EP21916465.4A patent/EP4271478A4/en active Pending
- 2021-12-30 WO PCT/US2021/065624 patent/WO2022147207A1/en not_active Ceased
- 2021-12-30 IL IL304049A patent/IL304049A/en unknown
- 2021-12-30 KR KR1020237025561A patent/KR20230128314A/ko active Pending
- 2021-12-30 CA CA3202826A patent/CA3202826A1/en active Pending
- 2021-12-30 US US18/270,284 patent/US20240110184A1/en active Pending
- 2021-12-30 JP JP2023540488A patent/JP2024501872A/ja active Pending
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20200248179A1 (en) * | 2017-10-02 | 2020-08-06 | Research Institute At Nationwide Children's Hospital | MiRNA Detargeting System for Tissue Specific Interference |
| US11286305B2 (en) * | 2018-08-02 | 2022-03-29 | Dyne Therapeutics, Inc. | Complex comprising anti-transferrin receptor antibody covalently linked to an oligonucleotide that targets DUX4 RNA |
| WO2020247738A1 (en) * | 2019-06-07 | 2020-12-10 | Dyne Therapeutics, Inc. | Methods of preparing protein-oligonucleotide complexes |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP4271478A4 * |
Cited By (48)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12329825B1 (en) | 2018-08-02 | 2025-06-17 | Dyne Therapeutics, Inc. | Muscle targeting complexes comprising an anti-transferrin receptor antibody linked to an oligonucleotide and method of use thereof to induce exon skipping of exon 44 of dystrophin in a subject |
| US11787869B2 (en) | 2018-08-02 | 2023-10-17 | Dyne Therapeutics, Inc. | Methods of using muscle targeting complexes to deliver an oligonucleotide to a subject having facioscapulohumeral muscular dystrophy or a disease associated with muscle weakness |
| US12496352B2 (en) | 2018-08-02 | 2025-12-16 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating myotonic dystrophy |
| US11633496B2 (en) | 2018-08-02 | 2023-04-25 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating dystrophinopathies |
| US12478687B2 (en) | 2018-08-02 | 2025-11-25 | Dyne Therapeutics, Inc. | United states |
| US12460011B2 (en) | 2018-08-02 | 2025-11-04 | Dyne Therapeutics, Inc. | Complexes comprising an anti-transferrin receptor antibody linked to an oligonucleotide and method of delivering an oligonucleotide to a subject |
| US12428487B2 (en) | 2018-08-02 | 2025-09-30 | Dyne Therapeutics, Inc. | Complexes comprising an anti-transferrin receptor antibody linked to an oligonicleotide and method of delivering oligonucleotide to a subject |
| US12370264B1 (en) | 2018-08-02 | 2025-07-29 | Dyne Therapeutics, Inc. | Complexes comprising an anti-transferrin receptor antibody linked to an oligonucleotide and method of delivering oligonucleotide to a subject |
| US12357703B2 (en) | 2018-08-02 | 2025-07-15 | Dyne Therapeutics, Inc. | Muscle-targeting complexes comprising an anti-transferin receptor antibody linked to an oligonucleotide and method of use thereof to induce exon skipping |
| US11497815B2 (en) | 2018-08-02 | 2022-11-15 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating dystrophinopathies |
| US12097263B2 (en) | 2018-08-02 | 2024-09-24 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating myotonic dystrophy |
| US11795233B2 (en) | 2018-08-02 | 2023-10-24 | Dyne Therapeutics, Inc. | Muscle-targeting complex comprising an anti-transferrin receptor antibody linked to an oligonucleotide |
| US11795234B2 (en) | 2018-08-02 | 2023-10-24 | Dyne Therapeutics, Inc. | Methods of producing muscle-targeting complexes comprising an anti-transferrin receptor antibody linked to an oligonucleotide |
| US11833217B2 (en) | 2018-08-02 | 2023-12-05 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating dystrophinopathies |
| US12325753B2 (en) | 2018-08-02 | 2025-06-10 | Dyne Therapeutics, Inc. | Method of using an anti-transferrin receptor antibody to deliver an oligonucleotide to a subject having facioscapulohumeral muscular dystrophy |
| US12319743B2 (en) | 2018-08-02 | 2025-06-03 | Dyne Therapeutics, Inc. | Complexes comprising an anti-transferrin receptor antibody linked to an oligonucleotide and method of delivering oligonucleotide to a subject |
| US11911484B2 (en) | 2018-08-02 | 2024-02-27 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating myotonic dystrophy |
| US12280122B2 (en) | 2018-08-02 | 2025-04-22 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating myotonic dystrophy |
| US12263225B2 (en) | 2018-08-02 | 2025-04-01 | Dyne Therapeutics, Inc. | Muscle-targeting complexes comprising an anti-transferrin receptor antibody linked to an oligonucleotide and methods of use thereof to target dystrophin and to treat Duchenne muscular dystrophy |
| US12173078B2 (en) | 2018-08-02 | 2024-12-24 | Dyne Therapeutics, Inc. | Complexes comprising an anti-transferrin receptor antibody linked to an oligonucleotide |
| US12005124B2 (en) | 2018-08-02 | 2024-06-11 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating dystrophinopathies |
| US12012460B2 (en) | 2018-08-02 | 2024-06-18 | Dyne Therapeutics, Inc. | Muscle-targeting complexes comprising an anti-transferrin receptor antibody linked to an oligonucleotide |
| US11518816B2 (en) | 2018-08-02 | 2022-12-06 | Dyne Therapeutics, Inc. | Methods of delivering an oligonucleotide to a subject having facioscapulohumeral muscular dystrophy |
| US12018087B2 (en) | 2018-08-02 | 2024-06-25 | Dyne Therapeutics, Inc. | Muscle-targeting complexes comprising an anti-transferrin receptor antibody linked to an oligonucleotide and methods of delivering oligonucleotide to a subject |
| US12173079B2 (en) | 2018-08-02 | 2024-12-24 | Dyne Therapeutics, Inc. | Muscle-targeting complexes comprising an anti-transferrin receptor antibody linked to an oligonucleotide |
| US12239717B2 (en) | 2021-07-09 | 2025-03-04 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating dystrophinopathies |
| US12403203B2 (en) | 2021-07-09 | 2025-09-02 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating dystrophinopathies |
| US12144868B2 (en) | 2021-07-09 | 2024-11-19 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating dystrophinopathies |
| US11771776B2 (en) | 2021-07-09 | 2023-10-03 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating dystrophinopathies |
| US11986537B2 (en) | 2021-07-09 | 2024-05-21 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating dystrophinopathies |
| US11839660B2 (en) | 2021-07-09 | 2023-12-12 | Dyne Therapeutics, Inc. | Anti-transferrin receptor antibody and uses thereof |
| US12239716B2 (en) | 2021-07-09 | 2025-03-04 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating dystrophinopathies |
| US12329824B1 (en) | 2021-07-09 | 2025-06-17 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating dystrophinopathies |
| US12397062B2 (en) | 2021-07-09 | 2025-08-26 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating dystrophinopathies |
| US12128109B2 (en) | 2021-07-09 | 2024-10-29 | Dyne Therapeutics, Inc. | Muscle targeting complexes and formulations for treating dystrophinopathies |
| US12144867B2 (en) | 2021-07-09 | 2024-11-19 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating dystrophinopathies |
| US11633498B2 (en) | 2021-07-09 | 2023-04-25 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating myotonic dystrophy |
| US11969475B2 (en) | 2021-07-09 | 2024-04-30 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating facioscapulohumeral muscular dystrophy |
| US11759525B1 (en) | 2021-07-09 | 2023-09-19 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating facioscapulohumeral muscular dystrophy |
| US11679161B2 (en) | 2021-07-09 | 2023-06-20 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating facioscapulohumeral muscular dystrophy |
| US12102687B2 (en) | 2021-07-09 | 2024-10-01 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating myotonic dystrophy |
| US11844843B2 (en) | 2021-07-09 | 2023-12-19 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating facioscapulohumeral muscular dystrophy |
| US11672872B2 (en) | 2021-07-09 | 2023-06-13 | Dyne Therapeutics, Inc. | Anti-transferrin receptor antibody and uses thereof |
| US12440575B2 (en) | 2021-07-09 | 2025-10-14 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating dystrophinopathies |
| US11638761B2 (en) | 2021-07-09 | 2023-05-02 | Dyne Therapeutics, Inc. | Muscle targeting complexes and uses thereof for treating Facioscapulohumeral muscular dystrophy |
| US11648318B2 (en) | 2021-07-09 | 2023-05-16 | Dyne Therapeutics, Inc. | Anti-transferrin receptor (TFR) antibody and uses thereof |
| US12440574B2 (en) | 2022-04-15 | 2025-10-14 | Dyne Therapeutics, Inc. | Muscle targeting complexes and formulations for treating myotonic dystrophy |
| US11931421B2 (en) | 2022-04-15 | 2024-03-19 | Dyne Therapeutics, Inc. | Muscle targeting complexes and formulations for treating myotonic dystrophy |
Also Published As
| Publication number | Publication date |
|---|---|
| US20240110184A1 (en) | 2024-04-04 |
| EP4271478A4 (en) | 2025-03-26 |
| CA3202826A1 (en) | 2022-07-07 |
| JP2024501872A (ja) | 2024-01-16 |
| EP4271478A1 (en) | 2023-11-08 |
| IL304049A (en) | 2023-08-01 |
| KR20230128314A (ko) | 2023-09-04 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12325753B2 (en) | Method of using an anti-transferrin receptor antibody to deliver an oligonucleotide to a subject having facioscapulohumeral muscular dystrophy | |
| US11638761B2 (en) | Muscle targeting complexes and uses thereof for treating Facioscapulohumeral muscular dystrophy | |
| US20240110184A1 (en) | Muscle targeting complexes and uses thereof for treating facioscapulohumeral muscular dystrophy | |
| US20240294921A1 (en) | Muscle targeting complexes and uses thereof for treating pompe disease | |
| US20230272065A1 (en) | Muscle targeting complexes and uses thereof for treating facioscapulohumeral muscular dystrophy | |
| US12460011B2 (en) | Complexes comprising an anti-transferrin receptor antibody linked to an oligonucleotide and method of delivering an oligonucleotide to a subject | |
| US11969475B2 (en) | Muscle targeting complexes and uses thereof for treating facioscapulohumeral muscular dystrophy | |
| KR20220125801A (ko) | 근육 표적화 복합체 및 안면견갑상완 근육 이영양증을 치료하기 위한 그의 용도 | |
| EP4551230A2 (en) | Muscle targeting complexes and uses thereof for treating facioscapulohumeral muscular dystrophy | |
| CA3234136A1 (en) | Muscle targeting complexes for treating facioscapulohumeral muscular dystrophy | |
| CA3222816A1 (en) | Muscle targeting complexes and uses thereof for treating friedreich's ataxia |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21916465 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3202826 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023540488 Country of ref document: JP |
|
| ENP | Entry into the national phase |
Ref document number: 20237025561 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202180092208.9 Country of ref document: CN |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021916465 Country of ref document: EP Effective date: 20230731 |